WO2017220569A1 - Binding molecules binding pd-l1 and lag-3 - Google Patents

Binding molecules binding pd-l1 and lag-3 Download PDF

Info

Publication number
WO2017220569A1
WO2017220569A1 PCT/EP2017/065073 EP2017065073W WO2017220569A1 WO 2017220569 A1 WO2017220569 A1 WO 2017220569A1 EP 2017065073 W EP2017065073 W EP 2017065073W WO 2017220569 A1 WO2017220569 A1 WO 2017220569A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody molecule
lag
mab
cells
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2017/065073
Other languages
English (en)
French (fr)
Inventor
Jamie Campbell
Nikole SANDY
Mihriban Tuna
Francisca WOLLERTON VAN HORCK
Katy Louise EVERETT
Miguel GASPAR
Matthew KRAMAN
Katarzyna KMIECIK
Mustapha FAROUDI
Natalie FOSH
Barbara HEBEIS
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
F Star Delta Ltd
Original Assignee
F Star Delta Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to US16/311,604 priority Critical patent/US11214620B2/en
Priority to SG11201811064TA priority patent/SG11201811064TA/en
Priority to BR112018076519A priority patent/BR112018076519A8/pt
Priority to EP17752291.9A priority patent/EP3472207B1/en
Priority to HRP20210602TT priority patent/HRP20210602T1/hr
Priority to EP20213956.4A priority patent/EP3858858A1/en
Priority to CN201780048977.2A priority patent/CN109563171B/zh
Priority to IL263730A priority patent/IL263730B2/en
Priority to PL17752291T priority patent/PL3472207T3/pl
Priority to MX2018016320A priority patent/MX2018016320A/es
Priority to LTEP17752291.9T priority patent/LT3472207T/lt
Priority to AU2017283181A priority patent/AU2017283181B2/en
Priority to SI201730684T priority patent/SI3472207T1/sl
Priority to RU2018143241A priority patent/RU2784388C9/ru
Priority to KR1020237006538A priority patent/KR102664891B1/ko
Priority to RS20210453A priority patent/RS61705B1/sr
Application filed by F Star Delta Ltd filed Critical F Star Delta Ltd
Priority to ES17752291T priority patent/ES2858091T3/es
Priority to JP2019518147A priority patent/JP7085709B2/ja
Priority to KR1020197001122A priority patent/KR20190019144A/ko
Priority to CA3027612A priority patent/CA3027612A1/en
Priority to DK17752291.9T priority patent/DK3472207T3/da
Priority to SM20210213T priority patent/SMT202100213T1/it
Publication of WO2017220569A1 publication Critical patent/WO2017220569A1/en
Anticipated expiration legal-status Critical
Priority to CY20211100319T priority patent/CY1124232T1/el
Priority to US17/533,230 priority patent/US20220185894A1/en
Priority to JP2022052202A priority patent/JP7464644B2/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/0005Vertebrate antigens
    • A61K39/0011Cancer antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39541Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4201Neoantigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/44Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/50Colon
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/524CH2 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/526CH3 domain
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/71Decreased effector function due to an Fc-modification
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/734Complement-dependent cytotoxicity [CDC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/74Inducing cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2318/00Antibody mimetics or scaffolds
    • C07K2318/20Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics

Definitions

  • the present invention relates to antibody molecules which bind to programmed death-ligand 1 (PD-L1) and lymphocyte-activation gene 3 (LAG-3).
  • the antibody molecules preferably comprise a CDR-based antigen binding site for PD-L1 , and a LAG-3 antigen binding site which may be located in two or more structural loops of a CH3 domain of the antibody molecule.
  • the antibody molecules of the invention find application, for example, in cancer therapy.
  • the LAG-3 gene is located on human chromosome 12, adjacent to the CD4 gene, and spans 8 exons.
  • the full-length transcript encodes a 525 amino acid protein with a molecular weight of 70 kDa and has functional activity, while the soluble form appears not to bind MHC class II molecules and its function is unknown.
  • Human full-length LAG-3 protein has 93% sequence identity to Macaca fascicularis (cynomolgus monkey) LAG-3 and 70% sequence identity to Mus musculus (house mouse) LAG-3.
  • LAG-3 is a transmembrane protein with four extracellular Ig-like domains (D1-D4), and a cytoplasmic portion responsible for LAG-3 signalling.
  • the cytoplasmic domain has an EP (glutamic acid/proline) motif that associates with LAG-3-associated protein (LAP) as well as a KIEELE motif thought to be required for LAG-3 modulation of T cell function. Reports on the role of the EP motif suggest that it may be responsible for trafficking of LAG-3 to the T cell surface membrane (Bae et al, 2014), or may be directly responsible for modulating downstream signalling of STAT5 during T cell activation (Durham et al, 2014), or possibly both.
  • EP glutamic acid/proline
  • LAG-3 on T cells The immuno-suppressive mechanism of LAG-3 on T cells is thought to be driven by cross- linking of LAG-3 on activated T cells resulting in decreased calcium flux and IL-2 release during T cell activation (Huard et al, 1997).
  • APCs Antigen Presenting Cells
  • binding to MHC II molecules by LAG-3 positive regulatory T cells causes decreased IL-12 secretion and down regulation of CD86 (Liang et al, 2008), a "secondary signal" of activation, resulting in T cell anergy from improper activation and/or reduced antigen presentation by the APCs.
  • LAG-3 knock out mouse models are viable, with only mild lympho-hyperproliferation
  • Tregs supress the immune response either by release of suppressive cytokines (such as IL-10 and ⁇ ), manipulation of inflammatory metabolism (such as CD73 catabolised adenosine), regulating APC maturation, or direct interaction between regulatory T cells and effector T cells.
  • suppressive cytokines such as IL-10 and ⁇
  • manipulation of inflammatory metabolism such as CD73 catabolised adenosine
  • regulating APC maturation or direct interaction between regulatory T cells and effector T cells.
  • MHC class II positive Tregs are more suppressive than MHC class II negative Tregs (Baecher-Allen et al, 2006) and actively suppress the immune response through direct interaction with LAG-3 expressed on effector T cells.
  • LAG-3 negative Tregs can suppress conventional T cell proliferation
  • LAG-3 negative CD4 and CD8 T cells are resistant to Treg immune suppression. This process was described to occur between human T cells through a process known as trogocytosis (Sega et al, 2014) whereby Tregs not only prevent APC maturation but also acquire MHC class II to suppress primed LAG-3 positive CD4 T cells.
  • LAG-3 expression is also a marker of repeated antigen stimulation.
  • T cells commonly adopt an "exhausted" phenotype, involving expression of immuno-suppressors such as PD-1 , CTLA-4, TIM-3, and LAG-3 (Wherry et al, 2011), where the cells have a general inability to properly proliferate and secrete chemokines in response to antigen. Inhibition of these immune-suppressors lowers the immune threshold and (re-)enables a proper anti-cancer response by the T cells. In preclinical models, this has been borne out using antagonist antibodies against LAG-3, CTLA-4 and PD-1 where a decrease in tumour burden was seen.
  • LAG-3 inhibition by antagonistic antibodies is thought to reactivate the immune response in the tumour microenvironment, where expression of LAG-3 on CD4 positive T cells and CD8 positive T cells is associated with an exhausted phenotype, and LAG-3 expression on Tregs is associated with potent immuno-suppressive capabilities.
  • Antibodies blocking LAG-3 increase T effector cell proliferation, cytokine production, cytotoxicity, and decrease Treg suppressor activity leading to a decrease in tumour growth.
  • tumour-infiltrating lymphocytes TILs
  • melanomas and lymphomas TILs
  • LAG- 3 is also closely correlated with T cell dysfunction in patients with chronic viral infection (Workman et al, 2005) and cancer (Workman et al, 2003).
  • LAG-3 has also been identified as a surface marker for tumour-infiltrating Tregs in a variety of human cancers (Camisachi et al. 2010; briefly et al, 2006).
  • Monoclonal antibodies to human LAG-3 are in clinical development to abrogate immune suppression and potentially enhance antigen presentation in cancers (solid and
  • LAG-525 and IMP-701 are human antibodies against LAG-3 and have advanced to Phase II and I clinical studies, respectively, in kidney cancer (Renal Cell Cancer); Non-Small Cell Lung Cancer (NSCLC); Nasopharyngeal Cancer; Colorectal Cancer; Melanoma; Gastric Cancer and Adenocarcinoma of the Gastroesophageal Junction.
  • Anti-LAG-3 antibody BMS-986016 (Bristol-Myers Squibb Company), is currently in Phase I clinical testing for Ovarian Cancer; NSCLC; Colorectal Cancer; Cervical Cancer; Melanoma; Gastric Cancer; Bladder Cancer; Head And Neck Cancer Squamous Cell Carcinoma; Renal Cell Carcinoma and in Phase II studies in NSCLC; Relapsed Chronic Lymphocytic Leukemia (CLL); Refractory Chronic Lymphocytic Leukemia (CLL); Melanoma; Non-Hodgkin
  • Lymphoma Hodgkin Lymphoma; Diffuse Large B-Cell Lymphoma; Indolent Lymphoma; Mantle Cell Lymphoma; Refractory Multiple Myeloma; and Relapsed Multiple Myeloma as either monotherapy or as part of combination therapies.
  • PD-1 Programmed cell death 1
  • PD-L1 CD274, B7-H1
  • PD-L2 B7-DC
  • PD-L1 is transiently expressed on all immune cells and some tumour cells.
  • PD-L1 is a type I transmembrane protein with two Ig-like domains within the extracellular region, a transmembrane domain and a short cytoplasmic domain.
  • the cytoplasmic domain has no known signal transduction motif suggesting that there is no signalling by PD-L1 on interaction of the ligand with its receptor. Its molecular weight is 40 kDa (290 amino acids) and it is encoded by the CD274 gene on mouse chromosome 19 and human chromosome 9, respectively.
  • PD-L1 is a member of the B7 protein family and shares approximately 20 % amino acid sequence identity with B7.1 and B7.2. Human PD-L1 shares 70 % and 93 % amino acid identity with the murine and cynomolgus orthologs of PD-L1 , respectively.
  • PD-L1 binds to its receptor PD-1 with an affinity (KD) of 770 nM.
  • KD affinity
  • PD-1 is expressed on activated T cells, B cells, and myeloid cells, and modulates activation or inhibition of cellular immune responses.
  • Binding of PD-L1 to PD-1 delivers an inhibitory signal, reducing cytokine production and proliferation of T cells. Consequently, PD-L1 expression by cells can mediate protection against cytotoxic T lymphocyte (CTL) killing and is a regulatory mechanism that dampens chronic immune responses during viral infections.
  • CTL cytotoxic T lymphocyte
  • Cancer as a chronic and proinflammatory disease subverts this immune-protective pathway through up-regulation of PD- L1 expression to evade the host immune response. In the context of an active immune response, IFNy also upregulates the expression of PD-L1.
  • PD-L1 also mediates immune suppression through interaction with another protein, B7.1 (also known as CD80), blocking its ability to deliver one of the secondary signals of activation on T cells through CD28.
  • B7.1 also known as CD80
  • PD-L1 expression has been shown in a wide variety of solid tumours. Of 654 samples examined in one study, spanning 19 tumours from different sites, 89 (14%) were PD-L1 positive ( ⁇ 5% frequency). The highest PD-L1 positive frequencies were seen in head and neck (17/54; 31 %), cervical (10/34; 29%), cancer of unknown primary origin (CUP; 8/29; 28%), glioblastoma multiforme (GBM; 5/20; 25%), bladder (8/37; 21 %), oesophageal (16/80; 20%), triple negative (TN) breast (6/33; 18%), and hepatocarcinoma (6/41 ; 15%) (Grosso et al, 2013).
  • Tumour-associated expression of PD-L1 has been shown to confer immune resistance and potentially protect tumour cells from T cell mediated apoptosis.
  • Therapies targeting PD-L1 have shown excellent results in murine in vivo studies.
  • treatment with anti-PD-L1 combined with either GVAX or FVAX vaccination strategies resulted in a significant effect both on survival (30 days for control vs 52 days for PD-L1 -treated) and percentage of tumour-free (5%) animals upon conclusion of the study (Curran et al, 2010).
  • Anti-PD-L1 therapy has also been used to study the mechanism of immune suppression in the P815 murine mastoma model.
  • P815 cells injected into mice normally trigger a strong immune response, which results in their rejection.
  • PD-L1 is expressed on P815 cells, these cells escape immune attack, which in turn can be negated through administration of anti-PD-L1 antibodies (Iwai et al, 2002).
  • anti-PD-L1 antibodies Iwai et al, 2002. It is evident that targeting the PD-1/PD-L1 axis in immunogenic human cancers (Herbst et at, 2014) results in a survival advantage through stimulation of an anti-cancer immune response (Wolchock et al, 2013; Larkin et al, 2015).
  • Atezolizumab (MPDL3280A, RG7466, TECENTRIQ) is a humanized lgG1 antibody which binds PD-L1. It is in clinical trials as a single agent and also in combination with other biologic and/or small molecule therapies for treatment of solid cancers, including colorectal cancer, breast cancer, non-small-cell lung carcinoma, bladder cancer, and renal cell carcinoma. Treatment with atezolizumab resulted in objective response rates (ORR) of 23% in NSCLC, 36% melanoma, 33% bladder, 14% in RCC, and 13% in head and neck cancers (Herbst et al, 2014; Powles et al, 2014).
  • ORR objective response rates
  • Avelumab (MSB0010718C) is a fully human lgG1 antibody which binds to PD-L1 and is undergoing clinical testing in a number of cancers including bladder cancer, gastric cancer, head and neck cancer, mesothelioma, non-small-cell lung carcinoma, ovarian cancer, renal cancer and Merkel-cell carcinoma.
  • Durvalumab is a human lgG1 antibody which binds to PD-L1 and is being tested in clinical trials alone or in combination with tremelimumab in non-small-cell lung cancer, squamous cell carcinoma of the head and neck, bladder cancer, pancreatic cancer and with other biologic and small molecules in trials for additional solid cancers such as gastric cancers, melanoma and unresectable hepatocellular carcinoma.
  • anti-PD-L1 antibodies have been tested in clinical trials, including BMS-936559 and others are in preclinical testing.
  • few anti-LAG-3 therapies are currently in clinical testing and none have been approved for therapy so there remains a need to develop additional molecules which target LAG-3.
  • current data shows that overall treatment with anti-PD-L1 monotherapy results in a response in less than 50% of cancer patients.
  • additional molecules which can target LAG-3 and/or PD-L1 and which find application in cancer therapy.
  • Anti-PD-1 and anti-PD-L1 antibodies are predominantly involved in breaking immune tolerance and activating an anti-tumour immune response.
  • l_AG-3 expressed on T cells following activation, and constitutively expressed on exhausted T cells, further maintains these cells in a suppressive state.
  • Blockade of LAG-3 when employed in combination with other established immune suppressive molecules (i.e.: PD-1 , PD-L1) has also been shown to provide a synergistic improved immune response in murine tumour models (Woo et al, 2012). The present inventors postulated that therapies targeting both of these pathways simultaneously will directly address mechanisms which promote and maintain T cell exhaustion.
  • targeting LAG-3 may suppress antigen presentation through the action of LAG-3 expressing regulatory T cells on APCs and the published research documenting down-regulation of CD86 (Grosso et al, 2013). Blocking this interaction is expected to maintain antigen presentation, while blocking PD-L1 signalling is expected to break tolerance, resulting in a significant anti-tumour response when both pathways are inhibited at the same time.
  • bispecific antibodies which bind to both LAG-3 and PD-L1 would confer a number of advantages over the combination of monoclonal antibodies against these antigens, including: 1. Directed Therapy
  • Activated T cells express LAG-3 in the lymph nodes.
  • One part of the anti-LAG-3/PD-L1 bispecific antibody targets primed LAG-3-positive T cells in the lymph node, which then traffic to the site of the tumour, transporting the bispecific antibody.
  • T cells carrying the bispecific antibody are able to immediately engage and block PD-L1 on tumour cells via the anti-PD-L1 portion. Consequently, all T cells traveling to the tumour site would be resistant to both LAG-3 and PD-L1/PD-1 signalling.
  • Primed CD8 positive T cells encounter tumour antigens within the tumour microenvironment, where they respond by killing the tumour cell in the absence of suppressive signals.
  • Bispecific antibodies are expected to be superior over combinations of individual monoclonal therapies by maintaining or prolonging this contact between T cells and tumour cells.
  • Signal strength in the activation of T cells is essential, which in the case of presented antigen in cancers may be key (Engels et al, 2013) and the presence of a bispecific anti-l_AG-3/PD-L1 antibody bound to targets on APC or cancer cells is expected to increase the time in which the T cells can successfully recognise antigen and become activated.
  • PD-L1 expression is significantly increased because of localised IFN- ⁇ release. This is true whether on target cancer cells, tumour-associated macrophages (TAM), or repeated stimulation of T cell populations.
  • TAM tumour-associated macrophages
  • a bispecific antibody that antagonises PD-L1 and LAG-3 is expected to localise and concentrate to the areas of greatest PD-L1 expression in the tumour whilst allowing the anti- LAG-3 portion to bind and prevent LAG-3-mediated suppression of T cells.
  • the present inventors were able to identify ten specific binding members comprising a binding site specific for LAG-3 in the CH3 domain of the molecule. These molecules were shown to have a high affinity for both human and cynomolgus LAG-3.
  • the high affinity for human LAG-3 is expected to be advantageous in the treatment of e.g. cancers containing tumour-infiltrating lymphocytes (TILs) expressing LAG-3 in human patients, while the high affinity for cynomolgus LAG-3, which is comparable to the affinity for human LAG-3, is expected to be useful in the evaluation of the properties of the specific binding members in cynomolgus monkey disease models.
  • TILs tumour-infiltrating lymphocytes
  • the specific binding members were also shown to have high activity in a T cell activation assay, which is expected to be predictive of improved efficacy in human patients through enhanced inhibition of LAG-3.
  • the present inventors further combined these specific binding members comprising a binding site specific for LAG-3 in the CH3 domain with an antibody Fab domain comprising a CDR-based antigen binding site for PD-L1 to create bispecific antibody molecules comprising binding sites for both LAG-3 and PD-L1 , which are expected to have the advantages detailed above.
  • Surrogate murine versions of these antibody molecules which bind to murine LAG-3 and murine PD-L1 were also prepared by the inventors and shown to be capable of significantly inhibiting tumour growth in syngeneic mouse models of cancer.
  • the present invention provides an antibody molecule which binds to both to PD-L1 and LAG-3.
  • these antibodies comprise:
  • LAG-3 antigen binding site located in, or engineered into, two or more structural loops of a CH3 domain of the antibody molecule.
  • the LAG-3 binding site preferably comprises the amino acid sequences WDEPWGED (SEQ ID NO: 1) and PYDRWVWPDE. (SEQ ID NO: 3).
  • the antibody molecule preferably comprises the amino acid sequence set forth in SEQ ID NO: 1 in the AB loop, and the amino acid sequence set forth in SEQ ID NO: 3 in the EF loop of the CH3 domain.
  • the present invention provides an antibody molecule which binds to programmed death-ligand 1 (PD-L1) and lymphocyte-activation gene 3 (LAG-3).
  • the antibody molecule preferably comprises (i) a CDR-based antigen binding site for PD-L1 ; and (ii) a LAG-3 antigen binding site located in a CH3 domain of the antibody molecule.
  • the LAG-3 binding site preferably comprises the amino acid sequences WDEPWGED (SEQ ID NO: 1) and PYDRWVWPDE (SEQ ID NO: 3).
  • the amino acid sequence WDEPWGED is preferably located in a first structural loop of the CH3 domain and the amino acid sequence PYDRWVWPDE is preferably located in a second structural loop of the CH3 domain.
  • the LAG-3 antigen-binding site may be located in a structural loop region of a CH3 domain of the antibody molecule, wherein the structural loop region preferably comprises two or more structural loops, and wherein the LAG-3 binding site preferably comprises the amino acid sequences WDEPWGED (SEQ ID NO: 1) and PYDRWVWPDE (SEQ ID NO: 3).
  • the LAG-3 antigen-binding site may be engineered into two or more structural loops of a CH3 domain of the antibody molecule, wherein the LAG-3 binding site preferably comprises the amino acid sequences WDEPWGED (SEQ ID NO: 1) and
  • the sequences of the LAG-3 binding site are preferably located in two or more structural loops of the CH3 domain of the antibody molecule.
  • the LAG-3 antigen-binding site comprises the amino acid sequence set forth in SEQ ID NO: 1 in the AB loop, and the amino acid sequence set forth in SEQ ID NO: 3 in the EF loop of the CH3 domain.
  • the amino acid sequence set forth in SEQ ID NO: 1 is preferably located at residues 1 1 to 18 of the CH3 domain; and/or the amino acid sequence set forth in SEQ ID NO: 3 is located at residues 92 to 101 of the CH3 domain; wherein the amino acid residue numbering is according to the ImMunoGeneTics IMGT) numbering scheme.
  • the LAG-3 antigen-binding site of the antibody molecule may further comprise one of the following sequences, preferably in the CD loop of the CH3 domain of the antibody molecule:
  • the LAG-3 antigen-binding site of the antibody molecule further comprise one of the following sequences, preferably in the CD loop of the CH3 domain of the antibody molecule: the amino acid sequence set forth in SEQ ID NO: 2, 28, or 38 in the CD loop of the CH3 domain. More preferably, the LAG-3 antigen-binding site of the antibody molecule further comprises the amino acid sequence set forth in SEQ ID NO: 2 in the CD loop of the CH3 domain
  • amino acid sequence set forth in SEQ ID NO: 2, 8, 13, 18, 23, 28, 33, 38, 43, or 48 is preferably located at residues 43 to 78 of the CH3 domain of the antibody molecule, wherein the residues are numbered according to the IMGT numbering scheme.
  • CH3 domain is a human immunoglobulin G domain, such as a human lgG1 , lgG2, lgG3, or lgG4 CH3 domain, most preferably a human lgG1 CH3 domain.
  • the sequences of human lgG1 , lgG2, lgG3, or lgG4 CH3 domains are known in the art.
  • the antibody molecule comprises the CH3 domain set forth in SEQ ID NO: 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50, more preferably the CH3 domain set forth in SEQ ID NO: 5, 30, or 40, most preferably the CH3 domain set forth in SEQ ID NO: 5.
  • the antibody molecule may comprise a CH3 domain with an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO: 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50, preferably SEQ ID NO: 5, 30, or 40, more preferably SEQ ID NO: 5.
  • the antibody molecule may further comprise a CH2 domain.
  • the CH2 domain is preferably located at the N-terminus of the CH3 domain, as in the case in a human IgG molecule.
  • the CH2 domain of the antibody molecule is preferably the CH2 domain of human lgG1 , lgG2, lgG3, or lgG4, more preferably the CH2 domain of human IgGl
  • sequences of human IgG domains are known in the art.
  • the antibody molecule comprises an IgG CH2 domain with the sequence set forth in SEQ ID NO: 53 or SEQ ID NO: 54, or a CH2 domain with an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO: 53 or SEQ ID NO: 54.
  • the antibody molecule comprises the sequence set forth in SEQ ID NO: 6, 7, 1 1 , 12, 16, 17, 21 , 22, 26, 27, 31 , 32, 36, 37, 41 , 42, 46, 47, 51 , or 52, or a sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 6, 7, 11 , 12, 16, 17, 21 , 22, 26, 27, 31 , 32, 36, 37, 41 , 42, 46, 47, 51 , or 52.
  • the antibody molecule comprises the sequence set forth in SEQ ID NO: 6, 7, 31 , 32, 41 , or 42, or a sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 6, 7, 31 , 32, 41 , or 42.
  • the antibody molecule comprises the sequence set forth in SEQ ID NO: 6 or 7, or a sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to the sequence set forth in SEQ ID NO: 6 or 7.
  • the antibody molecule is a human immunoglobulin G molecule, such as a human lgG1 , lgG2, lgG3 or lgG4 molecule, more preferably a human lgG1 molecule.
  • human immunoglobulin G molecules such as a human lgG1 , lgG2, lgG3 or lgG4 molecule, more preferably a human lgG1 molecule.
  • the sequences of human immunoglobulin G molecules is known in the art and introducing a CH3 domain or CH3 domain sequence as disclosed here into such a molecule would not present any difficulty to the skilled person.
  • the antibody molecule preferably comprise the CDRs of the VH and/or VL domains set forth in SEQ ID NOs 92 and 93.
  • Methods for determining CDR sequence in a given VH or VL domain are known in the art and include the Kabat and IMGT numbering systems.
  • the antibody molecule preferably comprise one or more, two or more, three or more, four or more, five or more, or all six of the complementarity determining regions set forth in SEQ ID NOs 86 to 91.
  • the antibody molecule comprises the VH and/or VL domains set forth in SEQ ID NOs 92 and 93, respectively.
  • the antibody molecule comprises the heavy chain sequence set forth in any one of SEQ ID NOs: 94 to 113, or a heavy chain with an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any one of SEQ ID NOs: 94 to 1 13, provided the VH domain of the heavy chain sequence remains unchanged.
  • the antibody molecule comprises the heavy chain sequence set forth in any one of SEQ ID NOs: 94, 95, 104, 105, 108, and 109, or a heavy chain with an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to any one of SEQ ID NOs: 94, 95, 104, 105, 108, and 109, provided the VH domain of the heavy chain sequence remains unchanged.
  • the antibody molecule comprises the heavy chain sequence set forth in SEQ ID NO: 94 or 95, or a heavy chain with an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NOs: 94 or 95, provided the VH domain of the heavy chain sequence remains unchanged.
  • the antibody molecule may in addition, or alternatively, comprise the light chain sequence set forth in SEQ ID NO: 116, or a light chain with an amino acid sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity to SEQ ID NO: 116, provided the VL domain of the light chain sequence remains unchanged.
  • the antibody molecule is preferably capable of simultaneously binding to PD-L1 and LAG-3.
  • the PD-L1 and LAG-3 may, for example, be present on two different cells. Without wishing to be limited by theory, it is thought that this results in cross-linking between cells and internalization of PD-L1 and/or LAG-3 making them unavailable for stimulation.
  • an antibody molecule comprising (i) a CDR-based antigen binding site for PD-L1 ; and (ii) a LAG-3 antigen binding site located in a CH3 domain of the antibody molecule, in accordance with the present invention, FS18-7-9/84G09, surprisingly mediated Complement Dependent Cytotoxicity (CDC) of PD-L1 expressing cells but not of LAG-3 expressing cells, even when a mixture of LAG-3 and PD-L1 expressing cells were present in the sample.
  • CDC Complement Dependent Cytotoxicity
  • the present invention relates to an antibody molecule which binds to tumour antigen and an immune cell antigen, wherein the antibody molecule comprises:
  • an antigen binding site for an immune cell antigen located in a constant domain, preferably a CH3 or CH2 domain, more preferably a CH3 domain, of the antibody molecule, wherein the antibody molecule does not mediate, or does not mediate significant, complement dependent cytotoxicity of an immune cell comprising said immune cell antigen when said immune cell is bound by the antibody molecule.
  • the antibody molecule further mediates complement dependent cytotoxicity of a tumour cell comprising said tumour antigen when said tumour cell is bound by the antibody molecule.
  • an antibody molecule comprising (i) a CDR- based antigen binding site for PD-L1 ; and (ii) a LAG-3 antigen binding site located in a CH3 domain of the antibody molecule, in accordance with the present invention, FS18-7- 9/84G09, surprisingly mediated low Antibody Dependent Cellular Cytotoxicity (ADCC) of LAG-3 expressing cells compared with ADCC of PD-L1 expressing cells.
  • ADCC Antibody Dependent Cellular Cytotoxicity
  • the present invention relates to an antibody molecule which binds to tumour antigen and an immune cell antigen, wherein the antibody molecule comprises:
  • the antibody molecule does not mediate, or not mediate significant, ADCC of an immune cell comprising said immune cell antigen when said immune cell is bound by the antibody molecule.
  • the antibody molecule may further not mediate, or not mediate significant, complement dependent cytotoxicity of an immune cell comprising said immune cell antigen when said immune cell is bound by the antibody molecule and/or may mediate complement dependent cytotoxicity of a tumour cell comprising said tumour antigen when said tumour cell is bound by the antibody molecule.
  • tumour antigens and immune cell antigens are known in the art.
  • the tumour antigen and immune cell antigen are preferably cell-surface antigens.
  • the immune cell antigen is preferably an antigen present on tumour-infiltrating lymphocytes.
  • the antigen binding site for the immune cell antigen preferably comprises one or more modifications in one or more structural loops of the constant domain of the antibody molecule, such as the AB, CD, and/or EF loop of the constant domain.
  • the binding site may be a l_AG-3 binding site as herein described.
  • the antibody molecule of the invention may be conjugated to an immune system modulator, cytotoxic molecule, radioisotope, or detectable label.
  • the immune system modulator may be cytotoxic molecule is a cytokine.
  • the present invention also provides a nucleic acid encoding an antibody molecule of the invention, as well as a vector comprising such a nucleic acid.
  • a recombinant host cell comprising a nucleic acid or the vector of the invention is also provided. Such a recombinant host cell may be used to poduce an antibody molecule.
  • a method of producing an antibody molecule of the invention comprising culturing the recombinant host cell under conditions for production of the antibody molecule.
  • the method may further comprise a step of isolating and/or purifying the antibody molecule.
  • the antibody molecules of the present invention are expected to find application in therapeutic applications, in particular therapeutic applications in humans, such as cancer treatment.
  • a pharmaceutical composition comprising an antibody molecule according to the invention and a pharmaceutically acceptable excipient.
  • the present invention also provides an antibody molecule of the invention, for use in a method of treating cancer in a patient. Also provided is a method of treating cancer in a patient, wherein the method comprises administering to the patient a therapeutically effective amount of an antibody molecule according to the invention. Further provided is the use of an antibody molecule according to the invention for use in the manufacture of a medicament for the treatment of cancer in a patient. The treatment may further comprise administering an anti-tumour vaccine and/or a chemotherapeutic agent to the patient.
  • Figure 1 A shows a sequence alignment of the nine Fcabs identified following the second affinity maturation, FS18-7-32; FS18-7-33; FS18-7-36; FS18-7-58; FS18-7-62; FS18-7-65; FS18-7-78; FS18-7-88; and FS18-7-95, against the parental Fcab, FS18-7-9.
  • B shows the percentage sequence identity of each of these Fcabs with the sequence of the parental Fcab, FS18-7-9.
  • Figure 2 shows the results of a T cell activation assay. Specifically, Figure 2 shows representative plots of IL-2 release, which is indicative of T cell activation, in the panel of cell lines treated with mAb 2 FS18-7-9/84G09 ( Figure 2A-C), or FS18-7-62/84G09 or FS18-7- 78/84G09 ( Figure 2D-F), and control antibodies.
  • Figure 2A The assay with LAG-3 and PD-L1 required inhibition of both targets (FS18-7-9/84G09LALA, FS18-7- 9/4420LALA+84G09, 25F7+84G09LALA or 25F7+S1 LALA) to have activation.
  • Figure 2B The assay with l_AG-3 only required inhibition of l_AG-3 for activation (FS18-7- 9/84G09LALA, FS18-7-9/4420LALA+84G09, 25F7+84G09LALA, 25F7+S1 LALA, 25F7, FS18-7-9/4420 LALA).
  • Figure 2C The assay with PD-L1 only required the inhibition of PD- L1 for activation (FS18-7-9/84G09LALA, FS18-7-9/4420LALA+84G09, 25F7+84G09LALA, 25F7+S1 LALA, 84G09LALA).
  • Figure 2D The assay with LAG-3 and PD-L1 required inhibition of both targets (FS18-7-62/84G09LALA, FS18-7-78/84G09LALA, FS18-7- 62/4420LALA+84G09, FS18-7-78/4420LALA+84G09, 25F7+84G09LALA or 25F7+S1 LALA) to have activation.
  • targets FS18-7-62/84G09LALA, FS18-7-78/84G09LALA, FS18-7- 62/4420LALA+84G09, FS18-7-78/4420LALA+84G09, 25F7+84G09LALA or 25F7+S1 LALA
  • Figure E The assay with only LAG-3 required inhibition of LAG-3 for activation (FS18-7-62/84G09LALA, FS18-7-62/4420LALA, FS18-7-78/84G09LALA, FS18-7- 78/4420LALA, FS18-7-62/4420LALA+84G09, FS18-7-78/4420LALA+84G09,
  • Figure 2F The assay with only PD-L1 required the inhibition of PD-L1 for activation (FS18-7-62/84G09LALA, FS18-7-78/84G09LALA, FS18-7- 62/4420LALA+84G09, FS18-7-78/4420LALA+84G09, 25F7+84G09LALA or 25F7+S1 LALA).
  • Figure 3 shows that FS18-7-9/84G09 was able to induce T cell activation, as indicated by IL-2 release, in the presence of both cLAG-3 + cPD-L1 and cLAG-3 or cPD-L1 alone showing functionally cynomolgus cross-reactivity.
  • Figure 4 shows a representative plot from the SEB assay.
  • LAG-3/PD-L1 mAb 2 and the combination of the LAG-3/4420 mAb 2 + 84G09LALA showed greater activation that the 84G09LALA mAb alone, whereas the LAG-3/4420 mAb 2 or 4420 mAb did not show significant activation.
  • Figure 5 shows the end tumour weights on day 20 in the non-established MC38 syngeneic tumour model.
  • LAG-3/PD-L1 mAb 2 (FS18-29/S1) treated mice had end tumours with significantly smaller weights than those treated with a combination of benchmark mAbs, C9B7W and S1.
  • Figure 6 shows growth curves of the non-established MC38 syngeneic tumour model.
  • LAG- 3/PD-L1 mAb 2 (FS18-29/S1) treated mice had smaller tumours than those treated with a combination of benchmark mAbs, C9B7W and S1 , or those treated with S1 alone.
  • the LAG- 3/4420 mAb 2 and benchmark anti-LAG-3 mAb had little impact on tumour growth.
  • FIG. 7 shows the end tumour weights on day 24 in the established MC38 syngeneic tumour model.
  • LAG-3/PD-L1 mAb 2 (FS18-29/S1) was just as effective in suppressing tumour growth as the combination of benchmark antibodies, C9B7W and S1.
  • FS18-29/4420 alone had no noticeable impact on tumour growth and S1 and C9B7W both had a mild effect on resulting tumour growth.
  • Figure 8 shows tumour growth curves of the established MC38 syngeneic tumour model.
  • LAG-3/PD-L1 mAb 2 (FS18-29/S1) treated mice had tumours volumes similar to those treated with a combination of benchmark mAbs, C9B7W and S1. Mice treated with S1 or C9B7W alone showed intermediate tumour volumes whereas l_AG-3/4420 mAb 2 treatment had no impact on tumour growth.
  • Figure 9 shows the end tumour weights on day 20 in the non-established CT26 syngeneic tumour model.
  • LAG-3/PD-L1 mAb 2 (FS18-29/S1 and FS18-35/S1) supressed tumour growth to a greater extent than combination of benchmark antibodies, C9B7W and S1.
  • Figure 10 shows tumour growth curves of the non-established CT26 syngeneic tumour model. There was a demonstrated statistically significant difference in FS18-35/S1 versus IgG control in suppressing tumour growth. Such a statistically significant difference was not observed with the combination of benchmark antibodies, versus the IgG control group.
  • Figure 11 shows the end tumour weights on day 22 in the non-established MC38 syngeneic tumour model used to compare the effect of the LALA mutation in the mAb 2 on tumour growth inhibition. There was no statistically significant difference in end tumour weight between mice treated with mAb 2 with and without the LALA mutation.
  • Figure 12 shows tumour growth curves of the non-established MC38 syngeneic tumour model used to compare the effect of mAb 2 with and without the LALA mutation on tumour growth inhibition. There was no statistically significant difference in the tumour growth curves between mice treated with mAb 2 with and without the LALA mutation, however there was a trend toward increased tumour growth inhibition by molecules containing the LALA mutation.
  • FIG. 13 shows the effect of mAb 2 treatment on T cell LAG-3 expression.
  • LAG-3 expression on CD8 (A), CD4 (B) and FoxP3 (C) tumour infiltrating lymphocytes (TILs) treated with mAb 2 FS18-29/S1 , FS18-29/4420, S1 , FS18-29/4420 and S1 , or control antibody 4420 is shown at day 19 and 23 after tumour inoculation, corresponding to days 3 and 7 after the last mAb 2 /antibody dosing, respectively.
  • LAG-3 expression was decreased after treatment with mAb 2 FS18-29/S1 at day 19 and 23.
  • Figure 14 shows the percentage of lysis of PD-L1 and LAG-3 expressing Raji cells following various antibody/mAb 2 treatments using a lactate dehydrogenase (LDH) release CDC assay.
  • LDH lactate dehydrogenase
  • Figure 15 shows the percentage of dead PD-L1 and LAG-3 expressing Raji cells following various treatments using a flow cytometry based CDC assay.
  • a mixture of differentially fluorescently labelled PD-L1 and LAG-3 expressing cells were incubated with control antibody 4420, anti-CD20 antibody Rituximab (RIT), a combination of anti-LAG-3 antibody 25F7 and anti-PD-L1 antibody 84G09, or mAb 2 FS18-7-9/84G09. Cells were then treated with baby rabbit complement and stained using a dye only staining dead cells. The percentage of dead cells in the two cell populations was evaluated as a percentage of total cells.
  • the cell type (PD-L1 expressing or LAG-3 expressing, identified by the differential fluorescent labels) evaluated following each treatment is indicated in Figure 15 after the name of the relevant treatment, see e.g. 4420 PDL1 , which refers to evaluation of viability of PD-L1 expressing Raji cells following treatment with control antibody 4420.
  • the relevant treatment see e.g. 4420 PDL1 , which refers to evaluation of viability of PD-L1 expressing Raji cells following treatment with control antibody 4420.
  • concentration of the antibody/mAb 2 treatment is indicated on the X-axis
  • Figure 16 shows the percentage lysis (cytotoxicity) of PD-L1 and LAG-3 expressing Raji cells following various treatments using a lactate dehydrogenase (LDH) release ADCC assay.
  • Cells were treated with anti-CD20 antibody Rituximab, anti-PD-L1 antibody 84G09, mAb 2 FS18-7-9/84G09, Rituximab comprising the LALA mutation, mAb 2 FS18-7-9/84G09 comprising the LALA mutation, anti-LAG-3 antibody 25F7, anti-PD-L1 antibody 84G09 comprising the LALA mutation, control antibody 4420, or control antibody 4420 comprising the LALA mutation.
  • Treated cells were then co-incubated with primary NK cells and specific LDH release was measured as a percentage compared to total lysis of target cells.
  • the concentration of the antibody/mAb 2 treatment is indicated on the X-axis.
  • the present invention relates to antibody molecules which bind both to PD-L1 and LAG-3.
  • the antibody molecules of the present invention comprise a CDR-based antigen binding site for PD-L1 and a LAG-3 antigen binding site located in a constant domain of the antibody molecule.
  • the terms "PD-L1” and “LAG-3” may refer to human PD-L1 and human LAG-3, murine PD-L1 and murine LAG-3, and/or cynomologus monkey PD-L1 and cynomologus monkey LAG-3, unless the context requires otherwise.
  • the terms "PD-L1” and “LAG-3” refer to human PD-L1 and human LAG-3, unless the context requires otherwise.
  • antibody molecule describes an immunoglobulin whether natural or partly or wholly synthetically produced.
  • the antibody molecule may be human or humanised.
  • the antibody molecule is preferably a monoclonal antibody molecule.
  • antibodies are the immunoglobulin isotypes, such as immunoglobulin G, and their isotypic subclasses, such as lgG1 , lgG2, lgG3 and lgG4, as well as fragments thereof.
  • antibody molecule thus includes antibody fragments, provided said fragments comprise a CDR-based antigen binding site for PD-L1 and a LAG-3 antigen binding site located in a constant domain, such as a CH1 , CH2, or CH3 domain, preferably a CH3 domain, of the antibody molecule.
  • a constant domain such as a CH1 , CH2, or CH3 domain, preferably a CH3 domain, of the antibody molecule.
  • immunoglobulin into another immunoglobulin is described for example in EP-A-184187, GB 2188638A or EP-A-239400. Similar techniques could be employed for the relevant constant domain sequences.
  • a hybridoma or other cell producing an antibody molecule may be subject to genetic mutation or other changes, which may or may not alter the binding specificity of antibodies produced.
  • antibody molecule should be construed as covering antibody fragments, derivatives, functional equivalents and homologues of antibodies, including any polypeptide comprising an immunoglobulin binding domain, whether natural or wholly or partially synthetic. Chimeric molecules comprising an immunoglobulin binding domain, or equivalent, fused to another polypeptide are therefore included. Cloning and expression of chimeric antibodies are described in EP-A- 0120694 and EP-A-0125023.
  • An example of an antibody fragment comprising both CDR sequences and CH3 domain is a minibody, which comprises an scFv joined to a CH3 domain (Hu et al. (1996), Cancer Res., 56(13):3055-61).
  • the antibody molecule of the present invention binds to PD-L1 and l_AG-3. Binding in this context may refer to specific binding.
  • the term “specific” may refer to the situation in which the antibody molecule will not show any significant binding to molecules other than its specific binding partner(s), here PD-L1 and LAG-3.
  • the term “specific” is also applicable where the antibody molecule is specific for particular epitopes, such as epitopes on PD-L1 and LAG-3, that are carried by a number of antigens in which case the antibody molecule will be able to bind to the various antigens carrying the epitope.
  • LAG-3 shares 40% sequence identity with CD4, its most closely related protein.
  • the present inventors tested the FS18-7-9 Fcab, which comprises the amino acid sequences set forth in SEQ ID NOs 1 to 3, for binding to CD4.
  • the FS18-7-9 Fcab showed no binding to CD4, demonstrating that this molecule binds LAG-3 specifically.
  • the LAG-3 binding site of an antibody molecule of the present invention does not bind, or does not show any significant binding, to CD4.
  • An antibody molecule of the invention preferably comprises a LAG-3 antigen binding site.
  • the LAG-3 antigen binding site is located in a constant domain of the antibody molecule, such as a CH1 , CH2, CH3 or CH4 domain.
  • the LAG-3 antigen binding site is located in the CH3 domain of the antibody molecule.
  • the LAG-3 binding site preferably comprises the amino acid sequences WDEPWGED (SEQ ID NO: 1) and PYDRWVWPDE. (SEQ ID NO: 3). These sequences were present in all of the lead anti-LAG-3 Fcab clones identified by the present inventors following an extensive screening and characterisation program as described in the examples.
  • amino acid sequences set forth in SEQ ID NOs 1 and 2 are preferably located in structural loops of the constant domain of the antibody molecule.
  • the introduction of sequences into the structural loop regions of antibody constant domains to create new antigen-binding sites is described, for example, in WO2006/072620 and WO2009/132876.
  • the structural loops of antibody constant domains include the AB, CD and EF loops.
  • the AB, CD, and EF loops are located at residues 1 1-18, 43-78 and 92-101 of the CH3 domain, where the amino acid residue numbering is according to the
  • the amino acid sequence set forth in SEQ ID NO: 1 is preferably located in the AB loop of the constant domain.
  • the amino acid sequence set forth in SEQ ID NO: 3 is preferably located in the EF loop of the constant domain. More preferably, the amino acid sequence set forth in SEQ ID NO: 1 is located at residues 11 to 18 of the CH3 domain; and/or the amino acid sequence set forth in SEQ ID NO: 3 is located at residues 92 to 101 of the CH3 domain, wherein the amino acid residue numbering is according to the IMGT numbering scheme.
  • the antibody molecule preferably comprises the amino acid sequence set forth in SEQ ID NO: 2, 8, 13, 18, 23, 28, 33, 38, 43, or 48, more preferably SEQ ID NO: 2, 28, or 38, yet more preferably SEQ ID NO: 2, in a structural loop of a constant domain of the antibody molecule.
  • the structural loop is preferably the CD loop and the constant domain is preferably the CH3 domain.
  • the amino acid sequence set forth in SEQ ID NO: 2, 8, 13, 18, 23, 28, 33, 38, 43, or 48 is preferably located at residues 43 to 78 of the CH3 domain, wherein the amino acid residue numbering is according to the IMGT numbering scheme.
  • An antibody molecule of the invention may further comprise a glutamic acid residue (E) at position 36 and/or a tyrosine residue (Y) at position 85.2 of the CH3 domain (as shown in Figure 1A), wherein the amino acid residue numbering is according to the IMGT numbering scheme.
  • an antibody molecule which comprises the CD structural loop region set forth in SEQ ID NO: 8 preferably further comprises a glutamic acid residue (E) at position 36 of the CH3 domain.
  • an antibody molecule which comprises the CD structural loop region set forth in SEQ ID NO: 18 preferably further comprises a tyrosine residue (Y) at position 85.2 of the CH3 domain.
  • the antibody molecule of the invention comprises a CH3 domain which comprises, has, or consists of the sequence set forth in SEQ ID NO: 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50, preferably a CH3 domain with the sequence set forth in SEQ ID NO: 5, 30, or 40, more preferably, a CH3 domain with the sequence set forth in SEQ ID NO: 5.
  • the antibody molecule of the invention may comprise a CH3 domain which comprises, has, or consists of the sequence set forth in SEQ ID NO: 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50, wherein the CH3 domain sequence further comprises a lysine residue (K) at the immediate C-terminus of the sequence shown in SEQ ID NO: 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50.
  • the antibody molecule of the invention may comprise a CH3 domain which comprises, has, or consists of the sequence set forth in SEQ ID NO: 5 with a lysine residue at the C-terminus of the sequence shown in SEQ ID NO: 5.
  • the sequence of such a CH3 domain would then be as follows:
  • the antibody molecule of the invention may comprise a CH2 domain of an immunoglobulin G molecule, such as a CH2 domain of an lgG1 , lgG2, lgG3, or lgG4 molecule.
  • the antibody molecule of the invention comprises a CH2 domain of an lgG1 molecule.
  • the CH2 domain may have the sequence set forth in SEQ ID NO: 53.
  • the CH2 domain of the antibody molecule may comprise a mutation to reduce or abrogate binding of the CH2 domain to one or more Fc ⁇ receptors, such as FcvRI, FcvRlla, FcvRllb, FcvRIII and/or to complement.
  • FcvRI, FcvRlla, FcvRllb, FcvRIII and/or to complement CH2 domains of human IgG domains normally bind to Fe y receptors and complement and the inventors postulate that reduced binding to Fe y receptors will reduce the antibody-dependent cell-mediated cytotoxicity (ADCC) and reduced binding to complement will reduce the complement-dependent cytotoxicity (CDC) activity of the antibody molecule.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • CDC complement-dependent cytotoxicity
  • the antibody molecule may comprise a CH2 domain, wherein the CH2 domain comprises alanine residues at positions 4 and 5 of the CH2 domain, wherein the numbering is according to the IMGT numbering scheme.
  • the antibody molecule comprises an lgG1 CH2 domain which comprises, has, or consists of the sequence set forth in SEQ ID NO: 54.
  • the antibody molecule of the present invention comprises a CDR-based antigen binding site for PD-L1.
  • CDR-based antigen binding site refers to the antigen-binding site of an antibody molecule variable region which is composed of six CDRs .
  • the preparation of antibody molecules against PD-L1 , and determination of the CDR sequences of such antibody molecules, is well within the capabilities of the skilled person and many suitable techniques are known in the art.
  • the antibody molecule of the invention comprises the HCDR3 of antibody 84G09.
  • the HCDR3 is known to play a role in determining the specificity of an antibody molecule (Segal et al., (1974), PNAS, 71 :4298-4302; Amit et al., (1986), Science, 233:747-753;
  • the antibody molecule may further comprise the HCDR1 , HCDR2, LCDR1 , LCDR2 and/or LCDR3 of antibody 84G09.
  • the skilled person would have no difficulty in determining the sequences of the CDRs from the VH and VL domain sequences of antibody 84G09 shown in SEQ ID NOs 92 and 93, respectively.
  • the CDR sequences may, for example, be determined according to Kabat (Kabat, E.A. et al., (1991)) or the IMGT numbering scheme.
  • the sequences of the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 of antibody 84G09, according to the IMGT numbering scheme, are set out in SEQ ID NOs 86, 87, 88, 89, 90, and 91 , respectively.
  • the sequences of the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 of antibody 84G09, according to Kabat, are set out in SEQ ID NOs 136, 137, 138, 139, 140, and 141 , respectively.
  • the antibody may also comprise the VH and/or VL domain of antibody 84G09.
  • the antibody molecule of the invention comprises (i) a CDR- based antigen binding site for PD-L1 comprising the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 sequences of antibody 84G09, and (ii) a LAG-3 antigen binding site located in a CH3 domain of the antibody molecule, wherein the LAG-3 binding site comprises the amino acid sequences set forth in SEQ ID NOs 1 and 3, and an amino acid sequence selected from the group consisting of: SEQ ID NOs 2, 8, 13, 18, 23, 28, 33, 38, 43, and 48.
  • the antibody molecule of the invention comprises (i) a CDR-based antigen binding site for PD-L1 comprising the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 sequences of antibody 84G09, and (ii) a LAG-3 antigen binding site located in a CH3 domain of the antibody molecule, wherein the LAG-3 binding site comprises the amino acid sequences set forth in SEQ ID NOs 1 and 3, and an amino acid sequence selected from the group consisting of: SEQ ID NOs 2, 28, and 38.
  • the antibody molecule of the invention comprises (i) a CDR-based antigen binding site for PD-L1 comprising the HCDR1 , HCDR2, HCDR3, LCDR1 , LCDR2 and LCDR3 sequences of antibody 84G09, and (ii) a LAG-3 antigen binding site located in a CH3 domain of the antibody molecule, wherein the LAG-3 binding site comprises the amino acid sequences set forth in SEQ ID NOs 1 , 2 and 3.
  • the antibody molecule of the invention comprises a VH domain and a VL domain which comprises, has, or consists of the sequence set forth in SEQ ID NOs 92 and 93, respectively, and a CH3 domain which comprises, has, or consists of the sequence set forth in SEQ ID NO: 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50, preferably a CH3 which comprises, has, or consists of the sequence set forth in SEQ ID NO: 5, 30, or 40, more preferably, a CH3 domain which comprises, has, or consists of the sequence set forth in SEQ ID NO: 5.
  • the antibody molecule comprises a heavy chain which comprises, has, or consists of the sequence set forth in SEQ ID NOs: 94 to 113 and a light chain which comprises, has, or consists of the sequence set forth in SEQ ID NO: 1 16. More preferably, the antibody molecule comprises a heavy chain which comprises, has, or consists of the sequence set forth in SEQ ID NOs: 94, 95, 104, 105, 108, and 109 and a light chain which comprises, has, or consists of the sequence set forth in SEQ ID NO: 1 16. Most preferably, the antibody molecule comprises a heavy chain which comprises, has, or consists of the sequence set forth in SEQ ID NO: 94 or 95 and a light chain which comprises, has, or consists of the sequence set forth in SEQ ID NO: 1 16.
  • the antibody molecules of the present invention may also comprise variants of the structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, light chain or heavy chain sequences disclosed herein, provided the VL and VH domains of the light and heavy chain sequences, respectively, remain unchanged. Suitable variants can be obtained by means of methods of sequence alteration, or mutation, and screening.
  • an antibody molecule comprising one or more variant sequences retains one or more of the functional characteristics of the parent antibody molecule, such as binding specificity and/or binding affinity for LAG-3 and PD-L1.
  • an antibody molecule comprising one or more variant sequences preferably binds to LAG-3 and/or PD-L1 with the same affinity, or a higher affinity, than the (parent) antibody molecule.
  • the parent antibody molecule is an antibody molecule which does not comprise the amino acid substitution(s), deletion(s), and/or insertion(s) which have been incorporated into the variant antibody molecule.
  • an antibody molecule of the invention may comprise a structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, light chain or heavy chain sequence which has at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1 %, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity to a structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, , light chain or heavy chain sequence disclosed herein, provided the VL and VH domains of the light and heavy chain sequences, respectively, remain unchanged.
  • the antibody molecule of the invention comprises a CH3 domain sequence which has at least 97%, at least 98%, at least 99%, at least 99.1 %, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity to the CH3 domain sequence set forth in SEQ ID NO: 4, 5, or 135.
  • the antibody molecule of the invention comprises a CH3 and CH2 domain sequence, which has at least 97%, at least 98%, at least 99%, at least 99.1 %, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity to the CH2 and CH3 domain sequence set forth in SEQ ID NO: 6 or 7.
  • GAP Garnier GAP (1990) J. Mol. Biol. 215: 405-410
  • FASTA Pearson and Lipman (1988) PNAS USA 85: 2444-2448
  • Smith-Waterman algorithm Smith and Waterman (1981) J. Mol Biol.
  • An antibody molecule of the invention may also comprise a structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, light chain or heavy chain sequence which has one or more amino acid sequence alterations (addition, deletion, substitution and/or insertion of an amino acid residue), preferably 20 alterations or fewer, 15 alterations or fewer, 10 alterations or fewer, 5 alterations or fewer, 4 alterations or fewer, 3 alterations or fewer, 2 alterations or fewer, or 1 alteration compared with a structural loop, CH3 domain, CH2 domain, CH2 and CH3 domain, light chain or heavy chain sequence disclosed herein, provided the VL and VH domains of the light and heavy chain sequences, respectively, remain unchanged.
  • alterations may be made in one or more framework regions of the antibody molecule outside the VH and VL domain sequences.
  • the antibody molecule of the invention may comprise a CH3 domain sequence with one or more amino acid sequence alterations (addition, deletion, substitution and/or insertion of an amino acid residue), preferably 20 alterations or fewer, 15 alterations or fewer, 10 alterations or fewer, 5 alterations or fewer, 4 alterations or fewer, 3 alterations or fewer, 2 alterations or fewer, or 1 alteration compared with the CH3 domain sequence set forth in SEQ ID NO: 4, 5, or 135.
  • amino acid sequence alterations additional, deletion, substitution and/or insertion of an amino acid residue
  • the antibody molecule of the invention comprises a CH3 and CH2 domain sequence, with one or more amino acid sequence alterations (addition, deletion, substitution and/or insertion of an amino acid residue), preferably 20 alterations or fewer, 15 alterations or fewer, 10 alterations or fewer, 5 alterations or fewer, 4 alterations or fewer, 3 alterations or fewer, 2 alterations or fewer, or 1 alteration compared with the CH2 and CH3 domain sequence set forth in SEQ ID NO: 6 or 7.
  • an antibody molecule which competes with an antibody molecule of the invention for binding to LAG-3 and/or PD-L1 , or which binds to the same epitope on l_AG-3 and/or PD-L1 as an antibody molecule of the invention, wherein the antibody molecule comprises both a CDR-based antigen binding site for PD-L1 and a l_AG-3 antigen binding site located in a CH3 domain of the antibody molecule.
  • Methods for determining competition for an antigen by two antibodies are known in the art. For example, competition of binding to an antigen by two antibodies can be determined using BIAcore. Methods for mapping the epitope bound by an antibody are similarly known in the art.
  • the antibody molecule of the invention preferably binds to LAG-3 with an affinity (KD) of 1 X 10 "9 M or an affinity which is greater.
  • the antibody molecule of the invention may bind to LAG-3 with an affinity (K D ) of 8 x 10 "10 M, or an affinity which is greater.
  • Fcabs have a smaller binding interface than monoclonal antibodies as the binding sites of Fcabs form a relatively compact antibody fragment with two binding sites situated in close proximity.
  • the Fab arms of a typical mAb are separated by a flexible hinge region.
  • the two antigen binding sites of an Fcab are also spatially close to each other, as compared with those of a typical mAb. Based on this smaller binding interface and reduced flexibility of the two binding sites it was surprising that the anti-LAG-3 Fcabs were able to bind to and inhibit LAG-3 with similar affinity and potency as a monoclonal antibody benchmark.
  • the antibody molecule of the invention preferably binds to PD-L1 with an affinity (KD) of 1 X 10 "9 M or an affinity which is greater.
  • the binding affinity of an antibody molecule to a cognate antigen, such as LAG-3 or PD-L1 can be determined by surface plasmon resonance (SPR), for example.
  • SPR surface plasmon resonance
  • the binding affinity of an antibody molecule to a cognate antigen, such as LAG-3 or PD-L1 , expressed on a cell surface can be determined by flow cytometry.
  • the antibody molecule of the present invention is preferably capable of binding to LAG-3 and PD-L1 expressed on the surface of a cell.
  • the cell is preferably a cancer cell.
  • the antibody molecule of the present invention is preferably capable of simultaneously binding to LAG-3 and PD-L1.
  • the antibody molecule of the present invention is capable of simultaneously binding to LAG-3 and PD-L1 , wherein the LAG-3 and PD-L1 are expressed on the surface of a single cell, or on the surface of two separate cells.
  • the antibody molecule of the invention may bind to human LAG-3, murine LAG-3, and/or cynomolgus monkey LAG-3.
  • the antibody molecule of the invention binds to human LAG-3.
  • the antibody molecule of the invention binds to human LAG- 3 and human PD-L1.
  • the antibody molecule of the invention comprises (i) a CDR-based antigen binding site for PD-L1 ; and (ii) a LAG-3 antigen binding site located in a constant domain of the antibody molecule.
  • Antibody molecules which do not comprise a l_AG-3 antigen binding site located in a constant domain, such as a CH3 domain, of the antibody molecule thus do not form part of the present invention.
  • a molecule which does not comprise a CDR-based antigen binding site for PD-L1 does not form part of the present invention.
  • the antibody molecule of the present invention may be conjugated to a therapeutic agent or detectable label.
  • the antibody molecule may be referred to as a conjugate.
  • the antibody molecule may be conjugated to an immune system modulator, cytotoxic molecule, radioisotope, or detectable label.
  • the immune system modulator or cytotoxic molecule may be a cytokine.
  • the detectable label may be a radioisotope, e.g. a non-therapeutic radioisotope.
  • the antibody molecule may be conjugated to the therapeutic agent or detectable label, by means of a peptide bond or linker, i.e. within a fusion polypeptide comprising said therapeutic agent or detectable label and the antibody molecule or a polypeptide chain component thereof.
  • Other means for conjugation include chemical conjugation, especially cross-linking using a bifunctional reagent (e.g. employing DOUBLE-REAGENTSTM Cross- linking Reagents Selection Guide, Pierce).
  • the antibody molecule and the therapeutic agent or detectable label may thus be connected to each other directly, for example through any suitable chemical bond or through a linker, for example a peptide linker.
  • the peptide linker may be a short (2-20, preferably 2-15, residue stretch of amino acids). Suitable examples of peptide linker sequences are known in the art. One or more different linkers may be used. The linker may be about 5 amino acids in length.
  • the chemical bond may be, for example, a covalent or ionic bond.
  • covalent bonds include peptide bonds (amide bonds) and disulphide bonds.
  • the antibody molecule and therapeutic or diagnostic agent may be covalently linked.
  • amide bonds peptide bonds
  • the antibody molecule and therapeutic or diagnostic agent may be produced (secreted) as a single chain polypeptide.
  • the invention also provides isolated nucleic acids encoding the antibodies molecules of the invention.
  • An isolated nucleic acid may be used to express the antibody molecule of the invention, for example, by expression in a bacterial, yeast, insect or mammalian host cell.
  • a preferred host cell is a mammalian cell such as a CHO, HEK or NSO cell.
  • the nucleic acid will generally be provided in the form of a recombinant vector for expression.
  • the isolated nucleic acid may, for example, comprise the sequence set forth in SEQ ID NO: 142, 4, 9, 14, 19, 24, 29, 34, 39, 44, or 49, which encode the CH3 domains of FS18-7-9 (CHO codon optimised nucleotide sequence), FS18-7-9 (HEK293-expressed nucleotide sequence), FS18-7-32, FS18-7-33, FS18-7-36, FS18-7-58, FS18-7-62, FS18-7-65, FS18-7- 78, FS18-7-88, and FS18-7-95, respectively.
  • FS18-7-9 CHO codon optimised nucleotide sequence
  • FS18-7-9 HEK293-expressed nucleotide sequence
  • In vitro host cells comprising such nucleic acids and vectors are part of the invention, as is their use for expressing the antibody molecules of the invention, which may subsequently be purified from cell culture and optionally formulated into a pharmaceutical composition.
  • the present invention thus further provides a method of producing the antibody molecule of the invention, comprising culturing the recombinant host cell of the invention under conditions for production of the antibody molecule. Methods for culturing suitable host cells as mentioned above are well-known in the art.
  • the method may further comprise isolating and/or purifying the antibody molecule.
  • the method may also comprise formulating the antibody molecule into a pharmaceutical composition, optionally with a pharmaceutically acceptable excipient or other substance as described below.
  • PD-L1 is known to be expressed on many cancer cells, while expression of l_AG-3 on cancer cells is more limited. Both are expressed on cells of the immune system. In particular, l_AG-3 is known to be expressed on exhausted T cells within the tumour environment.
  • the present inventors have shown that the use of an antibody molecule which binds to both LAG-3 and PD-L1 is effective in suppressing tumour growth in syngeneic mouse models of cancer, and that such antibody molecules are more effective than the administration of two binding molecules which bind l_AG-3 and PD-L1 , respectively.
  • an antibody molecule of the invention may be used in a method of treating cancer in a patient.
  • the patient is preferably a human patient.
  • Cells of the cancer to be treated using the antibody molecule of the invention may express LAG-3, e.g. on their cell surface.
  • cells of the cancer to be treated may have been determined to express LAG-3, e.g. on their cell surface.
  • B cell lymphomas have been shown to express LAG-3 on their cell surface.
  • tumours of the cancer to be treated using the antibody molecule of the invention may comprise LAG-3 expressing immune cells.
  • LAG- 3 expressing immune cells such as LAG-3 expressing TILs, are present between tumour cells in many cancers.
  • tumours of the cancer to be treated using the antibody molecule of the invention have been determined to contain LAG-3 expressing immune cells. Methods for determining the presence of LAG-3 expressing immune cells in a tumour or in the periphery of the tumour are known in the art.
  • Example 4 below also shows that the antibody molecules of the present invention can be used to treat tumours which express PD-L1 on their cell surface.
  • cells of the cancer to be treated using the antibody molecule of the invention may express PD-L1 , e.g. on their cell surface.
  • tumours of the cancer to be treated may comprise immune cells, such as TILs, that express PD-L1.
  • Cells of the cancer to be treated may have been determined to express PD-L1 , e.g. on their cell surface.
  • tumours of the cancer to be treated may have been determined to contain immune cells, such as TILs, that express PD-L1.
  • LAG-3 and PD-L1 Cell surface expression of LAG-3 and PD-L1 is expected to allow the antibody molecule to bind to LAG-3 and PD-L1 expressed on the surface of the immune cell and/or the cancer cell. This is thought to result in directed therapy, bridging, and localisation of cancer cells and immune cells.
  • a cancer to be treated using an antibody molecule of the invention may be selected from the group consisting of Hodgkin's lymphoma, non-Hodgkin's lymphoma (such as diffuse large B- cell lymphoma, indolent non-Hodgkin's lymphoma, mantle cell lymphoma, ovarian cancer, prostate cancer, colorectal cancer, fibrosarcoma, renal cell carcinoma, melanoma, pancreatic cancer, breast cancer, glioblastoma multiforme, lung cancer (such as non-small cell lung cancer), head and neck cancer (such as head and neck squamous cell carcinoma), stomach cancer (gastric cancer), bladder cancer, cervical cancer, uterine cancer, vulvar cancer, testicular cancer, penile cancer, leukemia (such as chronic lymphocytic leukemia, myeloid leukemia, acute lymphoblastoid leukaemia, or chronic lymphoblastoid leukaemia), multiple myeloma, s
  • lung cancer such as non-small cell lung cancer
  • nasopharyngeal cancer colorectal cancer
  • melanoma stomach cancer (gastric cancer)
  • esophageal cancer such as adenocarcinoma of the gastroesophageal junction
  • ovarian cancer cervical cancer, bladder cancer, head and neck cancer (such as head and neck squamous cell carcinoma)
  • leukemia such as chronic lymphocytic leukemia, Hodgkin's lymphoma, non-Hodgkin's lymphoma (such as diffuse large B-cell lymphoma, indolent non- Hodgkin's lymphoma, mantle cell lymphoma), and multiple myeloma using anti-LAG-3 antibodies
  • leukemia such as chronic lymphocytic leukemia
  • Hodgkin's lymphoma non-Hodgkin's lymphoma
  • non-Hodgkin's lymphoma such as diffuse large B-cell
  • the cancer to be treated using the antibody molecules of the present invention may be a renal cell carcinoma, lung cancer (such as non-small cell lung cancer), nasopharyngeal cancer, colorectal cancer, melanoma, stomach cancer (gastric cancer), esophageal cancer (such as adenocarcinoma of the gastroesophageal junction), ovarian cancer, cervical cancer, bladder cancer, head and neck cancer (such as head and neck squamous cell carcinoma), leukemia (such as chronic lymphocytic leukemia, Hodgkin's lymphoma, non-Hodgkin's lymphoma (such as diffuse large B-cell lymphoma, indolent non-Hodgkin's lymphoma, mantle cell lymphoma), or multiple myeloma.
  • lung cancer such as non-small cell lung cancer
  • nasopharyngeal cancer colorectal cancer
  • melanoma stomach cancer
  • stomach cancer gastric cancer
  • melanoma colorectal cancer, breast cancer, bladder cancer, renal cell carcinoma, bladder cancer, gastric cancer, head and neck cancer (such as squamous cell carcinoma of the head and neck), mesothelioma, lung cancer (such as non-small-cell lung cancer), ovarian cancer, Merkel-cell carcinoma, pancreatic cancer, melanoma and hepatocellular carcinoma using anti-PD-L1 antibodies has also been investigated in clinical trials and shown promising results.
  • the cancer to be treated using the antibody molecules of the present invention may be a melanoma, colorectal cancer, breast cancer, bladder cancer, renal cell carcinoma, bladder cancer, gastric cancer, head and neck cancer (such as squamous cell carcinoma of the head and neck), mesothelioma, lung cancer (such as non-small-cell lung cancer), ovarian cancer, Merkel-cell carcinoma, pancreatic cancer, melanoma, or hepatocellular carcinoma.
  • Preferred cancers for treatment using the antibody molecules of the present invention are lung cancer (such as non-small-cell lung cancer), bladder cancer, head and neck cancer (squamous cell carcinoma of the head and neck), diffuse large B cell lymphoma, gastric cancer, pancreatic cancer and hepatocellular carcinoma.
  • Tumours of these cancers are known to comprise LAG-3 expressing immune cells and to express PD-L1 either on their cell surface or to comprise immune cells expressing PD-L1.
  • cancer refers to a particular type of cancer, such as breast cancer
  • a cancer which originates from malignant transformation of a different tissue, e.g. ovarian tissue, may result in metastatic lesions in another location in the body, such as the breast, but is not thereby a breast cancer as referred to herein but an ovarian cancer.
  • the cancer may be a primary or secondary cancer.
  • the antibody molecule of the present invention may be for use in a method of treating cancer in a patient, wherein the cancer is a primary tumour and/or a tumour metastasis.
  • the antibody molecules of the invention are designed to be used in methods of treatment of patients, preferably human patients.
  • Antibody molecules will usually be administered in the form of a pharmaceutical composition, which may comprise at least one component in addition to the antibody molecule, such as a pharmaceutically acceptable excipient.
  • a pharmaceutical composition of the present invention may comprise, in addition to active ingredient, a pharmaceutically acceptable excipient, carrier, buffer, stabilizer or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient.
  • the precise nature of the carrier or other material will depend on the route of administration, which may be by injection, e.g. intravenous or subcutaneous.
  • the antibody molecule may be administered intravenously, or subcutaneously.
  • Liquid pharmaceutical compositions generally comprise a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil.
  • a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil.
  • Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.
  • the antibody molecule, or pharmaceutical composition comprising the antibody molecule is preferably in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
  • a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
  • isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
  • Preservatives, stabilizers, buffers, antioxidants and/or other additives may be employed, as required.
  • Many methods for the preparation of pharmaceutical formulations are known to those skilled in the art. See e.g. Robinson ed., Sustained and Controlled Release Drug Delivery Systems, Marcel Dekker, Inc., New York, 1978.
  • a composition comprising an antibody molecules according to the present invention may be administered alone or in combination with other treatments, concurrently or sequentially or as a combined preparation with another therapeutic agent or agents, dependent upon the condition to be treated.
  • an antibody molecule of the invention may be administered in combination with an existing therapeutic agent for the disease to be treated, e.g. a cancer as mentioned above.
  • an antibody molecule of the present invention may be administered to the patient in combination with a second anti-cancer therapy, such as chemotherapy, anti-tumour vaccination (also referred to as a cancer vaccination), radiotherapy, immunotherapy, an oncolytic virus, chimeric antigen receptor (CAR) T-cell therapy, or hormone therapy.
  • a second anti-cancer therapy such as chemotherapy, anti-tumour vaccination (also referred to as a cancer vaccination), radiotherapy, immunotherapy, an oncolytic virus, chimeric antigen receptor (CAR) T-cell therapy, or hormone therapy.
  • the antibody molecule of the invention may act as an adjuvant in anticancer therapy, such as chemotherapy, anti-tumour vaccination, or radiotherapy.
  • anticancer therapy such as chemotherapy, anti-tumour vaccination, or radiotherapy.
  • administration of the antibody molecule to the patient as part of chemotherapy, anti-tumour vaccination, or radiotherapy will trigger a greater immune response against the cancer associated antigens LAG-3 and PD-L1 , than is achieved with chemotherapy, anti-tumour vaccination, or radiotherapy alone.
  • anti-l_AG-3 therapies have shown good efficacy in treating viral based pathologies in mice (Blackburn SD, et al., 2009).
  • a method of treating cancer in a patient may thus comprise administering to the patient a therapeutically effective amount of an antibody molecule according to the present invention in combination with a chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic viruses, CAR-T cells, or agent for hormone therapy.
  • a chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic viruses, CAR-T cells, or agent for hormone therapy is preferably a
  • chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic viruses, CAR-T cells, or agent for hormone therapy for the cancer in question i.e. a chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic viruses, CAR-T cells, or agent for hormone therapy which has been shown to be effective in the treatment of the cancer in question.
  • a suitable chemotherapeutic agent, anti-tumour vaccine, radionuclide, immunotherapeutic agent, oncolytic viruses, CAR-T cells, or agent for hormone therapy which have been shown to be effective for the cancer in question is well within the capabilities of the skilled practitioner.
  • the method comprises administering to the patient a therapeutically effective amount of an antibody molecule according to the present invention in combination with a chemotherapeutic agent
  • the chemotherapeutic agent from the group consisting of: taxanes, cyctotoxic antibiotics, tyrosine kinase inhibitors, PARP inhibitors, B_RAF enzyme inhibitors, alkylating agents, platinum analogs, nucleoside analogs, thalidomide derivatives, antineoplastic chemotherapeutic agents and others.
  • Taxanes include docetaxel, paclitaxel and nab-paclitaxel; cytotoxic antibiotics include actinomycin, bleomycin, anthracyclines, doxorubicin and valrubicin; tyrosine kinase inhibitors include erlotinib, gefitinib, axitinib, PLX3397, imatinib, cobemitinib and trametinib; PARP inhibitors include piraparib; B-Raf enzyme inhibitors include vemurafenib and dabrafenib; alkylating agents include
  • platinum analogs include carboplatin, cisplatin and oxaliplatin
  • nucleoside analogs include gemcitabine and azacitidine
  • antineoplastics include fludarabine.
  • Other chemotherapeutic agents suitable for use in the present invention include methotrexate, defactinib, entinostat, pemetrexed, capecitabine, eribulin, irinotecan, fluorouracil, and vinblastine.
  • Vaccination strategies for the treatment of cancers has been both implemented in the clinic and discussed in detail within scientific literature (such as Rosenberg, S. 2000 Development of Cancer Vaccines). This mainly involves strategies to prompt the immune system to respond to various cellular markers expressed by autologous or allogenic cancer cells by using those cells as a vaccination method, both with or without granulocyte-macrophage colony-stimulating factor (GM-CSF). GM-CSF provokes a strong response in antigen presentation and works particularly well when employed with said strategies.
  • GM-CSF granulocyte-macrophage colony-stimulating factor
  • Administration may be in a "therapeutically effective amount", this being sufficient to show benefit to a patient. Such benefit may be at least amelioration of at least one symptom.
  • treatment of a specified disease refers to amelioration of at least one symptom.
  • the actual amount administered, and rate and time-course of administration will depend on the nature and severity of what is being treated, the particular patient being treated, the clinical condition of the individual patient, the cause of the disorder, the site of delivery of the composition, the type of antibody molecule, the method of administration, the scheduling of administration and other factors known to medical practitioners. Prescription of treatment, e.g. decisions on dosage etc., is within the responsibility of general practitioners and other medical doctors, and may depend on the severity of the symptoms and/or progression of a disease being treated.
  • Appropriate doses of antibody molecules are well known in the art (Ledermann et al. (1991) Int. J. Cancer 47: 659-664; and Bagshawe et al. (1991) Antibody, Immunoconjugates and Radiopharmaceuticals 4: 915-922). Specific dosages indicated herein, or in the Physician's Desk Reference (2003) as appropriate for an antibody molecule being administered, may be used.
  • a therapeutically effective amount or suitable dose of an antibody molecule can be determined by comparing it's in vitro activity and in vivo activity in an animal model. Methods for extrapolation of effective dosages in mice and other test animals to humans are known.
  • Treatments may be repeated at daily, twice-weekly, weekly or monthly intervals, at the discretion of the physician. Treatment may be given before, and/or after surgery, and may be administered or applied directly at the anatomical site of surgical treatment.
  • Naive phage libraries displaying the CH3 domain of human lgG1 (IMGT numbering 1.4-130) with randomisation within the AB (residues 14-18) and EF (residues 92-101) loops were used for selection with recombinant Fc-tagged human LAG-3 (LAG-3 Fc) antigen (R&D systems, 2319-L3-050).
  • the libraries were selected in three rounds using antigen captured on Protein A (Life Technologies, 10002D) or Protein G (Life Technologies, 10004D) beads.
  • the outputs were screened by ELISA and positive binders sub-cloned and expressed as soluble Fcabs (containing a truncated hinge) in Pichia pastoris using EasySelect Pichia Expression Kit (Life Technologies, K1740-01). The Fcabs were then screened for binding to recombinant human LAG-3 Fc on the Biacore 3000 (GE Healthcare). Briefly, LAG-3 Fc (R&D systems, 2319-L3-050) was coupled at a density of 7200 RU to a CM5 chip (GE Healthcare, BR-100012) using amine coupling (GE Healthcare, BR-1000-50).
  • Fcabs were diluted in HBS-P (GE Healthcare, BR100368) buffer and injected at 250 nM, 500 nM and 1000 nM for 3 min and then allowed to dissociate in buffer for 5 min.
  • Reference subtracted data (LAG-3 Fc flow cell 2 -blank flow cell) was analyzed using BIAevaluation 3.2 software to identify binding. Fcabs were then tested for binding to HEK cell-expressed human LAG-3 (LAG-3 cloned into pcDNA5FRT vector [Life Technologies, V6010-20] [See section 1.4.5 for methodology]).
  • HEK 293 cells overexpressing human LAG-3 grown in DMEM (Life Technologies, 61965-026) containing 10% FBS (Life Technologies, 10270-1-6), 100 ⁇ g/m ⁇ Hygromycin B (Melford Laboratories Ltd, Z2475), 15 ⁇ g/ml Blasticidin (Melford Laboratories Ltd, B1105) and 1 ⁇ g/ml Doxycyclin (Sigma, D9891) were detached from tissue culture flasks using cell dissociation buffer (Life Technologies, 13151-014) and seeded in V-bottom 96-well plates at 2x10 5 cells/well. Fcabs were incubated with the cells at 5 ⁇ in a 100 ⁇ volume for 1 h at 4 °C.
  • the plates were washed the secondary antibody (Anti-human Fc- 488, Jackson ImmunoResearch, 109-546-098) was diluted 1 : 1000 in PBS and 100 ⁇ was added to the cells and incubated for 30 min at 4 °C. The plates were washed and the cells were resuspended in 100 ⁇ PBS containing 1 ⁇ g/ml DAPI (Biotium, 40043). The plate was read on a BD FACSCanto II cytometer (BD Biosciences) and the data analysed using FlowJoX. The Fcabs were then expressed in mammalian cells by transformation using lipofectamine (Life Technologies, 11668-019) into Flp-ln T-Rex 293 cells (Life Technologies, R780-07).
  • lipofectamine Life Technologies, 11668-019
  • Flp-ln T-Rex 293 cells Life Technologies, R780-07
  • LAG-3 binding Fcabs were tested for inhibition of binding of human MHC class II on A375 cells (ATCC, CRL-1619) to recombinant LAG-3 Fc (using the methodology in example 1.6).
  • 54 unique Fcab sequences were identified from three rounds of phage selection, and 12 of these Fcabs were determined to bind to LAG-3 Fc by BIAcore analysis and/or bind to LAG-3 expressing HEK cells.
  • Three of the selected Fcabs were also able to inhibit the interaction of LAG-3 with MHC class II and were selected for affinity maturation. The three Fcabs were termed FS18-3, FS18-7 and FS18-21.
  • phage display affinity maturation libraries were constructed by randomising five residues in the AB loop (residues 14-18) and either five (residues 92-94 and 97-98) or eight (residues 92-94 and 97-101) residues in the EF loop of each of the three Fcabs identified using the naive selection process described above.
  • the affinity maturation libraries were selected using recombinant human LAG-3 Fc (R&D systems, 2319-L3-050) and HEK cells expressing human LAG-3 (as described above).
  • the outputs were screened by phage ELISA, the positive binders were subcloned and expressed as soluble Fcabs (containing a truncated hinge) in HEK Expi293 cells (Fcabs cloned into pTT5 vector [National Research Council of Canada] transfected using ExpiFectamine 293 Transfection kit [Life Technologies, A14524] into Expi293F cells [Life technologies,
  • the HEK expressed soluble Fcabs were then screened for binding to cell expressed human LAG-3, binding to cell expressed cynomolgus LAG-3 (methodology as example 1.4.3), and the ability to block MHC class II binding to recombinant LAG-3 Fc (methodology as in example 1.6).
  • the blocking Fcabs were further tested to determine whether they were able to reverse LAG-3 induced inhibition of IL-2 secretion in a T cell activation assay (methodology as in example 2.1). 61 unique anti-LAG-3 Fcabs were identified from the six affinity maturation libraries using these screening methods.
  • Affinity matured Fcabs from the FS18-7 lineage were shown to have the highest level of cross- reactivity with cynomolgus monkey LAG-3.
  • the three Fcabs from this lineage with the strongest binding to cynomolgus monkey LAG-3 Fc and the highest activity in the T cell activation assay were selected for further affinity maturation. These three Fcabs were also shown to block the interaction of LAG-3 Fc with cell expressed MHC class II.
  • a pool of the three Fcabs (FS18-7-7, FS18-7-9, and FS18-7-1 1) from the first affinity maturation was used to create further affinity maturation libraries.
  • the CD loop was hard randomized using randomized primers from ELLA Biotech.
  • a portion of amino acid positions in the CD loop (residues 45.1-78) was randomized using an equimolar distribution of amino acids excluding cysteine. Error prone PCR was also carried out across the entire CH3 domain sequence to introduce additional mutations that might enhance binding.
  • the affinity maturation libraries were generated in phage and selections performed against biotinylated recombinant LAG-3 avi-Fc (BPS Bioscience, 71147) and HEK hl_AG-3 cells and screened for binding to recombinant LAG-3 Fc (R&D systems, 2319-L3-050) by phage ELISA.
  • 86 unique Fcabs (containing a truncated hinge) were expressed in HEK293F cells. Selected Fcabs were also screened for activity in a T cell activation assay as described above.
  • the nine Fcabs identified during the second affinity maturation with the highest activity in the T cell activation assay (FS18-7-32; FS18-7-33; FS18-7-36; FS18-7-58; FS18- 7-62; FS18-7-65; FS18-7-78; FS18-7-88; and FS18-7-95), as well as the parental Fcab clone, FS18-7-9, were then further characterised as described below.
  • a sequence alignment of these nine Fcabs against the parental Fcab clone, FS18-7-9 is shown in Figure 1A.
  • Figure 1 B details the percentage sequence identity of each of the nine Fcab clones to the parental Fcab clone, FS18-7-9.
  • Fcabs originating from affinity maturation of the two other parental Fcab clones, FS18-7-7 and FS18-7-1 1 were not as promising candidates as those originating from affinity maturation of FS18-7-9 and were therefore not pursued further.
  • Fcab FS18-7 which was selected using the naive selection protocol described above, was used to generate phage libraries to select against mouse LAG-3. Two rounds of affinity maturation were performed, and Fcab clones FS18-7-108-29 and FS18-7-108-35, which showed high-affinity, specific binding to mouse LAG-3 were selected following affinity maturation. The ability of FS18-7-108-29 and FS18-7-108-35 to inhibit mouse LAG-3 in a T cell activation assay was confirmed. Epitope mapping using the Octet (Forteo Bio) showed that the anti-mouse LAG-3 Fcabs compete with the anti-human LAG-3 Fcabs (selected following the second affinity maturation as described above) for binding to human LAG-3.
  • “mock” mAb 2 comprising the lead anti-human l_AG-3 and anti-mouse LAG-3 Fcabs identified in 1.1 and 1.2 above were prepared in order to allow the characterisation of these Fcabs in mAb 2 format.
  • These mock mAb 2 were prepared from the anti-l_AG-3 Fcabs and the variable regions of anti-FITC antibody 4420 (see SEQ ID NO: 83, SEQ ID NO: 84, and SEQ ID NO: 85 for details) (Bedzyk, W. D., et al. 1989 and Bedzyk, W. D., et al. 1989).
  • the mock mAb 2 were prepared both with (SEQ ID NO: 63, 65, 67, 69, 71 , 73, 75, 77, 79, and 81) and without (SEQ ID NO: 64, 66, 68, 70, 72, 74, 76, 78, 80, and 82) the LALA mutation in the CH2 domain of the heavy chain (see section 1.5 below for details) and further comprised the light chain of the anti-FITC mAb 4420 (SEQ ID NO: 85).
  • the mock mAb 2 were produced by transient expression in HEK293-6E cells and purified using mAb Select SuRe protein A columns.
  • a BIAcore T200 (GE Healthcare) was used to measure the affinity of the anti-human LAG-3 Fcabs in the mock mAb 2 format for human l_AG-3.
  • Flow cell 4 of a CM5 sensor chip (GE Healthcare, BR1005-30) was immobilised with human LAG-3-Fc (R&D Systems, 2319-L3- 050), and flow cell 3 was immobilised with buffer for reference using the amine coupling kit (GE Healthcare, BR-1000-50).
  • LAG-3-Fc was diluted to 5 ⁇ g/ml in sodium acetate pH5 (ForteoBio, 18-1069) and injected at a flow rate of ⁇ /min for 12 seconds followed by deactivation of the surface by injection of ethanolamine for 420 sec.
  • the Immobilisation level was 158 RU.
  • the mock mAb 2 (or control anti-human LAG-3 mAb, 25F7) were diluted in HBS-P buffer (GE Healthcare, BR-1003-68) in a 2-fold dilution series from 4 ⁇ g/ml.
  • the control mAb/mock mAb 2 were injected with an association time of 240 seconds at 30 ⁇ / ⁇ , and a dissociation time 300 seconds at 30 ⁇ / ⁇ .
  • the surface was regenerated using 25mM NaOH for 30 seconds at 100 ⁇ /min.
  • the data was double reference subtracted and analysed using the BIAevaluation 3.2 software to calculate kinetic constants.
  • the Fcabs in mock mAb 2 format had affinities for human LAG-3 in the range of 0.8 - 1.1 nM (Table 1), which is similar to the affinity of the benchmark anti-human LAG-3 mAb 25F7.
  • Table 1 The affinity of the benchmark anti-human LAG-3 mAb 25F7.
  • Fcabs have a smaller binding interface than monoclonal antibodies as the binding sites of Fcabs form a relatively compact antibody fragment with two binding sites situated in close proximity.
  • the Fab arms of a typical mAb are separated by a flexible hinge region. Based on this smaller binding interface and the associated reduced flexibility of the two binding sites in the Fc region, it was unexpected that the anti-LAG-3 Fcabs were able to bind to and inhibit LAG-3 with similar affinity and potency as the benchmark antibody 25F7.
  • a Biacore 3000 (GE Healthcare) was used to measure the affinity of the surrogate Fcabs specific for mouse LAG-3 to mouse LAG-3.
  • Amine coupling (amine coupling kit, GE
  • ml_AG-3 Fc (R&D Systems, 3328-L3-050) diluted in 10 mM sodium acetate pH 5.0 (ForteBio, 18-1069) directly to a CM5 chip (GE Healthcare, BR-1000-12).
  • Flow cell 1 was coated with Mouse Fc (SinoBiological, 51094-MNAH), and flow cell 2 was coated with ml_AG-3 Fc at 950 RU.
  • Fcabs were diluted in HBS-P buffer (GE Healthcare, BR-1003-68) and injected at various concentrations (fourfold dilutions from 100 nM) for 3 min at 20 ⁇ /min and then allowed to dissociate in buffer for 12 min.
  • Lentiviral transduction methodology was used to generate DO11.10 cells (National Jewish Health) over-expressing human, cynomolgus or mouse LAG-3 using the Lenti-X HTX Packaging System (Clontech, Cat. No 631249).
  • Lenti-X expression vector (pLVX) (Clontech, Cat. No 631253), containing the mouse LAG-3 cDNA (SEQ ID NO: 96), human LAG-3 cDNA (SEQ ID NO: 95) or cynomolgus LAG-3 cDNA (SEQ ID NO: 97), was co-transfected with a Lenti-X HTX Packaging Mix into the Lenti-X 293T Cell Line (Clontech, Cat. No 632180) to generate virus.
  • the DO11.10 cell line was transduced using the lentiviral vectors produced with the Lenti-X HTX Packaging System.
  • the affinity of the anti-human LAG-3 Fcabs in mock mAb 2 format to cells expressing human LAG-3 was measured using flow cytometry.
  • mAb 2 and control mAb dilutions (2 x final concentration) were prepared in triplicate in 1 x DPBS (Gibco, 14190-094).
  • D01 1.10:LAG-3 cell suspensions were prepared in PBS+2%BSA (Sigma, A7906) and seeded at 4 x 10 "6 cell/ml with 50 ⁇ /well in V-bottomed 96-well plates (Costar, 3897).
  • mAb 2 or control mAb anti human LAG-3 mAb, 25F7
  • 50 ⁇ of the mAb 2 or control mAb anti human LAG-3 mAb, 25F7 dilutions were added to the wells containing cells (final volume 100 ⁇ ) and incubated at 4°C for 1 hour. The plates were washed and ⁇ /well of secondary antibody (anti- human Fc-488 antibody, Jackson ImmunoResearch, 109-546-098) diluted 1 : 1000 in
  • the affinity of the anti-human LAG-3 Fcabs in mock mAb 2 format to cells expressing cynomolgus LAG-3 was measured using flow cytometry.
  • mAb 2 and control mAb dilutions (2 x final concentration) were prepared in triplicate in 1 x DPBS (Gibco, 14190-094).
  • D01 1.10:LAG-3 cell suspensions were prepared in PBS+2%BSA (Sigma, A7906) and seeded at 4 x 10 "6 cell/ml with 50 ⁇ /well in V- bottomed 96-well plates (Costar, 3897).
  • mAb 2 or control mAb anti human LAG-3 mAb, 25F7 dilutions were added to the wells containing cells (final volume 100 ⁇ ) and incubated at 4°C for 1 hour.
  • the plates were washed and ⁇ /well of secondary antibody (anti-human Fc-488 antibody, Jackson ImmunoResearch, 109-546-098) diluted 1 : 1000 in PBS+2% BSA was then added and incubated for 30 mins at 4°C in the dark.
  • the plates were washed and resuspended in 100 ⁇ of PBS containing DAPI (Biotium, 40043) at 1 mg/ml. The plates were read using Canto II flow cytometer (BD Bioscience).
  • the mouse LAG-3 sequence (SEQ ID NO: 96) was subcloned into pcDNA5FRT vector (Life Technologies, V6010-20) using Kpnl (NEB, R0142) and Notl (NEB, R0146) restriction digestion. The vector was then transformed into Flp-ln T-REx 293 HEK cell line (Life Technologies, R780-07) using Lipofectamine 2000 (Life Technologies, 1 1668-019).
  • Transformed Flp-ln T-REx 293 cells were grown in DMEM (Life Technologies, 61965-026) containing 10% FBS (Life Technologies, 10270-1-6), 100 g/ml Hygromycin B (Melford Laboratories Ltd, Z2475), 15 g/ml Blasticidin (Melford Laboratories Ltd, B1105) for 3-4 weeks until colonies of stably transformed cells were apparent. These colonies were amplified in the presence of 1 ⁇ g/ml Doxycyclin (Sigma, D9891) and tested for mouse LAG-3 expression using PE conjugated anti-mouse LAG-3 (clone C9B7W, BD Biosciences, 552380).
  • the affinity of the surrogate anti-mouse LAG-3 Fcabs (containing the truncated hinge; SEQ ID NO: 58) to cell-expressed mouse LAG-3 was determined using flow cytometry.
  • HEK cells expressing ml_AG-3 grown in DMEM (Life Technologies, 61965-026) containing 10% FBS (Life Technologies, 10270-1-6), 100 g/ml Hygromycin B (Melford Laboratories Ltd, Z2475), 15 ⁇ g/ml Blasticidin (Melford Laboratories Ltd, B1 105) and 1 ⁇ g/ml Doxycyclin (Sigma, D9891) were detached from tissue culture flasks using cell dissociation buffer (Life Technologies, 61965-026) containing 10% FBS (Life Technologies, 10270-1-6), 100 g/ml Hygromycin B (Melford Laboratories Ltd, Z2475), 15 ⁇ g/ml Blasticidin (Melford Laboratories Ltd, B1 105) and 1
  • V-bottom 96-well plates (Costar, 3897) at 2x10 5 cells/well.
  • the plates were centrifuged at 1500 rpm for 3 min at 4°C to pellet the cells.
  • a dilution series of the Fcabs (or control mAb) were incubated with the cells in a 100 ⁇ volume for 1 h at 4 °C.
  • the plates were washed and secondary antibody (Anti-human Fc-488, Jackson ImmunoResearch, 109-546-098 for Fcabs or Anti-Rat IgG (H+L), Alexa Fluor 488 Conjugate, ThermoFisher, A-1 1006 for C9B7W) was diluted 1 :1000 in PBS and 100 ⁇ was added to the cells for 30 min at 4 °C (plates were kept in the dark). The plates were then washed and the cells resuspended in 100 ⁇ PBS containing 1 ⁇ g/ml DAPI (Biotium, 40043). The plates were read using Canto II flow cytometer (BD Bioscience).
  • HEK cells expressing ml_AG-3 grown in DM EM (Life Technologies, 61965-026) containing 10% FBS (Life Technologies, 10270-1-6), 100 ⁇ g/ml Hygromycin B (Melford Laboratories Ltd, Z2475), 15 ⁇ g/ml Blasticidin (Melford Laboratories Ltd, B1 105) and 1 ⁇ g/ml Doxycyclin (Sigma, D9891) were detached from tissue culture flasks using cell dissociation buffer (Life Technologies, 13151-014). Cells were collected by centrifuged at 1500 rpm for 3 min at 4°C to pellet the cells and then
  • the plates were then washed and the cells resuspended in 60 ⁇ PBS containing 1 ⁇ g/ml DAPI (Biotium, 40043). The plates were read using Canto II flow cytometer (BD Bioscience). Dead cells were excluded and the fluorescence in the FITC channel (488nm/530/30) was measured. The data was fitted using log (agonist) vs response in GraphPad Prism Software.
  • the anti-human LAG-3 Fcab FS18-7-9 in mock mAb 2 format bound to mouse LAG-3 with an EC50 of 19 nM compared to an EC50 of 2.6 nM for the surrogate anti-mouse LAG-3 Fcab FS18-7-9-108 (Table 6).
  • the human mAb, 25F7 does not show any detectable binding to mouse LAG-3, indicating that the human LAG-3 Fcab, FS18-7-9, has a different binding epitope on LAG-3 than that of 25F7.
  • the introduction of the LALA mutation in the CH2 domain of human lgG1 is known to reduce Fc ⁇ receptor binding (Bruhns, P., et al. (2009); and Xu, D. et al. (2000)).
  • BIAcore was used to confirm that the LALA mutation had reduced the binding affinity of the Fcabs (in mock mAb 2 format) to Fey receptors.
  • the human FcyR binding assay was performed on a Biacore T200 instrument (GE Healthcare) using the Fcabs in the mock mAb 2 format.
  • Human FcyRs (R&D Systems, 1257-FC, 1330-CD, 1875-CD, 4325-FC) were immobilized using amine coupling (amine coupling kit, GE Healthcare, BR-1000-50) onto a Series S CM5 chip (GE Healthcare, BR-1005-30) to a surface density of 370 RU for FcyRI, 264 RU for FcvRIII (high affinity human FcyRs) and 500 RU for FcyRlla and FcyRllb (low affinity human FcyRs). For each immobilized chip a flow cell was left blank for background subtraction. FcyR were
  • Table 7 Binding response of anti-human LAG-3 Fcabs in mock mAb 2 format (comprising LALA mutation as detailed above) to human Fey receptors by SPR
  • Fcabs containing the truncated hinge; SEQ ID NO: 58
  • SEQ ID NO: 58 The ability of the Fcabs (containing the truncated hinge; SEQ ID NO: 58) to block the interaction between recombinant human or mouse LAG-3 Fc and human MHC Class II was studied by measuring binding of LAG-3 Fc to A375 cells, a melanoma cell line that expresses human MHC Class II.
  • A375 ATCC, CRL-1619 cells grown in DM EM (Life Technologies, 61965-026) containing 10% FBS (Life Technologies, 10270-106) were detached from cell culture flasks using cell dissociation buffer (Life Technologies, 13151- 014) and seeded in V-bottom 96-well plates (Costar, 3897) at 2x10 5 cells/well.
  • the plates were centrifuged at 1500 rpm for 3 min at 4 °C to pellet the cells.
  • the relevant concentrations of Fcab or control mAb were incubated with 1 ⁇ g/ml l_AG-3 Fc (human LAG- 3-Fc R&D Systems, 2319-L3-050 or mouse LAG-3 Fc R&D Systems, 3328-L3-050) in 100 ⁇ DM EM containing 10% FBS for 1 h at 4 °C.
  • LAG-3/Fcab mix was added to the A375 cells and incubated for 1 h at 4 °C. Cells were washed.
  • the anti-human LAG-3 Fcabs tested were also able to inhibit the interaction of human MHC class II with human LAG-3 with a similar potency as the control anti-human LAG-3 mAb (25F7).
  • DNA inserts encoding variable heavy and light chain regions of 84G09 were codon optimised for mammalian expression and synthesised by DNA2.0 (Menlo Park, CA, USA).
  • the inserts supplied in pJ-Amp-high host vector were sub-cloned into expression vectors pFS-hHC2.1-G1 m17(z) LALA (IgG heavy chain containing LALA mutation) or pFS-hHC2.1- G1 m17(z) (IgG heavy chain without LALA mutation) and pFShKLO (IgG kappa light chain) via EcoRI and Nhel restriction digest.
  • HEK293-6E cells were sub-cultured in pre-warmed F17 medium (Invitrogen, A13835-01) supplemented with 4mM of GlutaMAX-1 (Invitrogen, 35050-038), 0.1 % of Pluronic F-68 (Invitrogen A13835-01) and 25 ⁇ g/ml of geneticin (Invitrogen, 10131-027). Cells were incubated at 37 °C, 140 rpm, 5% C0 2 and subcultured at 0.3x10 6 cells/ml on a three then four day regime.
  • HEK293-6E cells were transfected transiently using PEIpro at 1 mg/ml (Polyplus, PPLU1 15). 24 hours prior transfection cells were seeded at 0.8x10 6 cells/ml in culture medium.
  • a DNA mixture was prepared by mixing 10 ml of warmed Opti-MEMI (Invitrogen, 1 1058-021), 100 ⁇ g endotoxin-free DNA encoding the heavy chain and 100 ⁇ g endotoxin-free DNA encoding the light chain.
  • PEI mixture was prepared by mixing 10 ml of warmed Opti-MEMI and 200 ⁇ of PEIpro and vortexing.
  • the DNA mixture was quickly added to the vortexed PEI mixture, mixed by vortex pulsing 3 times for 1 s, incubated 3 min at room temperature and added drop by drop to the cells. 48 hours after transfection 20 ml of F17 plus supplements with 0.5% Tryptone N1 (TekniScience Inc., 19553) was added to each flask. 6 days after transfection cells were harvested by centrifugation at 4500 rpm for 40 min.
  • Clarified supernatants were purified using pre-packed 5ml HiTrap MabSelect SuRe columns (GE Healthcare, 11-0034-95) on an AKTAexplorer or AKTAxpress. Briefly, the columns were equilibrated with 50mM Tris-HCI, 250mM NaCI at pH 7.0, unbound material washed with the same buffer at 5 ml/min. The products were eluted with 10mM sodium formate pH 3.0 at 5 ml/min. Eluted samples were immediately buffer exchange into PBS pH 7.4 using PD-10 columns (GE Healthcare, 17-0851-01) pre-equilibrated with PBS pH 7.4 according to the manufacturer recommendations.
  • the heavy chains of the mAb 2 molecules FS18-7-9/84G09 (SEQ ID NOs 94 and 95), FS18- 7-32/84G09 (SEQ ID NOs 96 and 97), FS18-7-33/84G09 (SEQ ID NOs 98 and 99), FS18-7- 36/84G09 (SEQ ID NOs 100 and 101), FS18-7-58/84G09 (SEQ ID NOs 102 and 103), FS18-7-62/84G09 (SEQ ID NOs 104 and 105), FS18-7-65/84G09 (SEQ ID NOs 106 and 107), FS18-7-78/84G09 (SEQ ID NOs 108 and 109), FS18-7-88/84G09 (SEQ ID NOs 110 and 1 11) and FS18-7-95/84G09 (SEQ ID NOs 1 12 and 1 13) were prepared by replacing the CH3 domains of the monoclonal antibodies 84G09 (with and without the LALA mutation)
  • the heavy chain of the mAb 2 were co-transfected with the light chain of 84G09 (SEQ ID NO: 1 16) as described for mAb 84G09 in section 2.1 above.
  • the mAb 2 were then expressed and purified as described for mAb 84G09 in section 2.1 above.
  • the anti-FITC mAb (with and without LALA mutation) was prepared as described for mAb 84G09 in section 2.1 above using the heavy chains (SEQ ID NOs 83 and 84; with and without LALA mutation) and light chain (SEQ ID NO: 85) of mAb 4420.
  • the heavy chains of the mAb 2 molecules FS18- 7-9/4420 (SEQ ID NOs 63 and 64), FS18-7- 32/4420 (SEQ ID NOs 65 and 66), FS 18-7-33/4420 (SEQ ID NOs 67 and 68, FS18-7- 36/4420 (SEQ ID NOs 69 and 70), FS 18-7-58/4420 (SEQ ID NOs 71 and 72), FS18-7- 62/4420 (SEQ ID NOs 73 and 74), FS 18-7-65/4420 (SEQ ID NOs 75 and 76), FS18-7- 78/4420 (SEQ ID NOs 77 and 78), FS 18-7-88/4420 (SEQ ID NOs 79 and 80) and FS18-7- 95/4420 (SEQ ID NOs 81 and 82) were prepared by replacing the CH3 domains of the monoclonal antibodies 4420 (with and without the LALA mutation) with the CH3 domains of the human LAG-3 specific Fcabs FS18-
  • the mouse anti-PD-L1 mAb (with and without LALA mutation) was prepared as described for mAb 84G09 in section 2.1 above using the heavy chain (SEQ ID NOs 122 and 123) and light chain (SEQ ID NO: 119) of mAb SL
  • the heavy chain of the mAb 2 molecules FS18-7-108-29/S1 (SEQ ID NOs 1 17 and 1 18) and FS18-7-108-35/S1 (SEQ ID NOs 120 and 121) were prepared by replacing the CH3 domains of the monoclonal antibodies S1 (with and without the LALA mutation) with the CH3 domains of the mouse LAG-3 specific Fcabs FS18- 7-108-29 and FS18-7-108-35 within Xhol and BamHI sites present in the sequence of the unmodified CH3 domain of human lgG1.
  • the heavy chain of the mAb 2 were co-transfected with the light chain of S1 as described for mAb 84G09 in section 2.1 above.
  • the proteins were then expressed and purified as described for mAb 84G09 in section 2.1 above.
  • Protein L (Thermo, 21189) was immobilized on flow cells 1 and 2 of a Series S CM5 chip (GE Healthcare, BR-1005-30) by amine coupling (GE Healthcare, BR-1000-50) to a surface density of 2000 RU by following the manufacturer's instructions for the BIAcore T200 instrument.
  • a Series S CM5 chip GE Healthcare, BR-1005-30
  • amine coupling GE Healthcare, BR-1000-50
  • a surface density of 2000 RU by following the manufacturer's instructions for the BIAcore T200 instrument.
  • LAG-3 binding the mAb 2 samples (all containing the LALA mutation) were captured on flow cell 2 only and human LAG-3Fc (R&D Systems, 2319-L3) at 4
  • the binding affinities for human PD-L1 and human LAG-3 were comparable for all the mAb 2 tested.
  • the mAb 2 binding affinities for human PD-L1 were comparable to 84G09, indicating that introduction of the LAG-3 binding site into the CH3 domain did not affect PD-L1 binding.
  • mAb 2 (FS18-7-09/84G09, FS18-7-32/84G09, FS18-7-33/84G09, FS18-7- 36/84G09, FS18-7-62/84G09, FS18-7-65/84G09, and FS18-7-78/84G09 all with the LALA mutation) to bind simultaneously to LAG-3 and PD-L1 was tested by SPR.
  • Human PD-L1 Fc R&D Systems, 156-B7 was immobilized on flow cell 2 of a Series S CM5 chip (GE
  • Flow cell 1 was activated and deactivated without any protein immobilised for background subtraction.
  • 10 ⁇ g/ml of mAb 2 was flowed across flow cells 1 and 2, at a flow rate of 10 ⁇ /min for 3 min.
  • 40 nM of LAG-3Fc was flowed across both flow cell 1 and 2 at a flow rate of 10 ⁇ /min for 3 min.
  • dissociation was followed for 3 min.
  • Sensor chip was regenerated after each cycle with a 15 s injection of 25 mM NaOH at a flow rate of 100 ⁇ /min.
  • Human Fey receptors were immobilized on a CM5 chip to a surface density of approximately 200 RU for Fey Rl (R&D Systems, 1257-FC) and Fey Rllla (R&D Systems, 4325-FC) and approximately 500 RU for Fey Rlla (R&D Systems, 1330-CD) and Fey Rllb/c (R&D Systems, 1875-CD), according to the manufacturer's instruction for the BIAcore3000 instrument.
  • 100 ⁇ g/ml of mAbs or mAb 2 were flowed across the chip for 3 min at a flow rate of 10 ⁇ /min and the dissociation was followed for 5 min.
  • Running buffer was PBS (Lonza, BE17-516F) + 0.05% (v/v) P20 surfactant (GE Healthcare, BR-1000-54).
  • the positive control was wild-type lgG1 4420-mAb.
  • Monoclonal lgG2 and lgG4 mAbs to irrelevant targets (20H4 and MOR7490) and mouse lgG1 (Sigma, P5305) were included as reference points. No regeneration was required due to the fast dissociation rates of the binding complexes.
  • concentration of mAb 2 was increased to 500 ⁇ g/ml to compensate for the weaker binding to these two receptors. The results are shown in Table 12.
  • Table 12 Binding response of anti-LAG-3/PD-L1 mAb 2 to human Fey receptors as determined by SPR
  • the LALA variant introduced into the mAb or mAb 2 reduces the ability of these molecules to bind human Fey receptors.
  • the human LAG-3 sequence (SEQ ID NO: 126) or cynomolgus LAG-3 sequence (SEQ ID NO: 128) were subcloned into pcDNA5FRT vector (Life Technologies, V6010-20) using Kpnl (NEB, R0142) and NotI (NEB, R0146) restriction digestion. The vector was then transformed into Flp-ln T-REx 293 HEK cell line (Life Technologies, R780-07) using Lipofectamine 2000 (Life Technologies, 1 1668-019).
  • Transformed Flp-ln T-REx 293 cells were grown in DMEM (Life Technologies, 61965-026) containing 10% FBS (Life Technologies, 10270-1-6), 100 ⁇ g/ml Hygromycin B (Melford Laboratories Ltd, Z2475), 15 ⁇ g/ml Blasticidin (Melford Laboratories Ltd, B1105) for 3-4 weeks until colonies of stably transformed cells were apparent. These colonies were amplified in the presence of 1 ⁇ g/ml Doxycyclin (Sigma, D9891) and tested for LAG-3 expression was confirmed by flow cytometry.
  • the affinity of the mAb 2 (all containing the LALA mutation) for cell expressed human or cynomolgus LAG-3 was determined using flow cytometry.
  • V-bottom 96-well plates (Costar, 3897) at 2x10 5 cells/well.
  • the plates were centrifuged at 1500 rpm for 3 min at 4 °C to pellet the cells.
  • a dilution series of the mAb 2 (or control mAb) were incubated with the cells in a 100 ⁇ volume for 1 h at 4 °C.
  • the plates were washed and secondary antibody (Anti-human Fc-488, Jackson ImmunoResearch, 109-546-098) was diluted 1 : 1000 in PBS and 100 ⁇ was added to the cells for 30 min at 4 °C (plates were kept in the dark).
  • the plates were washed and then cells were resuspended in 100 ⁇ PBS containing 1 ⁇ g/ml DAPI (Biotium, 40043). The plates were read using Canto II flow cytometer (BD Bioscience). Dead cells were excluded and the fluorescence in the FITC channel (488nm/530/30) was measured. The data was fit using log (agonist) vs response in GraphPad Prism Software. The plates were read on a BD FACSCanto II cytometer (BD Biosciences) and the data analysed using FlowJo. The results are shown in Table 13.
  • Table 13 Binding affinity of anti-LAG-3/PD-L1 mAb 2 to HEK cells expressing human or cynomolgus LAG-3 as determined by flow cytometry
  • results confirm mAb 2 binding to human and cynomologus LAG-3 expressed on HEK cells.
  • tested mAb 2 show better or equal binding to the human LAG-3 and at least two times better binding to the cynomologus LAG-3 when compared with control anti-LAG-3 antibody 25F7. No cross-reactivity with other proteins expressed on the surface of the HEK cell line was observed.
  • the human PD-L1 sequence (SEQ ID NO: 129) or cynomolgus PD-L1 sequence (SEQ ID NO: 131) were subcloned into pcDNA5FRT vector (Life Technologies, V6010-20) using Kpnl (NEB, R0142) and NotI (NEB, R0146) restriction digestion. The vector was then transformed into Flp-ln T-REx 293 HEK cell line (Life Technologies, R780-07) using Lipofectamine 2000 (Life Technologies, 1 1668-019).
  • Transformed Flp-ln T-REx 293 cells were grown in DMEM (Life Technologies, 61965-026) containing 10% FBS (Life Technologies, 10270-1 -6), 100 ⁇ g/ml Hygromycin B (Melford Laboratories Ltd, Z2475), 15 ⁇ g/ml Blasticidin (Melford Laboratories Ltd, B1 105) for 3-4 weeks until colonies of stably transformed cells were apparent. These colonies were amplified in the presence of 1 ⁇ g/ml Doxycyclin (Sigma, D9891) and LAG-3 expression was confirmed by flow cytometry.
  • the affinity of the mAb 2 (all containing the LALA mutation) binding to cell expressed human or cynomolgus PD-L1 or to parental (untransformed cells) was determined using flow cytometry.
  • HEK cells expressing human or cynomolgus PD-L1 grown in DMEM (Life trademark) was determined using flow cytometry.
  • a dilution series of the mAb 2 (or control mAb) was incubated with the cells in a 100 ⁇ volume for 1 h at 4 °C.
  • the plates were washed and secondary antibody (Anti-human Fc-488, Jackson ImmunoResearch, 109-546-098) was diluted 1 : 1000 in PBS and 100 ⁇ was added to the cells for 30 min at 4 °C (plates were kept in the dark).
  • the plates were washed then cells were resuspended in 100 ⁇ PBS containing 1 ⁇ g/ml DAPI (Biotium, 40043). The plates were read using Canto I I flow cytometer (BD Bioscience).
  • Table 14 Binding affinity of anti-LAG-3/PD-L1 mAb 2 to HEK cells expressing human or cynomolgus PD-L1 as measured by flow cytometry
  • the murine LAG-3 sequence (SEQ ID NO: 127) or murine PD-L1 sequence (SEQ ID NO: 130) were subcloned into pcDNA5FRT vector (Life Technologies, V6010-20) using Kpnl (NEB, R0142) and NotI (NEB, R0146) restriction digestion. The vector was then transformed into Flp-ln T-REx 293 HEK cell line (Life Technologies, R780-07) using Lipofectamine 2000 (Life Technologies, 1 1668-019).
  • Transformed Flp-ln T-REx 293 cells were grown in DMEM (Life Technologies, 61965-026) containing 10% FBS (Life Technologies, 10270-1-6), 100 ⁇ g/ml Hygromycin B (Melford Laboratories Ltd, Z2475), 15 ⁇ g/ml Blasticidin (Melford Laboratories Ltd, B1105) for 3-4 weeks until colonies of stably transformed cells were apparent. These colonies were amplified in the presence of 1 ⁇ g/ml Doxycyclin (Sigma, D9891) and LAG-3 or PD-L1 expression was confirmed by flow cytometry.
  • the affinity of the mAb 2 (all containing the LALA mutations) binding to cell expressed murine LAG-3 or murine PD-L1 was determined using flow cytometry.
  • the plates were centrifuged at 1500 rpm for 3 min at 4 °C to pellet the cells.
  • a dilution series of the mAb 2 (or control mAb) were incubated with the cells in a 60 ⁇ volume for 1 h at 4 °C.
  • the plates were washed and secondary antibody (Anti-human Fc-488, Jackson ImmunoResearch, 109-546-098 for mAb 2 or Anti-Rat IgG (H+L), Alexa Fluor 488, ThermoFisher, A-11006 for anti-LAG-3 control, C9B7W) was diluted 1 : 1000 in PBS and 50 ⁇ was added to the cells for 30 min at 4 °C (plates were kept in the dark).
  • the plates were washed then cells were resuspended in 50 ⁇ FACS Cell Fix (BD Bioscience, 340181) for 15 minutes, then washed and resuspended in 100 ⁇ PBS containing 1 ⁇ g/ml DAPI (Biotium, 40043). The plates were read using Canto II flow cytometer (BD Bioscience). Dead cells were excluded and the fluorescence in the FITC channel (488nm/530/30) was measured. The data was fit using log (agonist) vs response in GraphPad Prism Software. The plates were read on a BD FACSCanto II cytometer (BD Biosciences) and the data analysed using FlowJo. The results are shown in Table 15.
  • Table 15 Binding affinity of surrogate anti-mouse l_AG-3/PD-L1 mAb 2 to HEK cells expressing murine LAG-3 or murine PD-L1 by flow cytometry
  • the surrogate mAb 2 were able to bind to cell-expressed murine LAG-3 and to cell expressed murine PD-L1.
  • the binding affinity of the surrogate mAb 2 to cell expressed murine LAG-3 is approximately the same as the affinity of the anti-human LAG-3/PD-L1 mAb 2 to human LAG- 3 (2.3-3.8 nM compared to 2.5-4.2 nM) and the binding affinity of the surrogate mAb 2 to cell- expressed murine PD-L1 is within 3-fold the affinity of the anti-human LAG-3/PD-L1 mAb 2 to human PD-L1 (11.9-12.3 nM compared to 3.1-4.0 nM), demonstrating that these mAb 2 are suitable surrogates for the anti-human LAG-3/PD-L1 mAb 2 for use in vivo studies in mice.
  • Example 3 Activity of mAb 2 molecules in T cell activation assays and an SEB assay 3.1 T cell activation assay
  • IL-2 release assay based on the D01 1.10 OVA T-lymphocyte and LK35.2 B-lymphocyte hybridoma cell lines was used for functional screening of the mAb 2 .
  • IL-2 release is a marker of T cell activation.
  • T cells, expressing endogenous murine PD-1 were transfected with either empty vector (pLVX) or human LAG-3 construct.
  • B-cells were transfected with empty vector (pLVX) or human PD-L1 construct.
  • Lentiviral transduction methodology was used to generate DO11.10 cells (National Jewish Health) overexpressing human, cynomolgus or mouse LAG-3 using the Lenti-X HTX
  • Lenti-X expression vector (Cat. No 631253), containing the mouse LAG-3 cDNA (SEQ ID NO: 127), human LAG-3 cDNA (SEQ ID NO: 126) or cynomolgus LAG-3 cDNA (SEQ ID NO: 128), was co-transfected with a Lenti-X HTX Packaging Mix into the Lenti-X 293T Cell Line (Cat. No 632180) to generate virus.
  • the D01 1.10 cell line was transduced using the lentiviral vectors produced with the Lenti-X HTX Packaging System. Production of antigen presenting cells over-expressing PD-L1
  • Lentiviral transduction methodology was used to generate LK35.2 B cell lymphoma (ATCC, HB-98) overexpressing human, cynomolgus or mouse PD-L1 using the Lenti-X HTX
  • Lenti-X expression vector (Cat. No 631249) (Cat. No 631253), containing the mouse PD-L1 cDNA (SEQ ID NO: 130), human PD-L1 cDNA (SEQ ID NO: 129 or cynomolgus PD-L1 cDNA (SEQ ID NO: 131), was co-transfected with a Lenti-X HTX Packaging Mix into the Lenti-X 293T Cell Line (Cat. No 632180) to generate virus. The LK35.2 cell line was transduced using the lentiviral vectors produced with the Lenti-X HTX Packaging System.
  • DMEM Gibco, 61965-026
  • FBS Gibco, 10270-106
  • 1 mM Sodium Pyruvate Gibco, 1 1360-070
  • 1 g/ml puromycin Gibco, A1 1138-03
  • Experimental medium complete DO1 1.10 culture medium without puromycin.
  • DO11.10 hl_AG-3 DO11.10 T cell hybridoma transduced with a lentiviral vector to overexpress human LAG-3;
  • DO11.10 pLVX DO1 1.10 T cell hybridoma transduced with an empty lentiviral
  • DO11.10 cLAG-3 DO11.10 T cell hybridoma transduced with a lentiviral vector to overexpress cynomolgus LAG-3.
  • LK 35.2 hPD-L1 B cell hybridoma transduced with a lentiviral vector containing hPD- L1 to overexpress human PD-L1 ;
  • PLVX B cell hybridoma transduced with an empty lentiviral (pLVX) vector
  • LK 35.2 cPD-LI B cell hybridoma transduced with a lentiviral vector to overexpress cynomolgus PD-L1.
  • DO11.10 cells (either DO11.10 pLVX cells or DO1 1.10 h LAG-3 cells) at 0.3 x 10 6 cells/ml were mixed at a 1 : 1 ratio with antibodies at 3 x final concentration. Antibodies and DO11.10 cells were incubated at 37° C, 5% C0 2 for 1 hour.
  • LK 35.2 cells (both pLVX and PD-L1- pLVX) were incubated at 3x10 5 cells/ml experimental media with the OVA peptide at 1.5 ⁇ for 30 min.
  • LK 35.2 cells + OVA were added to D01 1.10 cells/treatment mix at a 1 :2 ratio in the following combinations: Human functional screen
  • the concentration of mlL-2 was plotted vs the log concentration of Fcab or mAb and the resulting curves were fitted using the log (agonist) vs response equation in GraphPad Prism.
  • Table 16 shows the EC50 values and the maximal IL-2 release of the mAb 2 and control mAbs, calculated as a percentage of the control (84G09 + 25F7).
  • Figure 2A-F show representative plots of IL-2 release by the panel of cell lines treated with FS18-7-9/84G09, FS18-7-62/84G09, or FS18- 7-78/84G09, and controls.
  • FS18-7-9/84G09 containing the LALA mutation
  • Figure 3 A-C show the results in the panel of three cell based assays.
  • FS18-7-9/84G09 was able to induce T cell activation in the presence of both cl_AG-3 + cPD-L1 and cLAG-3 or cPD-L1 alone, indicating that the mAb 2 are functionally cynomolgus cross-reactive and therefore suitable for use in primate based safety studies.
  • Staphylococcal Enterotoxin B assay Three mAb 2 (all containing the LALA mutation) were tested in the human-PBMC based Staphylococcal Enterotoxin B assay (SEB assay). Staphylococcal Enterotoxin B is a superantigen, and binds to MHC class II molecules on antigen presenting cells (APCs) and the ⁇ chain of the T cell receptor (TCR), causing non-specific activation of T cells and cytokine release. There is no requirement for antigen to be present to see T cell activation.
  • the SEB assay uses stimulated human cells (PBMCs) with physiological levels of checkpoint inhibitors, and can be used to confirm that T cell activation is enhanced by the mAb 2 in a human system. Three mAb 2 were tested in the SEB system with cells coming from four different donors. Generation of expanded T cells
  • PMBCs were isolated from leukocyte cones by Ficoll gradient seperation.
  • CD4+ T cells were isolated using human CD4+ T Cell Isolation Kit (Miltenyi Biotec Ltd, 130-096-533) according to the manufacturer's instruction.
  • Human T-Activator CD3/CD28 Dynabeads (Life Technologies Inc.
  • CD4+ T cells at 1.0 x10 6 cells/ml in RPMI with 10% FBS and 1x Penicillin Streptomycin Solution and 50 lU/ml recombinant human IL2 (Peprotech, 200-02-50ug ) with 3: 1 bead to cell ratio were transferred to T75 flask (Greiner Bio-one, 690195) and incubated at 37°C + 5% C0 2 . After 3 days the cells were gently resuspended and counted. The cell density was maintained between 0.8-1 x 10 6 cells/ml by adding fresh media (RPMI-10% FBS + Penicillin
  • monocytes were isolated from human PBMCs using human Pan Monocyte Isolation Kit, (Miltenyi Biotec Ltd, 130-096-537) following the manufacturer's instructions. Monocytes were differentiated to iDCs using human Mo-DC Differentiation Medium (Miltenyi Biotec Ltd, 130-094-812) following the manufacturer's instructions.
  • Expanded T cells were thawed one day before the experiment, washed with AIM medium (Gibco, 12055-091) and incubated at 37°C, 5% C0 2 overnight at 1x10 6 cells/ml in AIM medium. 2 ⁇ concentration of each antibody/mixture was prepared in DPBS (Gibco, 14190-169) and diluted 1 : 10 in medium (30 ⁇ + 270 ⁇ ) to obtain 200 nM. In a 96 well plate, serial dilutions were carried out at 1 :10 (30 ⁇ + 270 ⁇ experimental medium; 2x final cone).
  • MoiDCs were thawed, washed with AIM medium and mixed with T cells from the same donor at a 1 :10 ratio (5 ml of iDCs at 2x10 5 cells/ml were combined with 5ml of T cells at 2x10 6 cells/ml). 20 ⁇ of SEB (Sigma, S4881) at 0.1 was added to 10 ml of the cells.
  • the assay was performed according to the kit manufacturer's instructions using supernatants diluted 1 :30 with PBA (DPBS, 2% BSA (Sigma, A7906- 100G)).
  • the concentration of human IFN Y was plotted vs the log concentration of mAb 2 or mAb and the resulting curves were fitted using the log (agonist) vs response equation in GraphPad Prism software.
  • Table 17 shows the EC50 values and the span of the I FNy release in the SEB assay with cells from four different cell donors (Donors A to D).
  • Figure 4 shows a representative plot of the SEB assay with a single donor.
  • Table 17 ECso values calculated for six mAb 2 based on six SEB assays with 4 different cell donors.
  • Example 4 In vivo activity of mAb 2 molecules in murine tumour models
  • the MC38 syngeneic tumour model was used in this experiment as MC38 tumours are known to express PD-L1 on their cell surface and to be highly immunogenic resulting in increased LAG-3 expression on immune cells in the tumour and tumour periphery.
  • the surrogate mouse mAb 2 FS18-7-108-29/S1 containing the LALA mutation (SEQ ID NO: 1 17 and 119) referred to as FS18-29/S1 was tested for in vivo activity using a MC38 syngeneic mouse tumour growth model.
  • the ability of the mAb 2 to inhibit tumour growth was compared to that of the LAG-3/mock mAb 2 , FS18-7-108-29/4420 containing the LALA mutation (SEQ ID NO: 132 and 85) referred to as FS18-29/4420, the benchmark anti-LAG-3 mAb C9B7W (2B scientific; Catalogue Number BE0174-50MG), the benchmark anti-PD-L1 mAb S1 containing the LALA mutation (SEQ ID NO: 122 and 119) and to a combination of mAbs C9B7W and Sl
  • mice C57BL/6 female mice (Charles River) aged 8-10 weeks and weighing 20-25 g each were rested for one week prior to the study start. All animals were micro-chipped and given a unique identifier. Each cohort had 10 mice.
  • the MC38 colon carcinoma cell line S.
  • MC38 cells were thawed from -150 °C storage and added to 20 ml DM EM (Gibco, 61965- 026) with 10% FCS (Gibco, 10270-106) in a T175 tissue culture flask. Mice were anaesthetised using isoflurane (Abbott Laboratories) and each animal received 2x10 6 cells injected subcutaneously in the left flank. 7-8 days following tumour cell inoculation, mice which did not have tumours at this point were removed from the study.
  • mAb 2 molecules and the control_antibodies were analysed within 24 hours prior to injection by SEC-HPLC profiling and checked for impurities. Antibodies were prepared at a final concentration of 10 mg/kg in PBS and combined with a second antibody in the combination studies.
  • the mAb 2 molecules and the control antibodies were administered to the mice by intraperitoneal (IP) injection on days 8, 11 , and 14 following tumour inoculation. Accurate measurements of tumours were taken, any drug dosing due on the day in question was performed, and the mice subjected to close observation for the remainder of the trial. Tumour volume measurements were taken with callipers to determine the longest axis and the shortest axis of the tumour. The following formula was used to calculate the tumour volume:
  • the surrogate mAb 2 FS18-29/S1 also had a marked effect on tumour growth preventing the establishment in 6 of 8 growing MC38 tumours, and slowing the growth of the remaining 2.
  • Administration of the benchmark anti-LAG-3 and PD-L1 antibodies in combination slowed tumour growth in 7 animals with no animals being tumour free.
  • FS18-29/4420 alone had no marked effect on tumour growth, indicating that for maximal efficacy, the mAb 2 requires the anti-PD-L1 Fab.
  • the benchmark anti-mouse LAG-3 antibody alone had little or no effect on resulting tumour growth while the benchmark anti-mouse PD- L1 prevented establishment of 1 of 7 tumours in this cohort, and had some overall effect of slowing tumour growth.
  • Syngeneic mouse models are accepted as appropriate murine systems for testing the anti- tumour effect of inhibiting therapeutic targets and have been used extensively to validate development of human therapeutics.
  • the surrogate mouse mAb 2 FS18-7-108-29/S1 containing the LALA mutation, (SEQ ID NO: 1 17 and 119) referred to as FS18-29/S1 was tested for in vivo activity in a MC38 syngeneic mouse tumour growth model.
  • the ability of the mAb 2 to inhibit tumour growth was compared to that of the LAG-3/mock mAb 2 , FS18-7-108-29/4420 containing the LALA mutation (SEQ ID NO: 132 and 85), referred to as FS18-29/4420, the benchmark LAG-3 mAb C9B7W, the benchmark PD-L1 mAb S1 containing the LALA mutation (SEQ ID NO: 122 and 119) and to a combination of C9B7W and S1.
  • C57BL/6 female mice (Charles River) aged 8-10 weeks and weighing 20-25 g each were rested for one week prior to the study start. All animals were micro-chipped and given a unique identifier. Each cohort had 10 mice.
  • the MC38 colon carcinoma cell line S.
  • MC38 cells (approximately 3-5x10 6 ) was thawed from -150 °C storage and added to 20 ml DMEM (Gibco, 61965-026) with 10% FCS (Gibco, 10270-106) in a T175 tissue culture flask. Mice were anaesthetised using isofluorane (Abbot Laboratories) and 2x10 6 cells in 100 ⁇ were injected subcutaneously into the left flank of each mouse. 7-8 days following tumour cell inoculation, mice were routinely monitored for health and tumour growth appropriate for initiation of the study. When the majority of mice exhibited tumours of 5-10 mm diameter, they were sorted and randomised back into study cohorts. Any mice which did not have appropriately sized tumours at this point were removed from the study.
  • mAb 2 molecules and the control_antibodies were analysed within 24 hours prior to injection by SEC-HPLC profiling and checked for impurities. Antibodies were prepared at a final concentration of 10 mg/kg in PBS and combined with the second antibody for the combination studies.
  • the mAb 2 molecules and the control_antibodies were administered to the mice on days 15, 18, and 21 following tumour inoculation by IP injection. Animals were health screened under anaesthesia three times a week in a blinded fashion, during which time accurate measurements of tumours were taken. Tumour volume measurements were taken with callipers to determine the longest axis and the shortest axis of the tumour. The formula used to calculate the tumour volume was as set out in section 4.1 above.
  • tumour growth in syngeneic tumour models in mice is best accomplished through therapeutic intervention at early time points (starting tumour volumes of less than 40mm 3 ). The later the intervention is administered, the more difficult it is to observe positive effects with respect to tumour growth, though perhaps this is more akin to the situation in the human clinical setting.
  • FS18-29/S1 had a positive effect in both suppressing tumour growth and preventing the establishment of MC38 colon carcinoma in immune competent mice when given at early time points in C57BL/6 mice.
  • FS18-29/S1 was just as effective in suppressing tumour growth as the combination of benchmark antibodies.
  • FS18-29/4420 alone had no noticeable impact on tumour growth and S1 and C9B7W both had a mild effect on resulting tumour growth.
  • CT26 syngeneic tumour model was used in this experiment as CT26 tumours are known to express PD-L1 on their cell surface and to be highly immunogenic resulting in increased LAG-3 expression on immune cells in the tumour and periphery.
  • the ability of the mAb 2 to inhibit tumour growth was compared to that of the LAG-3/mock mAb 2 , FS 18-7- 108-29/4420 containing the LALA mutation (SEQ ID NO: 132 and 85), referred to as FS18-29/4420, and FS 18-7- 108-35/4420 containing the LALA mutation (SEQ ID NO: 133 and 85), referred to as FS18-35/4420, the benchmark LAG-3 mAb C9B7W, the benchmark PD-L1 mAb S1 containing the LALA mutation (SEQ ID NO: 122 and 119) and to a combination of C9B7W and S1.
  • mice were thawed from -150 °C storage and added to 20 ml DM EM (Gibco, 61965-026) with 10% FCS (Gibco, 10270-106) in a T175 tissue culture flask. 7-8 days following tumour cell inoculation, mice were routinely monitored for health and tumour growth appropriate for initiation of the study. When the majority of mice exhibited tumours with a diameter of 3-5 mm 3 , they were sorted and randomised back into study cohorts. Any mice which did not have tumours at this point were removed from the study.
  • mAb 2 molecules and the control antibodies were analysed within 24 hours of injection by SEC-HPLC profiling and checked for impurities.
  • Antibodies were prepared at a final concentration of 10 mg/kg in PBS and combined with a second antibody in the combination studies.
  • the mAb 2 molecules and the control_antibodies were administered to the mice on days 8, 11 , and 14 following tumour inoculation. Animals were health screened during which time accurate measurements of tumours were taken. Tumour volume measurements were taken with callipers to determine the longest axis and the shortest axis of the tumour. The formula used to calculate the tumour volume was as set out in section 4.1 above:
  • the CT26 tumour model is an aggressive, fast growing tumour model, one that is inherently prone to mice developing intestinal metastasis, and as a result has a very limited therapeutic window.
  • FS18-7-108-29/S1 LALA and FS18-7-108-29/S1 were tested to examine potential differences in anti-tumour activity of these mAb 2 with and without the LALA mutation in the Fc region.
  • the surrogate mouse mAb 2 FS18-7-108-29/S1 referred to as FS18-29/S1 with (SEQ ID NO: 1 17 and 119) and without LALA mutation (SEQ ID NO: 118 and 119) were tested for in vivo activity using a MC38 syngeneic mouse tumour growth model.
  • the ability of the mAb 2 to inhibit tumour growth was compared to that of the LAG- 3/mock mAb 2 , FS18-7-108-29/4420 with (SEQ ID NO: 132 and 85) and without LALA mutation (SEQ ID NO: 134 and 85) referred to as FS18-29/4420LALA and FS18-29/4420 and a combination of the LAG-3/mock mAb 2 with and without LALA mutation with the benchmark PD-L1 mAb S1 with (SEQ ID NO: 122 and 1 19) and without the LALA mutation (SEQ ID NO: 123 and 1 19).
  • mice C57BL/6 female mice (Charles River) aged 8-10 weeks and weighing 20-25 g each were rested for one week prior to the study start. All animals were micro-chipped and given a unique identifier. Each cohort had 10 mice.
  • the MC38 colon carcinoma cell line S.
  • MC38 cells (approximately 3-5x10 6 ) were thawed from -150 °C storage and added to 20 ml DMEM (Gibco, 61965-026) with 10% FCS (Gibco, 10270-106) in a T175 tissue culture flask. Mice were anaesthetised using isofluorane (Abbot Laboratories) and 2x10 6 cells in 100 ⁇ were injected subcutaneously into the left flank of each mouse. Mice were allowed to recover under observation and the inoculation date noted as Day 0. 7-8 days following tumour cell inoculation, mice were routinely monitored for health and tumour growth appropriate for initiation of the study. Any mice which did not have tumours at this point were removed from the study.
  • mAb 2 molecules and the control_antibodies were analysed within 24 hours prior to injection by SEC-HPLC profiling and checked for impurities.
  • Antibodies were prepared at a final concentration of 10 mg/kg in PBS and combined with a second antibody in the combination studies.
  • the mAb 2 molecules and the control antibodies were administered to the mice on days 8, 11 , and 14 following tumour inoculation by IP injection. Animals were health screened under anaesthesia three times a week in a blinded fashion, during which time accurate measurements of tumours were taken. Tumour volume measurements were taken with callipers to determine the longest axis and the shortest axis of the tumour. The formula used to calculate the tumour volume was as set out in section 4.1.
  • mice All mice were humanely sacrificed and the tumours were excised and weighed. The results are shown in Figures 11 and 12.
  • FS18-29/S1 The mechanism by which the surrogate mouse mAb 2 FS18-7-108-29/S1 containing the LALA mutation, (SEQ ID NOs: 117 and 1 19) referred to as FS18-29/S1 led to decreased tumour burden was tested in a MC38 syngeneic mouse tumour growth model expressing ovalbumin (MC38.0VA).
  • FS18-29/S1 The effect of FS18-29/S1 was compared to that of the LAG-3/mock mAb 2 , FS 18-7- 108-29/4420 containing the LALA mutation (SEQ ID NOs: 132 and 85), referred to as FS18-29/4420, the benchmark PD-L1 mAb S1 containing the LALA mutation (SEQ ID NOs: 122 and 1 19) and to a combination of FS18-29/4420 and S1.
  • tumour cell implantation On the day of implant, cultured MC38.0VA cells were harvested during log phase growth (Confluency -75%) and resuspended in PBS at a concentration of 1 x 10 7 cells/mL. Tumours were initiated by first anesthetizing each animal with isoflurane, then subcutaneously implanting 1 x 10 6 MC38.0VA cells (0.1 ml_ suspension) into the left flank of each test animal. Eleven days after tumour cell implantation animals were randomised, using a deterministic randomisation method, into five groups with individual tumour volumes of 32 to 62.5 mm 3 .
  • TILs were examined for l_AG-3 expression after the third dose of antibody/mAb 2 had been administered, when a separation in the growth of the tumour between control and mAb 2 treatments is seen but before there is a large difference between tumour sizes which might skew results.
  • l_AG-3 expression on TILs was found to be markedly decreased in animals treated with the mAb 2 FS18-29/S1 or with the combination of FS18-29/4420 and S1.
  • LAG-3 expression on CD8, CD4 and FoxP3 tumour infiltrating lymphocytes (TILs) was decreased after treatment with FS18-29/S1 at day 19 and 23 after tumour inoculation, which
  • TILs Once the TILs become activated, they are able to recognise neo-antigens expressed by the tumour and mount a response against it. This is therefore thought to be the mechanism by which treatment with anti-LAG3/PD-L1 mAb 2 results in a reduction in the tumour burden.
  • Cytotoxicity activity of mAb 2 lgG1 antibodies usually exhibit effector functions via conserved interaction sites within the constant region of the molecule. These include Antibody Dependent Cellular Cytotoxicity (ADCC), mediated by binding to FcvR expressed on Monocytes/Macrophages, dendritic cells, NK cells, neutrophils and other granulocytes, and Complement Dependent Cytotoxicity (CDC), mediated by induction of the complements cascade initiated by binding to C1 q complement component. Since LAG-3 is predominantly expressed on activated T cells and PD-L1 is expressed on these but also on tumour cells at high levels, the ability of mAb 2 FS18-7-9/84G09 (SEQ ID NOs 94 and 116) to induce ADCC and CDC was investigated.
  • ADCC Antibody Dependent Cellular Cytotoxicity
  • CDC Complement Dependent Cytotoxicity
  • FS18-7-9/84G09 treatment of LAG-3 or PD-L1 expressing cells, followed by incubation with either NK cells or complement, induces lysis of the respective target cells.
  • FS18-7-9/84G09 is a bispecific antibody, it was also tested whether target engagement on one of the specificities affects effector function towards cells expressing the target for the other specificity.
  • mAb 2 FS18-7-9/84G09 Understanding the effector functions of mAb 2 FS18-7-9/84G09 is useful for a number of reasons, including determining whether a mutation which reduces effector functions, such as the LALA mutation, should be included in the molecule to protect LAG-3 expressing effector T cells engaged in tumour killing from FS18-7-9/84G09-mediated ADCC and/or CDC.
  • Raji cells recombinantly expressing LAG-3 or PD-L1 were used for all assays, using their endogenous expression of CD20 as a control for targeting with a generic version of
  • ADCC activity towards LAG-3 or PD-L1 expressing cells was measured using NK cells isolated from frozen PBMC and LDH release measured colourimetrically (CytoTox 96 by Promega).
  • Rituximab in various isotypes and Fc configurations was used as a control. No reliable method for measuring ADCC differentially is known, so differential ADCC activity was not measured.
  • the PD-L1 specific mAb (84G09) and the LAG-3 specific mAb (25F7) were used as controls.
  • An IgG isotype control (4420) which was either used as negative control or to generate the CDC background activity was also used.
  • the LALA versions of the respective antibodies and mAb 2 (excluding 25F7) were also compared to the lgG1 wild-type versions in the CDC and ADCC assays to determine the effect of this mutation on these effector functions.
  • Control wells containing the IgG (4420 LALA) at the highest concentration used were also prepared.
  • Cell suspensions of Raji cells recombinantly expressing LAG-3 or PD-L1 respectively, were prepared in serum free medium for the LDH release assay and added to an equal volume of the prepared antibodies/mAb 2 .
  • cell suspensions of 5 x 10 7 cells were prepared and resuspended in either 0.5 ⁇ CellTracker deep red (CellTrackerTM Deep Red, Thermo Fisher, #C34565) or 5 ⁇ for CellTracker Green (CellTrackerTM Green CM FDA (5- chloromethylfluorescein diacetate, Thermo Fisher, # C7025) in serum free medium. After a 30 min incubation at 37°C, cells were washed in serum free medium and either added to the prepared antibody/mAb 2 -containing wells directly, or combined with the other differentially stained cell line at equal volumes and then added to the antibody/mAb 2 -containing wells as described above.
  • the dead cell dye SYTOX® Blue Dead Cell Stain, Thermo Fisher, #S34857
  • Flow Cytometry was performed on a Cytoflex flow cytometer gating on the intact cell populations based on FSC and SSC and detecting the percentage of Sytox positive cells (channel PB450) of both the CellTrackerTM Deep Red positive and the CellTrackerTM Green CM FDA positive cell populations.
  • ADCC Antibody-Dependent Cell Cytotoxicity Using Lactate Dehydrogenase (LDH) Measurement in Glycosylation Engineering of Biopharmaceuticals: Methods and Protocols, Methods in Molecular Biology. New York: Springer Science + Business Media. Volume 988, pp 305-317) . Briefly, target cells were pre-incubated with the antibodies before adding primary NK cells isolated from human PBMCs (NK cell isolation kit, Miltenyi Biotec, 130-092-657) at a ratio of 20 to 1 for 4 hrs.
  • NK cell isolation kit Miltenyi Biotec, 130-092-657
  • cytotoxicity assay was performed following manufacturer's instructions (CytoTox 96 Non-Radioactive Cytotoxicity Assay, Promega, G1780). % lysis was calculated based on 100% target cell lysis, taking into account spontaneous lysis of effector and target cells. 6.3 Results and conclusions
  • PD-L1 expressing Raji cells were targeted by the anti-CD20 antibody Rituximab, which resulted in a maximum lysis of ⁇ 60% when measuring CDC by generic LDH release.
  • Anti- PD-L1 antibody 84G09 (which comprises the F(ab) 2 portion of mAb 2 FS18-7-9/84G09), and FS18-7-9/84G09 in lgG1 format, showed higher maximum lysis and also higher lysis potency, with estimated half maximal doses of about half of that required by Rituximab in lgG1 format.
  • LAG-3 expressing Raji cells were targeted for CDC by the anti-CD20 antibody Rituximab, however, the LAG-3 antibody 25F7 showed even better potency with an estimated half maximal dose of about half of that required for Rituximab. None of the other antibodies showed any CDC activity against LAG-3 expressing Raji cells, including FS18-7-9/84G09. The introduction of the LALA mutation had very limited effect on the CDC activity of
  • a differential CDC assay employing flow cytometry, was developed by the inventors to distinguish which target expressing cells were lysed when treated with FS18-7-9/84G09 or control antibodies. This assay was used to confirm the results from the basic LDH release CDC assay described above. Compared to the IgG isotype control antibody (4420), which had no effect on the percentage of live cells, Rituximab mediated a reduction of live cells and an increase of dead cells, both of PD-L1 and LAG-3 expressing cells. However, FS18-7- 9/84G09 had no effect on LAG-3 expressing cells, but very efficiently lysed PD-L1 expressing cells.
  • the mixture of the LAG-3 specific antibody 25F7 and the PD-L1 antibody 84G09 also showed a dose-dependent decrease in live cells and a reciprocal increase in dead cells, however, the maximal lysis of LAG-3 expressing cells was only just over 50% of cells, but was reached already at a concentration around 1 nM, the lowest dose to achieve maximal lysis of all antibodies tested.
  • this experiment shows that the presence of LAG-3 expressing cells has no effect on the CDC activity of FS18-7-9/84G09 towards PD- L1 expressing cells. The results are shown in Figure 15.
  • PD-L1 expressing Raji cells were targeted for ADCC by the anti-CD20 antibody Rituximab, FS18-7-9/84G09, and 84G09 with very similar efficacy and potency, resulting in a maximum lysis of around 40% of cells.
  • Rituximab and 84G09 containing the LALA mutation showed no ADCC-mediated lysis and FS18-7-9/84G09 containing the LALA mutation showed no or very low ADCC-meditated lysis of PD-L1 expressing target cells.
  • the LAG-3 specific antibody 25F7 and the isotype control 4420 with and without the LALA mutation showed no activity in this assay.
  • LAG-3 expressing Raji cells were targeted by Rituximab and 25F7 for ADCC-mediated lysis, resulting in maximum lysis of about 40%.
  • FS18-7-9/84G09 also mediated lysis of LAG-3 expressing cells by ADCC, be it with a much lower potency and efficacy, only reaching just under 20% lysis at 2.5 nM concentration.
  • the introduction of the LALA mutation abrogated all ADCC activity of Rituximab and FS18-7-9/84G09. 84G09 and the isotype control 4420 with and without the LALA mutation showed no ADCC activity in this assay as expected, as these antibodies do not bind LAG-3 ( Figure 16B). Sequence listing
  • Amino acid seguence anti-mouse LAG-3 Fcab FS18-7-108-29 comprising LALA mutation (underlined) (SEQ I D NO: 59)
  • the CH3 domain is shown in italics.
  • the AB, CD and EF loops of the CH3 domain are shown in bold and underlined.
  • the CH3 domain is shown in italics.
  • the AB, CD and EF loops of the CH3 domain are shown in bold and underlined.
  • the CH3 domain is shown in italics.
  • the AB, CD and EF loop regions are shown in bold and underlined.
  • Amino acid sequence of the anti-mouse LAG-3 Fcab FS18-7-108-35 without LALA mutation SEQ ID NO: 62
  • the CH3 domain is shown in italics.
  • the AB, CD and EF loop regions are shown in bold and underlined.
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS18-7-9/4420 comprising LALA mutation (SEQ ID NO: 63)
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS 18-7-32/4420 comprising LALA mutation (SEQ ID NO: 651
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS18-7- 32/without LALA mutation (SEQ ID NO: 66)
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS 18-7-33/4420 comprising LALA mutation (SEQ ID NO: 67)
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS 18-7-33/4420 without LALA mutation (SEQ ID NO: 68)
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS 18-7-36/4420 comprising LALA mutation (SEQ ID NO: 69)
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS 18-7-36/4420 without LALA mutation (SEQ ID NO: 70)
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS 18-7-58/4420 without LALA mutation (SEQ ID NO: 72)
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS 18-7-62/4420 comprising LALA mutation (SEQ ID NO: 73)
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS 18-7-65/4420 comprising LALA mutation (SEQ ID NO: 751
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS 18-7-65/4420 without LALA mutation (SEQ ID NO: 76)
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS 18-7-78/4420 without LALA mutation (SEQ ID NO: 78)
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS 18-7-88/4420 comprising LALA mutation (SEQ ID NO: 79)
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS 18-7-95/4420 comprising LALA mutation (SEQ ID NO: 811
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the heavy chain of anti-human LAG-3/FITC mAb 2 FS 18-7-95/4420 without LALA mutation (SEQ ID NO: 82)
  • Position of the CDRs are underlined. Position of LALA mutation is in bold. EVKLDETGGGLVQPGRPMKLSCVASGFTFSDYWMNWVRQSPEKGLEWVAQIRNKPYNYETYYSDS
  • Amino acid sequence of the anti-FITC mAb 4420 light chain (SEQ ID NO: 85)
  • LCDR2 VASSLQS (SEQ ID NO: 140) LCDR3 QQSYSNPIT (SEQ ID NO: 141)
  • Amino acid sequence of the anti-PD-L1 antibody 84G09 VL domain (SEQ ID NO: 93)
  • Amino acid sequence of the anti-human LAG-3/PD-L1 mAb 2 FS18-7-9/84G09 with LALA mutation heavy chain (SEQ ID NO: 94)
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the anti-human LAG-3/PD-L1 mAb 2 FS18-7-32/84G09 with LALA mutation heavy chain (SEQ ID NO: 96)
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the anti-human LAG-3/PD-L1 mAb 2 FS18-7-32/84G09 heavy chain (SEQ ID NO: 97)
  • Amino acid sequence of the anti-human LAG-3/PD-L1 mAb 2 FS18-7-33/84G09 with LALA mutation heavy chain (SEQ ID NO: 98)
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the anti-human LAG-3/PD-L1 mAb 2 FS18-7-33/84G09 heavy chain (SEQ ID NO: 99)
  • Amino acid sequence of the anti-human LAG-3/PD-L1 mAb 2 FS18-7-36/84G09 with LALA mutation heavy chain (SEQ ID NO: 100)
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the anti-human LAG-3/PD-L1 mAb 2 FS18-7-36/84G09 heavy chain (SEQ ID NO: 101)
  • Amino acid sequence of the anti-human LAG-3/PD-L1 mAb 2 FS18-7-58/84G09 with LALA mutation heavy chain (SEQ ID NO: 102)
  • Position of the CDRs are underlined, and the AB, CD, and EF loop sequences are in bold and underlined. Position of LALA mutation is in bold.
  • Amino acid sequence of the anti-human LAG-3/PD-L1 mAb 2 FS18-7-62/84G09 with LALA mutation heavy chain (SEQ ID NO: 104)

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Mycology (AREA)
  • Microbiology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Oncology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicinal Preparation (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Transition And Organic Metals Composition Catalysts For Addition Polymerization (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
PCT/EP2017/065073 2016-06-20 2017-06-20 Binding molecules binding pd-l1 and lag-3 Ceased WO2017220569A1 (en)

Priority Applications (25)

Application Number Priority Date Filing Date Title
KR1020237006538A KR102664891B1 (ko) 2016-06-20 2017-06-20 Pd-l1 및 lag-3에 결합하는 결합 분자
BR112018076519A BR112018076519A8 (pt) 2016-06-20 2017-06-20 Moléculas de ligação que se ligam a pd-l1 e lag-3
EP17752291.9A EP3472207B1 (en) 2016-06-20 2017-06-20 Binding molecules binding pd-l1 and lag-3
HRP20210602TT HRP20210602T1 (hr) 2016-06-20 2017-06-20 Vezujuće molekule koje vežu pd-l1 i lag-3
EP20213956.4A EP3858858A1 (en) 2016-06-20 2017-06-20 Binding molecules binding pd-l1 and lag-3
CN201780048977.2A CN109563171B (zh) 2016-06-20 2017-06-20 结合pd-l1和lag-3的结合分子
IL263730A IL263730B2 (en) 2016-06-20 2017-06-20 Binding molecules that bind PD-L1 and LAG-3
PL17752291T PL3472207T3 (pl) 2016-06-20 2017-06-20 Wiążące cząsteczki wiążące się z PD-L1 i LAG-3
MX2018016320A MX2018016320A (es) 2016-06-20 2017-06-20 Moleculas de union que se unen a (pd-l1) y (lag-3).
LTEP17752291.9T LT3472207T (lt) 2016-06-20 2017-06-20 Surišančios molekulės, kurios suriša pd-l1 ir lag-3
AU2017283181A AU2017283181B2 (en) 2016-06-20 2017-06-20 Binding molecules binding PD-L1 and LAG-3
SI201730684T SI3472207T1 (sl) 2016-06-20 2017-06-20 Vezavne molekule, ki vežejo PD-L1 in LAG-3
RU2018143241A RU2784388C9 (ru) 2016-06-20 2017-06-20 СВЯЗЫВАЮЩИЕ МОЛЕКУЛЫ, СВЯЗЫВАЮЩИЕ PD-L1 и LAG-3
US16/311,604 US11214620B2 (en) 2016-06-20 2017-06-20 Binding molecules binding PD-L1 and LAG-3
KR1020197001122A KR20190019144A (ko) 2016-06-20 2017-06-20 Pd-l1 및 lag-3에 결합하는 결합 분자
RS20210453A RS61705B1 (sr) 2016-06-20 2017-06-20 Vezujući molekuli koji vezuju pd-l1 i lag-3
ES17752291T ES2858091T3 (es) 2016-06-20 2017-06-20 Moléculas de unión que se unen a PD-L1 y LAG-3
JP2019518147A JP7085709B2 (ja) 2016-06-20 2017-06-20 Pd-l1及びlag-3に結合する結合分子
SG11201811064TA SG11201811064TA (en) 2016-06-20 2017-06-20 Binding molecules binding pd-l1 and lag-3
CA3027612A CA3027612A1 (en) 2016-06-20 2017-06-20 Binding molecules binding pd-l1 and lag-3
DK17752291.9T DK3472207T3 (da) 2016-06-20 2017-06-20 Bindingsmolekyler, der binder pd-l1 og lag-3
SM20210213T SMT202100213T1 (it) 2016-06-20 2017-06-20 Molecole leganti che legano pd-1 e lag-3
CY20211100319T CY1124232T1 (el) 2016-06-20 2021-04-13 Συνδετικα μορια συνδεσης pd-l1 και lag-3
US17/533,230 US20220185894A1 (en) 2016-06-20 2021-11-23 Binding molecules binding pd-l1 and lag-3
JP2022052202A JP7464644B2 (ja) 2016-06-20 2022-03-28 Pd-l1及びlag-3に結合する結合分子

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201662352482P 2016-06-20 2016-06-20
US62/352,482 2016-06-20

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/311,604 A-371-Of-International US11214620B2 (en) 2016-06-20 2017-06-20 Binding molecules binding PD-L1 and LAG-3
US17/533,230 Continuation US20220185894A1 (en) 2016-06-20 2021-11-23 Binding molecules binding pd-l1 and lag-3

Publications (1)

Publication Number Publication Date
WO2017220569A1 true WO2017220569A1 (en) 2017-12-28

Family

ID=59631719

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2017/065073 Ceased WO2017220569A1 (en) 2016-06-20 2017-06-20 Binding molecules binding pd-l1 and lag-3

Country Status (25)

Country Link
US (2) US11214620B2 (enExample)
EP (2) EP3472207B1 (enExample)
JP (2) JP7085709B2 (enExample)
KR (2) KR20190019144A (enExample)
CN (1) CN109563171B (enExample)
AR (1) AR110101A1 (enExample)
AU (1) AU2017283181B2 (enExample)
BR (1) BR112018076519A8 (enExample)
CA (1) CA3027612A1 (enExample)
CY (1) CY1124232T1 (enExample)
DK (1) DK3472207T3 (enExample)
ES (1) ES2858091T3 (enExample)
HR (1) HRP20210602T1 (enExample)
HU (1) HUE053742T2 (enExample)
IL (1) IL263730B2 (enExample)
LT (1) LT3472207T (enExample)
MX (1) MX2018016320A (enExample)
PL (1) PL3472207T3 (enExample)
PT (1) PT3472207T (enExample)
RS (1) RS61705B1 (enExample)
SG (1) SG11201811064TA (enExample)
SI (1) SI3472207T1 (enExample)
SM (1) SMT202100213T1 (enExample)
TW (1) TW201803906A (enExample)
WO (1) WO2017220569A1 (enExample)

Cited By (96)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018148476A1 (en) 2017-02-10 2018-08-16 Regeneron Pharmaceuticals, Inc. Radiolabeled anti-lag3 antibodies for immuno-pet imaging
WO2018222711A2 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Compositions comprising a combination of an anti-lag-3 antibody, a pd-1 pathway inhibitor, and an immunotherapeutic agent
WO2018222722A2 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Compositions comprising an anti-lag-3 antibody or an anti-lag-3 antibody and an anti-pd-1 or anti-pd-l1 antibody
WO2018222718A1 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Treatment of lag-3 positive tumors
WO2019121906A1 (en) * 2017-12-19 2019-06-27 F-Star Beta Limited Specific pd-l1 binding sequences inserted in a ch3 domain
WO2019129054A1 (zh) * 2017-12-27 2019-07-04 信达生物制药(苏州)有限公司 三链抗体、其制备方法及其用途
WO2019165982A1 (en) * 2018-02-28 2019-09-06 WuXi Biologics Ireland Limited Monoclonal antibody against human lag-3, method for preparing same, and use thereof
WO2019210848A1 (en) * 2018-05-03 2019-11-07 Shanghai Epimab Biotherapeutics Co., Ltd. High affinity antibodies to pd-1 and lag-3 and bispecific binding proteins made therefrom
WO2019246142A1 (en) * 2018-06-18 2019-12-26 Haiming Chen Soluble bispecific fusion proteins for cancer immunotherapy
WO2020011973A1 (en) * 2018-07-12 2020-01-16 F-Star Beta Limited Antibody molecules
WO2020023707A1 (en) 2018-07-26 2020-01-30 Bristol-Myers Squibb Company Lag-3 combination therapy for the treatment of cancer
US10604576B2 (en) 2016-06-20 2020-03-31 Kymab Limited Antibodies and immunocytokines
WO2020081928A1 (en) 2018-10-19 2020-04-23 Bristol-Myers Squibb Company Combination therapy for melanoma
EP3715375A1 (en) 2019-03-23 2020-09-30 Ablevia biotech GmbH Compound for the prevention or treatment of pre-eclampsia
EP3715376A1 (en) 2019-03-23 2020-09-30 Ablevia biotech GmbH Compound for the prevention or treatment of myasthenia gravis
EP3715374A1 (en) 2019-03-23 2020-09-30 Ablevia biotech GmbH Compound for the sequestration of undesirable antibodies in a patient
WO2020215049A1 (en) * 2019-04-19 2020-10-22 ImmunoBrain Checkpoint, Inc. Modified anti-pd-l1 antibodies and methods and uses for treating a neurodegenerative disease
WO2020229626A1 (en) 2019-05-14 2020-11-19 F-Star Delta Limited Dosage regimes for the administration of a lag-3/pd-l1 bispecific antibody
WO2020243568A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Methods of identifying a subject suitable for an immuno-oncology (i-o) therapy
WO2020243563A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Multi-tumor gene signatures for suitability to immuno-oncology therapy
WO2020243570A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Cell localization signature and combination therapy
WO2021024020A1 (en) 2019-08-06 2021-02-11 Astellas Pharma Inc. Combination therapy involving antibodies against claudin 18.2 and immune checkpoint inhibitors for treatment of cancer
WO2021055994A1 (en) 2019-09-22 2021-03-25 Bristol-Myers Squibb Company Quantitative spatial profiling for lag-3 antagonist therapy
CN112552411A (zh) * 2019-09-26 2021-03-26 上海药明生物技术有限公司 新型抗pd-l1/抗lag-3双特异性抗体及其用途
WO2021092220A1 (en) 2019-11-06 2021-05-14 Bristol-Myers Squibb Company Methods of identifying a subject with a tumor suitable for a checkpoint inhibitor therapy
WO2021092221A1 (en) 2019-11-06 2021-05-14 Bristol-Myers Squibb Company Methods of identifying a subject with a tumor suitable for a checkpoint inhibitor therapy
WO2021092380A1 (en) 2019-11-08 2021-05-14 Bristol-Myers Squibb Company Lag-3 antagonist therapy for melanoma
WO2021158938A1 (en) 2020-02-06 2021-08-12 Bristol-Myers Squibb Company Il-10 and uses thereof
JP2021524283A (ja) * 2018-05-17 2021-09-13 イムノーム、インコーポレイテッド Ch3ドメインエピトープタグ
EP3778632A4 (en) * 2018-04-03 2021-10-27 Jiangsu Huaiyu Pharmaceutical Co., Ltd. MONOCLONAL ANTI-HUMAN LAG-3 ANTIBODIES AND USES THEREOF
WO2021228978A1 (en) * 2020-05-12 2021-11-18 Astrazeneca Ab Methods and combinations for the treatment of cancer using immune checkpoint inhibitor antibodies
US11214620B2 (en) 2016-06-20 2022-01-04 F-Star Therapeutics Limited Binding molecules binding PD-L1 and LAG-3
US11214618B2 (en) 2016-06-20 2022-01-04 F-Star Therapeutics Limited LAG-3 binding members
WO2022008519A1 (en) 2020-07-07 2022-01-13 BioNTech SE Therapeutic rna for hpv-positive cancer
WO2022047412A1 (en) 2020-08-31 2022-03-03 Bristol-Myers Squibb Company Cell localization signature and immunotherapy
WO2022047189A1 (en) 2020-08-28 2022-03-03 Bristol-Myers Squibb Company Lag-3 antagonist therapy for hepatocellular carcinoma
WO2022063879A1 (en) 2020-09-23 2022-03-31 Ablevia Biotech Gmbh Compound for the sequestration of undesirable antibodies in a patient
WO2022087402A1 (en) 2020-10-23 2022-04-28 Bristol-Myers Squibb Company Lag-3 antagonist therapy for lung cancer
WO2022120179A1 (en) 2020-12-03 2022-06-09 Bristol-Myers Squibb Company Multi-tumor gene signatures and uses thereof
WO2022135666A1 (en) 2020-12-21 2022-06-30 BioNTech SE Treatment schedule for cytokine proteins
WO2022136257A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022136266A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022146947A1 (en) 2020-12-28 2022-07-07 Bristol-Myers Squibb Company Antibody compositions and methods of use thereof
WO2022146948A1 (en) 2020-12-28 2022-07-07 Bristol-Myers Squibb Company Subcutaneous administration of pd1/pd-l1 antibodies
US11396647B2 (en) 2020-01-07 2022-07-26 Board Of Regents, The University Of Texas System Human methylthioadenosine/adenosine depleting enzyme variants for cancer therapy
WO2022165214A1 (en) 2021-01-29 2022-08-04 Board Of Regents, The University Of Texas System Methods of treating cancer with kinase inhibitors
US11421028B2 (en) 2016-02-06 2022-08-23 Epimab Biotherapeutics, Inc. Fabs-in-tandem immunoglobulin and uses thereof
WO2022212400A1 (en) 2021-03-29 2022-10-06 Juno Therapeutics, Inc. Methods for dosing and treatment with a combination of a checkpoint inhibitor therapy and a car t cell therapy
EP3916016A4 (en) * 2019-01-25 2022-11-02 Innovent Biologics (Suzhou) Co., Ltd. NOVEL BISPECIFIC ANTIBODY MOLECULE AND BISPECIFIC ANTIBODY WITH SIMULTANEOUS COMBINATION OF PD-L1 AND LAG-3
US11492405B2 (en) 2014-03-12 2022-11-08 Yeda Research And Development Co. Ltd Reducing systemic regulatory t cell levels or activity for treatment of disease and injury of the CNS
WO2022240741A1 (en) 2021-05-12 2022-11-17 Dana-Farber Cancer Institute, Inc. Lag3 and gal3 inhibitory agents, xbp1, cs1, and cd138 peptides, and methods of use thereof
WO2023285552A1 (en) 2021-07-13 2023-01-19 BioNTech SE Multispecific binding agents against cd40 and cd137 in combination therapy for cancer
US11629193B2 (en) 2016-07-19 2023-04-18 F-Star Therapeutics Limited EGFR binding molecules
WO2023061930A1 (en) 2021-10-11 2023-04-20 BioNTech SE Therapeutic rna for lung cancer
WO2023077090A1 (en) 2021-10-29 2023-05-04 Bristol-Myers Squibb Company Lag-3 antagonist therapy for hematological cancer
US11643464B2 (en) 2014-03-12 2023-05-09 Yeda Research and Develpment & Co. Ltd Reducing systemic regulatory T cell levels or activity for treatment of a retinal degeneration disorder
US11692032B2 (en) 2015-10-09 2023-07-04 Regeneron Pharmaceuticals, Inc. Anti-LAG3 antibodies and uses thereof
WO2023147371A1 (en) 2022-01-26 2023-08-03 Bristol-Myers Squibb Company Combination therapy for hepatocellular carcinoma
US11732044B2 (en) 2017-12-27 2023-08-22 Innovent Biologics (Suzhou) Co., Ltd. Anti-LAG-3 antibody and use thereof
WO2023164638A1 (en) 2022-02-25 2023-08-31 Bristol-Myers Squibb Company Combination therapy for colorectal carcinoma
WO2023168404A1 (en) 2022-03-04 2023-09-07 Bristol-Myers Squibb Company Methods of treating a tumor
US11753479B2 (en) 2014-03-04 2023-09-12 Kymab Limited Nucleic acids encoding anti-OX40L antibodies
WO2023170606A1 (en) 2022-03-08 2023-09-14 Alentis Therapeutics Ag Use of anti-claudin-1 antibodies to increase t cell availability
WO2023178329A1 (en) 2022-03-18 2023-09-21 Bristol-Myers Squibb Company Methods of isolating polypeptides
US11779604B2 (en) 2016-11-03 2023-10-10 Kymab Limited Antibodies, combinations comprising antibodies, biomarkers, uses and methods
WO2023235847A1 (en) 2022-06-02 2023-12-07 Bristol-Myers Squibb Company Antibody compositions and methods of use thereof
EP4081248A4 (en) * 2019-12-23 2024-01-10 MacroGenics, Inc. METHOD FOR TREATING CANCER
US11884727B2 (en) 2014-03-12 2024-01-30 Yeda Research And Development Co. Ltd. Reducing systemic regulatory T cell levels or activity for treatment of amyotrophic lateral sclerosis
EP4319755A1 (en) 2021-04-08 2024-02-14 Board of Regents, The University of Texas System Compounds and methods for theranostic targeting of parp activity
RU2818587C2 (ru) * 2019-05-14 2024-05-03 Ф-стар Терапьютикс Лимитед Режимы дозирования при введении биспецифичного антитела против lag -3/pd-l1
US11986536B2 (en) 2019-03-23 2024-05-21 Ablevia Biotech Gmbh Compound for the sequestration of undesirable antibodies in a patient
WO2024116140A1 (en) 2022-12-01 2024-06-06 Medimmune Limited Combination therapy for treatment of cancer comprising anti-pd-l1 and anti-cd73 antibodies
WO2024126457A1 (en) 2022-12-14 2024-06-20 Astellas Pharma Europe Bv Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and immune checkpoint inhibitors
WO2024137776A1 (en) 2022-12-21 2024-06-27 Bristol-Myers Squibb Company Combination therapy for lung cancer
WO2024107731A3 (en) * 2022-11-14 2024-08-15 Ablexis, Llc Anti-pd-l1 antibodies
WO2024173876A1 (en) 2023-02-17 2024-08-22 Regeneron Pharmaceuticals, Inc. Radiolabeled anti-lag3 antibodies for immuno-pet imaging
EP4242234A4 (en) * 2020-12-10 2024-09-25 Beijing Dongfang Biotech Co. Ltd. Anti-lag-3 monoclonal antibody, and antigen-binding fragment and application thereof
WO2024196952A1 (en) 2023-03-20 2024-09-26 Bristol-Myers Squibb Company Tumor subtype assessment for cancer therapy
WO2024194482A1 (en) 2023-03-23 2024-09-26 Invox Pharma Limited Dosage regimens for the administration of a bispecific antibody in combination with chemotherapy
US12103976B2 (en) 2018-07-12 2024-10-01 Invox Pharma Limited Fc binding fragments comprising a CD137 antigen-binding site
US12209128B2 (en) 2016-06-20 2025-01-28 Kymab Limited Anti-PD-L1 antibodies
WO2025038763A1 (en) 2023-08-15 2025-02-20 Bristol-Myers Squibb Company Ceramic hydroxyapatite chromatography flow through method
US12252537B2 (en) 2018-07-12 2025-03-18 Invox Pharma Limited Antibody molecules that bind CD137 and OX40
WO2025096478A1 (en) 2023-10-30 2025-05-08 Regeneron Pharmaceuticals, Inc. Stable antibody formulation comprising fianlimab
US12297283B2 (en) 2018-07-12 2025-05-13 Invox Pharma Limited Fc binding fragments comprising an OX40 antigen-binding site
US12319739B2 (en) 2018-07-12 2025-06-03 Invox Pharma Limited Mesothelin and CD137 binding molecules
US12325742B2 (en) 2018-07-12 2025-06-10 Invox Pharma Limited Anti-mesothelin antibodies
WO2025121445A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2
WO2025121444A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and anti-vegfr2 antibodies
WO2025120866A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2
US12344672B2 (en) 2018-07-12 2025-07-01 Invox Pharma Limited Antibody molecules that bind PD-L1 and CD137
WO2025145207A1 (en) 2023-12-29 2025-07-03 Bristol-Myers Squibb Company Combination therapy of kras inhibitor and treg-depleting agent
WO2025184211A1 (en) 2024-02-27 2025-09-04 Bristol-Myers Squibb Company Anti-ceacam5 antibody drug conjugates
WO2025184208A1 (en) 2024-02-27 2025-09-04 Bristol-Myers Squibb Company Anti-ceacam5 antibodies and uses thereof
WO2025226695A1 (en) 2024-04-23 2025-10-30 Regeneron Pharmaceuticals, Inc. Stable antibody formulation
WO2025245489A1 (en) 2024-05-24 2025-11-27 Bristol-Myers Squibb Company Treatment of tumors in subjects having fgl-1 positive samples

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102821103B1 (ko) * 2018-12-17 2025-06-13 일루미나, 인코포레이티드 유동 셀 및 시퀀싱 키트
CN110950966B (zh) * 2019-12-13 2020-12-11 启辰生生物科技(珠海)有限公司 融合蛋白、编码核酸和细胞及用途
WO2023170633A1 (en) * 2022-03-10 2023-09-14 Mendus B.V. Use of modified cells of leukemic origin and pd-l1 antibody for enhancing the efficacy of cancer cell therapy

Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0120694A2 (en) 1983-03-25 1984-10-03 Celltech Limited Processes for the production of multichain polypeptides or proteins
EP0125023A1 (en) 1983-04-08 1984-11-14 Genentech, Inc. Recombinant immunoglobulin preparations, methods for their preparation, DNA sequences, expression vectors and recombinant host cells therefor
EP0184187A2 (en) 1984-12-04 1986-06-11 Teijin Limited Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it
EP0239400A2 (en) 1986-03-27 1987-09-30 Medical Research Council Recombinant antibodies and methods for their production
WO2006072620A1 (en) 2005-01-05 2006-07-13 F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. Synthetic immunoglobulin domains with binding properties engineered in regions of the molecule different from the complementarity determining regions
WO2009132876A1 (en) 2008-05-02 2009-11-05 F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H Cytotoxic immunoglobulin
EP2407487A1 (en) * 2010-07-14 2012-01-18 F-Star Biotechnologische Forschungs - und Entwicklungsges. M.B.H. Multispecific modular antibody
WO2015048312A1 (en) * 2013-09-26 2015-04-02 Costim Pharmaceuticals Inc. Methods for treating hematologic cancers
EP2905030A1 (en) * 2008-08-11 2015-08-12 E. R. Squibb & Sons, L.L.C. Human antibodies that bind lymphocyte activation gene-3 (LAG-3) and uses thereof
US9567399B1 (en) * 2016-06-20 2017-02-14 Kymab Limited Antibodies and immunocytokines

Family Cites Families (42)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE2245404C3 (de) 1972-09-15 1978-08-31 Robert Bosch Gmbh, 7000 Stuttgart Massewiderstand, insbesondere für Zündkerzen, sowie Verfahren zur Herstellung desselben
JPS531908B2 (enExample) 1973-11-12 1978-01-23
JPS5746634B2 (enExample) 1974-05-10 1982-10-04
JPS5146628A (ja) 1974-10-17 1976-04-21 Nippon Denso Co Teikoirisupaakupuragu
DE19818214A1 (de) 1998-04-24 1999-10-28 Bosch Gmbh Robert Zündkerze für eine Brennkraftmaschine
JP4578025B2 (ja) 2001-07-06 2010-11-10 日本特殊陶業株式会社 スパークプラグ
RS54271B1 (sr) * 2005-07-01 2016-02-29 E. R. Squibb & Sons, L.L.C. Humana monoklonska antitela za ligand programirane smrti 1 (pd-l1)
ES2627223T3 (es) 2007-06-26 2017-07-27 F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H Presentación de agentes de unión
EP2546268A1 (en) 2011-07-13 2013-01-16 F-Star Biotechnologische Forschungs - und Entwicklungsges. M.B.H. Internalising immunoglobulin
UY34887A (es) 2012-07-02 2013-12-31 Bristol Myers Squibb Company Una Corporacion Del Estado De Delaware Optimización de anticuerpos que se fijan al gen de activación de linfocitos 3 (lag-3) y sus usos
JP5276742B1 (ja) 2012-08-09 2013-08-28 日本特殊陶業株式会社 点火プラグ
HUE049957T2 (hu) 2013-03-15 2020-11-30 Glaxosmithkline Ip Dev Ltd Lag-3 elleni kötõfehérjék
LT3116909T (lt) 2014-03-14 2020-02-10 Novartis Ag Antikūno molekulės prieš lag-3 ir jų panaudojimas
WO2015198312A1 (en) 2014-06-24 2015-12-30 Ccam Therapeutics Ltd. Compositions comprising antibodies to ceacam-1 and lag-3 for cancer therapy
JP5902757B2 (ja) 2014-06-24 2016-04-13 日本特殊陶業株式会社 スパークプラグ
TWI693232B (zh) 2014-06-26 2020-05-11 美商宏觀基因股份有限公司 與pd-1和lag-3具有免疫反應性的共價結合的雙抗體和其使用方法
BR112017002596A2 (pt) 2014-08-10 2018-01-30 Federal-Mogul Ignition Company vela de ignição com vedação melhorada
JO3663B1 (ar) 2014-08-19 2020-08-27 Merck Sharp & Dohme الأجسام المضادة لمضاد lag3 وأجزاء ربط الأنتيجين
WO2016177802A1 (en) 2015-05-04 2016-11-10 Pieris Pharmaceuticals Gmbh Anti-cancer fusion polypeptide
EP3988577A1 (en) 2015-05-21 2022-04-27 Alligator Bioscience AB Anti-cd137 antibodies
TWI773646B (zh) 2015-06-08 2022-08-11 美商宏觀基因股份有限公司 結合lag-3的分子和其使用方法
JP6025921B1 (ja) 2015-06-22 2016-11-16 日本特殊陶業株式会社 スパークプラグ
EP3322433B1 (en) 2015-07-15 2023-05-31 Pieris Pharmaceuticals GmbH Novel proteins specific for lag-3
CA2993177A1 (en) 2015-07-22 2017-01-26 Sorrento Therapeutics, Inc. Antibody therapeutics that bind lag3
WO2017025498A1 (en) 2015-08-07 2017-02-16 Pieris Pharmaceuticals Gmbh Novel fusion polypeptide specific for lag-3 and pd-1
KR101782487B1 (ko) 2015-09-24 2017-09-27 재단법인 목암생명과학연구소 신규 항-메소텔린 항체 및 이를 포함하는 조성물
TWI756187B (zh) 2015-10-09 2022-03-01 美商再生元醫藥公司 抗lag3抗體及其用途
GB201519481D0 (en) 2015-11-04 2015-12-16 Cancer Rec Tech Ltd Immunomodulatory antibodies
MA43260A (fr) 2015-11-18 2018-09-26 Merck Sharp & Dohme Liants pd1 et/ou lag3
EP3377533A2 (en) 2015-11-19 2018-09-26 Sutro Biopharma, Inc. Anti-lag3 antibodies, compositions comprising anti-lag3 antibodies and methods of making and using anti-lag3 antibodies
SG10201912405TA (en) 2016-01-11 2020-02-27 Inhibrx Inc Multivalent and multispecific 41bb-binding fusion proteins
WO2017182672A1 (en) 2016-04-22 2017-10-26 Alligator Bioscience Ab Novel bispecific polypeptides against cd137
CA3026474A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
WO2017220555A1 (en) 2016-06-20 2017-12-28 F-Star Beta Limited Lag -3 binding members
EP3472207B1 (en) * 2016-06-20 2021-01-20 F-Star Delta Limited Binding molecules binding pd-l1 and lag-3
GB201612520D0 (en) 2016-07-19 2016-08-31 F-Star Beta Ltd Binding molecules
EP3487883B1 (en) 2016-07-20 2023-01-04 Stcube, Inc. Methods of cancer treatment and therapy using a combination of antibodies that bind glycosylated pd-l1
EP3515951B1 (en) 2016-09-23 2024-02-28 Merus N.V. Binding molecules that modulate a biological activity expressed by a cell
GB201700345D0 (en) 2017-01-09 2017-02-22 F-Star Beta Ltd Conditional agonists of immune responses
CN111406067B (zh) 2017-08-04 2022-11-08 健玛保 与pd-l1和cd137结合的结合剂及其用途
ES3024433T3 (en) 2017-12-19 2025-06-04 F Star Therapeutics Ltd Fc binding fragments comprising a pd-l1 antigen-binding site
GB201811404D0 (en) 2018-07-12 2018-08-29 F Star Beta Ltd Anti-CD137 Antibodies

Patent Citations (11)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0120694A2 (en) 1983-03-25 1984-10-03 Celltech Limited Processes for the production of multichain polypeptides or proteins
EP0125023A1 (en) 1983-04-08 1984-11-14 Genentech, Inc. Recombinant immunoglobulin preparations, methods for their preparation, DNA sequences, expression vectors and recombinant host cells therefor
EP0184187A2 (en) 1984-12-04 1986-06-11 Teijin Limited Mouse-human chimaeric immunoglobulin heavy chain, and chimaeric DNA encoding it
EP0239400A2 (en) 1986-03-27 1987-09-30 Medical Research Council Recombinant antibodies and methods for their production
GB2188638A (en) 1986-03-27 1987-10-07 Gregory Paul Winter Chimeric antibodies
WO2006072620A1 (en) 2005-01-05 2006-07-13 F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. Synthetic immunoglobulin domains with binding properties engineered in regions of the molecule different from the complementarity determining regions
WO2009132876A1 (en) 2008-05-02 2009-11-05 F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H Cytotoxic immunoglobulin
EP2905030A1 (en) * 2008-08-11 2015-08-12 E. R. Squibb & Sons, L.L.C. Human antibodies that bind lymphocyte activation gene-3 (LAG-3) and uses thereof
EP2407487A1 (en) * 2010-07-14 2012-01-18 F-Star Biotechnologische Forschungs - und Entwicklungsges. M.B.H. Multispecific modular antibody
WO2015048312A1 (en) * 2013-09-26 2015-04-02 Costim Pharmaceuticals Inc. Methods for treating hematologic cancers
US9567399B1 (en) * 2016-06-20 2017-02-14 Kymab Limited Antibodies and immunocytokines

Non-Patent Citations (43)

* Cited by examiner, † Cited by third party
Title
"31st Annual Meeting and Associated Programs of the Society for Immunotherapy of Cancer (SITC 2016): part one", JOURNAL FOR IMMUNOTHERAPY OF CANCER, BIOMED CENTRAL LTD, LONDON, UK, vol. 4, no. 1, 16 November 2016 (2016-11-16), pages 1 - 106, XP021241440, DOI: 10.1186/S40425-016-0172-7 *
"F-star Alpha: A new asset centric company", 11 February 2014 (2014-02-11), XP055160760, Retrieved from the Internet <URL:http://www.onenucleus.com/media/Events/LSLS/11 feb 2014/Jane Dancer.pdf> [retrieved on 20150108] *
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 405 - 410
AMIT ET AL., SCIENCE, vol. 233, 1986, pages 747 - 753
BAE J; LEE SJ; PARK CG; LEE YS; CHUN T: "Trafficking of LAG-3 to the surface on activated T cells via its cytoplasmic domain and protein kinase C signaling", J IMMUNOL., vol. 193, no. 6, 2014, pages 3101 - 12
BAECHER-ALLAN C; WOLF E; HAFLER DA: "MHC class II expression identifies functionally distinct human regulatory T cells", J IMMUNOL., vol. 176, no. 8, 2006, pages 4622 - 31
BAGSHAWE ET AL., ANTIBODY, IMMUNOCONJUGATES AND RADIOPHARMACEUTICALS, vol. 4, 1991, pages 915 - 922
BROUSSAS, MATTHIEU; BROYER, LUCILE; GOETSCH, LILIANE: "Methods in Molecular Biology", vol. 988, 2013, SPRINGER SCIENCE + BUSINESS MEDIA, article "Evaluation of Antibody-Dependent Cell Cytotoxicity Using Lactate Dehydrogenase (LDH) Measurement in Glycosylation Engineering of Biopharmaceuticals: Methods and Protocols", pages: 305 - 317
CAMISASCHI C; CASATI C; RINI F; PEREGO M; DE FILIPPO A; TRIEBEL F; PARMIANI G; BELLI F; RIVOLTINI L; CASTELLI C: "LAG-3 expression defines a subset of CD4(+)CD25(high)Foxp3(+) regulatory T cells that are expanded at tumor sites", J IMMUNOL., vol. 184, no. 11, 2010, pages 6545 - 51
CATON ET AL., J. IMMUNOL., vol. 144, 1990, pages 1965 - 1968
CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 877 - 883
CURRAN MA; MONTALVO W; YAGITA H; ALLISON JP: "PD-1 and CTLA-4 combination blockade expands infiltrating T cells and reduces regulatory T and myeloid cells within B16 melanoma tumors", PROC NATL ACAD SCI USA, vol. 107, no. 9, 2010, pages 4275 - 80, XP055067204, DOI: doi:10.1073/pnas.0915174107
DEMEURE, C. E.; WOLFERS, J.; MARTIN-GARCIA, N.; GAULARD, P.; TRIEBEL, F.: "T Lymphocytes infiltrating various tumour types express the MHC class II ligand lymphocyte activation gene-3 (LAG-3): role of LAG-3/MHC class II interactions in cell-cell contacts", EUROPEAN JOURNAL OF CANCER, vol. 37, 2001, pages 1709 - 1718, XP004301143, DOI: doi:10.1016/S0959-8049(01)00184-8
DURHAM NM; NIRSCHL CJ; JACKSON CM; ELIAS J; KOCHEL CM; ANDERS RA; DRAKE CG: "Lymphocyte Activation Gene 3 (LAG-3) modulates the ability of CD4 T cells to be suppressed in vivo", PLOS ONE, vol. 9, no. 11, 2015, pages e109080
ENGELS B; ENGELHARD VH; SIDNEY J; SETTE A; BINDER DC; LIU RB; KRANZ DM; MEREDITH SC; ROWLEY DA; SCHREIBER H: "Relapse or eradication of cancer is predicted by peptide-major histocompatibility complex affinity", CANCER CELL., vol. 23, no. 4, 2013, pages 516 - 26, XP028578787, DOI: doi:10.1016/j.ccr.2013.03.018
GANDHI MK; LAMBLEY E; DURAISWAMY J; DUA U; SMITH C; ELLIOTT S; GILL D; MARLTON P; SEYMOUR J; KHANNA R: "Expression of LAG-3 by tumor-infiltrating lymphocytes is coincident with the suppression of latent membrane antigen-specific CD8+ T cell function in Hodgkin lymphoma patients", BLOOD, vol. 108, no. 7, 2006, pages 2280 - 9
GROSSO J; INZUNZA D; WU Q ET AL.: "Programmed death-ligand 1 (PD-L1) expression in various tumor types", JOURNAL FOR IMMUNOTHERAPY OF CANCER, vol. 1, no. 1, 2013, pages 53
HERBST RS; SORIA JC; KOWANETZ M; FINE GD; HAMID O; GORDON MS; SOSMAN JA; MCDERMOTT DF; POWDERLY JD; GETTINGER SN: "Predictive correlates of response to the anti-PD-L1 antibody MPDL3280A in cancer patients", NATURE, vol. 515, no. 7528, 2014, pages 563 - 7, XP055262130, DOI: doi:10.1038/nature14011
HU ET AL., CANCER RES., vol. 56, no. 13, 1996, pages 3055 - 61
HUARD B; MASTRANGELI R; PRIGENT P: "Characterization of the major histocompatibility complex class II binding site on LAG-3 protein", PROC NATL ACAD SCI USA, vol. 94, 1997, pages 5744 - 9, XP002037067, DOI: doi:10.1073/pnas.94.11.5744
IWAI Y; ISHIDA M; TANAKA Y; OKAZAKI T; HONJO T; MINATO N: "Involvement of PD-L1 on tumor cells in the escape from host immune system and tumor immunotherapy by PD-L1 blockade", PROC NATL ACAD SCI USA, vol. 99, no. 19, pages 12293 - 7, XP002398159, DOI: doi:10.1073/pnas.192461099
JING W; GERSHAN JA; WEBER J; TLOMAK D; MCOLASH L; SABATOS-PEYTON C; JOHNSON BD1: "Combined immune checkpoint protein blockade and low dose whole body irradiation as immunotherapy for myeloma", J IMMUNOTHER CANCER, vol. 3, no. 1, 2015, pages 2, XP021210655, DOI: doi:10.1186/s40425-014-0043-z
KABAT ET AL., J. IMMUNOL., vol. 147, 1991, pages 1709 - 1719
KABAT, E.A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION, pages: 91 - 3242
LARKIN J; HODI FS; WOLCHOK JD: "Combined Nivolumab and Ipilimumab or Monotherapy in Untreated Melanoma", N ENGL J MED, vol. 373, no. 13, 2015, pages 1270 - 1
LEDERMANN ET AL., INT. J. CANCER, vol. 47, 1991, pages 659 - 664
MATTHEW KRAMAN ET AL: "A LAG-3/PD-L1 bispecific antibody inhibits tumor growth in two syngeneic colon carcinoma models", 13 November 2016 (2016-11-13), XP055369256, Retrieved from the Internet <URL:http://www.f-star.com/media/73722/A-LAG-3-PD-L1-bispecific-antibody-inhibits-tumour-growth-in-two-syngeneic-colon-carcinoma-models.pdf> [retrieved on 20170504] *
NUCL. ACIDS RES., vol. 25, 1997, pages 3389 - 3402
PEARSON; LIPMAN, PNAS USA, vol. 85, 1988, pages 2444 - 2448
PHYSICIAN'S DESK REFERENCE, 2003
POWLES T; EDER JP; FINE GD; BRAITEH FS; LORIOT Y; CRUZ C; BELLMUNT J; BURRIS HA; PETRYLAK DP; TENG SL: "MPDL3280A (anti-PD-L1) treatment leads to clinical activity in metastatic bladder cancer", NATURE, vol. 515, no. 7528, 2014, pages 558 - 62, XP055207741, DOI: doi:10.1038/nature13904
ROBINSON: "Sustained and Controlled Release Drug Delivery Systems", 1978, MARCEL DEKKER, INC.
SEGA EL; LEVESON-GOWER DB; FLOREK M; SCHNEIDAWIND D; LUONG RH; NEGRIN RS: "Role of lymphocyte activation gene-3 (Lag-3) in conventional and regulatory T cell function in allogeneic transplantation", PLOS ONE, vol. 9, no. 1, 2014, pages e86551
SEGAL ET AL., PNAS, vol. 71, 1974, pages 4298 - 4302
SHARON ET AL., J. IMMUNOL., vol. 144, 1990, pages 4863 - 4869
SHARON ET AL., PNAS, vol. 87, 1990, pages 4814 - 4817
SMITH; WATERMAN, J. MOL BIOL., vol. 147, 1981, pages 195 - 197
WEIQING JING ET AL: "Combined immune checkpoint protein blockade and low dose whole body irradiation as immunotherapy for myeloma", JOURNAL FOR IMMUNOTHERAPY OF CANCER, BIOMED CENTRAL LTD, LONDON, UK, vol. 3, no. 1, 20 January 2015 (2015-01-20), pages 2, XP021210655, ISSN: 2051-1426, DOI: 10.1186/S40425-014-0043-Z *
WOLCHOK J ET AL.: "Nivolumab plus ipilimumab in advanced melanoma", N ENGL J MED, vol. 369, no. 2, 2013, pages 122 - 33, XP055182024, DOI: doi:10.1056/NEJMoa1302369
WOO SR; TURNIS ME; GOLDBERG MV; BANKOTI J; SELBY M; NIRSCHL CJ; BETTINI ML; GRAVANO DM; VOGEL P; LIU CL: "Immune inhibitory molecules LAG-3 and PD-1 synergistically regulate T cell function to promote tumoral immune escape", CANCER RES, vol. 72, no. 4, 2012, pages 917 - 2, XP055151722, DOI: doi:10.1158/0008-5472.CAN-11-1620
WORKMAN CJ; VIGNALI DA: "Negative regulation of T cell homeostasis by lymphocyte activation gene-3 (CD223", J IMMUNOL, vol. 174, no. 2, 15 January 2005 (2005-01-15), pages 688 - 95
WORKMAN CJ; VIGNALI DA: "The CD4-related molecule, LAG-3 (CD223), regulates the expansion of activated T cells", EUR J IMMUNOL, vol. 33, no. 4, April 2003 (2003-04-01), pages 970 - 9, XP055121082, DOI: doi:10.1002/eji.200323382

Cited By (142)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11753479B2 (en) 2014-03-04 2023-09-12 Kymab Limited Nucleic acids encoding anti-OX40L antibodies
US11773175B2 (en) 2014-03-04 2023-10-03 Kymab Limited Antibodies, uses and methods
US11492405B2 (en) 2014-03-12 2022-11-08 Yeda Research And Development Co. Ltd Reducing systemic regulatory t cell levels or activity for treatment of disease and injury of the CNS
US11643464B2 (en) 2014-03-12 2023-05-09 Yeda Research and Develpment & Co. Ltd Reducing systemic regulatory T cell levels or activity for treatment of a retinal degeneration disorder
US11884727B2 (en) 2014-03-12 2024-01-30 Yeda Research And Development Co. Ltd. Reducing systemic regulatory T cell levels or activity for treatment of amyotrophic lateral sclerosis
US11884728B2 (en) 2014-03-12 2024-01-30 Yeda Research And Development Co. Ltd. Reducing systemic regulatory T cell levels or activity for treatment of amyotrophic lateral sclerosis
US11692032B2 (en) 2015-10-09 2023-07-04 Regeneron Pharmaceuticals, Inc. Anti-LAG3 antibodies and uses thereof
US11421028B2 (en) 2016-02-06 2022-08-23 Epimab Biotherapeutics, Inc. Fabs-in-tandem immunoglobulin and uses thereof
US12209128B2 (en) 2016-06-20 2025-01-28 Kymab Limited Anti-PD-L1 antibodies
US11214620B2 (en) 2016-06-20 2022-01-04 F-Star Therapeutics Limited Binding molecules binding PD-L1 and LAG-3
US11214618B2 (en) 2016-06-20 2022-01-04 F-Star Therapeutics Limited LAG-3 binding members
US10604576B2 (en) 2016-06-20 2020-03-31 Kymab Limited Antibodies and immunocytokines
EP3472206B1 (en) * 2016-06-20 2025-01-15 invoX Pharma Limited Lag-3 binding members
US12187798B2 (en) 2016-06-20 2025-01-07 Invox Pharma Limited LAG-3 binding members
US11629193B2 (en) 2016-07-19 2023-04-18 F-Star Therapeutics Limited EGFR binding molecules
US11779604B2 (en) 2016-11-03 2023-10-10 Kymab Limited Antibodies, combinations comprising antibodies, biomarkers, uses and methods
WO2018148476A1 (en) 2017-02-10 2018-08-16 Regeneron Pharmaceuticals, Inc. Radiolabeled anti-lag3 antibodies for immuno-pet imaging
US11511001B2 (en) 2017-02-10 2022-11-29 Regeneron Pharmaceuticals, Inc. Radiolabeled anti-LAG3 antibodies for immuno-PET imaging
US10905784B2 (en) 2017-02-10 2021-02-02 Regeneron Pharmaceuticals, Inc. Radiolabeled anti-LAG3 antibodies for immuno-PET imaging
US12049503B2 (en) 2017-05-30 2024-07-30 Bristol-Myers Squibb Company Treatment of LAG-3 positive tumors
WO2018222711A2 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Compositions comprising a combination of an anti-lag-3 antibody, a pd-1 pathway inhibitor, and an immunotherapeutic agent
EP4306542A2 (en) 2017-05-30 2024-01-17 Bristol-Myers Squibb Company Treatment of lag-3 positive tumors
US11807686B2 (en) 2017-05-30 2023-11-07 Bristol-Myers Squibb Company Treatment of LAG-3 positive tumors
US11723975B2 (en) 2017-05-30 2023-08-15 Bristol-Myers Squibb Company Compositions comprising an anti-LAG-3 antibody or an anti-LAG-3 antibody and an anti-PD-1 or anti-PD-L1 antibody
WO2018222722A2 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Compositions comprising an anti-lag-3 antibody or an anti-lag-3 antibody and an anti-pd-1 or anti-pd-l1 antibody
EP4245375A2 (en) 2017-05-30 2023-09-20 Bristol-Myers Squibb Company Compositions comprising a combination of an anti-lag-3 antibody, a pd-1 pathway inhibitor, and an immunotherapeutic agent
WO2018222718A1 (en) 2017-05-30 2018-12-06 Bristol-Myers Squibb Company Treatment of lag-3 positive tumors
US11548948B2 (en) 2017-12-19 2023-01-10 F-Star Therapeutics Limited FC binding fragments comprising a PD-L1 antigen-binding site
WO2019121906A1 (en) * 2017-12-19 2019-06-27 F-Star Beta Limited Specific pd-l1 binding sequences inserted in a ch3 domain
JP2021508449A (ja) * 2017-12-19 2021-03-11 エフ−スター ベータ リミテッド Ch3ドメイン中に挿入された特異的pd−l1結合配列
AU2018387741B2 (en) * 2017-12-19 2025-09-25 Invox Pharma Limited FC binding fragments comprising a PD-L1 antigen-binding site
JP7489316B2 (ja) 2017-12-19 2024-05-23 エフ-スター セラピューティクス リミテッド Pd-li抗原結合部位を有するfc結合断片
US11732044B2 (en) 2017-12-27 2023-08-22 Innovent Biologics (Suzhou) Co., Ltd. Anti-LAG-3 antibody and use thereof
WO2019129054A1 (zh) * 2017-12-27 2019-07-04 信达生物制药(苏州)有限公司 三链抗体、其制备方法及其用途
WO2019165982A1 (en) * 2018-02-28 2019-09-06 WuXi Biologics Ireland Limited Monoclonal antibody against human lag-3, method for preparing same, and use thereof
EP3758751A4 (en) * 2018-02-28 2021-11-17 Wuxi Biologics Ireland Limited. MONOCLONAL ANTIBODIES AGAINST HUMAN LAG-3, METHOD OF MANUFACTURING AND USING THEREOF
US12371493B2 (en) 2018-02-28 2025-07-29 Wuxi Biologics (Shanghai) Co., Ltd. Monoclonal antibody against human LAG-3, method for preparing the same, and use thereof
US11795221B2 (en) 2018-02-28 2023-10-24 WuXi Biologics Ireland Limited Monoclonal antibody against human LAG-3, method for preparing the same, and use thereof
EP3778632A4 (en) * 2018-04-03 2021-10-27 Jiangsu Huaiyu Pharmaceutical Co., Ltd. MONOCLONAL ANTI-HUMAN LAG-3 ANTIBODIES AND USES THEREOF
WO2019210848A1 (en) * 2018-05-03 2019-11-07 Shanghai Epimab Biotherapeutics Co., Ltd. High affinity antibodies to pd-1 and lag-3 and bispecific binding proteins made therefrom
US12060425B2 (en) 2018-05-03 2024-08-13 Shanghai Epimab Biotherapeutics Co., Ltd. High affinity antibodies to PD-1 and LAG-3 and bispecific binding proteins made therefrom
JP2021524283A (ja) * 2018-05-17 2021-09-13 イムノーム、インコーポレイテッド Ch3ドメインエピトープタグ
EP3793604A4 (en) * 2018-05-17 2022-03-02 Immunome, Inc. CH3 DOMAIN EPITOPE MARKERS
WO2019246142A1 (en) * 2018-06-18 2019-12-26 Haiming Chen Soluble bispecific fusion proteins for cancer immunotherapy
US12344672B2 (en) 2018-07-12 2025-07-01 Invox Pharma Limited Antibody molecules that bind PD-L1 and CD137
EP4556020A3 (en) * 2018-07-12 2025-06-11 invoX Pharma Limited Antibody molecules
US12103976B2 (en) 2018-07-12 2024-10-01 Invox Pharma Limited Fc binding fragments comprising a CD137 antigen-binding site
US12247074B2 (en) 2018-07-12 2025-03-11 Invox Pharma Limited Antibody molecules
WO2020011973A1 (en) * 2018-07-12 2020-01-16 F-Star Beta Limited Antibody molecules
US12252537B2 (en) 2018-07-12 2025-03-18 Invox Pharma Limited Antibody molecules that bind CD137 and OX40
US12297283B2 (en) 2018-07-12 2025-05-13 Invox Pharma Limited Fc binding fragments comprising an OX40 antigen-binding site
US12319739B2 (en) 2018-07-12 2025-06-03 Invox Pharma Limited Mesothelin and CD137 binding molecules
US12325742B2 (en) 2018-07-12 2025-06-10 Invox Pharma Limited Anti-mesothelin antibodies
EP4667493A2 (en) 2018-07-26 2025-12-24 Bristol-Myers Squibb Company Lag-3 combination therapy for the treatment of cancer
WO2020023707A1 (en) 2018-07-26 2020-01-30 Bristol-Myers Squibb Company Lag-3 combination therapy for the treatment of cancer
EP4663244A2 (en) 2018-10-19 2025-12-17 Bristol-Myers Squibb Company Combination therapy for melanoma
WO2020081928A1 (en) 2018-10-19 2020-04-23 Bristol-Myers Squibb Company Combination therapy for melanoma
EP4445958A2 (en) 2018-10-19 2024-10-16 Bristol-Myers Squibb Company Combination therapy for melanoma
EP3916016A4 (en) * 2019-01-25 2022-11-02 Innovent Biologics (Suzhou) Co., Ltd. NOVEL BISPECIFIC ANTIBODY MOLECULE AND BISPECIFIC ANTIBODY WITH SIMULTANEOUS COMBINATION OF PD-L1 AND LAG-3
EP3715376A1 (en) 2019-03-23 2020-09-30 Ablevia biotech GmbH Compound for the prevention or treatment of myasthenia gravis
EP3715374A1 (en) 2019-03-23 2020-09-30 Ablevia biotech GmbH Compound for the sequestration of undesirable antibodies in a patient
EP3715375A1 (en) 2019-03-23 2020-09-30 Ablevia biotech GmbH Compound for the prevention or treatment of pre-eclampsia
EP3960769A1 (en) 2019-03-23 2022-03-02 Ablevia biotech GmbH Compound for the sequestration of undesirable antibodies in a patient
WO2020193487A1 (en) 2019-03-23 2020-10-01 Ablevia Biotech Gmbh Compound for the prevention or treatment of myasthenia gravis
US11986536B2 (en) 2019-03-23 2024-05-21 Ablevia Biotech Gmbh Compound for the sequestration of undesirable antibodies in a patient
WO2020193486A1 (en) 2019-03-23 2020-10-01 Ablevia Biotech Gmbh Compound for the sequestration of undesirable antibodies in a patient
US12011484B2 (en) 2019-03-23 2024-06-18 Ablevia Biotech Gmbh Compound for the sequestration of undesirable antibodies in a patient
WO2020215049A1 (en) * 2019-04-19 2020-10-22 ImmunoBrain Checkpoint, Inc. Modified anti-pd-l1 antibodies and methods and uses for treating a neurodegenerative disease
JP2022529789A (ja) * 2019-04-19 2022-06-24 イミュノブレイン チェックポイント,インコーポレイテッド 神経変性疾患を治療するための改変抗pd-l1抗体および治療方法および使用
US11732046B2 (en) 2019-04-19 2023-08-22 ImmunoBrain Checkpoint, Inc. Modified anti-PD-L1 antibody and methods and uses for treating a neurodegenerative disease
US10995141B2 (en) 2019-04-19 2021-05-04 ImmunoBrain Checkpoint, Inc. Modified anti-PD-L1 antibody and methods and uses for treating a neurodegenerative disease
JP7752050B2 (ja) 2019-04-19 2025-10-09 イミュノブレイン チェックポイント,インコーポレイテッド 神経変性疾患を治療するための改変抗pd-l1抗体および治療方法および使用
RU2818587C2 (ru) * 2019-05-14 2024-05-03 Ф-стар Терапьютикс Лимитед Режимы дозирования при введении биспецифичного антитела против lag -3/pd-l1
WO2020229626A1 (en) 2019-05-14 2020-11-19 F-Star Delta Limited Dosage regimes for the administration of a lag-3/pd-l1 bispecific antibody
JP2022533578A (ja) * 2019-05-14 2022-07-25 エフ-スター セラピューティクス リミテッド Lag-3/pd-l1二重特異性抗体の投与のための投与計画
US20220275092A1 (en) * 2019-05-14 2022-09-01 F-Star Therapeutics Limited Dosage regimes for the administration of a lag-3/pd-l1 bispecific antibody
WO2020243568A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Methods of identifying a subject suitable for an immuno-oncology (i-o) therapy
WO2020243570A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Cell localization signature and combination therapy
WO2020243563A1 (en) 2019-05-30 2020-12-03 Bristol-Myers Squibb Company Multi-tumor gene signatures for suitability to immuno-oncology therapy
WO2021024020A1 (en) 2019-08-06 2021-02-11 Astellas Pharma Inc. Combination therapy involving antibodies against claudin 18.2 and immune checkpoint inhibitors for treatment of cancer
WO2021025177A1 (en) 2019-08-06 2021-02-11 Astellas Pharma Inc. Combination therapy involving antibodies against claudin 18.2 and immune checkpoint inhibitors for treatment of cancer
WO2021055994A1 (en) 2019-09-22 2021-03-25 Bristol-Myers Squibb Company Quantitative spatial profiling for lag-3 antagonist therapy
CN112552411B (zh) * 2019-09-26 2022-07-29 无锡药明生物技术股份有限公司 新型抗pd-l1/抗lag-3双特异性抗体及其用途
JP2022550364A (ja) * 2019-09-26 2022-12-01 ウーシー バイオロジクス アイルランド リミテッド 新規抗pd-l1/抗lag-3二重特異性抗体およびその使用
CN112552411A (zh) * 2019-09-26 2021-03-26 上海药明生物技术有限公司 新型抗pd-l1/抗lag-3双特异性抗体及其用途
WO2021057930A1 (en) * 2019-09-26 2021-04-01 Wuxi Biologics (Shanghai) Co., Ltd. A novel anti-pd-l1/anti-lag-3 bispecific antibody and uses thereof
EP4034569A4 (en) * 2019-09-26 2023-11-01 Wuxi Biologics Ireland Limited NOVEL BISPECIFIC ANTI-PD-L1/ANTI-LAG-3 ANTIBODY AND ITS USES
WO2021092220A1 (en) 2019-11-06 2021-05-14 Bristol-Myers Squibb Company Methods of identifying a subject with a tumor suitable for a checkpoint inhibitor therapy
WO2021092221A1 (en) 2019-11-06 2021-05-14 Bristol-Myers Squibb Company Methods of identifying a subject with a tumor suitable for a checkpoint inhibitor therapy
WO2021092380A1 (en) 2019-11-08 2021-05-14 Bristol-Myers Squibb Company Lag-3 antagonist therapy for melanoma
EP4081248A4 (en) * 2019-12-23 2024-01-10 MacroGenics, Inc. METHOD FOR TREATING CANCER
US11396647B2 (en) 2020-01-07 2022-07-26 Board Of Regents, The University Of Texas System Human methylthioadenosine/adenosine depleting enzyme variants for cancer therapy
US11591579B2 (en) 2020-01-07 2023-02-28 Board Of Regents, The University Of Texas System Human methylthioadenosine/adenosine depleting enzyme variants for cancer therapy
WO2021158938A1 (en) 2020-02-06 2021-08-12 Bristol-Myers Squibb Company Il-10 and uses thereof
WO2021228978A1 (en) * 2020-05-12 2021-11-18 Astrazeneca Ab Methods and combinations for the treatment of cancer using immune checkpoint inhibitor antibodies
WO2022008519A1 (en) 2020-07-07 2022-01-13 BioNTech SE Therapeutic rna for hpv-positive cancer
WO2022047189A1 (en) 2020-08-28 2022-03-03 Bristol-Myers Squibb Company Lag-3 antagonist therapy for hepatocellular carcinoma
WO2022047412A1 (en) 2020-08-31 2022-03-03 Bristol-Myers Squibb Company Cell localization signature and immunotherapy
WO2022063879A1 (en) 2020-09-23 2022-03-31 Ablevia Biotech Gmbh Compound for the sequestration of undesirable antibodies in a patient
WO2022087402A1 (en) 2020-10-23 2022-04-28 Bristol-Myers Squibb Company Lag-3 antagonist therapy for lung cancer
WO2022120179A1 (en) 2020-12-03 2022-06-09 Bristol-Myers Squibb Company Multi-tumor gene signatures and uses thereof
AU2021398061B2 (en) * 2020-12-10 2025-09-11 Beijing Dongfang Biotech Co., Ltd Anti-lag-3 monoclonal antibody and antigen binding fragment thereof, and use thereof
EP4242234A4 (en) * 2020-12-10 2024-09-25 Beijing Dongfang Biotech Co. Ltd. Anti-lag-3 monoclonal antibody, and antigen-binding fragment and application thereof
WO2022136255A1 (en) 2020-12-21 2022-06-30 BioNTech SE Treatment schedule for cytokine proteins
WO2022135666A1 (en) 2020-12-21 2022-06-30 BioNTech SE Treatment schedule for cytokine proteins
WO2022136266A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022135667A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022136257A1 (en) 2020-12-21 2022-06-30 BioNTech SE Therapeutic rna for treating cancer
WO2022146948A1 (en) 2020-12-28 2022-07-07 Bristol-Myers Squibb Company Subcutaneous administration of pd1/pd-l1 antibodies
WO2022146947A1 (en) 2020-12-28 2022-07-07 Bristol-Myers Squibb Company Antibody compositions and methods of use thereof
EP4566674A2 (en) 2020-12-28 2025-06-11 Bristol-Myers Squibb Company Antibody compositions and methods of use thereof
WO2022165214A1 (en) 2021-01-29 2022-08-04 Board Of Regents, The University Of Texas System Methods of treating cancer with kinase inhibitors
WO2022212400A1 (en) 2021-03-29 2022-10-06 Juno Therapeutics, Inc. Methods for dosing and treatment with a combination of a checkpoint inhibitor therapy and a car t cell therapy
EP4319755A1 (en) 2021-04-08 2024-02-14 Board of Regents, The University of Texas System Compounds and methods for theranostic targeting of parp activity
WO2022240741A1 (en) 2021-05-12 2022-11-17 Dana-Farber Cancer Institute, Inc. Lag3 and gal3 inhibitory agents, xbp1, cs1, and cd138 peptides, and methods of use thereof
WO2023285552A1 (en) 2021-07-13 2023-01-19 BioNTech SE Multispecific binding agents against cd40 and cd137 in combination therapy for cancer
WO2023061930A1 (en) 2021-10-11 2023-04-20 BioNTech SE Therapeutic rna for lung cancer
WO2023077090A1 (en) 2021-10-29 2023-05-04 Bristol-Myers Squibb Company Lag-3 antagonist therapy for hematological cancer
WO2023147371A1 (en) 2022-01-26 2023-08-03 Bristol-Myers Squibb Company Combination therapy for hepatocellular carcinoma
WO2023164638A1 (en) 2022-02-25 2023-08-31 Bristol-Myers Squibb Company Combination therapy for colorectal carcinoma
WO2023168404A1 (en) 2022-03-04 2023-09-07 Bristol-Myers Squibb Company Methods of treating a tumor
WO2023170606A1 (en) 2022-03-08 2023-09-14 Alentis Therapeutics Ag Use of anti-claudin-1 antibodies to increase t cell availability
WO2023178329A1 (en) 2022-03-18 2023-09-21 Bristol-Myers Squibb Company Methods of isolating polypeptides
WO2023235847A1 (en) 2022-06-02 2023-12-07 Bristol-Myers Squibb Company Antibody compositions and methods of use thereof
WO2024107731A3 (en) * 2022-11-14 2024-08-15 Ablexis, Llc Anti-pd-l1 antibodies
WO2024116140A1 (en) 2022-12-01 2024-06-06 Medimmune Limited Combination therapy for treatment of cancer comprising anti-pd-l1 and anti-cd73 antibodies
WO2024126457A1 (en) 2022-12-14 2024-06-20 Astellas Pharma Europe Bv Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and immune checkpoint inhibitors
WO2024137776A1 (en) 2022-12-21 2024-06-27 Bristol-Myers Squibb Company Combination therapy for lung cancer
WO2024173876A1 (en) 2023-02-17 2024-08-22 Regeneron Pharmaceuticals, Inc. Radiolabeled anti-lag3 antibodies for immuno-pet imaging
WO2024196952A1 (en) 2023-03-20 2024-09-26 Bristol-Myers Squibb Company Tumor subtype assessment for cancer therapy
WO2024194482A1 (en) 2023-03-23 2024-09-26 Invox Pharma Limited Dosage regimens for the administration of a bispecific antibody in combination with chemotherapy
WO2025038763A1 (en) 2023-08-15 2025-02-20 Bristol-Myers Squibb Company Ceramic hydroxyapatite chromatography flow through method
WO2025096478A1 (en) 2023-10-30 2025-05-08 Regeneron Pharmaceuticals, Inc. Stable antibody formulation comprising fianlimab
WO2025121445A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2
WO2025121444A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and anti-vegfr2 antibodies
WO2025120867A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and anti-vegfr2 antibodies
WO2025120866A1 (en) 2023-12-08 2025-06-12 Astellas Pharma Inc. Combination therapy involving bispecific binding agents binding to cldn18.2 and cd3 and agents stabilizing or increasing expression of cldn18.2
WO2025145207A1 (en) 2023-12-29 2025-07-03 Bristol-Myers Squibb Company Combination therapy of kras inhibitor and treg-depleting agent
WO2025184208A1 (en) 2024-02-27 2025-09-04 Bristol-Myers Squibb Company Anti-ceacam5 antibodies and uses thereof
WO2025184211A1 (en) 2024-02-27 2025-09-04 Bristol-Myers Squibb Company Anti-ceacam5 antibody drug conjugates
WO2025226695A1 (en) 2024-04-23 2025-10-30 Regeneron Pharmaceuticals, Inc. Stable antibody formulation
WO2025245489A1 (en) 2024-05-24 2025-11-27 Bristol-Myers Squibb Company Treatment of tumors in subjects having fgl-1 positive samples

Also Published As

Publication number Publication date
JP7085709B2 (ja) 2022-06-17
RS61705B1 (sr) 2021-05-31
SI3472207T1 (sl) 2021-04-30
SMT202100213T1 (it) 2021-05-07
EP3858858A1 (en) 2021-08-04
IL263730A (en) 2019-01-31
JP7464644B2 (ja) 2024-04-09
AR110101A1 (es) 2019-02-27
AU2017283181A1 (en) 2019-01-03
BR112018076519A2 (pt) 2019-04-02
PT3472207T (pt) 2021-03-31
US11214620B2 (en) 2022-01-04
IL263730B1 (en) 2024-02-01
IL263730B2 (en) 2024-06-01
ES2858091T3 (es) 2021-09-29
LT3472207T (lt) 2021-05-10
BR112018076519A8 (pt) 2022-07-12
JP2022095746A (ja) 2022-06-28
JP2019526273A (ja) 2019-09-19
CN109563171B (zh) 2023-09-19
RU2018143241A (ru) 2020-07-21
CA3027612A1 (en) 2017-12-28
PL3472207T3 (pl) 2021-07-12
KR20230035680A (ko) 2023-03-14
KR20190019144A (ko) 2019-02-26
CN109563171A (zh) 2019-04-02
SG11201811064TA (en) 2019-01-30
US20190256602A1 (en) 2019-08-22
HRP20210602T1 (hr) 2021-05-14
KR102664891B1 (ko) 2024-05-13
CY1124232T1 (el) 2022-05-27
EP3472207A1 (en) 2019-04-24
HUE053742T2 (hu) 2021-07-28
MX2018016320A (es) 2019-05-30
EP3472207B1 (en) 2021-01-20
DK3472207T3 (da) 2021-04-12
TW201803906A (zh) 2018-02-01
AU2017283181B2 (en) 2024-08-15
RU2018143241A3 (enExample) 2020-11-11
US20220185894A1 (en) 2022-06-16

Similar Documents

Publication Publication Date Title
JP7464644B2 (ja) Pd-l1及びlag-3に結合する結合分子
US12187798B2 (en) LAG-3 binding members
KR20210030956A (ko) Pd-l1 및 cd137에 결합하는 항체 분자
HK40057934A (en) Binding molecules binding pd-l1 and lag-3
RU2784388C2 (ru) СВЯЗЫВАЮЩИЕ МОЛЕКУЛЫ, СВЯЗЫВАЮЩИЕ PD-L1 и LAG-3
RU2784388C9 (ru) СВЯЗЫВАЮЩИЕ МОЛЕКУЛЫ, СВЯЗЫВАЮЩИЕ PD-L1 и LAG-3
HK40001116A (en) Binding molecules binding pd-l1 and lag-3
HK40001116B (en) Binding molecules binding pd-l1 and lag-3
HK40001083B (en) Lag-3 binding members
HK40001083A (en) Lag-3 binding members

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17752291

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 3027612

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2019518147

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112018076519

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2017283181

Country of ref document: AU

Date of ref document: 20170620

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20197001122

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017752291

Country of ref document: EP

Effective date: 20190121

ENP Entry into the national phase

Ref document number: 112018076519

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20181219

WWW Wipo information: withdrawn in national office

Ref document number: 749115

Country of ref document: NZ