WO2015106052A1 - Factor viii chimeric proteins and uses thereof - Google Patents

Factor viii chimeric proteins and uses thereof Download PDF

Info

Publication number
WO2015106052A1
WO2015106052A1 PCT/US2015/010738 US2015010738W WO2015106052A1 WO 2015106052 A1 WO2015106052 A1 WO 2015106052A1 US 2015010738 W US2015010738 W US 2015010738W WO 2015106052 A1 WO2015106052 A1 WO 2015106052A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
fviii
protein
chimeric protein
domain
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2015/010738
Other languages
English (en)
French (fr)
Inventor
Ekta Seth Chhabra
Tongyao Liu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Biogen MA Inc
Original Assignee
Biogen MA Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=53524349&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2015106052(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to CN202310343186.XA priority Critical patent/CN116621991A/zh
Priority to MX2016008958A priority patent/MX389878B/es
Priority to EA201691111A priority patent/EA201691111A1/ru
Priority to UAA201607049A priority patent/UA120917C2/uk
Priority to US15/110,673 priority patent/US11192936B2/en
Priority to CN202310324943.9A priority patent/CN117106095A/zh
Priority to RS20220879A priority patent/RS63583B1/sr
Priority to LTEPPCT/US2015/010738T priority patent/LT3091997T/lt
Priority to IL246476A priority patent/IL246476B/en
Priority to BR112016015512-2A priority patent/BR112016015512B1/pt
Priority to SG11201605242YA priority patent/SG11201605242YA/en
Priority to JP2016545930A priority patent/JP6749836B2/ja
Priority to BR122023020301-1A priority patent/BR122023020301B1/pt
Priority to KR1020167021744A priority patent/KR102409250B1/ko
Priority to IL282168A priority patent/IL282168B2/en
Priority to MYPI2016001276A priority patent/MY192481A/en
Priority to AU2015204646A priority patent/AU2015204646B2/en
Application filed by Biogen MA Inc filed Critical Biogen MA Inc
Priority to HRP20220960TT priority patent/HRP20220960T1/hr
Priority to CN202510297383.1A priority patent/CN120209161A/zh
Priority to ES15735473T priority patent/ES2927475T3/es
Priority to PH1/2016/501323A priority patent/PH12016501323B1/en
Priority to DK15735473.9T priority patent/DK3091997T5/da
Priority to PL15735473.9T priority patent/PL3091997T3/pl
Priority to EP22181403.1A priority patent/EP4176894B1/en
Priority to SI201531867T priority patent/SI3091997T1/sl
Priority to CN202210167747.0A priority patent/CN114736305B/zh
Priority to CA2935954A priority patent/CA2935954C/en
Priority to NZ721544A priority patent/NZ721544A/en
Priority to CN201580009942.9A priority patent/CN106456718B/zh
Priority to CN202310334224.5A priority patent/CN116731201A/zh
Priority to EP15735473.9A priority patent/EP3091997B1/en
Priority to EP24157036.5A priority patent/EP4389139A3/en
Publication of WO2015106052A1 publication Critical patent/WO2015106052A1/en
Anticipated expiration legal-status Critical
Priority to AU2020277146A priority patent/AU2020277146B2/en
Priority to US17/519,719 priority patent/US20220275057A1/en
Priority to AU2024205200A priority patent/AU2024205200A1/en
Priority to NL301303C priority patent/NL301303I2/nl
Priority to LTPA2024536C priority patent/LTPA2024536I1/lt
Priority to FR24C1052C priority patent/FR24C1052I2/fr
Priority to US19/029,777 priority patent/US20250289869A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/745Blood coagulation or fibrinolysis factors
    • C07K14/755Factors VIII, e.g. factor VIII C (AHF), factor VIII Ag (VWF)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/36Blood coagulation or fibrinolysis factors
    • A61K38/37Factors VIII
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/04Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/30Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/31Fusion polypeptide fusions, other than Fc, for prolonged plasma life, e.g. albumin

Definitions

  • Haemophilia A is a bleeding disorder caused by defects in the gene encoding coagulation factor VIII (FVIII) and affects 1-2 in 10,000 male births. Graw et al, Nat. Rev. Genet. 6(6): 488- 501 (2005). Patients affected with hemophilia A can be treated with infusion of purified or recombinantly produced FVIII. All commercially available FVIII products, however, are known to have a half- life of about 8-12 hours, requiring frequent intravenous administration to the patients. See Weiner M.A. and Cairo, M.S., Pediatric Hematology Secrets, Lee, M.T., 12. Disorders of Coagulation, Elsevier Health Sciences, 2001 ; Lillicrap, D.
  • FVIII coagulation factor VIII
  • VWF Plasma von Willebrand Factor
  • ADAMTS- 13 a disintegrin and metalloprotease with thrombospondin motif- 13
  • the activated FVIII together with activated factor IX, calcium, and phospholipid ("tenase complex"), induces the activation of factor X, generating large amounts of thrombin.
  • Thrombin in turn, then cleaves fibrinogen to form soluble fibrin monomers, which then spontaneously polymerize to form the soluble fibrin polymer.
  • Thrombin also activates factor XIII, which, together with calcium, serves to crosslink and stabilize the soluble fibrin polymer, forming crosslmked (insoluble) fibrin.
  • the activated FVIII is cleared fast from the circulation by proteolysis.
  • the present invention provides a chimeric protein comprising (i) a first polypeptide which comprises a Factor VIII (“FVIII”) protein fused to a first immunoglobulin (“Ig") constant region or a portion thereof and (ii) a second polypeptide which comprises a von Willebrand Factor ("VWF") protein comprising a D' domain and a D3 domain of VWF fused to a second Ig constant region or a portion thereof by an XTEN sequence in-between, wherein the XTEN sequence contains less than 288 amino acid residues and wherein the first polypeptide is linked to or associated with the second polypeptide.
  • Certain embodiments include the chimeric protein as described herein, wherein the XTEN sequence in the second polypeptide consists of an amino acid sequence having a length of between 12 amino acids and 287 amino acids.
  • chimeric protein as described herein, wherein the chimeric protein exhibits a longer half-life compared to a corresponding fusion protein comprising the first polypeptide and the second polypeptide wherein the second polypeptide of the fusion protein comprises an XTEN sequence containing at least 288 amino acids.
  • AE288 is SEQ ID NO: 8.
  • the chimeric protein as described herein wherein the XTEN sequence of the second polypeptide contains about 36, about 42, about 72, or about 144 amino acids.
  • the XTEN sequence of the second polypeptide is selected from AE42, AE72, AE144, AG42, AG72, or AG144.
  • Some embodiments include the chimeric protein as described herein, wherein the XTEN sequence of the second polypeptide is selected from SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 1 1, SEQ ID NO: 55; SEQ ID NO: 56; SEQ ID NO: 57; SEQ ID NO: 58; SEQ ID NO: 58; SEQ ID NO: 59; SEQ ID NO: 14; SEQ ID NO: 60; SEQ ID NO: 61 ; SEQ ID NO: 62; or SEQ ID NO: 63.
  • the first polypeptide further comprises a second XTEN sequence which links the FVIII protein with the first Ig constant region or a portion thereof. Also disclosed is the chimeric protein as described herein, wherein the first polypeptide comprises a third XTEN sequence which is inserted at one or more insertion sites within the FVIII protein. In some embodiments the first polypeptide further comprises a second XTEN sequence which is inserted at one or more insertion sites within the FVIII protein. In certain embodiments, the first polypeptide comprises a third XTEN sequence which links the FVIII protein with the first Ig constant region or a portion thereof.
  • the chimeric protein as described herein wherein the second XTEN sequence, the third XTEN sequence, or the second and third XTEN sequences are each independently selected from AE42, AE72, AE864, AE576, AE288, AE144, AG864, AG576, AG288, and AG144.
  • the second XTEN sequence, the third XTEN sequence, or the second and third XTEN sequences are each independently selected from SEQ ID NO: 8; SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 1 1, SEQ ID NO: 17; SEQ ID NO: 54; SEQ ID NO: 19; SEQ ID NO: 16; SEQ ID NO: 18; SEQ ID NO: 15; SEQ ID NO: 55; SEQ ID NO: 56; SEQ ID NO: 57; SEQ ID NO: 58; SEQ ID NO: 59; SEQ ID NO: 14; SEQ ID NO: 60; SEQ ID NO: 61 ; SEQ ID NO: 62; or SEQ ID NO: 63.
  • the second XTEN sequence, the third XTEN sequence, or both the second and third XTEN sequences are each independently AE288 or AG288.
  • the XTEN sequence in the second polypeptide is fused to the second Ig constant region or a portion thereof by a linker.
  • the linker is a cleavable linker.
  • Some embodiments include the chimeric protein as described herein, wherein the linker is cleavable by a protease selected from factor XIa, factor Xlla, kallikrein, factor Vila, factor IXa, factor Xa, factor Ila (thrombin), Elastase-2, Granzyme-B, TEV, Enterokinase, Protease 3C, Sortase A, MMP-12, MMP-13, MMP- 17, and MMP-20.
  • the linker is cleavable by factor Ila (thrombin).
  • the linker comprises one or more cleavage sites comprising an amino acid sequence selected from RRRR (SEQ ID NO: 102), RKRRKR (SEQ ID NO: 103), RRRRS (SEQ ID NO: 104), TQSFNDFTR (SEQ ID NO: 1), SVSQTSKLTR (SEQ ID NO: 3), DFLAEGGGVR (SEQ ID NO: 4), TTKIKPR (SEQ ID NO: 5), LVPRG (SEQ ID NO: 6), ALRPR (SEQ ID NO: 7), KLTRAET (SEQ ID NO: 121), DFTRVVG (SEQ ID NO: 122), TMTRIVGG (SEQ ID NO: 123), SPFRSTGG (SEQ ID NO: 124), LQVRIVGG (SEQ ID NO: 125), PLGRIVGG (SEQ ID NO: 126), IEGRTVGG (SEQ ID NO: 127), LTPRSL
  • the linker comprises TLDPRSFLLRNPNDKYEPFWEDEEK (SEQ ID NO: 146).
  • the cleavage sites comprise an amino acid sequence of LVPRG (SEQ ID NO:6).
  • the cleavage site comprises an amino acid sequence of IEPRSFS (SEQ ID NO: 194).
  • the cleavage site comprises an amino acid sequence of IEPRSFS (SEQ ID NO: 194), wherein the cleavage site is not the full length a2 region of FVIII.
  • the cleavage site comprises a fragment of an a2 region of FVIII comprising at least the sequence IEPR (SEQ ID NO: 200).
  • the cleavage site comprises a fragment of an a2 region of FVIII comprising at least the sequence IEPR (SEQ ID NO: 200), wherein the cleavage site is not the full length a2 region.
  • the cleavage site is cleavable in a thrombin cleavage assay as provided herein or as known in the art.
  • Some embodiments include the chimeric protein as described herein, wherein the first Ig constant region or a portion thereof comprises a first Fc region and/or the second Ig constant region or a portion thereof comprises a second Fc region.
  • the first Ig constant region or a portion thereof and the second Ig constant region or a portion thereof extend the half-life of the chimeric protein.
  • the first polypeptide and the second polypeptide is fused by a linker.
  • the first polypeptide and the second polypeptide is fused by a processable linker.
  • the first Ig constant region or a portion thereof is associated with the second Ig constant region or a portion thereof.
  • the first Ig constant region or a portion thereof is associated with the second Ig constant region or a portion thereof by a covalent bond.
  • the covalent bond is a disulfide bond.
  • Some embodiments include the chimeric protein as described herein, wherein the X or XI consists of an amino acid sequence in length between 12 amino acids and 287 amino acids.
  • the chimeric protein as described herein exhibits a longer half-life compared to a corresponding chimeric protein comprising the formula except that the X or XI is AE288.
  • AE288 is SEQ ID NO:8.
  • Some embodiments include the chimeric protein as described herein, wherein the X or XI in the formula contains about 36, about 42, about 72, or about 144 amino acids. In certain embodiments the X or XI in the formula is selected from AE42, AE72, AE144, AG42, AG72, or AG144.
  • the X or XI in the formula is selected from SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 1 1, SEQ ID NO: 55; SEQ ID NO: 56; SEQ ID NO: 57; SEQ ID NO: 58; SEQ ID NO: 59; SEQ ID NO: 14; SEQ ID NO: 60; SEQ ID NO: 61 ; SEQ ID NO: 62; or SEQ ID NO: 63.
  • the X2 comprises an amino acid sequence having a length of at least about 36 amino acids, at least about 42 amino acids, at least about 144 amino acids, at least about 288 amino acids, at least about 576 amino acids, at least about 864 amino acids.
  • the X2 is selected from AE42, AE72, AE864, AE576, AE288, AE144, AG864, AG576, AG288, and AG144.
  • the X2 is selected from SEQ ID NO: 8; SEQ ID NO: 9; SEQ ID NO: 10; SEQ ID NO: 1 1 ; SEQ ID NO: 17; SEQ ID NO: 54; SEQ ID NO: 19; SEQ ID NO: 16; SEQ ID NO: 18; SEQ ID NO: 15; SEQ ID NO: 55; SEQ ID NO: 56; SEQ ID NO: 57; SEQ ID NO: 58; SEQ ID NO: 59; SEQ ID NO: 14; SEQ ID NO: 60; SEQ ID NO: 61 ; SEQ ID NO: 62; or SEQ ID NO: 63.
  • the X2 is AE288 or AG288.
  • the chimeric protein as described herein comprising X or XI and/or X2 that exhibits a longer half- life compared to the chimeric protein not comprising X or XI and/or X2.
  • the LI and/or L2 is a cleavable linker.
  • the L4 and/or L5 is a cleavable linker.
  • the linker is cleavable by a protease selected from factor XIa, factor Xlla, kallikrein, factor Vila, factor IXa, factor Xa, factor Ila (thrombin), Elastase-2, Granzyme-B, TEV, Enterokinase, Protease 3C, Sortase A, MMP-12, MMP-13, MMP- 17, and MMP-20.
  • a protease selected from factor XIa, factor Xlla, kallikrein, factor Vila, factor IXa, factor Xa, factor Ila (thrombin), Elastase-2, Granzyme-B, TEV, Enterokinase, Protease 3C, Sortase A, MMP-12, MMP-13, MMP- 17, and MMP-20.
  • the linker is cleavable by factor Ila (thrombin).
  • Some embodiments include the chimeric protein as described herein, wherein the linker comprises one or more cleavage sites comprising an amino acid sequence selected from RRRR (SEQ ID NO: 102), RKRRKR (SEQ ID NO: 103), RRRRS (SEQ ID NO: 104), TQSFNDFTR (SEQ ID NO: 2), SVSQTSKLTR (SEQ ID NO: 3), DFLAEGGGVR (SEQ ID NO: 4), TTKIKPR (SEQ ID NO: 5), LVPRG (SEQ ID NO: 6), ALRPR (SEQ ID NO: 7), KLTRAET (SEQ ID NO: 121), DFTRVVG (SEQ ID NO: 122), TMTRIVGG (SEQ ID NO: 123), SPFRSTGG (SEQ ID NO: 124), LQVRIVGG (SEQ ID NO: 125), PLGRIVGG (SEQ ID NO: 126), IEGRTVGG (SEQ ID NO: 127), LTPR
  • the linker comprises TLDPRSFLLRNPNDKYEPFWEDEEK (SEQ ID NO: 146). In certain embodiments the linker comprises an amino acid sequence of LVPRG (SEQ ID NO: 6). In some embodiments the linker comprises an al region of FVIII, an a2 region of FVIII, an a3 region of FVIII, or any combination thereof. In certain embodiments the linker comprises a fragment of the a2 region of FVIII. The fragment of the a2 region can in some cases comprise the sequence DKNTGD YYED S YEDI S AYLLSKNNAIEPRSF S (SEQ ID NO: 88).
  • a smaller fragment of the a2 region of FVIII can be used, including a fragment having the sequence of IEPRSFS (SEQ ID NO: 194).
  • the linker comprises the amino acid sequence of IEPRSFS (SEQ ID NO: 194).
  • the linker comprises the amino acid sequence of IEPRSFS (SEQ ID NO: 194), wherein the linker is not the full-length a2 region of FVIII.
  • the a2 region of FVIII comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, or 100% identical to either ISDKNTGDYYEDSYEDISAYLLSKN AIEPRSFS (SEQ ID NO: 106) or DKNTGDYYEDSYEDISAYLLSKNNAIEPRSFS (SEQ ID NO: 88).
  • the al region comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, or 100% identical to I SMKNNEEAED YDDDLTD SEMD VVRFDDDNSP SFIQIRS V (SEQ ID NO: 107).
  • the a3 region comprises an amino acid sequence at least about 80%, about 85%, about 90%, about 95%, or 100% identical to ISEITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPRSFQ (SEQ ID NO: 108).
  • the Fl comprises a first Fc region and/or the F2 comprises a second Fc region.
  • Some embodiments include the chimeric protein as described herein, wherein the chimeric protein comprising the Fl and the F2 exhibits a longer half-life compared to the chimeric protein not comparing the F 1 and the F2.
  • the L3 is a processable linker.
  • the VWF protein is associated with the FVIII protein by a non- covalent bond.
  • the half-life of the chimeric protein is extended compared to a FVIII protein without the VWF protein and/or the XTEN sequence or compared to wild type FVIII.
  • the half-life of the chimeric protein is extended at least about 1.5 times, at least about 2 times, at least about 2.5 times, at least about 3 times, at least about 4 times, at least about 5 times, at least about 6 times, at least about 7 times, at least about 8 times, at least about 9 times, at least about 10 times, at least about 1 1 times, or at least about 12 times longer than a FVIII protein without the VWF protein or the XTEN sequence or than wild type FVIII.
  • the chimeric protein as described herein, wherein the half-life of the chimeric protein is at least about 17 hours, at least about 18 hours, at least about 19 hours, at least about 20 hours, at least about 21 hours, at least about 22 hours, at least about 23 hours, at least about 24 hours, at least about 25 hours, at least about 26 hours, at least about 27 hours, at least about 28 hours, at least about 29 hours, at least about 30 hours, at least about 31 hours, at least about 32 hours, at least about 33 hours, at least about 34 hours, at least about 35 hours, at least about 36 hours, at least about 48 hours, at least about 60 hours, at least about 72 hours, at least about 84 hours, at least about 96 hours, or at least about 108 hours.
  • the half-life of the chimeric protein is about 40 hours in HemA mice.
  • the VWF protein does not bind substantially to a VWF clearance receptor.
  • the VWF protein is capable of protecting the FVIII protein from one or more protease cleavages, protecting the FVIII protein from activation, stabilizing the heavy chain and/or the light chain of the FVIII protein, or preventing clearance of the FVIII protein by one or more scavenger receptors.
  • Some embodiments include the chimeric protein as described herein, wherein the VWF protein inhibits or prevents endogenous VWF from binding to the FVIII protein by shielding or blocking a VWF binding site on the FVIII protein.
  • the VWF binding site is located in the A3 domain or the C2 domain of the FVIII protein or both the A3 domain and the C2 domain.
  • the VWF binding site comprises the amino acid sequence corresponding to amino acids 1669 to 1689 and 2303 to 2332 of SEQ ID NO: 65.
  • the first Ig constant region or a portion thereof and the second Ig constant region or a portion thereof are identical or different.
  • the FVIII protein is linked to and/or inserted with at least two XTEN sequences, at least three XTEN sequences, at least four XTEN sequences, at least five XTEN sequences, or at least six XTEN sequences.
  • the FVIII protein comprises one or more domains of FVIII selected from an Al domain, al acidic region, an A2 domain, a2 acidic region, a B domain, an A3 domain, a3 acidic region, a CI domain, a C2 domain, one or more fragments thereof, and any combinations thereof.
  • the chimeric protein as described herein wherein the one or more insertion sites in the FVIII protein is located within one or more domains of the FVIII protein selected from the Al domain, the al acidic region, the A2 domain, the a2 acidic region, the A3 domain, the B domain, the C 1 domain, the C2 domain, and any combinations thereof or between one or more domains of the FVIII protein selected from the group consisting of the Al domain and al acidic region, the al acidic region and A2 domain, the A2 domain and a2 acidic region, the a2 acidic region and B domain, the B domain and A3 domain, the A3 domain and C 1 domain, the C 1 domain and C2 domain, and any combinations thereof or between two domains of the FVIII protein selected from the Al domain and al acidic region, the al acidic region and A2 domain, the A2 domain and a2 acidic region, the a2 acidic region and B domain, the B domain and A3 domain, the A3 domain and
  • the one or more insertion sites in the FVIII protein are one or more amino acids selected from the group consisting of the amino acid residues in Table 7, Table 8, Table 9 and Table 10.
  • the insertion sites in the FVIII protein are located immediately downstream of amino acid 745 corresponding to the mature FVIII protein (SEQ ID NO: 65).
  • the insertion sites in the FVIII protein are located immediately downstream of residue 1656 and residue 1900 corresponding to the mature FVIII protein (SEQ ID NO: 65).
  • the insertion sites in the FVIII protein are immediately downstream of residues 26, 1656, and 1900 corresponding to the mature FVIII protein (SEQ ID NO: 65).
  • the insertion sites in the FVIII protein are immediately downstream of residues 403 and 745 corresponding to the mature FVIII protein (SEQ ID NO: 65). In some embodiments the insertion sites in the FVIII protein are immediately downstream of residues 745 and 1900 corresponding to the mature FVIII protein (SEQ ID NO: 65). In certain embodiments the insertion sites in the FVIII protein are immediately downstream of residues 18 and 745 corresponding to the mature FVIII protein (SEQ ID NO: 65). In some embodiments the FVIII protein is a dual chain FVIII isoform. In some embodiments the FVIII protein is a single chain FVIII isoform. In certain embodiments the FVIII protein comprises B domain or a portion thereof. In some embodiments the FVIII protein is SQ B domain deleted FVIII.
  • Some embodiments include the chimeric protein as described herein, wherein the single chain FVIII isoform contains at least one amino acid substitution at a residue corresponding to residue 1648, residue 1645, or both residues corresponding to the full-length mature Factor VIII polypeptide (SEQ ID NO: 65) or residue 754, residue 751, or both residues of SQ BDD Factor VIII (SEQ ID NO: 67).
  • the amino acid substitution is an amino acid other than arginine.
  • the dual chain FVIII isoform comprises a first chain comprising a heavy chain of FVIII and a second chain comprising a light chain of FVIII, wherein the heavy chain and the light chain are associated with each other by a metal bond.
  • the D' domain comprises an amino acid sequence at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 764 to 866 of SEQ ID NO: 21.
  • the D3 domain comprises an amino acid sequence at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 867 to 1240 of SEQ ID NO: 21.
  • the VWF protein is a monomer.
  • chimeric protein as described herein, which comprises at least two amino acids
  • VWF proteins at least three VWF proteins, at least four VWF proteins, at least five VWF proteins, or at least six VWF proteins.
  • the VWF protein comprises an amino acid sequence at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 764 to 1240 of SEQ ID NO: 21.
  • the VWF protein consists essentially of or consists of amino acids 764 to 1240 of SEQ ID NO: 21.
  • the VWF protein contains at least one amino acid substitution at a residue corresponding to residue 1099, residue 1 142, or both residues 1099 and 1 142 of SEQ ID NO: 21.
  • the VWF protein contains an amino acid other than cysteine substituted for a residue corresponding to residue 1099, residue 1 142, or both residues 1099 and 1 142 of SEQ ID NO: 21.
  • the VWF protein further comprises the D 1 domain, the D2 domain, or the D 1 and D2 domains of VWF.
  • Some embodiments include the chimeric protein as described herein, wherein the VWF protein further comprises a VWF domain selected from the Al domain, the A2 domain, the A3 domain, the D4 domain, the B l domain, the B2 domain, the B3 domain, the CI domain, the C2 domain, the CK domain, one or more fragments thereof, and any combinations thereof.
  • the chimeric protein as described herein, wherein the VWF protein consists essentially of or consists of: (1) the D' and D3 domains of VWF or fragments thereof; (2) the Dl, D', and D3 domains of VWF or fragments thereof; (3) the D2, D', and D3 domains of VWF or fragments thereof; (4) the D 1 , D2, D', and D3 domains of VWF or fragments thereof; or (5) the Dl, D2, D', D3, and Al domains of VWF or fragments thereof.
  • Some embodiments include the chimeric protein as described herein, wherein the VWF protein further comprises a signal peptide of VWF or FVIII which is operably linked to the VWF protein.
  • linkers have a length of at least about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 1 10, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1200, 1400, 1600, 1800, or 2000 amino acid residues. In some embodiments one or more of the linkers have a length of about 1 to about 2000 amino acid residues. In certain embodiments one or more of the linkers comprise a gly/ser peptide.
  • the gly/ser peptide has a formula of (Gly 4 Ser) n (SEQ ID NO: 94) or S(Gly 4 Ser) n (SEQ ID NO: 164), wherein n is a positive integer selected from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9 and 10.
  • the (Gly 4 Ser) n linker is (Gly 4 Ser) 3 (SEQ ID NO: 100) or (Gly 4 Ser) 4 (SEQ ID NO: 165).
  • the linker comprises 20 amino acids, 35 amino acids, 48 amino acids, 73 amino acids, or 95 amino acids.
  • the cleavable linker is SGGGGSGGGGSGGGGSGGGGSGGGGSLVPRGSGG (SEQ ID NO: 166).
  • the chimeric protein as described herein is polysialylated, pegylated, or hesylated.
  • the first polypeptide comprises at least about 80%, 90%, 95%, 99%, or 100% identical to FVIII161 (SEQ ID NO: 69), FVIII169 (SEQ ID NO: 70), FVIII173 (SEQ ID NO: 72), FVIII195 (SEQ ID NO: 73), FVIII196 (SEQ ID NO: 74), FVIII199 (SEQ ID NO: 75), FVIII201 (SEQ ID NO: 76), FVIII203 (SEQ ID NO: 77), FVIII204 (SEQ ID NO: 78), FVIII205 (SEQ ID NO: 79), FVIII266 (SEQ ID NO: 80), FVIII267 (SEQ ID NO: 81), FVIII268 (SEQ ID NO: 82), FVIII269 (SEQ ID NO: 83), FVIII271 (SEQ ID NO: 84), FVIII272 (SEQ ID NO: 85), or
  • the first polypeptide comprises FVIII 169 (SEQ ID NO: 70) and the second polypeptide comprises VWF057 (SEQ ID NO: 152). In other embodiments, the first polypeptide comprises FVIII 169 (SEQ ID NO: 70) and the second polypeptide comprises VWF059 (SEQ ID NO: 197). In yet another embodiment, the first polypeptide comprises FVIII169 (SEQ ID NO: 70) and the second polypeptide comprises VWF062 (SEQ ID NO: 199). In some embodiments, the chimeric protein is efficacious in preventing and/or stopping bleeding from a subject in need thereof.
  • polynucleotide or a set of polynucleotides encoding the chimeric protein as described herein further comprises a polynucleotide chain, which encodes PC5 or PC7.
  • Some embodiments include a vector comprising the polynucleotide as described herein and one or more promoter operably linked to the polynucleotide or the set of polynucleotides.
  • the vector as described herein further comprises an additional vector, which comprises a polynucleotide chain encoding PC5 or PC7.
  • a host cell comprising the polynucleotide or the vector as described herein.
  • the host cell is a mammalian cell.
  • the mammalian cell is selected from HEK293 cell, CHO cell, and BHK cell.
  • a pharmaceutical composition comprising the chimeric protein, the polynucleotide, the vector, or the host cell as described herein, and a pharmaceutically acceptable carrier.
  • the chimeric protein has extended half-life compared to wild type FVIII protein.
  • the half-life of the chimeric protein is extended at least about 1.5 times, at least about 2 times, at least about 2.5 times, at least about 3 times, at least about 4 times, at least about 5 times, at least about 6 times, at least about 7 times, at least about 8 times, at least about 9 times, at least about 10 times, at least about 1 1 times, or at least about 12 times longer than wild type FVIII.
  • Some embodiments include the composition as described herein, wherein the half-life of the chimeric protein is at least about 17 hours, at least about 18 hours, at least about 19 hours, at least about 20 hours, at least about 21 hours, at least about 22 hours, at least about 23 hours, at least about 24 hours, at least about 25 hours, at least about 26 hours, at least about 27 hours, at least about 28 hours, at least about 29 hours, at least about 30 hours, at least about 31 hours, at least about 32 hours, at least about 33 hours, at least about 34 hours, at least about 35 hours, at least about 36 hours, at least about 48 hours, at least about 60 hours, at least about 72 hours, at least about 84 hours, at least about 96 hours, or at least about 108 hours.
  • the half-life of the chimeric protein is about 40 hours in HemA mice.
  • the composition as described herein is administered by a route selected from the group consisting of topical administration, intraocular administration, parenteral administration, intrathecal administration, subdural administration and oral administration.
  • the parenteral administration is intravenous or subcutaneous administration.
  • the composition as described herein is used to treat a bleeding disease or condition in a subject in need thereof.
  • the bleeding disease or condition is selected from the group consisting of a bleeding coagulation disorder, hemarthrosis, muscle bleed, oral bleed, hemorrhage, hemorrhage into muscles, oral hemorrhage, trauma, trauma capitis, gastrointestinal bleeding, intracranial hemorrhage, intra-abdominal hemorrhage, intrathoracic hemorrhage, bone fracture, central nervous system bleeding, bleeding in the retropharyngeal space, bleeding in the retroperitoneal space, bleeding in the illiopsoas sheath and any combinations thereof.
  • the subject is scheduled to undergo a surgery.
  • the treatment is prophylactic or on-demand.
  • Also disclosed is a method of extending or increasing half-life of the chimeric protein comprising adding an effective amount of the chimeric protein, the polynucleotide, the vector, the host cell, or the composition as described herein to a subject in need thereof, wherein the VWF protein, the XTEN sequence, the first Ig constant region or a portion thereof, and the second Ig constant region or a portion thereof increase the half-life of the chimeric protein.
  • Some embodiments include a method of treating a bleeding disease or disorder in a subject in need thereof comprising administering an effective amount of the chimeric protein, the polynucleotide, the vector, the host cell, or the composition as described herein, wherein the bleeding disease or disorder is selected from the group consisting of a bleeding coagulation disorder, hemarthrosis, muscle bleed, oral bleed, hemorrhage, hemorrhage into muscles, oral hemorrhage, trauma, trauma capitis, gastrointestinal bleeding, intracranial hemorrhage, intraabdominal hemorrhage, intrathoracic hemorrhage, bone fracture, central nervous system bleeding, bleeding in the retropharyngeal space, bleeding in the retroperitoneal space, and bleeding in the illiopsoas sheath.
  • a bleeding coagulation disorder hemarthrosis
  • muscle bleed oral bleed
  • hemorrhage hemorrhage into muscles
  • oral hemorrhage trauma, trauma capitis
  • the subject is an animal. In certain embodiments the animal is a human. In some embodiments the subject is suffering from hemophilia A. In certain embodiments the treatment is prophylactic or on-demand. In some embodiments the effective amount is 0.1 ⁇ g/kg to 500 mg/kg.
  • a method as described herein wherein the chimeric protein, the polynucleotide, the vector, the host cell, or the composition as described herein is administered by a route selected from the group consisting of topical administration, intraocular administration, parenteral administration, intrathecal administration, subdural administration and oral administration.
  • the parenteral administration is selected from the group consisting of intravenous administration, subcutaneous administration, intramuscular administration, and intradermal administration.
  • Some embodiments include a method of making a chimeric protein, comprising transfecting one or more host cell with the polynucleotide or the vector as described herein and expressing the chimeric protein in the host cell.
  • the method as described herein further comprises isolating the chimeric protein.
  • the chimeric protein is efficacious in stopping and/or preventing bleeding in the subject.
  • FIG. 1 shows a schematic diagram of a chimeric protein comprising a first polypeptide which comprises a FVIII protein (Al-A2-partial or full B-A3-C1-C2) fused to an Fc region, wherein an XTEN is inserted at an insertion site within the FVIII protein and a second polypeptide which comprises a VWF protein comprising D'D3 domains, an XTEN having less than 288 amino acids, a thrombin cleavable linker, and a second Fc region.
  • XTEN insertions in the FVIII protein and/or fusions to the VWF protein extend a half-life of the chimeric protein by increasing the hydrodynamic radius and by blocking receptor-mediated clearance.
  • the D'D3 domains of VWF block FVIII interaction with endogenous VWF, stabilize the FVIII protein, and extend a half-life of the chimeric protein.
  • the Fc domains can covalently link the D'D3 domains with the FVIII protein and extend a half-life of the chimeric protein through FcRn-mediated recycling pathway.
  • the thrombin-cleavable linker enables a release of the D'D3 domains upon FVIII activation and ensures the correct alignment between FVIII and the D'D3 domains of VWF.
  • Figure 2 shows three plasmid expression system for FVIII-XTEN-Fc:D'D3-XTEN-Fc heterodimers: a first plasmid comprising a nucleotide sequence encoding single chain FVIII- XTEN-Fc in which an XTEN is inserted in the B domain; a second plasmid comprising a nucleotide sequence encoding D 1D2D'D3-XTEN-Fc, in which the XTEN sequence comprises less than 288 amino acids; and a third plasmid comprising a nucleotide sequence encoding PACE, a propeptide processing enzyme.
  • the D1D2 propeptide domains of VWF can be processed from the D'D3 domains by intracellular processing.
  • the resulting complex contains three products, the first molecule being FVIII-XTEN/D'D3 heterodimers, the second molecule being a by-product, homodimer of D'D3- XTEN-Fc, and the third molecule being another by-product, i.e., FVIII(XTEN)-Fc.
  • FIG. 3 shows additive effects of XTEN insertions on the half-life extension of the heterodimers.
  • FVIII 169 comprises a B domain deleted FVIII protein fused to an Fc region, wherein an XTEN sequence (e.g., AE288) is inserted at amino acid 745 corresponding to mature full length FVIII.
  • FVIII205 comprises a B domain deleted FVIII protein fused to an Fc region, wherein an XTEN sequence (e.g., AE144) is inserted at amino acid 18 corresponding to mature full length FVIII and another XTEN sequence (e.g., AE288) is inserted at amino acid 745 corresponding to mature full length FVIII.
  • VWF031 comprises a D' domain and a D3 domain of VWF fused to an Fc region by a thrombin cleavable linker (no XTEN).
  • VWF034 comprises a D' domain and a D3 domain of VWF fused to AE288 and an Fc region.
  • the half-life of FVIII 169/VWF031 is 16.7 hours in HemA mice; the half-life of FVIII205/VWF031 (circle) is 29.4 hours in HemA mice; and the half-life of FVIII 169/VWF034 (square) is 31.1 hours in HemA mice.
  • Figure 4 shows that AE144 XTEN confers better half-life extension than AE288 XTEN when inserted between the D'D3 domains of VWF and Fc domains.
  • VWF169/VWF034 square
  • FVIII 169/VWF057 circle
  • VWF057 comprises D'D3 domains of VWF fused to AE144 and an Fc region.
  • FIG. 5 shows that Fc domains are needed for half-life extension of the chimeric protein heterodimers.
  • Figure 6A shows similar acute efficacy of FVIII -XTEN-Fc/D'D3-XTEN-Fc heterodimers compared to B domain deleted FVIII (SQ BDD FVIII) in HemA mice tail clip model. Mice were dosed at 75 IU/kg, and the activity was measured by aPTT assay. SQ BDD FVIII is shown as circle while FVIII 169/VWF034 is shown as square, FVIII 169/VWF057 is shown as diamond, and vehicle is shown as inverted triangle. The construct details of FVIII 169, VWF034, and VWF057 are shown elsewhere herein.
  • Figure 6B shows a comparison of the acute efficacy of FVIII 169/VWF034 with B domain deleted FVIII (SQ BDD FVIII) in HemA mice at 37.5 IU/kg dose, and the activity was measured by aPTT assay.
  • mice in each treatment groups are indicated by the horizontal lines, blood loss (uL) in C57/BL6 mice is shown as hollow triangle; the blood loss (uL) after dosing of 37.5 IU/kg of rBDD-FVIII is shown as hollow circle; the blood loss (uL) after dosing of 37.5 IU/kg FVIII 169/VWF034 is shown as hollow square and the blood loss (uL) after dosing of vehicle is shown as inverted triangle.
  • Figures 7A-B show that rFVIII169/VWF057 heterodimer provides longer protection to
  • FIG. 7A shows the rebleeding data in mice that received rFVIII169/VWF057 at 72 hours before tail injury (square), SQ BDD-FVIII at 48 hours before tail injury (diamond), SQ BDD FVIII at 24 hours before tail injury (inverted triangle), and vehicle (circle). The activity was measured by aPTT assay. X-axis shows time in hours, and the Y axis shows percent of Non-Bleeders.
  • Figure 7B shows the corresponding survival data in the four categories of the mice shown in Figure 7A. The mice received 12 IU/kg of FVriH69/VWF057 72 hours prior to tail injury showed similar protection on re-bleeding and survival compared to the mice received SQ BDD FVIII treatment 24 hour before the tail injury.
  • Figure 8A shows the comparable rebleeding data in mice that received rFVIII-XTEN-
  • Fc/D'D3-XTEN-Fc Heterodimers at 96 hours versus rBDD-FVIII at 24 hours before the injury Filled squares show the rebleeding data in mice received FVIII 169/VWF034 at 24 hours before the injury; hollow squares show the rebleeding data in mice received FVIII 169/VWF034 at 96 hours before the injury; filled diamond show the rebleeding data in mice received FVIII 169/VWF057 at 24 hours before the injury; hollow diamond show the rebleeding data in mice received FVIII 169/VWF057 at 96 hours before the injury; filled circles show the rebleeding data in mice received rBDD-FVIII at 24 hours before the injury; hollow circles show the rebleeding data in mice received rBDD-FVIII at 48 hours before the injury; and filled triangle show the rebleeding data in mice received vehicle.
  • X axis shows time in hours
  • y axis shows percent of
  • Figure 8B shows the survival curve in mice that received rFVIII-XTEN-Fc/D'D3-XTEN-
  • Figure 9 shows a diagram of representative FVIII- VWF heterodimers and FVIII 169,
  • FVIII286, VWF057, VWF059, and VWF062 constructs comprises a B domain deleted FVIII protein with R1648A substitution fused to an Fc region, wherein an XTEN sequence (e.g., AE288) is inserted at amino acid 745 corresponding to mature full length FVIII (Al-al-A2-a2-288XTEN-a3-A3-Cl-C2-Fc).
  • XTEN sequence e.g., AE288
  • FVIII286 construct comprises a B domain deleted FVIII protein with R1648 substitution fused to an Fc region, wherein an XTEN sequence (e.g., AE288) is inserted at amino acid 745 corresponding to mature full length FVIII, with additional a2 region in between FVIII and Fc (Al-al-A2-a2-288XTEN-a3-A3-Cl-C2-a2- Fc).
  • an XTEN sequence e.g., AE288
  • VWF057 is a VWF-Fc fusion construct that comprises D'D3 domain of the VWF protein (with two amino acid substitutions in D'D3 domain, i.e., C336A and C379A) linked to the Fc region via a VWF linker, which comprises LVPRG thrombin site ("LVPRG”; SEQ ID NO: 6) and GS linker ("GS"), wherein an XTEN sequence (i.e., AE144) is inserted between D'D3 domain and the VWF linker (D'D3-144XTEN-GS+LVPRG-Fc).
  • a VWF linker which comprises LVPRG thrombin site ("LVPRG”; SEQ ID NO: 6) and GS linker ("GS"), wherein an XTEN sequence (i.e., AE144) is inserted between D'D3 domain and the VWF linker (D'D3-144XTEN-GS+LVPRG-Fc).
  • VWF059 is a VWF-Fc fusion construct that comprises D'D3 domain of the VWF protein (with two amino acid substitutions in D'D3 domain, i.e., C336A and C379A) linked to the Fc region via an acidic region 2 (a2) of FVIII as a VWF linker, wherein an XTEN sequence (i.e., AE144) is inserted between D'D3 domain and the VWF linker.
  • D'D3 domain of the VWF protein with two amino acid substitutions in D'D3 domain, i.e., C336A and C379A
  • an XTEN sequence i.e., AE144
  • VWF062 is a VWF-Fc fusion construct that comprises D'D3 domain of the VWF protein (with two amino acid substitutions in D'D3 domain, i.e., C336A and C379A) linked to the Fc region, wherein an XTEN sequence (i.e., AE144) is inserted between D'D3 domain and the Fc region (D'D3-144XTEN-Fc).
  • D'D3 domain of the VWF protein with two amino acid substitutions in D'D3 domain, i.e., C336A and C379A
  • an XTEN sequence i.e., AE144
  • FIG. 10 shows a schematic diagram representing FVIII/VWF heterodimer constructs, for example, FVIII169/VWF057, FVIII169/VWF059, FVIII169/VWF059A, and FVIII169/VWF073.
  • the arrow shows the site where an optional linker is added to introduce a thrombin cleavage site.
  • FVIII169/VWF057 has a linker comprising LVPRG (SEQ ID NO: 6).
  • FVIII169/VWF059 has a linker comprising the FVIII a2 region (i.e., ISDK TGDYYEDSYEPISAYLLSK NAIEPRSFSDKTH (SEQ ID NO: 106)).
  • FVIII 169/VWF059A has a linker comprising a truncated FVIII a2 region (i.e., DKNTGDYYEDSYEDISAYLLSKNNAiEPRSFSDKTH (SEQ ID NO: 88)).
  • FVIII 169/VWF073 has a linker within the VWF073 construct (SEQ ID NO: 175) comprising a fragment of the FVIII a2 region consisting of IEPRSFS (SEQ ID NO: 194).
  • Figures 1 1A-C show SDS-PAGE images following thrombin digestion of
  • FIG. 1 1A shows staining of the SDS-PAGE gel with an anti-D3 antibody (AB 96340). Arrows highlight "LCFc:D'D3-XTEN-Fc,” which is the un-cleaved, full-length FVIII 169/VWF057; and "D'D3-144 XTEN,” which is the resulting fragment following cleavage by thrombin.
  • Figure 1 IB shows staining of the SDS-PAGE gel with an anti-HC antibody (GMA012). Arrows highlight the FVIII heavy chain (“HC”) and FVIII A2 domain.
  • Figure 11C shows the overlay of panels A and B. Samples were collected at the time points indicated at the top of each panel. Arrows point to the relevant proteins.
  • Figures 12A-C shows SDS-PAGE images following thrombin digestion of
  • FIG. 12A shows staining of the SDS-PAGE gel with an anti-D3 antibody (AB 96340). Arrows highlight "LCFc:D'D3-XTEN-Fc,” which is the un-cleaved, full-length FVIII 169/VWF059; and "D'D3- 144 XTEN,” which is the resulting fragment following cleavage by thrombin.
  • Figure 12B shows staining of the SDS-PAGE gel with an anti-HC antibody (GMA012).
  • FIG. 12C shows the overlay of panels A and B. Samples were collected at the time points indicated at the top of each panel
  • Figure 13 shows acute efficacy data of HemA mice treated with FVIII 169/VWF059
  • the present invention is directed to a chimeric protein comprising two polypeptides, a first polypeptide comprising a FVIII protein fused to a first Ig constant region and a second polypeptide comprising a VWF protein fused to a second Ig constant region or a portion thereof by an XTEN sequence, wherein the XTEN sequence contains less than 288 amino acids.
  • a or “an” entity refers to one or more of that entity; for example, “a nucleotide sequence,” is understood to represent one or more nucleotide sequences.
  • the terms “a” (or “an”), “one or more,” and “at least one” can be used interchangeably herein.
  • polynucleotide or “nucleotide” is intended to encompass a singular nucleic acid as well as plural nucleic acids, and refers to an isolated nucleic acid molecule or construct, e.g., messenger RNA (mR A) or plasmid DNA (pDNA).
  • a polynucleotide comprises a conventional phosphodiester bond or a non-conventional bond (e.g., an amide bond, such as found in peptide nucleic acids (PNA)).
  • PNA peptide nucleic acids
  • nucleic acid refers to any one or more nucleic acid segments, e.g., DNA or RNA fragments, present in a polynucleotide.
  • isolated nucleic acid or polynucleotide is intended a nucleic acid molecule, DNA or RNA, which has been removed from its native environment.
  • a recombinant polynucleotide encoding a Factor VIII polypeptide contained in a vector is considered isolated for the purposes of the present invention.
  • Further examples of an isolated polynucleotide include recombinant polynucleotides maintained in heterologous host cells or purified (partially or substantially) from other polynucleotides in a solution.
  • Isolated RNA molecules include in vivo or in vitro RNA transcripts of polynucleotides of the present invention.
  • Isolated polynucleotides or nucleic acids according to the present invention further include such molecules produced synthetically.
  • a polynucleotide or a nucleic acid can include regulatory elements such as promoters, enhancers, ribosome binding sites, or transcription termination signals.
  • a "coding region” or “coding sequence” is a portion of polynucleotide which consists of codons translatable into amino acids. Although a “stop codon” (TAG, TGA, or TAA) is typically not translated into an amino acid, it may be considered to be part of a coding region, but any flanking sequences, for example promoters, ribosome binding sites, transcriptional terminators, introns, and the like, are not part of a coding region.
  • coding region typically determined by a start codon at the 5' terminus, encoding the amino terminus of the resultant polypeptide, and a translation stop codon at the 3' terminus, encoding the carboxyl terminus of the resulting polypeptide.
  • Two or more coding regions of the present invention can be present in a single polynucleotide construct, e.g., on a single vector, or in separate polynucleotide constructs, e.g., on separate (different) vectors.
  • a single vector can contain just a single coding region, or comprise two or more coding regions, e.g., a single vector can separately encode a binding domain-A and a binding domain-B as described below.
  • a vector, polynucleotide, or nucleic acid of the invention can encode heterologous coding regions, either fused or unfused to a nucleic acid encoding a binding domain of the invention.
  • Heterologous coding regions include without limitation specialized elements or motifs, such as a secretory signal peptide or a heterologous functional domain.
  • Certain proteins secreted by mammalian cells are associated with a secretory signal peptide which is cleaved from the mature protein once export of the growing protein chain across the rough endoplasmic reticulum has been initiated.
  • signal peptides are generally fused to the N-terminus of the polypeptide, and are cleaved from the complete or "full-length" polypeptide to produce a secreted or "mature" form of the polypeptide.
  • a native signal peptide or a functional derivative of that sequence that retains the ability to direct the secretion of the polypeptide that is operably associated with it.
  • a heterologous mammalian signal peptide e.g. , a human tissue plasminogen activator (TP A) or mouse B-glucuronidase signal peptide, or a functional derivative thereof, can be used.
  • downstream when refers to a nucleotide sequence, means that a nucleic acid or a nucleotide sequence is located 3' to a reference nucleotide sequence.
  • downstream nucleotide sequences relate to sequences that follow the starting point of transcription. For example, the translation initiation codon of a gene is located downstream of the start site of transcription.
  • downstream when refers to a polypeptide sequence, means that the amino acid or an amino acid insertion site is located at the C-terminus of the reference amino acids.
  • an insertion site immediately downstream of amino acid 745 corresponding to the mature wild type FVIII protein means that the insertion site is between amino acid 745 and amino acid 746 corresponding to the mature wild type FVIII protein.
  • upstream refers to a nucleotide sequence that is located 5' to a reference nucleotide sequence.
  • upstream nucleotide sequences relate to sequences that are located on the 5' side of a coding region or starting point of transcription. For example, most promoters are located upstream of the start site of transcription.
  • regulatory region refers to nucleotide sequences located upstream (5' non-coding sequences), within, or downstream (3' non-coding sequences) of a coding region, and which influence the transcription, RNA processing, stability, or translation of the associated coding region. Regulatory regions may include promoters, translation leader sequences, introns, polyadenylation recognition sequences, RNA processing sites, effector binding sites and stem-loop structures. If a coding region is intended for expression in a eukaryotic cell, a polyadenylation signal and transcription termination sequence will usually be located 3' to the coding sequence.
  • a polynucleotide which encodes a gene product can include a promoter and/or other transcription or translation control elements operably associated with one or more coding regions.
  • a coding region for a gene product e.g., a polypeptide
  • a coding region and a promoter are "operably associated" if induction of promoter function results in the transcription of mRNA encoding the gene product encoded by the coding region, and if the nature of the linkage between the promoter and the coding region does not interfere with the ability of the promoter to direct the expression of the gene product or interfere with the ability of the DNA template to be transcribed.
  • Other transcription control elements besides a promoter, for example enhancers, operators, repressors, and transcription termination signals, can also be operably associated with a coding region to direct gene product expression.
  • transcription control regions are known to those skilled in the art. These include, without limitation, transcription control regions which function in vertebrate cells, such as, but not limited to, promoter and enhancer segments from cytomegaloviruses (the immediate early promoter, in conjunction with intron-A), simian virus 40 (the early promoter), and retroviruses (such as Rous sarcoma virus).
  • Other transcription control regions include those derived from vertebrate genes such as actin, heat shock protein, bovine growth hormone and rabbit ⁇ -globin, as well as other sequences capable of controlling gene expression in eukaryotic cells. Additional suitable transcription control regions include tissue-specific promoters and enhancers as well as lymphokine-inducible promoters (e.g., promoters inducible by interferons or interleukins).
  • translation control elements include, but are not limited to ribosome binding sites, translation initiation and termination codons, and elements derived from picomaviruses (particularly an internal ribosome entry site, or IRES, also referred to as a CITE sequence).
  • RNA messenger RNA
  • tRNA transfer RNA
  • shRNA small hairpin RNA
  • siRNA small interfering RNA
  • expression produces a "gene product.”
  • a gene product can be either a nucleic acid, e.g., a messenger RNA produced by transcription of a gene, or a polypeptide which is translated from a transcript.
  • Gene products described herein further include nucleic acids with post transcriptional modifications, e.g., polyadenylation or splicing, or polypeptides with post translational modifications, e.g., methylation, glycosylation, the addition of lipids, association with other protein subunits, or proteolytic cleavage.
  • post transcriptional modifications e.g., polyadenylation or splicing
  • polypeptides with post translational modifications e.g., methylation, glycosylation, the addition of lipids, association with other protein subunits, or proteolytic cleavage.
  • a "vector” refers to any vehicle for the cloning of and/or transfer of a nucleic acid into a host cell.
  • a vector may be a replicon to which another nucleic acid segment may be attached so as to bring about the replication of the attached segment.
  • a "replicon” refers to any genetic element (e.g., plasmid, phage, cosmid, chromosome, virus) that functions as an autonomous unit of replication in vivo, i.e., capable of replication under its own control.
  • the term “vector” includes both viral and nonviral vehicles for introducing the nucleic acid into a cell in vitro, ex vivo or in vivo.
  • Plasmids A large number of vectors are known and used in the art including, for example, plasmids, modified eukaryotic viruses, or modified bacterial viruses. Insertion of a polynucleotide into a suitable vector can be accomplished by ligating the appropriate polynucleotide fragments into a chosen vector that has complementary cohesive termini.
  • Vectors may be engineered to encode selectable markers or reporters that provide for the selection or identification of cells that have incorporated the vector. Expression of selectable markers or reporters allows identification and/or selection of host cells that incorporate and express other coding regions contained on the vector.
  • selectable marker genes known and used in the art include: genes providing resistance to ampicillin, streptomycin, gentamycin, kanamycin, hygromycin, bialaphos herbicide, sulfonamide, and the like; and genes that are used as phenotypic markers, i.e., anthocyanin regulatory genes, isopentanyl transferase gene, and the like.
  • reporters known and used in the art include: luciferase (Luc), green fluorescent protein (GFP), chloramphenicol acetyltransferase (CAT), -galactosidase (LacZ), -glucuronidase (Gus), and the like. Selectable markers may also be considered to be reporters.
  • Plasmid refers to an extra-chromosomal element often carrying a gene that is not part of the central metabolism of the cell, and usually in the form of circular double-stranded DNA molecules.
  • Such elements may be autonomously replicating sequences, genome integrating sequences, phage or nucleotide sequences, linear, circular, or supercoiled, of a single- or double- stranded DNA or RNA, derived from any source, in which a number of nucleotide sequences have been joined or recombined into a unique construction which is capable of introducing a promoter fragment and DNA sequence for a selected gene product along with appropriate 3' untranslated sequence into a cell.
  • Eukaryotic viral vectors that can be used include, but are not limited to, adenovirus vectors, retrovirus vectors, adeno-associated virus vectors, and poxvirus, e.g., vaccinia virus vectors, baculovirus vectors, or herpesvirus vectors.
  • Non-viral vectors include plasmids, liposomes, electrically charged lipids (cytofectins), DNA-protein complexes, and biopolymers.
  • a "cloning vector” refers to a "replicon,” which is a unit length of a nucleic acid that replicates sequentially and which comprises an origin of replication, such as a plasmid, phage or cosmid, to which another nucleic acid segment may be attached so as to bring about the replication of the attached segment.
  • Certain cloning vectors are capable of replication in one cell type, e.g., bacteria and expression in another, e.g., eukaryotic cells.
  • Cloning vectors typically comprise one or more sequences that can be used for selection of cells comprising the vector and/or one or more multiple cloning sites for insertion of nucleic acid sequences of interest.
  • expression vector refers to a vehicle designed to enable the expression of an inserted nucleic acid sequence following insertion into a host cell.
  • the inserted nucleic acid sequence is placed in operable association with regulatory regions as described above.
  • Vectors are introduced into host cells by methods well known in the art, e.g., transfection, electroporation, microinjection, transduction, cell fusion, DEAE dextran, calcium phosphate precipitation, lipofection (lysosome fusion), use of a gene gun, or a DNA vector transporter.
  • Culture means to incubate cells under in vitro conditions that allow for cell growth or division or to maintain cells in a living state.
  • Cultured cells means cells that are propagated in vitro.
  • polypeptide is intended to encompass a singular "polypeptide” as well as plural “polypeptides,” and refers to a molecule composed of monomers (amino acids) linearly linked by amide bonds (also known as peptide bonds).
  • polypeptide refers to any chain or chains of two or more amino acids, and does not refer to a specific length of the product.
  • polypeptides dipeptides, tripeptides, oligopeptides, "protein,” “amino acid chain,” or any other term used to refer to a chain or chains of two or more amino acids, are included within the definition of "polypeptide,” and the term “polypeptide” can be used instead of, or interchangeably with any of these terms.
  • polypeptide is also intended to refer to the products of post-expression modifications of the polypeptide, including without limitation glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, or modification by non-naturally occurring amino acids.
  • a polypeptide can be derived from a natural biological source or produced recombinant technology, but is not necessarily translated from a designated nucleic acid sequence. It can be generated in any manner, including by chemical synthesis.
  • an "isolated" polypeptide or a fragment, variant, or derivative thereof refers to a polypeptide that is not in its natural milieu. No particular level of purification is required. For example, an isolated polypeptide can simply be removed from its native or natural environment. Recombinantly produced polypeptides and proteins expressed in host cells are considered isolated for the purpose of the invention, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique.
  • fragments or variants of polypeptides are also included in the present invention.
  • fragments or variants of polypeptides include any polypeptides which retain at least some of the properties ⁇ e.g., FcRn binding affinity for an FcRn binding domain or Fc variant, coagulation activity for an FVIII variant, or FVIII binding activity for the VWF fragment) of the reference polypeptide.
  • Fragments of polypeptides include proteolytic fragments, as well as deletion fragments, in addition to specific antibody fragments discussed elsewhere herein, but do not include the naturally occurring full-length polypeptide (or mature polypeptide).
  • Variants of polypeptide binding domains or binding molecules of the present invention include fragments as described above, and also polypeptides with altered amino acid sequences due to amino acid substitutions, deletions, or insertions. Variants can be naturally or non-naturally occurring. Non- naturally occurring variants can be produced using art-known mutagenesis techniques. Variant polypeptides can comprise conservative or non-conservative amino acid substitutions, deletions or additions.
  • VWF protein or "VWF proteins” used herein means any VWF fragments that interact with FVIII and retain at least one or more properties that are normally provided to FVIII by full-length VWF, e.g., preventing premature activation to FVIIIa, preventing premature proteolysis, preventing association with phospholipid membranes that could lead to premature clearance, preventing binding to FVIII clearance receptors that can bind naked FVIII but not VWF-bound FVIII, and/or stabilizing the FVIII heavy chain and light chain interactions.
  • a "conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • basic side chains e
  • a string of amino acids can be conservatively replaced with a structurally similar string that differs in order and/or composition of side chain family members.
  • sequence identity between two polypeptides is determined by comparing the amino acid sequence of one polypeptide to the sequence of a second polypeptide.
  • sequence identity is determined by comparing the amino acid sequence of one polypeptide to the sequence of a second polypeptide.
  • whether any particular polypeptide is at least about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or 100% identical to another polypeptide can be determined using methods and computer programs/software known in the art such as, but not limited to, the BESTFIT program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, WI 5371 1).
  • BESTFIT uses the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981), to find the best segment of homology between two sequences.
  • the parameters are set, of course, such that the percentage of identity is calculated over the full-length of the reference polypeptide sequence and that gaps in homology of up to 5% of the total number of amino acids in the reference sequence are allowed.
  • an "amino acid corresponding to" or an "equivalent amino acid" in a VWF sequence or a FVIII protein sequence is identified by alignment to maximize the identity or similarity between a first VWF or FVIII sequence and a second VWF or FVIII sequence.
  • the number used to identify an equivalent amino acid in a second VWF or FVIII sequence is based on the number used to identify the corresponding amino acid in the first VWF or FVIII sequence.
  • insertion site refers to a position in a FVIII polypeptide, or fragment, variant, or derivative thereof, which is immediately upstream of the position at which a heterologous moiety can be inserted.
  • An "insertion site” is specified as a number, the number being the number of the amino acid in mature native FVIII (SEQ ID NO: 65) to which the insertion site corresponds, which is immediately N-terminal to the position of the insertion.
  • the phrase “a3 comprises an XTEN at an insertion site which corresponds to amino acid 1656 of SEQ ID NO: 65” indicates that the heterologous moiety is located between two amino acids corresponding to amino acid 1656 and amino acid 1657 of SEQ ID NO: 65.
  • inserted refers to the position of an XTEN in a chimeric polypeptide relative to the analogous position in native mature human FVIII.
  • the terms refer to the characteristics of the recombinant FVIII polypeptide relative to native mature human FVIII, and do not indicate, imply or infer any methods or process by which the chimeric polypeptide was made.
  • the phrase "an XTEN is inserted into immediately downstream of residue 745 of the FVIII polypeptide” means that the chimeric polypeptide comprises an XTEN immediately downstream of an amino acid which corresponds to amino acid 745 in native mature human FVIII, e.g., bounded by amino acids corresponding to amino acids 745 and 746 of native mature human FVIII.
  • a "fusion" or “chimeric” protein comprises a first amino acid sequence linked to a second amino acid sequence with which it is not naturally linked in nature.
  • the amino acid sequences which normally exist in separate proteins can be brought together in the fusion polypeptide, or the amino acid sequences which normally exist in the same protein can be placed in a new arrangement in the fusion polypeptide, e.g., fusion of a Factor VIII domain of the invention with an Ig Fc domain.
  • a fusion protein is created, for example, by chemical synthesis, or by creating and translating a polynucleotide in which the peptide regions are encoded in the desired relationship.
  • a chimeric protein can further comprises a second amino acid sequence associated with the first amino acid sequence by a covalent, non-peptide bond or a non-covalent bond.
  • half-life refers to a biological half-life of a particular polypeptide in vivo.
  • Half-life may be represented by the time required for half the quantity administered to a subject to be cleared from the circulation and/or other tissues in the animal.
  • a clearance curve of a given polypeptide is constructed as a function of time, the curve is usually biphasic with a rapid a-phase and longer ⁇ -phase.
  • the a-phase typically represents an equilibration of the administered Fc polypeptide between the intra- and extra-vascular space and is, in part, determined by the size of the polypeptide.
  • the ⁇ -phase typically represents the catabolism of the polypeptide in the intravascular space.
  • FVIII and chimeric proteins comprising FVIII are monophasic, and thus do not have an alpha phase, but just the single beta phase. Therefore, in certain embodiments, the term half-life as used herein refers to the half-life of the polypeptide in the ⁇ -phase. The typical ⁇ phase half-life of a human antibody in humans is 21 days.
  • the term "linked” as used herein refers to a first amino acid sequence or nucleotide sequence covalently or non-covalently joined to a second amino acid sequence or nucleotide sequence, respectively.
  • the first amino acid or nucleotide sequence can be directly joined or juxtaposed to the second amino acid or nucleotide sequence or alternatively an intervening sequence can covalently join the first sequence to the second sequence.
  • the term "linked” means not only a fusion of a first amino acid sequence to a second amino acid sequence at the C- terminus or the N-terminus, but also includes insertion of the whole first amino acid sequence (or the second amino acid sequence) into any two amino acids in the second amino acid sequence (or the first amino acid sequence, respectively).
  • the first amino acid sequence can be linked to a second amino acid sequence by a peptide bond or a linker.
  • the first nucleotide sequence can be linked to a second nucleotide sequence by a phosphodiester bond or a linker.
  • the linker can be a peptide or a polypeptide (for polypeptide chains) or a nucleotide or a nucleotide chain (for nucleotide chains) or any chemical moiety (for both polypeptide and polynucleotide chains).
  • the term "linked" is also indicated by a hyphen (-).
  • association with refers to a covalent or non-covalent bond formed between a first amino acid chain and a second amino acid chain.
  • association with means a covalent, non-peptide bond or a non-covalent bond. This association can be indicated by a colon, i.e., (:). In another embodiment, it means a covalent bond except a peptide bond.
  • the amino acid cysteine comprises a thiol group that can form a disulfide bond or bridge with a thiol group on a second cysteine residue.
  • the CHI and CL regions are associated by a disulfide bond and the two heavy chains are associated by two disulfide bonds at positions corresponding to 239 and 242 using the Kabat numbering system (position 226 or 229, EU numbering system).
  • covalent bonds include, but are not limited to, a peptide bond, a metal bond, a hydrogen bond, a disulfide bond, a sigma bond, a pi bond, a delta bond, a glycosidic bond, an agnostic bond, a bent bond, a dipolar bond, a Pi backbond, a double bond, a triple bond, a quadruple bond, a quintuple bond, a sextuple bond, conjugation, hyperconjugation, aromaticity, hapticity, or antibonding.
  • Non- limiting examples of non-covalent bond include an ionic bond ⁇ e.g., cation-pi bond or salt bond), a metal bond, an hydrogen bond ⁇ e.g., dihydrogen bond, dihydrogen complex, low-barrier hydrogen bond, or symmetric hydrogen bond), van der Walls force, London dispersion force, a mechanical bond, a halogen bond, aurophilicity, intercalation, stacking, entropic force, or chemical polarity.
  • the term "monomer-dimer hybrid” used herein refers to a chimeric protein comprising a first polypeptide chain and a second polypeptide chain, which are associated with each other by a disulfide bond, wherein the first chain comprises a clotting factor, e.g., Factor VIII, and a first Fc region and the second chain comprises, consists essentially of, or consists of a second Fc region without the clotting factor.
  • the monomer-dimer hybrid construct thus is a hybrid comprising a monomer aspect having only one clotting factor and a dimer aspect having two Fc regions.
  • cleavage site refers to a site recognized by an enzyme. Certain enzymatic cleavage sites comprise an intracellular processing site.
  • a polypeptide has an enzymatic cleavage site cleaved by an enzyme that is activated during the clotting cascade, such that cleavage of such sites occurs at the site of clot formation. Exemplary such sites include, e.g., those recognized by thrombin, Factor XIa or Factor Xa.
  • Exemplary FXIa cleavage sites include, e.g., TQSFNDFTR (SEQ ID NO: 1) and SVSQTSKLTR (SEQ ID NO: 3).
  • Exemplary thrombin cleavage sites include, e.g., DFLAEGGGVR (SEQ ID NO: 4), TTKIKPR (SEQ ID NO: 5), LVPRG (SEQ ID NO: 6) , ALRPR (SEQ ID NO: 7), ISDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFS (SEQ ID NO: 106), DKNTGDYYEDSYEDISAYLLSKNNAIEPRSFS (SEQ ID NO: 88), and IEPRSFS (SEQ ID NO: 194).
  • Other enzymatic cleavage sites are known in the art and described in elsewhere herein.
  • processing site refers to a type of enzymatic cleavage site in a polypeptide which is a target for enzymes that function after translation of the polypeptide. In one embodiment, such enzymes function during transport from the Golgi lumen to the trans-Golgi compartment. Intracellular processing enzymes cleave polypeptides prior to secretion of the protein from the cell. Examples of such processing sites include, e.g., those targeted by the PACE/furin (where PACE is an acronym for Paired basic Amino acid Cleaving Enzyme) family of endopeptidases.
  • PACE is an acronym for Paired basic Amino acid Cleaving Enzyme
  • PCSK1 also known as PCl/Pc3
  • PCSK2 also known as PC2
  • PCSK3 also known as furin or PACE
  • PCSK4 also known as PC4
  • PCSK5 also known as PC5 or PC6
  • PCSK6 also known as PACE4
  • PCSK7 also known as PC7/LPC, PC8, or SPC7.
  • PCSK1 also known as PCl/Pc3
  • PCSK2 also known as PC2
  • PCSK3 also known as furin or PACE
  • PCSK4 also known as PC4
  • PCSK5 also known as PC5 or PC6
  • PCSK7 also known as PC7/LPC, PC8, or SPC7.
  • PCSK7 also known as PC7/LPC, PC8, or SPC7
  • Furin refers to the enzymes corresponding to EC No. 3.4.21.75.
  • Furin is subtilisin-like proprotein convertase, which is also known as PACE (Paired basic Amino acid Cleaving Enzyme).
  • PACE Porous basic Amino acid Cleaving Enzyme
  • Furin deletes sections of inactive precursor proteins to convert them into biologically active proteins.
  • pro-peptide of VWF can be cleaved from mature VWF molecule by a Furin enzyme.
  • Furin cleaves the D1D2 from the D'D3 of VWF.
  • a nucleotide sequence encoding Furin can be expressed together with the nucleotide sequence encoding a VWF fragment so that D1D2 domains can be cleaved off intracellularly by Furin.
  • a “processable linker” as used herein refers to a linker comprising at least one intracellular processing site, which are described elsewhere herein.
  • Hemostatic disorder means a genetically inherited or acquired condition characterized by a tendency to hemorrhage, either spontaneously or as a result of trauma, due to an impaired ability or inability to form a fibrin clot. Examples of such disorders include the hemophilias. The three main forms are hemophilia A (factor VIII deficiency), hemophilia B (factor IX deficiency or "Christmas disease”) and hemophilia C (factor XI deficiency, mild bleeding tendency).
  • hemostatic disorders include, e.g., Von Willebrand disease, Factor XI deficiency (PTA deficiency), Factor XII deficiency, deficiencies or structural abnormalities in fibrinogen, prothrombin, Factor V, Factor VII, Factor X or factor XIII, Bernard- Soulier syndrome, which is a defect or deficiency in GPIb.
  • GPIb the receptor for VWF, can be defective and lead to lack of primary clot formation (primary hemostasis) and increased bleeding tendency), and thrombasthenia of Glanzman and Naegeli (Glanzmann thrombasthenia).
  • primary hemostasis primary hemostasis
  • Naegeli Glanzman and Naegeli
  • the chimeric molecules of the invention can be used prophylactically.
  • prophylactic treatment refers to the administration of a molecule prior to a bleeding episode.
  • the subject in need of a general hemostatic agent is undergoing, or is about to undergo, surgery.
  • the chimeric protein of the invention can be administered prior to or after surgery as a prophylactic.
  • the chimeric protein of the invention can be administered during or after surgery to control an acute bleeding episode.
  • the surgery can include, but is not limited to, liver transplantation, liver resection, dental procedures, or stem cell transplantation.
  • the chimeric protein of the invention is also used for on-demand treatment.
  • on-demand treatment refers to the administration of a chimeric molecule in response to symptoms of a bleeding episode or before an activity that may cause bleeding.
  • the on-demand treatment can be given to a subject when bleeding starts, such as after an injury, or when bleeding is expected, such as before surgery.
  • the on-demand treatment can be given prior to activities that increase the risk of bleeding, such as contact sports.
  • acute bleeding refers to a bleeding episode regardless of the underlying cause.
  • a subject may have trauma, uremia, a hereditary bleeding disorder (e.g., factor VII deficiency) a platelet disorder, or resistance owing to the development of antibodies to clotting factors.
  • Treat, treatment, treating, as used herein refers to, e.g., the reduction in severity of a disease or condition; the reduction in the duration of a disease course; the amelioration of one or more symptoms associated with a disease or condition; the provision of beneficial effects to a subject with a disease or condition, without necessarily curing the disease or condition, or the prophylaxis of one or more symptoms associated with a disease or condition.
  • the term "treating" or "treatment” means maintaining a FVIII trough level at least about 1 IU/dL, 2 IU/dL, 3 IU/dL, 4 IU/dL, 5 IU/dL, 6 IU/dL, 7 IU/dL, 8 IU/dL, 9 IU/dL, 10 IU/dL, 1 1 IU/dL, 12 IU/dL, 13 IU/dL, 14 IU/dL, 15 IU/dL, 16 IU/dL, 17 IU/dL, 18 IU/dL, 19 IU/dL, or 20 IU/dL in a subject by administering a chimeric protein or a VWF fragment of the invention.
  • treating or treatment means maintaining a FVIII trough level between about 1 and about 20 IU/dL, about 2 and about 20 IU/dL, about 3 and about 20 IU/dL, about 4 and about 20 IU/dL, about 5 and about 20 IU/dL, about 6 and about 20 IU/dL, about 7 and about 20 IU/dL, about 8 and about 20 IU/dL, about 9 and about 20 IU/dL, or about 10 and about 20 IU/dL.
  • Treatment or treating of a disease or condition can also include maintaining FVIII activity in a subject at a level comparable to at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 1 1%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, or 20% of the FVIII activity in a non-hemophiliac subject.
  • the minimum trough level required for treatment can be measured by one or more known methods and can be adjusted (increased or decreased) for each person.
  • the present invention is directed to extending a half- life of a chimeric protein using a
  • Endogenous VWF associates with about 95% to about 98% of FVIII in non-covalent complexes. While endogenous VWF is a FVIII half-life limiting factor, endogenous VWF bound to a FVIII protein is also known to protect FVIII in various ways.
  • full length VWF (as a multimer having about 250 kDa) can protect FVIII from protease cleavage and FVIII activation, stabilize the FVIII heavy chain and/or light chain, and prevent clearance of FVIII by scavenger receptors.
  • endogenous VWF limits the FVIII half-life by preventing pinocytosis and by clearing FVIII- VWF complex from the system through the VWF clearance pathway. It is believed, while not bound by a theory, that endogenous VWF is a half-life limiting factor that prevents the half- life of a chimeric protein fused to a half-life extender from being longer than about two-fold that of wild-type FVIII.
  • the present invention is directed to preventing or inhibiting interaction between endogenous VWF and a FVIII protein using a VWF protein comprising a D' domain and a D3 domain (e.g., a VWF fragment) and at the same time to increasing a half-life of resulting FVIII protein(s) by using an XTEN sequence in combination with an Ig constant region or a portion thereof.
  • a shorter XTEN sequence i.e., XTEN that contains less than 288 amino acids in length, i.e., XTEN that is shorter than 288 amino acids
  • a shorter XTEN sequence is better in extending a half-life of the chimeric protein.
  • the invention is directed to a chimeric protein comprising (i) a first polypeptide which comprises a FVIII protein fused to a first Ig constant region or a portion thereof and (ii) a second polypeptide which comprises a VWF protein comprising a D' domain and a D3 domain of VWF fused to a second Ig constant region or a portion thereof by an XTEN sequence in-between, wherein the XTEN sequence contains less than 288 amino acid residues and wherein the first polypeptide is linked to or associated with the second polypeptide.
  • the XTEN sequence in the second polypeptide consists of an amino acid sequence having a length of between 12 amino acids and 287 amino acids.
  • the chimeric protein exhibits a longer half-life compared to a corresponding fusion protein comprising the first polypeptide and the second polypeptide, wherein the second polypeptide comprises an XTEN sequence containing at least 288 amino acids, e.g., AE288, e.g., SEQ ID NO: 8.
  • the XTEN sequence in the second polypeptide contains at least about 36, at least about 42, at least about 72, or at least about 144 amino acids, but less than 288 amino acids, e.g., AE42, AE72, AE144 (AE144, AE144_2A, AE144_3B, AE144_4A, AE144 5A, AE144 6B) , AG42, AG72, or AG144 (AG144, AG144 A, AG144 B, AG144 C, AG144 F), e.g., SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 1 1, SEQ ID NO: 55; SEQ ID NO: 56; SEQ ID NO: 57; SEQ ID NO: 58; SEQ ID NO: 59; SEQ ID NO: 14; SEQ ID NO: 60; SEQ ID NO: 61 ; SEQ ID NO: 62; or SEQ ID NO: 63.
  • the chimeric protein of the invention can further comprise a second XTEN sequence which links the FVIII protein with the first Ig constant region or a portion thereof.
  • the invention is directed to a chimeric protein comprising (i) a first polypeptide which comprises a FVIII protein fused to a first Ig constant region or a portion thereof and (ii) a second polypeptide which comprises a VWF protein comprising a D' domain and a D3 domain of VWF fused to a second Ig constant region or a portion thereof by a first XTEN sequence in-between, wherein the XTEN sequence contains less than 288 amino acid residues and wherein the first polypeptide are linked to or associated with the second polypeptide, and wherein the first polypeptide further comprises a second XTEN sequence which is inserted at one or more insertion sites within the FVIII protein or which is fused to the FVIII protein and/or the first Ig constant region or a portion thereof.
  • a second XTEN sequence is inserted at one or more insertion sites within the FVIII protein.
  • a second XTEN sequence is fused to the FVIII protein and/or the first Ig constant region or a portion thereof.
  • a second XTEN sequence is inserted at one or more insertion sites within the FVIII protein and a third XTEN sequence is fused to the FVIII protein and/or the first Ig constant region or a portion thereof.
  • the second and/or third XTEN sequences can be any length of XTEN amino acids.
  • the second and/or third XTEN sequences are disclosed elsewhere herein, e.g., AE42, AE72, AE864, AE576, AE288, AE144, AG864, AG576, AG288, and AG144, e.g., SEQ ID NO: 8; SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 1 1, SEQ ID NO: 17; SEQ ID NO: 54; SEQ ID NO: 19; SEQ ID NO: 16; SEQ ID NO: 18; SEQ ID NO: 15; SEQ ID NO: 55; SEQ ID NO: 56; SEQ ID NO: 57; SEQ ID NO: 58; SEQ ID NO: 59; SEQ ID NO: 14; SEQ ID NO: 60; SEQ ID NO: 61 ; SEQ ID NO: 62; or SEQ ID NO: 63.
  • the second and/or third XTEN sequence is AE288 or AG288, e.g., SEQ ID NO: 8 or 19.
  • the invention is directed to a chimeric protein comprising (i) a first polypeptide which comprises a FVIII protein fused to a first Ig constant region or a portion thereof by an optional linker, wherein an optional XTEN sequence (X2) is inserted at one or more insertion sites within the FVIII protein or is fused to the FVIII protein or to the first Ig constant region or a portion thereof, and (ii) a second polypeptide which comprises a VWF protein comprising a D' domain and a D3 domain of VWF fused to a second Ig constant region or a portion thereof by an XTEN sequence (XI) between the VWF protein and the second Ig constant region or a portion thereof, wherein the XTEN sequence (XI) contains less than 288 amino acid residues and is fused to the VWF
  • the invention is directed to a chimeric protein comprising (i) a first polypeptide which comprises a FVIII protein fused to a first Ig constant region or a portion thereof by an optional linker, wherein an optional XTEN sequence (X2) is inserted at one or more insertion sites within the FVIII protein or is fused to the FVIII protein or to the first Ig constant region or a portion thereof, and (ii) a second polypeptide which comprises a VWF protein comprising a D' domain and a D3 domain of VWF fused to a second Ig constant region or a portion thereof by an XTEN sequence (XI) between the VWF protein and the second Ig constant region or a portion thereof, wherein the XTEN sequence (XI) contains less than 288 amino acid residues and is fused to the second Ig constant region or a portion thereof by a linker and wherein the first polypeptide and the second polypeptide are associated.
  • a first polypeptide which comprises a FVIII protein fuse
  • the linker fusing the XTEN sequence (XI) with the VWF protein or the second Ig constant region or a portion thereof is a cleavable linker.
  • cleavable linkers Non-limiting examples of the cleavable linkers are shown elsewhere herein.
  • the linker is a thrombin cleavable linker.
  • the chimeric protein is two polypeptide chains, the first chain comprising the first polypeptide described above and the second chain comprising the second polypeptide described above.
  • the two polypeptide chains comprise (i) a first chain comprising a single chain FVIII protein, a first Ig constant region or a portion thereof, and an optional XTEN sequence which is inserted at one or more insertion sites within the FVIII protein or is fused to the FVIII protein or to the first Ig constant region or a portion thereof, and (ii) a second chain comprising a VWF protein fused to a second Ig constant region or a portion thereof by an XTEN sequence (XI) in-between, wherein the XTEN sequence (XI) contains less than 288 amino acids.
  • the chimeric protein is two polypeptide chains, a first chain comprising a heavy chain of a FVIII protein and a second chain comprising, from N-terminus to C-terminus, a light chain of a FVIII protein, an optional XTEN sequence which is inserted at one or more insertion sites within the FVIII protein or is fused to the FVIII protein or to the first Ig constant region or a portion thereof, and a first Ig constant region or a portion thereof, an optional linker (e.g., a processable linker), a VWF protein, an XTEN sequence (XI), a second optional linker (e.g., a cleavable linker), and a second Ig constant region or a portion thereof.
  • an optional linker e.g., a processable linker
  • VWF protein e.g., an XTEN sequence (XI)
  • XI XTEN sequence
  • a second optional linker e.g., a cle
  • the chimeric protein is three polypeptide chains, (i) a first chain comprising a heavy chain of a FVIII protein, (ii) a second chain comprising a light chain of a FVIII protein, a first Ig constant region or a portion thereof, and an optional XTEN sequence which is inserted at one or more insertion sites within the heavy chain or the light chain of the FVIII protein or is fused to the FVIII protein or to the first Ig constant region or a portion thereof, and (iii) a third chain comprising a VWF protein fused to a second Ig constant region or a portion thereof by an XTEN sequence (XI) in-between, wherein the first chain and the second chain are associated by a non-covalent bond, e.g., a metal bond, and the second chain and the third chain are associated by a covalent bond, e.g., a disulfide bond.
  • the chimeric protein is a single chain comprising, from N terminus to C terminus, a single chain FVIII protein, an optional XTEN sequence which is inserted at one or more insertion sites within the FVIII protein or is fused to the FVIII protein or to the first Ig constant region or a portion thereof, and a first Ig constant region or a portion thereof, an optional linker (e.g., a processable linker), a VWF protein, an XTEN sequence (XI), a second optional linker (e.g., a cleavable linker), and a second Ig constant region or a portion thereof.
  • an optional linker e.g., a processable linker
  • VWF protein e.g., an XTEN sequence
  • XI XTEN sequence
  • second optional linker e.g., a cleavable linker
  • a chimeric protein comprises one of the following formulae (a)-
  • CD F 1 -X2-F 1 V-L 1 -X 1 -L2-F2; (k) V-L 1 -X-L2-F2-L3 -FVIII-L4-F 1 ;
  • V is a VWF protein, which comprises a D' domain and a D3 domain
  • X or XI is a first XTEN sequence that contains less than 288 amino acids
  • X2 is a second XTEN sequence
  • FVIII comprises a FVIII protein
  • FVIII(X2) comprises a FVIII protein having a second XTEN sequence inserted in one or more insertion sites within the FVIII protein
  • Fl is a first Ig constant region or a portion thereof
  • F2 is a second Ig constant region or a portion thereof
  • LI, L2, L3, L4, or L5 is an optional linker
  • (-) is a peptide bond
  • (:) is a covalent bond or a non-covalent bond.
  • the X or XI consists of an amino acid sequence having a length of between 12 amino acids and 287 amino acids.
  • the chimeric protein exhibits a longer half-life compared to a corresponding fusion protein comprising a formula wherein the X or XI is AE288, e.g., SEQ ID NO: 8.
  • the X or XI in the formula contains at least about 36, at least about
  • AG 144 AG 144, AG144 A, AG144 B, AG144 C, AG144 F
  • SEQ ID NO: 9 SEQ ID NO: 9
  • SEQ ID NO: 10 SEQ ID NO: 1 1, SEQ ID NO: 55; SEQ ID NO: 56; SEQ ID NO: 57; SEQ ID NO:
  • the X2 comprises an amino acid sequence having a length of at least about 36 amino acids, at least 42 amino acids, at least 144 amino acids, at least 288 amino acids, at least 576 amino acids, or at least 864 amino acids, e.g., AE42, AE72, AE864, AE576, AE288, AE144, AG864, AG576, AG288, or AG144, e.g., SEQ ID NO: 9; SEQ ID NO: 10; SEQ ID NO: 15; SEQ ID NO: 16; SEQ ID NO: 8; SEQ ID NO: 1 1 ; SEQ ID NO: 17; SEQ ID NO: 18, SEQ ID NO: 19, or SEQ ID NO: 14.
  • the X2 is AE288 or AG288, e.g., SEQ ID NO: 8 or 19.
  • the chimeric protein comprising the X or XI and/or X2 has an extended half-life compared to a chimeric protein without the X or XI and/or X2.
  • the LI and/or L2 is a cleavable linker.
  • the L4 and/or L5 is a cleavable linker.
  • VWF Von Willebrand Factor
  • VWF also known as F8VWF
  • F8VWF is a large multimeric glycoprotein present in blood plasma and produced constitutively in endothelium (in the Weibel-Palade bodies), megakaryocytes (a- granules of platelets), and subendothelian connective tissue.
  • the basic VWF monomer is a 2813 amino acid protein.
  • Every monomer contains a number of specific domains with a specific function, the DVD3 domain (which binds to Factor VIII), the Al domain (which binds to platelet GPIb-receptor, heparin, and/or possibly collagen), the A3 domain (which binds to collagen), the CI domain (in which the RGD domain binds to platelet integrin ⁇ 3 ⁇ 4 ⁇ 3 when this is activated), and the "cysteine knot" domain at the C-terminal end of the protein (which VWF shares with platelet-derived growth factor (PDGF), transforming growth factor- ⁇ (TGF ) and ⁇ -human chorionic gonadotropin ( HCG)).
  • PDGF platelet-derived growth factor
  • TGF transforming growth factor- ⁇
  • HCG ⁇ -human chorionic gonadotropin
  • the VWF protein is a VWF fragment.
  • a VWF fragment as used herein includes, but is not limited to, functional VWF fragments comprising a D' domain and a D3 domain, which are capable of inhibiting binding of endogenous VWF to FVIII.
  • the VWF fragment binds to the FVIII protein.
  • the VWF fragment blocks the VWF binding site on the FVIII protein, thereby inhibiting interaction of the FVIII protein with endogenous VWF.
  • the VWF fragments include derivatives, variants, mutants, or analogues that retain these activities of VWF.
  • VWF is designated as SEQ ID NO: 20.
  • SEQ ID NO: 21 is the amino acid sequence of full-length VWF. Each domain of VWF is listed in Table 1.
  • VWF D1D2 region 23 AEGTRGRS STARCSLFGS
  • the VWF protein as used herein can be a VWF fragment comprising a D' domain and a
  • the VWF fragment comprising the D' domain and the D3 domain can further comprise a VWF domain selected from the group consisting of an Al domain, an A2 domain, an A3 domain, a Dl domain, a D2 domain, a D4 domain, a B l domain, a B2 domain, a B3 domain, a CI domain, a C2 domain, a CK domain, one or more fragments thereof, and any combinations thereof.
  • a VWF fragment comprises, consists essentially of, or consists of: (1) the D' and D3 domains of VWF or fragments thereof; (2) the Dl, D', and D3 domains of VWF or fragments thereof; (3) the D2, D', and D3 domains of VWF or fragments thereof; (4) the Dl, D2, D', and D3 domains of VWF or fragments thereof; or (5) the Dl, D2, D', D3, and Al domains of VWF or fragments thereof.
  • the VWF fragment described herein does not contain a site binding to a VWF clearance receptor.
  • the VWF fragment described herein is not amino acids 764 to 1274 of SEQ ID NO: 21.
  • the VWF fragment of the present invention can comprise any other sequences linked to or fused to the VWF fragment.
  • a VWF fragment described herein can further comprise a signal peptide.
  • the VWF fragment comprising a D' domain and a D3 domain binds to or is associated with a FVIII protein.
  • a VWF fragment of the invention protects FVIII from protease cleavage and FVIII activation, stabilizes the heavy chain and light chain of FVIII, and prevents clearance of FVIII by scavenger receptors.
  • the VWF fragment binds to or associates with a FVIII protein and blocks or prevents binding of the FVIII protein to phospholipid and activated Protein C.
  • the VWF fragment of the invention reduces the clearance of FVIII by VWF clearance receptors and thus extends half-life of the chimeric protein.
  • the half-life extension of a chimeric protein is thus due to the binding of or associating with the VWF fragment lacking a VWF clearance receptor binding site to the FVIII protein and shielding or protecting of the FVIII protein by the VWF fragment from endogenous VWF which contains the VWF clearance receptor binding site.
  • the FVIII protein bound to or protected by the VWF fragment can also allow recycling of a FVIII protein.
  • a VWF protein useful for the present invention comprises a D' domain and a D3 domain of VWF, wherein the D' domain is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 764 to 866 of SEQ ID NO: 21, wherein the VWF protein prevents or inhibits binding of endogenous VWF to FVIII.
  • a VWF protein comprises the D' domain and the D3 domain of VWF, wherein the D3 domain is at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 867 to 1240 of SEQ ID NO: 21, wherein the VWF protein prevents or inhibits binding of endogenous VWF to FVIII.
  • a VWF protein described herein comprises, consists essentially of, or consists of the D' domain and D3 domain of VWF, which are at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 764 to 1240 of SEQ ID NO: 21, wherein the VWF protein prevents or inhibits binding of endogenous VWF to FVIII.
  • a VWF protein comprises, consists essentially of, or consists of the Dl, D2, D', and D3 domains at least 60%, 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 23 to 1240 of SEQ ID NO: 21, wherein the VWF protein prevents or inhibits binding of endogenous VWF to FVIII.
  • the VWF protein further comprises a signal peptide operably linked thereto.
  • a VWF protein useful for the invention consists essentially of or consists of (1) the D'D3 domain, the D1D'D3 domain, D2D'D3 domain, or D1D2DO3 domain and (2) an additional VWF sequence up to about 10 amino acids (e.g., any sequences from amino acids 764 to 1240 of SEQ ID NO: 21 to amino acids 764 to 1250 of SEQ ID NO: 21), up to about 15 amino acids (e.g., any sequences from amino acids 764 to 1240 of SEQ ID NO: 21 to amino acids 764 to 1255 of SEQ ID NO: 21), up to about 20 amino acids (e.g., any sequences from amino acids 764 to 1240 of SEQ ID NO: 21 to amino acids 764 to 1260 of SEQ ID NO: 21), up to about 25 amino acids (e.g., any sequences from amino acids 764 to 1240 of SEQ ID NO: 21 to amino acids 764 to 1265 of SEQ ID NO: 21), or up to about
  • the VWF protein comprising or consisting essentially of the D' domain and the D3 domain is neither amino acids 764 to 1274 of SEQ ID NO: 21 nor the full- length mature VWF.
  • the D1D2 domain is expressed in trans with the D'D3 domain. In some embodiments, the D1D2 domain is expressed in cis with the D'D3 domain.
  • the VWF protein comprising the D'D3 domains linked to the
  • D1D2 domains further comprises an intracellular cleavage site, e.g., (a cleavage site by PACE (furin) or PC5), allowing cleavage of the D1D2 domains from the D'D3 domains upon expression.
  • intracellular cleavage site e.g., (a cleavage site by PACE (furin) or PC5), allowing cleavage of the D1D2 domains from the D'D3 domains upon expression.
  • intracellular cleavage site are disclosed elsewhere herein.
  • a VWF protein comprises a D' domain and a D3 domain, but does not comprise an amino acid sequence selected from the group consisting of (1) amino acids 1241 to 2813 corresponding to SEQ ID NO: 21, (2) amino acids 1270 to amino acids 2813 corresponding to SEQ ID NO: 21, (3) amino acids 1271 to amino acids 2813 corresponding to SEQ ID NO: 21, (4) amino acids 1272 to amino acids 2813 corresponding to SEQ ID NO: 21, (5) amino acids 1273 to amino acids 2813 corresponding to SEQ ID NO: 21, (6) amino acids 1274 to amino acids 2813 corresponding to SEQ ID NO: 21, and any combinations thereof.
  • a VWF protein of the present invention comprises, consists essentially of, or consists of an amino acid sequence corresponding to the D' domain, D3 domain, and Al domain, wherein the amino acid sequence is at least 60%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acid 764 to 1479 of SEQ ID NO: 21, wherein the VWF protein prevents binding of endogenous VWF to FVIII.
  • the VWF protein is not amino acids 764 to 1274 of SEQ ID NO: 21.
  • a VWF protein of the invention comprises a D' domain and a D3 domain, but does not comprise at least one VWF domain selected from the group consisting of (1) an Al domain, (2) an A2 domain, (3) an A3 domain, (4) a D4 domain, (5) a B l domain, (6) a B2 domain, (7) a B3 domain, (8) a CI domain, (9) a C2 domain, (10) a CK domain, (1 1) a CK domain and C2 domain, (12) a CK domain, a C2 domain, and a CI domain, (13) a CK domain, a C2 domain, a CI domain, a B3 domain, (14) a CK domain, a C2 domain, a CI domain, a B3 domain, a B2 domain, (15) a CK domain, a C2 domain, a CI domain, a B3 domain, a B2 domain, (15) a CK domain, a C2 domain, a CI domain
  • the VWF protein comprises the D'D3 domains and one or more domains or modules.
  • domains or modules include, but are not limited to, the domains and modules disclosed in Zhour et al., Blood published online April 6, 2012: DOI 10.1 182/blood-2012-01-405134, which is incorporated herein by reference in its entirety.
  • the VWF protein can comprise the D'D3 domain and one or more domains or modules selected from the group consisting of Al domain, A2 domain, A3 domain, D4N module, VWD4 module, C8-4 module, TIL-4 module, CI module, C2 module, C3 module, C4 module, C5 module, C5 module, C6 module, and any combinations thereof.
  • the VWF protein is linked to a heterologous moiety, wherein the heterologous moiety is linked to the N-terminus or the C-terminus of the VWF protein or inserted immediately downstream of one or more amino acids (e.g., one or more XTEN insertion sites) in the VWF protein.
  • the insertion sites for the heterologous moiety in the VWF protein can be in the D' domain, the D3 domain, or both.
  • the heterologous moiety can be a half- life extender.
  • a VWF protein useful for the invention forms a multimer, e.g., dimer, trimer, tetramer, pentamer, hexamer, heptamer, or the higher order multimers.
  • the VWF protein is a monomer having only one VWF protein.
  • the VWF protein of the present invention can have one or more amino acid substitutions, deletions, additions, or modifications.
  • the VWF protein can include amino acid substitutions, deletions, additions, or modifications such that the VWF protein is not capable of forming a disulfide bond or forming a dimer or a multimer.
  • the amino acid substitution is within the D' domain and the D3 domain.
  • a VWF protein useful for the invention contains at least one amino acid substitution at a residue corresponding to residue 1099, residue 1 142, or both residues 1099 and 1 142 corresponding to SEQ ID NO: 21.
  • the at least one amino acid substitution can be any amino acids that are not occurring naturally in the wild type VWF.
  • the amino acid substitution can be any amino acids other than cysteine, e.g., Isoleucine, Alanine, Leucine, Asparagine, Lysine, Aspartic acid, Methionine, Phenylalanine, Glutamic acid, Threonine, Glutamine, Tryptophan, Glycine, Valine, Proline, Serine, Tyrosine, Arginine, or Histidine.
  • the amino acid substitution has one or more amino acids that prevent or inhibit the VWF proteins from forming multimers.
  • the VWF protein useful herein can be further modified to improve its interaction with FVIII, e.g., to improve binding affinity to FVIII.
  • the VWF protein comprises a serine residue at the residue corresponding to amino acid 764 of SEQ ID NO: 21 and a lysine residue at the residue corresponding to amino acid 773 of SEQ ID NO: 21. Residues 764 and/or 773 can contribute to the binding affinity of the VWF proteins to FVIII.
  • the VWF proteins useful for the invention can have other modifications, e.g., the protein can be pegylated, glycosylated, hesylated, or polysialylated.
  • XTEN sequence refers to extended length polypeptides with non- naturally occurring, substantially non-repetitive sequences that are composed mainly of small hydrophilic amino acids, with the sequence having a low degree or no secondary or tertiary structure under physiologic conditions.
  • XTENs can serve as a carrier, conferring certain desirable pharmacokinetic, physicochemical and pharmaceutical properties when linked to a VWF protein or a FVIII sequence of the invention to create a chimeric protein.
  • desirable properties include but are not limited to enhanced pharmacokinetic parameters and solubility characteristics.
  • XTEN specifically excludes antibodies or antibody fragments such as single-chain antibodies or Fc fragments of a light chain or a heavy chain.
  • the present invention provides that a shorter XTEN sequence provides an improved half- life extending property compared to a longer XTEN sequence when the XTEN sequence is fused to a VWF protein and/or the second Ig constant region or a portion thereof. Therefore, the XTEN sequence fused to a VWF protein and/or the second Ig constant region or a portion thereof contains less than 288 amino acids in length, i.e., is shorter than 288 amino acids.
  • the XTEN sequence fused to a VWF protein and/or the second Ig constant region or a portion thereof consists of an amino acid sequence having a length of between 12 amino acids and 287 amino acids.
  • the XTEN sequence fused to a VWF protein and/or the second Ig constant region or a portion thereof comprise at least about 36 amino acids, at least about 42 amino acids, at least about 72 amino acids, or at least about 144 amino acids, but less than 288 amino acids.
  • the XTEN sequence fused to a VWF protein and/or the second Ig constant region or a portion thereof is selected from AE36, AG36, AE42, AG42, AE72, AG72, AE144, or AG 144.
  • the XTEN sequence fused to a VWF protein and/or the second Ig constant region or a portion thereof is an amino acid sequence at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 1 1, or SEQ ID NO: 14, wherein the chimeric protein exhibits an improved half- life compared to a chimeric protein without the XTEN sequence.
  • the chimeric protein of the invention can further comprise an additional (second, third, or more) XTEN sequences.
  • the additional XTEN sequence can further be fused to the FVIII protein or the first Ig constant region or a portion thereof.
  • the additional XTEN sequences can be any length.
  • the additional XTEN sequence fused to the FVIII protein or the first Ig constant region or a portion thereof is a peptide or a polypeptide having greater than about 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1200, 1400, 1600, 1800, or 2000 amino acid residues.
  • the additional XTEN sequence is a peptide or a polypeptide having greater than about 20 to about 3000 amino acid residues, greater than about 30 to about 2500 residues, greater than about 40 to about 2000 residues, greater than about 50 to about 1500 residues, greater than about 60 to about 1000 residues, greater than about 70 to about 900 residues, greater than about 80 to about 800 residues, greater than about 90 to about 700 residues, greater than about 100 to about 600 residues, greater than about 1 10 to about 500 residues, or greater than about 120 to about 400 residues.
  • the XTEN sequences can comprise one or more sequence motif of 9 to 14 amino acid residues or an amino acid sequence at least 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the sequence motif, wherein the motif comprises, consists essentially of, or consists of 4 to 6 types of amino acids selected from the group consisting of glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P). See US 2010-0239554 Al .
  • the XTEN sequence comprises non-overlapping sequence motifs in which at least about 80%, or at least about 85%, or at least about 90%, or at least about 91%, or at least about 92%, or at least about 93%, or at least about 94%, or at least about 95%, or at least about 96%, or at least about 97%, or at least about 98%, or at least about 99% or about 100% of the sequence consists of multiple units of non-overlapping sequences selected from a single motif family selected from Table 2A, resulting in a family sequence.
  • family means that the XTEN has motifs selected only from a single motif category from Table 2A; i.e., AD, AE, AF, AG, AM, AQ, BC, or BD XTEN, and that any other amino acids in the XTEN not from a family motif are selected to achieve a needed property, such as to permit incorporation of a restriction site by the encoding nucleotides, incorporation of a cleavage sequence, or to achieve a better linkage to FVIII or VWF.
  • an XTEN sequence comprises multiple units of non-overlapping sequence motifs of the AD motif family, or of the AE motif family, or of the AF motif family, or of the AG motif family, or of the AM motif family, or of the AQ motif family, or of the BC family, or of the BD family, with the resulting XTEN exhibiting the range of homology described above.
  • the XTEN comprises multiple units of motif sequences from two or more of the motif families of Table 2A. These sequences can be selected to achieve desired physical/chemical characteristics, including such properties as net charge, hydrophilicity, lack of secondary structure, or lack of repetitiveness that are conferred by the amino acid composition of the motifs, described more fully below.
  • the motifs incorporated into the XTEN can be selected and assembled using the methods described herein to achieve an XTEN of about 36 to about 3000 amino acid residues.
  • the XTEN sequence used in the invention is at least 60%, 70%,
  • the XTEN sequence is at least 60%, 70%, 80%, 90%, 95%, 96%,
  • the XTEN sequence is selected from the group consisting of AE42 (SEQ ID NO: 9), AE72 (SEQ ID NO: 10), AE144 2A (SEQ IDNO: 55), AE144 3B (SEQ ID NO: 56), AE144 4A (SEQ ID NO: 57), AE144 5A (SEQ IDNO: 58), AE144 6B (SEQ ID NO: 59), AG144 A (SEQ ID NO: 60), AG144 B (SEQ ID NO: 61), AG144 C (SEQ ID NO: 62), AG144 F (SEQ IDNO: 63), AE864 (SEQ ID NO: 15), AE576 (SEQ ID NO: 16), AE288 (SEQ ID NO: 8), AE288 2 (SEQ ID NO: 54), AE144 (SEQ ID NO: 1 1), AG864 (SEQ ID NO: 17), AG576 (SEQ ID NO: 18), AG288 (SEQ ID NO: 19), AG144 (SEQ ID NO: 9),
  • SEQ ID NO: 17 SPGASPGTSSTGSPGASPGTSSTGSPGTPGSGTASSSPGSSTPSGATGSPGASPGTSST
  • the XTEN amino acids that are not glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P) are either interspersed throughout the XTEN sequence, are located within or between the sequence motifs, or are concentrated in one or more short stretches of the XTEN sequence, e.g., to create a linker between the XTEN and the FVIII or VWF components.
  • the XTEN component comprises amino acids other than glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P)
  • Hydrophobic residues that are less favored in construction of XTEN include tryptophan, phenylalanine, tyrosine, leucine, isoleucine, valine, and methionine.
  • the XTEN sequences can contain less than 5% or less than 4% or less than 3% or less than 2% or less than 1% or none of the following amino acids: cysteine (to avoid disulfide formation and oxidation), methionine (to avoid oxidation), asparagine and glutamine (to avoid desamidation).
  • the XTEN component comprising other amino acids in addition to glycine (G), alanine (A), serine (S), threonine (T), glutamate (E) and proline (P) have a sequence with less than 5% of the residues contributing to alpha-helices and beta-sheets as measured by the Chou- Fasman algorithm and have at least 90%, or at least about 95% or more random coil formation as measured by the GOR algorithm.
  • the XTEN sequence used in the invention affects the physical or chemical property, e.g., pharmacokinetics, of the chimeric protein of the present invention.
  • the XTEN sequence used in the present invention can exhibit one or more of the following advantageous properties: conformational flexibility, enhanced aqueous solubility, high degree of protease resistance, low immunogenicity, low binding to mammalian receptors, or increased hydrodynamic (or Stokes) radii.
  • the XTEN sequence linked to a FVIII protein in this invention increases pharmacokinetic properties such as longer terminal half-life or increased area under the curve (AUC), so that the chimeric protein described herein stays in vivo for an increased period of time compared to wild type FVIII.
  • the XTEN sequence used in this invention increases pharmacokinetic properties such as longer terminal half- life or increased area under the curve (AUC), so that FVIII protein stays in vivo for an increased period of time compared to wild type FVIII.
  • One embodiment of the present invention is a FVIII/VWF fusion protein comprising a
  • FVIII portion fused to an Fc region and a VWF portion fused to an Fc region, wherein an XTEN sequence (e.g., AE288) is inserted within the FVIII portion, and wherein an XTEN sequence having less than 288 amino acids (e.g., AE144) is inserted between the VWF portion and the Fc portion.
  • an XTEN sequence e.g., AE288
  • an XTEN sequence having less than 288 amino acids e.g., AE144
  • insertion of an XTEN having less than 288 amino acids between the VWF portion and the Fc portion has a greater effect on the pharmacokinetics of the chimeric protein than the insertion of an XTEN having 288 amino acids between the VWF portion and the Fc portion.
  • insertion of an XTEN sequence having less than 288 amino acids between the VWF portion and the Fc portion in FVIII/VWF fusion protein can increase the terminal half-life of the chimeric protein compared to an XTEN having 288 amino acids.
  • the terminal half-life is increased by at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, or at least about 30%, relative to the insertion of an XTEN sequence having 288 amino acids.
  • the terminal half-life is increased by at least about 35% relative to the insertion of an XTEN having 288 amino acids. Insertion of an XTEN sequence having less than 288 amino acids can also increase the AUC value of the chimeric protein.
  • AUC is increased by at least about 50%, at least about 100%, or at least about 200% relative to the insertion of an XTEN having 288 amino acids. In one particular embodiment, AUC is increased by about two-fold. Insertion of an XTEN sequence having less than 288 amino acids can also reduce the clearance of the chimeric protein. For example, clearance can be decreased by at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, or at least about 30%, relative to the insertion of an XTEN sequence having 288 amino acids. Insertion of an XTEN sequence having less than 288 amino acids can increase mean residence time (MRT) and/or decrease the apparent volume of distribution at steady state (Vss) relative to the insertion of an XTEN having 288 amino acids.
  • MRT mean residence time
  • Vss apparent volume of distribution at steady state
  • a variety of methods and assays can be employed to determine the physical/chemical properties of proteins comprising the XTEN sequence. Such methods include, but are not limited to analytical centrifugation, EPR, HPLC-ion exchange, HPLC-size exclusion, HPLC-reverse phase, light scattering, capillary electrophoresis, circular dichroism, differential scanning calorimetry, fluorescence, HPLC-ion exchange, HPLC-size exclusion, IR, NMR, Raman spectroscopy, refractometry, and UV/Visible spectroscopy. Additional methods are disclosed in Amau et al, Prot Expr and Purif 48, 1- 13 (2006).
  • a FVIII protein as used herein means a functional FVIII polypeptide in its normal role in coagulation, unless otherwise specified.
  • the term a FVIII protein includes a functional fragment, variant, analog, or derivative thereof that retains the function of full-length wild-type Factor VIII in the coagulation pathway.
  • a FVIII protein is used interchangeably with FVIII polypeptide (or protein) or FVIII. Examples of the FVIII functions include, but not limited to, an ability to activate coagulation, an ability to act as a cofactor for factor IX, or an ability to form a tenase complex with factor IX in the presence of Ca 2+ and phospholipids, which then converts Factor X to the activated form Xa.
  • the FVIII protein can be the human, porcine, canine, rat, or murine FVIII protein.
  • comparisons between FVIII from humans and other species have identified conserved residues that are likely to be required for function (Cameron et ah, Thromb. Haemost. 79:317-22 (1998); US 6,251,632).
  • a number of tests are available to assess the function of the coagulation system: activated partial thromboplastin time (aPTT) test, chromogenic assay, ROTEM assay, prothrombin time (PT) test (also used to determine INR), fibrinogen testing (often by the Clauss method), platelet count, platelet function testing (often by PFA- 100), TCT, bleeding time, mixing test (whether an abnormality corrects if the patient's plasma is mixed with normal plasma), coagulation factor assays, antiphospho lipid antibodies, D-dimer, genetic tests (e.g., factor V Leiden, prothrombin mutation G20210A), dilute Russell's viper venom time (dRVVT), miscellaneous platelet function tests, thromboelastography (TEG or Sonoclot), thromboelastometry (TEM ® , e.g., ROTEM ® ), or euglobulin lysis time (ELT).
  • aPTT activated partial thro
  • the aPTT test is a performance indicator measuring the efficacy of both the "intrinsic"
  • ROTEM analysis provides information on the whole kinetics of haemostasis: clotting time, clot formation, clot stability and lysis.
  • the different parameters in thromboelastometry are dependent on the activity of the plasmatic coagulation system, platelet function, fibrinolysis, or many factors which influence these interactions.
  • This assay can provide a complete view of secondary haemostasis.
  • FVIII polypeptide and polynucleotide sequences are known, as are many functional fragments, mutants and modified versions. Examples of human FVIII sequences (full-length) are shown below.
  • FVIII Fral-length FVIII (FVIII signal peptide underlined; FVIII heavy chain is double underlined;
  • FVIII polypeptides include full-length FVIII, full-length FVIII minus Met at the N- terminus, mature FVIII (minus the signal sequence), mature FVIII with an additional Met at the N-terminus, and/or FVIII with a full or partial deletion of the B domain.
  • FVIII variants include B domain deletions, whether partial or full deletions.
  • FVIII protein has the following formula: Al-al-A2-a2-B-a3-A3-Cl-C2, where Al, A2, and A3 are the structurally-related "A domains,” B is the “B domain,” CI and C2 are the structurally- related "C domains,” and al, a2 and a3 are acidic spacer regions.
  • the Al domain of human FVIII extends from Alal to about Arg336, the al spacer region extends from about Met337 to about Val374, the A2 domain extends from about Ala375 to about Tyr719, the a2 spacer region extends from about Glu720 to about Arg740, the B domain extends from about Ser741 to about Arg 1648, the a3 spacer region extends from about Glul649 to about Argl689, the A3 domain extends from about Serl690 to about Leu2025, the CI domain extends from about Gly2026 to about Asn2072, and the C2 domain extends from about Ser2073 to Tyr2332.
  • designation of the locations of the boundaries between the domains and regions of FVIII can vary in different literature references. The boundaries noted herein are therefore designated as approximate by use of the term "about.”
  • the human FVIII gene was isolated and expressed in mammalian cells (Toole, J. J., et al,
  • the human FVIII B-domain is replaced with the human Factor V B-domain as shown in U.S. Pat. No. 5,004,803.
  • the cDNA sequence encoding human Factor VIII and amino acid sequence are shown in SEQ ID NOs: 1 and 2, respectively, of US Application Publ. No. 2005/0100990.
  • porcine FVIII sequence is published in Toole, J. J., et al, Proc. Natl. Acad. Sci. USA
  • the FVIII (or FVIII portion of a chimeric protein) may be at least
  • FVIII amino acid sequence of amino acids 1 to 1438 of SEQ ID NO: 67 or amino acids 1 to 2332 of SEQ ID NO: 65 (without a signal sequence) or a FVIII amino acid sequence of amino acids 1 to 19 of SEQ ID NO: 64 and 1 to 1438 of SEQ ID NO: 67 or amino acids 1 to 19 of SEQ ID NO: 64 and amino acids 1 to 2332 of SEQ ID NO: 65 (with a signal sequence), wherein the FVIII has a clotting activity, e.g., activates Factor IX as a cofactor to convert Factor X to activated Factor X.
  • a clotting activity e.g., activates Factor IX as a cofactor to convert Factor X to activated Factor X.
  • the FVIII (or FVIII portion of a chimeric protein) may be identical to a FVIII amino acid sequence of amino acids 1 to 1438 of SEQ ID NO: 67 or amino acids 1 to 2332 of SEQ ID NO: 65 (without a signal sequence).
  • the FVIII may further comprise a signal sequence.
  • the "B-domain" of FVIII is the same as the B-domain known in the art that is defined by internal amino acid sequence identity and sites of proteolytic cleavage, e.g., residues Ser741-Argl648 of full-length human FVIII.
  • the other human FVIII domains are defined by the following amino acid residues: Al, residues Alal-Arg372; A2, residues Ser373- Arg740; A3, residues Serl690-Asn2019; CI, residues Lys2020-Asn2172; C2, residues Ser2173- Tyr2332.
  • the A3-C1-C2 sequence includes residues Serl690-Tyr2332.
  • BDD FVIII B-domain- deleted factor VIII
  • REFACTO ® recombinant BDD FVIII
  • BDD FVIII heavy chain is double underlined; B domain is italicized; and BDD FVIII light chain is in plain text.
  • SEQ ID NO: 68 A nucleotide sequence encoding Table 6 (SEQ ID NO: 68) is shown in Table 6.
  • ATGTGCACTC AGGCCTGATT GGACCCCTTC TGGTCTGCCA CACTAACACA CTGAACCCTG 3661 CTCATGGGAG ACAAGTGACA GTACAGGAAT TTGCTCTGTT TTTCACCATC TTTGATGAGA
  • a "B-domain-deleted FVIII" may have the full or partial deletions disclosed in U.S. Pat.
  • a B-domain-deleted FVIII sequence of the present invention comprises any one of the deletions disclosed at col. 4, line 4 to col. 5, line 28 and Examples 1-5 of U.S. Pat. No. 6,316,226 (also in US 6,346,513).
  • a B-domain deleted Factor VIII is the S743/Q1638 B-domain deleted Factor VIII (SQ BDD FVIII) (e.g., Factor VIII having a deletion from amino acid 744 to amino acid 1637, e.g., Factor VIII having amino acids 1-743 and amino acids 1638-2332 of SEQ ID NO: 65, i.e., SEQ ID NO: 67).
  • a B-domain- deleted FVIII of the present invention has a deletion disclosed at col. 2, lines 26-51 and examples 5-8 of U.S. Patent No. 5,789,203 (also US 6,060,447, US 5,595,886, and US 6,228,620).
  • a B-domain-deleted Factor VIII has a deletion described in col. 1, lines 25 to col. 2, line 40 of US Patent No. 5,972,885; col. 6, lines 1-22 and example 1 of U.S. Patent no. 6,048,720; col. 2, lines 17-46 of U.S. Patent No. 5,543,502; col. 4, line 22 to col. 5, line 36 of U.S. Patent no. 5,171,844; col. 2, lines 55-68, figure 2, and example 1 of U.S. Patent No. 5,1 12,950; col. 2, line 2 to col. 19, line 21 and table 2 of U.S. Patent No. 4,868,1 12; col. 2, line 1 to col. 3, line 19, col. 3, line 40 to col.
  • a B-domain-deleted FVIII has a deletion of most of the B domain, but still contains amino-terminal sequences of the B domain that are essential for in vivo proteolytic processing of the primary translation product into two polypeptide chain, as disclosed in WO 91/09122.
  • a B-domain-deleted FVIII is constructed with a deletion of amino acids 747- 1638, i.e., virtually a complete deletion of the B domain.
  • a B-domain-deleted Factor VIII may also contain a deletion of amino acids 771-1666 or amino acids 868- 1562 of FVIII. Meulien P., et al. Protein Eng. 2(4): 301-6 (1988). Additional B domain deletions that are part of the invention include: deletion of amino acids 982 through 1562 or 760 through 1639 (Toole et al, Proc. Natl. Acad. Sci. U.S.A. (1986) 83, 5939-5942)), 797 through 1562 (Eaton, et al.
  • BDD FVIII includes a FVIII polypeptide containing fragments of the B- domain that retain one or more N-linked glycosylation sites, e.g., residues 757, 784, 828, 900, 963, or optionally 943, which correspond to the amino acid sequence of the full-length FVIII sequence.
  • B-domain fragments include 226 amino acids or 163 amino acids of the B-domain as disclosed in Miao, H.Z., et al, Blood 103(a): 3412-3419 (2004), Kasuda, A, et al, J. Thromb. Haemost. 6: 1352-1359 (2008), and Pipe, S.W., et al, J. Thromb.
  • BDD FVIII further comprises a point mutation at residue 309 (from Phe to Ser) to improve expression of the BDD FVIII protein. See Miao, H.Z., et al., Blood 103(a): 3412-3419 (2004).
  • the BDD FVIII includes a FVIII polypeptide containing a portion of the B-domain, but not containing one or more furin cleavage sites (e.g., Argl313 and Arg 1648). See Pipe, S.W., et al, J. Thromb. Haemost. 9: 2235-2242 (201 1). Each of the foregoing deletions may be made in any FVIII sequence.
  • the FVIII has a partial B-domain. In some embodiments, the
  • FVIII protein with a partial B-domain is FVIII198.
  • FVIII198 is a partial B-domain containing single chain FVIIIFc molecule-226N6.
  • Number 226 represents the N-terminus 226 amino acid of the FVIII B-domain, and N6 represents six N-glycosylation sites in the B-domain.
  • FVIII is cleaved right after Arginine at amino acid 1648 (in full- length Factor VIII or SEQ ID NO: 65), amino acid 754 (in the S743/Q1638 B-domain deleted Factor VIII or SEQ ID NO: 67), or the corresponding Arginine residue (in other variants), thereby resulting in a heavy chain and a light chain.
  • FVIII comprises a heavy chain and a light chain, which are linked or associated by a metal ion-mediated non-covalent bond.
  • FVIII is a single chain FVIII that has not been cleaved right after
  • Arginine at amino acid 1648 in full-length FVIII or SEQ ID NO: 65
  • amino acid 754 in the S743/Q1638 B-domain-deleted FVIII or SEQ ID NO: 67
  • the corresponding Arginine residue in other variants.
  • a single chain FVIII may comprise one or more amino acid substitutions.
  • the amino acid substitution is at a residue corresponding to residue 1648, residue 1645, or both of full-length mature Factor VIII polypeptide (SEQ ID NO: 65) or residue 754, residue 751, or both of SQ BDD Factor VIII (SEQ ID NO: 67).
  • the amino acid substitution can be any amino acids other than Arginine, e.g., isoleucine, leucine, lysine, methionine, phenylalanine, threonine, tryptophan, valine, alanine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, proline, selenocysteine, serine, tyrosine, histidine, ornithine, pyrrolysine, or taurine.
  • Arginine e.g., isoleucine, leucine, lysine, methionine, phenylalanine, threonine, tryptophan, valine, alanine, asparagine, aspartic acid, cysteine, glutamic acid, glutamine, glycine, proline, selenocysteine, serine, tyrosine, histidine, ornithine, pyrrol
  • FVIII can further be cleaved by thrombin and then activated as FVIIIa, serving as a cofactor for activated Factor IX (FIXa). And the activated FIX together with activated FVIII forms a Xase complex and converts Factor X to activated Factor X (FXa).
  • FVIII is cleaved by thrombin after three Arginine residues, at amino acids 372, 740, and 1689 (corresponding to amino acids 372, 740, and 795 in the B-domain deleted FVIII sequence), the cleavage generating FVIIIa having the 50kDa Al, 43kDa A2, and 73kDa A3-C1-C2 chains.
  • the FVIII protein useful for the present invention is non-active FVIII.
  • the FVIII protein is an activated FVIII.
  • the protein having FVIII polypeptide linked to or associated with the VWF protein can comprise a sequence at least 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 65 or 67, wherein the sequence has the FVIII clotting activity, e.g., activating Factor IX as a cofactor to convert Factor X to activated Factor X (FXa).
  • FXa Factor IX as a cofactor to convert Factor X to activated Factor X
  • Hybrid or “chimeric” polypeptides and proteins, as used herein, includes a combination of a first polypeptide chain, e.g., the VWF protein fused to an XTEN sequence having less than 288 amino acids and a first Ig constant region or a portion thereof, with a second polypeptide chain, e.g., a FVIII protein fused to a second Ig constant region or a portion thereof, thereby forming a heterodimer.
  • the first polypeptide and the second polypeptide in a hybrid are associated with each other via protein-protein interactions, such as charge-charge or hydrophobic interactions.
  • a first polypeptide comprises a VWF protein- XTEN-Fc fusion protein
  • a second polypeptide comprises FVIII-Fc fusion protein, making the hybrid a heterodimer, wherein the XTEN contains less than 288 amino acids.
  • the first polypeptide comprises a VWF protein-XTEN-Fc fusion protein
  • the second polypeptide comprises FVIII(X)-Fc fusion protein, making the hybrid a heterodimer, wherein the XTEN contains less than 288 amino acids.
  • the first polypeptide and the second polypeptide can be associated through a covalent bond, e.g., a disulfide bond, between the first Fc region and the second Fc region.
  • the first polypeptide and the second polypeptide can further be associated with each other by binding between the VWF fragment and the FVIII protein.
  • a FVIII protein useful in the present invention can include FVIII having one or more additional XTEN sequences, which do not affect the FVIII coagulation activity.
  • Such XTEN sequences can be fused to the C-terminus or N-terminus of the FVIII protein or inserted between one or more of the two amino acid residues in the FVIII protein while the insertions do not affect the FVIII coagulation activity or FVIII function.
  • the insertions improve pharmacokinetic properties of the FVIII protein (e.g., half-life).
  • the insertions can be multiple insertions, e.g., more than two, three, four, five, six, seven, eight, nine, or ten insertions. Examples of the insertion sites include, but are not limited to, the sites listed in Tables 7, 8, 9, 10, 1 1, 12, 13, 14, 15 or any combinations thereof.
  • the FVIII protein linked to one or more XTEN sequences can be represented as
  • a is the N-terminal amino acid residue of the first portion of the FVIII protein
  • b is the C-terminal amino acid residue of the first portion of the FVIII protein but is also the N- terminal amino acid residue of the two amino acids of an insertion site in which the XTEN sequence is inserted,
  • c is the N-terminal amino acid residue of the second portion of the FVIII protein but is also the C- terminal amino acid residue of the two amino acids of an insertion site in which the XTEN sequence is inserted, and
  • d is the C-terminal amino acid residue of the FVIII protein
  • first portion of the FVIII protein and the second portion of the FVIII protein are not identical to each other and are of sufficient length together such that the FVIII protein has a FVIII coagulation activity.
  • FVIII protein are fragments of SEQ ID NO: 65 [full length mature FVIII sequence] or SEQ ID NO: 67 [B-domain deleted FVIII], e.g., N-terminal portion and C-terminal portion, respectively.
  • the first portion of the FVIII protein comprises the Al domain and the A2 domain of the FVIII protein.
  • the second portion of the FVIII protein comprises the A3 domain, the CI domain, and optionally the C2 domain.
  • the first portion of the FVIII protein comprises the Al domain and A2 domain
  • the second portion of the FVIII protein comprises a portion of the B domain, the A3 domain, the CI domain, and optionally the C2 domain.
  • the first portion of the FVIII protein comprises the Al domain, A2 domain, and a portion of the B domain of the FVIII protein
  • the second portion of the FVIII protein comprises the A3 domain, the C 1 domain, and optionally the C2 domain.
  • the first portion of the FVIII protein comprises the Al domain, A2 domain, and a first portion of the B domain of the FVIII protein.
  • the second portion of the FVIII protein comprises a second portion of the B domain, the A3 domain, the CI domain, and optionally the C2 domain.
  • the two amino acids can be any one or more of the amino acid residues insertion sites shown in Tables 7, 8, 9, 10, 1 1 , 12, 13, 14, and 15.
  • "b” can be the amino acid residue immediately upstream of the site in which one or more XTEN sequences are inserted or linked
  • "c” can be the amino acid residue immediately downstream of the site in which the one or more XTEN sequences are inserted or linked.
  • "a” is the first mature amino acid sequence of a FVIII protein
  • "d” is the last amino acid sequence of a FVIII protein.
  • FVIII (a ⁇ 3 ⁇ 4 can be an amino acid sequence at least 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or 100% identical to amino acids 1 to 745 of SEQ ID NO: 67 [B domain deleted FVIII amino acid sequence] or SEQ ID NO: 65 [full length FVIII] and FVIll (c ⁇ d) can be amino acids 746 to 1438 of SEQ ID NO: 67 or amino acids 1641 to 2332 of SEQ ID NO: 65, respectively.
  • the insertion site in the FVIII protein is located in one or more domains of the FVIII protein, which is the N-terminus, the Al domain, the A2 domain, the A3 domain, the B domain, the C 1 domain, the C2 domain, the C-terminus, or two or more combinations thereof or between two domains of the FVIII protein, which are the Al domain and al acidic region, and the al acidic region and A2 domain, the A2 domain and a2 acidic region, the a2 acidic region and B domain, the B domain and A3 domain, and the A3 domain and C 1 domain, the C 1 domain and C2 domain, or any combinations thereof.
  • the insertion sites in which the XTEN sequence can be inserted are selected from the group consisting of the N-terminus and Al domain, the N-terminus and A2 domain, the N-terminus and A3 domain, the N-terminus and B domain, the N-terminus and C 1 domain, the N-terminus and C2 domain, the N-terminus and the C-terminus, the Al and A2 domains, the Al and A3 domains, the Al and B domains, the Al and C I domains, the Al and C2 domains, the Al domain and the C-terminus, the A2 and A3 domains, the A2 and B domains, the A2 and CI domains, the A2 and C2 domains, the A2 domain and the C-terminus, the A3 and B domains, the A3 and CI domains, the A3 and C2 domains, the A3 domain and the C-terminus, the B and C 1 domains, the B and C2 domains, the B domain and the C-terminus, the group consist
  • the FVIII protein in which the XTEN sequence is inserted immediately downstream of one or more amino acids (e.g., one or more XTEN insertion sites) in the FVIII protein or linked at the C-terminus or the N-terminus, retains the FVIII activity after linkage to or insertion by the XTEN sequence.
  • the XTEN sequence can be inserted in the FVIII protein once or more than once, twice, three times, four times, five times, or six times such that the insertions do not affect the FVIII activity (i.e., the FVIII protein still retains the coagulation property).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Animal Behavior & Ethology (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Molecular Biology (AREA)
  • Hematology (AREA)
  • Immunology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Epidemiology (AREA)
  • Toxicology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Diabetes (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Medicinal Preparation (AREA)
PCT/US2015/010738 2014-01-10 2015-01-09 Factor viii chimeric proteins and uses thereof Ceased WO2015106052A1 (en)

Priority Applications (39)

Application Number Priority Date Filing Date Title
EP24157036.5A EP4389139A3 (en) 2014-01-10 2015-01-09 Factor viii chimeric proteins and uses thereof
ES15735473T ES2927475T3 (es) 2014-01-10 2015-01-09 Proteínas quiméricas de factor VIII y usos de las mismas
EA201691111A EA201691111A1 (ru) 2014-01-10 2015-01-09 Химерные белки фактора viii и их применение
UAA201607049A UA120917C2 (uk) 2014-01-10 2015-01-09 Химерний білок фактора viii та його застосування
US15/110,673 US11192936B2 (en) 2014-01-10 2015-01-09 Factor VIII chimeric proteins and uses thereof
CN202310324943.9A CN117106095A (zh) 2014-01-10 2015-01-09 因子viii嵌合蛋白及其用途
RS20220879A RS63583B1 (sr) 2014-01-10 2015-01-09 Himerni proteini faktora viii i njihova upotreba
LTEPPCT/US2015/010738T LT3091997T (lt) 2014-01-10 2015-01-09 Viii faktoriaus chimeriniai baltymai ir jų panaudojimo būdai
IL246476A IL246476B (en) 2014-01-10 2015-01-09 Factor viii chimeric proteins and their uses
BR112016015512-2A BR112016015512B1 (pt) 2014-01-10 2015-01-09 Proteína quimérica, composição farmacêutica e seus usos
SG11201605242YA SG11201605242YA (en) 2014-01-10 2015-01-09 Factor viii chimeric proteins and uses thereof
JP2016545930A JP6749836B2 (ja) 2014-01-10 2015-01-09 第viii因子キメラタンパク質及びその使用
BR122023020301-1A BR122023020301B1 (pt) 2014-01-10 2015-01-09 Uso de uma proteína quimérica compreendendo uma proteína fviii
KR1020167021744A KR102409250B1 (ko) 2014-01-10 2015-01-09 인자 viii 키메라 단백질 및 이들의 용도
IL282168A IL282168B2 (en) 2014-01-10 2015-01-09 Factor viii chimeric proteins and their uses
MYPI2016001276A MY192481A (en) 2014-01-10 2015-01-09 Factor viii chimeric proteins and uses thereof
AU2015204646A AU2015204646B2 (en) 2014-01-10 2015-01-09 Factor VIII chimeric proteins and uses thereof
DK15735473.9T DK3091997T5 (da) 2014-01-10 2015-01-09 Kimære faktor viii-proteiner og anvendelser deraf
HRP20220960TT HRP20220960T1 (hr) 2014-01-10 2015-01-09 Kimerni proteini faktora viii i njihova upotreba
CN202510297383.1A CN120209161A (zh) 2014-01-10 2015-01-09 因子viii嵌合蛋白及其用途
PH1/2016/501323A PH12016501323B1 (en) 2014-01-10 2015-01-09 Factor viii chimeric proteins and uses thereof
CN202310343186.XA CN116621991A (zh) 2014-01-10 2015-01-09 因子viii嵌合蛋白及其用途
MX2016008958A MX389878B (es) 2014-01-10 2015-01-09 Proteinas quimericas de factor viii y usos de estas.
PL15735473.9T PL3091997T3 (pl) 2014-01-10 2015-01-09 Białka chimeryczne czynnika viii i ich zastosowania
EP22181403.1A EP4176894B1 (en) 2014-01-10 2015-01-09 Factor viii chimeric proteins and uses thereof
SI201531867T SI3091997T1 (sl) 2014-01-10 2015-01-09 Himerni proteini faktorja VIII in njihova uporaba
CN202210167747.0A CN114736305B (zh) 2014-01-10 2015-01-09 因子viii嵌合蛋白及其用途
CA2935954A CA2935954C (en) 2014-01-10 2015-01-09 Factor viii chimeric proteins and uses thereof
NZ721544A NZ721544A (en) 2014-01-10 2015-01-09 Factor viii chimeric proteins and uses thereof
CN201580009942.9A CN106456718B (zh) 2014-01-10 2015-01-09 因子viii嵌合蛋白及其用途
CN202310334224.5A CN116731201A (zh) 2014-01-10 2015-01-09 因子viii嵌合蛋白及其用途
EP15735473.9A EP3091997B1 (en) 2014-01-10 2015-01-09 Factor viii chimeric proteins and uses thereof
AU2020277146A AU2020277146B2 (en) 2014-01-10 2020-11-25 Factor VIII chimeric proteins and uses thereof
US17/519,719 US20220275057A1 (en) 2014-01-10 2021-11-05 Factor viii chimeric proteins and uses thereof
AU2024205200A AU2024205200A1 (en) 2014-01-10 2024-07-30 Factor VIII chimeric proteins and uses thereof
NL301303C NL301303I2 (nl) 2014-01-10 2024-12-10 efanesoctocog alfa
LTPA2024536C LTPA2024536I1 (https=) 2014-01-10 2024-12-13
FR24C1052C FR24C1052I2 (fr) 2014-01-10 2024-12-13 Protéines chimériques de facteur viii et leurs utilisations
US19/029,777 US20250289869A1 (en) 2014-01-10 2025-01-17 Factor viii chimeric proteins and uses thereof

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201461926226P 2014-01-10 2014-01-10
US61/926,226 2014-01-10
US201461988104P 2014-05-02 2014-05-02
US61/988,104 2014-05-02

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/110,673 A-371-Of-International US11192936B2 (en) 2014-01-10 2015-01-09 Factor VIII chimeric proteins and uses thereof
US17/519,719 Division US20220275057A1 (en) 2014-01-10 2021-11-05 Factor viii chimeric proteins and uses thereof

Publications (1)

Publication Number Publication Date
WO2015106052A1 true WO2015106052A1 (en) 2015-07-16

Family

ID=53524349

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/010738 Ceased WO2015106052A1 (en) 2014-01-10 2015-01-09 Factor viii chimeric proteins and uses thereof

Country Status (30)

Country Link
US (3) US11192936B2 (https=)
EP (3) EP4389139A3 (https=)
JP (5) JP6749836B2 (https=)
KR (1) KR102409250B1 (https=)
CN (6) CN117106095A (https=)
AU (3) AU2015204646B2 (https=)
BR (1) BR112016015512B1 (https=)
CY (3) CY1125614T1 (https=)
DK (2) DK3091997T5 (https=)
EA (1) EA201691111A1 (https=)
ES (2) ES2982051T3 (https=)
FI (2) FI4176894T3 (https=)
FR (1) FR24C1052I2 (https=)
HR (2) HRP20220960T1 (https=)
HU (3) HUE066567T2 (https=)
IL (2) IL282168B2 (https=)
LT (3) LT3091997T (https=)
MX (2) MX389878B (https=)
MY (2) MY192481A (https=)
NL (1) NL301303I2 (https=)
NO (1) NO2024057I1 (https=)
NZ (1) NZ721544A (https=)
PH (1) PH12016501323B1 (https=)
PL (2) PL3091997T3 (https=)
PT (2) PT4176894T (https=)
RS (2) RS65533B1 (https=)
SG (3) SG11201605242YA (https=)
SI (2) SI3091997T1 (https=)
UA (1) UA120917C2 (https=)
WO (1) WO2015106052A1 (https=)

Cited By (38)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN105567733A (zh) * 2016-01-11 2016-05-11 佛山安普泽生物医药股份有限公司 CHO细胞表达凝血酶-Fc融合蛋白的方法
US9376672B2 (en) 2009-08-24 2016-06-28 Amunix Operating Inc. Coagulation factor IX compositions and methods of making and using same
WO2016188907A1 (en) * 2015-05-22 2016-12-01 Csl Behring Recombinant Facility Ag Truncated von willebrand factor polypeptides for treating hemophilia
EP3013358A4 (en) * 2013-06-28 2017-03-22 Biogen MA Inc. Thrombin cleavable linker with xten and its uses thereof
WO2017050820A1 (en) * 2015-09-22 2017-03-30 Novo Nordisk A/S Fviii fusion proteins
WO2017129630A1 (en) * 2016-01-26 2017-08-03 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-vwf d'd3 single-domain antibodies and polypeptides comprising thereof
WO2017136358A1 (en) 2016-02-01 2017-08-10 Bioverativ Therapeutics Inc. Optimized factor viii genes
WO2017197048A1 (en) * 2016-05-11 2017-11-16 Amunix Operating Inc. Albumin binding conjugate compositions and methods of making and using same
WO2017222337A1 (ko) * 2016-06-24 2017-12-28 재단법인 목암생명과학연구소 Fviii 및 vwf 인자를 포함하는 키메라 단백질 및 그 용도
WO2018102760A1 (en) 2016-12-02 2018-06-07 Bioverativ Therapeutics Inc. Methods of inducing immune tolerance to clotting factors
WO2018102743A1 (en) 2016-12-02 2018-06-07 Bioverativ Therapeutics Inc. Methods of treating hemophilic arthropathy using chimeric clotting factors
US10138291B2 (en) 2012-07-11 2018-11-27 Bioverativ Therapeutics Inc. Factor VIII complex with XTEN and von Willebrand Factor protein, and uses thereof
WO2019032898A1 (en) 2017-08-09 2019-02-14 Bioverativ Therapeutics Inc. NUCLEIC ACID MOLECULES AND USES THEREOF
US10370430B2 (en) 2012-02-15 2019-08-06 Bioverativ Therapeutics Inc. Recombinant factor VIII proteins
WO2019152692A1 (en) 2018-02-01 2019-08-08 Bioverativ Therapeutics, Inc. Use of lentiviral vectors expressing factor viii
US10421798B2 (en) 2012-02-15 2019-09-24 Bioverativ Therapeutics Inc. Factor VIII compositions and methods of making and using same
WO2019222682A1 (en) 2018-05-18 2019-11-21 Bioverativ Therapeutics Inc. Methods of treating hemophilia a
US10548953B2 (en) 2013-08-14 2020-02-04 Bioverativ Therapeutics Inc. Factor VIII-XTEN fusions and uses thereof
WO2020033863A1 (en) 2018-08-09 2020-02-13 Bioverativ Therapeutics Inc. Nucleic acid molecules and uses thereof for non-viral gene therapy
CN110950964A (zh) * 2018-09-26 2020-04-03 安源医药科技(上海)有限公司 突变型单链人凝血因子viii融合蛋白及其制备方法与用途
US10745680B2 (en) 2015-08-03 2020-08-18 Bioverativ Therapeutics Inc. Factor IX fusion proteins and methods of making and using same
WO2020187969A1 (en) 2019-03-19 2020-09-24 CSL Behring Lengnau AG Factor ix variants and uses thereof in therapy
WO2020215010A1 (en) 2019-04-17 2020-10-22 Codiak Biosciences, Inc. Compositions of exosomes and aav
EP3736286A1 (en) 2019-05-09 2020-11-11 Biotest AG Single chain factor viii molecule
WO2020257462A1 (en) 2019-06-19 2020-12-24 Bioverativ Therapeutics Inc. Recombinant factor viii-fc for treating hemophilia and low bone mineral density
WO2021067389A1 (en) 2019-09-30 2021-04-08 Bioverativ Therapeutics Inc. Lentiviral vector formulations
US11192936B2 (en) 2014-01-10 2021-12-07 Bioverativ Therapeutics Inc. Factor VIII chimeric proteins and uses thereof
WO2021262963A1 (en) 2020-06-24 2021-12-30 Bioverativ Therapeutics Inc. Methods for the removal of free factor viii from preparations of lentiviral vectors modified to express said protein
US20220033475A1 (en) * 2018-10-23 2022-02-03 The Children's Hospital Of Philadelphia Compositions and methods for modulating factor viii function
US11339204B2 (en) 2017-05-04 2022-05-24 Imperial College Innovations Ltd. Truncated VWF
US11370827B2 (en) 2012-01-12 2022-06-28 Bioverativ Therapeutics Inc. Chimeric factor VIII polypeptides and uses thereof
WO2023028440A2 (en) 2021-08-23 2023-03-02 Bioverativ Therapeutics Inc. Baculovirus expression system
WO2023028456A1 (en) 2021-08-23 2023-03-02 Bioverativ Therapeutics Inc. Optimized factor viii genes
WO2023056331A1 (en) 2021-09-30 2023-04-06 Bioverativ Therapeutics Inc. Nucleic acids encoding factor viii polypeptides with reduced immunogenicity
US11642398B2 (en) 2013-03-15 2023-05-09 Bioverativ Therapeutics Inc. Factor IX polypeptide formulations
US11787851B2 (en) 2013-02-15 2023-10-17 Bioverativ Therapeutics Inc. Optimized factor VIII gene
RU2812863C2 (ru) * 2018-05-18 2024-02-05 Байоверетив Терапьютикс Инк. Способы лечения гемофилии a
US12275970B2 (en) 2014-06-30 2025-04-15 Bioverativ Therapeutics Inc. Optimized factor IX gene

Families Citing this family (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CA2748314C (en) * 2009-02-03 2018-10-02 Amunix Operating Inc. Extended recombinant polypeptides and compositions comprising same
US10640822B2 (en) * 2016-02-29 2020-05-05 Iridia, Inc. Systems and methods for writing, reading, and controlling data stored in a polymer
WO2020028830A1 (en) 2018-08-03 2020-02-06 Sangamo Therapeutics, Inc. Improved clinical parameters by expression of factor viii
MY204234A (en) 2018-08-27 2024-08-16 Regeneron Pharma Use of raman spectroscopy in downstream purification
US10654911B1 (en) * 2019-04-02 2020-05-19 Beijing Neoletix Biological Technology Co., Ltd. Vector co-expressing truncated von Willebrand factor and factor VIII
WO2022018541A1 (en) 2020-07-22 2022-01-27 Ricoh Company, Ltd. Ink set, printed matter, printing method, and printing device
AU2022298798A1 (en) 2021-06-23 2024-02-08 Bioverativ Therapeutics Inc. Formulations of factor viii chimeric proteins and uses thereof
CN115873099B (zh) * 2022-12-30 2023-10-20 福因医药科技(武汉)有限公司 一种改造的重组凝血因子viii及其应用
CN116715752B (zh) * 2023-06-16 2024-11-15 苏州诺洁贝生物技术有限公司 凝血因子fviii蛋白变体、表达载体和用途

Citations (91)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4215051A (en) 1979-08-29 1980-07-29 Standard Oil Company (Indiana) Formation, purification and recovery of phthalic anhydride
WO1987004187A1 (en) 1986-01-03 1987-07-16 Genetics Institute, Inc. METHOD FOR PRODUCING FACTOR VIII:c-TYPE PROTEINS
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4713339A (en) 1983-01-19 1987-12-15 Genentech, Inc. Polycistronic expression vector construction
WO1988003558A1 (en) 1986-11-14 1988-05-19 Genetics Institute, Inc. Eucaryotic expression system
US4757006A (en) 1983-10-28 1988-07-12 Genetics Institute, Inc. Human factor VIII:C gene and recombinant methods for production
WO1988007089A1 (en) 1987-03-18 1988-09-22 Medical Research Council Altered antibodies
WO1988008035A1 (en) 1987-04-06 1988-10-20 Genetics Institute, Inc. IMPROVED METHOD FOR PRODUCING FACTOR VIII:c-TYPE PROTEINS
US4800159A (en) 1986-02-07 1989-01-24 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences
US4868112A (en) 1985-04-12 1989-09-19 Genetics Institute, Inc. Novel procoagulant proteins
US4965188A (en) 1986-08-22 1990-10-23 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme
US4965199A (en) 1984-04-20 1990-10-23 Genentech, Inc. Preparation of functional human factor VIII in mammalian cells using methotrexate based selection
US4994371A (en) 1987-08-28 1991-02-19 Davie Earl W DNA preparation of Christmas factor and use of DNA sequences
US5004803A (en) 1988-11-14 1991-04-02 Genetics Institute, Inc. Production of procoagulant proteins
WO1991009122A1 (en) 1989-12-15 1991-06-27 Kabivitrum Ab A recombinant human factor viii derivative
US5112950A (en) 1987-08-11 1992-05-12 Transgene S.A. Factor viii analog, preparation process, and pharmaceutical composition containing it
US5171844A (en) 1987-06-12 1992-12-15 Gist-Brocades N.W. Proteins with factor viii activity: process for their preparation using genetically-engineered cells and pharmaceutical compositions containing them
WO1993020093A1 (en) 1992-04-07 1993-10-14 Emory University Hybrid human/porcine factor viii
WO1994011503A2 (en) 1992-11-13 1994-05-26 Genetics Institute, Inc. Chimeric factor viii
WO1996014339A1 (en) 1994-11-05 1996-05-17 The Wellcome Foundation Limited Antibodies
US5543502A (en) 1986-06-24 1996-08-06 Novo Nordisk A/S Process for producing a coagulation active complex of factor VIII fragments
US5595886A (en) 1986-01-27 1997-01-21 Chiron Corporation Protein complexes having Factor VIII:C activity and production thereof
US5658570A (en) 1991-07-25 1997-08-19 Idec Pharmaceuticals Corporation Recombinant antibodies for human therapy
WO1998005787A1 (en) 1996-08-02 1998-02-12 Bristol-Myers Squibb Company A method for inhibiting immunoglobulin-induced toxicity resulting from the use of immunoglobulins in therapy and in vivo diagnosis
US5739277A (en) 1995-04-14 1998-04-14 Genentech Inc. Altered polypeptides with increased half-life
WO1998023289A1 (en) 1996-11-27 1998-06-04 The General Hospital Corporation MODULATION OF IgG BINDING TO FcRn
US5834250A (en) 1988-10-28 1998-11-10 Genentech, Inc. Method for identifying active domains and amino acid residues in polypeptides and hormone variants
US5859204A (en) 1992-04-07 1999-01-12 Emory University Modified factor VIII
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
US5972885A (en) 1993-07-05 1999-10-26 Pharmacia & Upjohn Aktiebolag Method for treatment of hemophilia by extravascular administration of factor VIII deletion derivatives
US5981216A (en) 1985-04-01 1999-11-09 Alusuisse Holdings A.G. Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same
WO1999058572A1 (en) 1998-05-08 1999-11-18 Cambridge University Technical Services Limited Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis
WO2000009560A2 (en) 1998-08-17 2000-02-24 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
US6030613A (en) 1995-01-17 2000-02-29 The Brigham And Women's Hospital, Inc. Receptor specific transepithelial transport of therapeutics
US6048720A (en) 1995-09-29 2000-04-11 Pharmacia & Upjohn Ab Conjugates of a polypeptide and a biocompatible polymer
US6060447A (en) 1987-05-19 2000-05-09 Chiron Corporation Protein complexes having Factor VIII:C activity and production thereof
WO2000032767A1 (en) 1998-12-03 2000-06-08 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. RECOMBINANT SOLUBLE Fc RECEPTORS
US6086875A (en) 1995-01-17 2000-07-11 The Brigham And Women's Hospital, Inc. Receptor specific transepithelial transport of immunogens
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
US6096871A (en) 1995-04-14 2000-08-01 Genentech, Inc. Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life
US6121022A (en) 1995-04-14 2000-09-19 Genentech, Inc. Altered polypeptides with increased half-life
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
US6242195B1 (en) 1998-04-02 2001-06-05 Genentech, Inc. Methods for determining binding of an analyte to a receptor
US6251632B1 (en) 1997-03-06 2001-06-26 Queen's University At Kingston Canine factor VIII gene, protein and methods of use
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
US6346513B1 (en) 1987-06-12 2002-02-12 Baxter Trading Gmbh Proteins with factor VIII activity: process for their preparation using genetically-engineered cells and pharmaceutical compositions containing them
US6376463B1 (en) 1992-04-07 2002-04-23 Emory University Modified factor VIII
WO2002044215A2 (en) 2000-12-01 2002-06-06 Cockbain, Julian Hybrid antibodies
WO2002060919A2 (en) 2000-12-12 2002-08-08 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
US6458563B1 (en) 1996-06-26 2002-10-01 Emory University Modified factor VIII
US6485726B1 (en) 1995-01-17 2002-11-26 The Brigham And Women's Hospital, Inc. Receptor specific transepithelial transport of therapeutics
US6528624B1 (en) 1998-04-02 2003-03-04 Genentech, Inc. Polypeptide variants
WO2003074569A2 (en) 2002-03-01 2003-09-12 Immunomedics, Inc. Bispecific antibody point mutations for enhancing rate of clearance
WO2003077834A2 (en) 2002-03-15 2003-09-25 The Brigham And Women's Hospital, Inc. Central airway administration for systemic delivery of therapeutics
WO2004016750A2 (en) 2002-08-14 2004-02-26 Macrogenics, Inc. FcϜRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF
WO2004029207A2 (en) 2002-09-27 2004-04-08 Xencor Inc. Optimized fc variants and methods for their generation
WO2004035752A2 (en) 2002-10-15 2004-04-29 Protein Design Labs, Inc. ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
WO2004044859A1 (en) 2002-11-14 2004-05-27 Gary Michael Wilson Warning unit
WO2004063351A2 (en) 2003-01-09 2004-07-29 Macrogenics, Inc. IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME
WO2004074455A2 (en) 2003-02-20 2004-09-02 Applied Molecular Evolution Fc REGION VARIANTS
WO2004099249A2 (en) 2003-05-02 2004-11-18 Xencor, Inc. Optimized fc variants and methods for their generation
WO2005040217A2 (en) 2003-10-17 2005-05-06 Cambridge University Technical Services Limited Antibodies having a mutated amino acid residue at position 268 (ch2 region) in constant regions
US20050100990A1 (en) 2003-10-31 2005-05-12 American National Red Cross Factor VIII compositions and methods
WO2005047327A2 (en) 2003-11-12 2005-05-26 Biogen Idec Ma Inc. NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO
WO2005070963A1 (en) 2004-01-12 2005-08-04 Applied Molecular Evolution, Inc Fc region variants
WO2005077981A2 (en) 2003-12-22 2005-08-25 Xencor, Inc. Fc POLYPEPTIDES WITH NOVEL Fc LIGAND BINDING SITES
WO2005092925A2 (en) 2004-03-24 2005-10-06 Xencor, Inc. Immunoglobulin variants outside the fc region
WO2005123780A2 (en) 2004-04-09 2005-12-29 Protein Design Labs, Inc. Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis
WO2006019447A1 (en) 2004-07-15 2006-02-23 Xencor, Inc. Optimized fc variants
WO2006047350A2 (en) 2004-10-21 2006-05-04 Xencor, Inc. IgG IMMUNOGLOBULIN VARIANTS WITH OPTIMIZED EFFECTOR FUNCTION
US7041635B2 (en) 2003-01-28 2006-05-09 In2Gen Co., Ltd. Factor VIII polypeptide
WO2006085967A2 (en) 2004-07-09 2006-08-17 Xencor, Inc. OPTIMIZED ANTI-CD20 MONOCONAL ANTIBODIES HAVING Fc VARIANTS
US20070231329A1 (en) 2003-03-03 2007-10-04 Xencor, Inc. Fc Variants Having Increased Affinity for FcyRIIb
US7317091B2 (en) 2002-03-01 2008-01-08 Xencor, Inc. Optimized Fc variants
US20080057056A1 (en) 2003-03-03 2008-03-06 Xencor, Inc. Fc Variants with Increased Affinity for FcyRIIC
US7348004B2 (en) 2003-05-06 2008-03-25 Syntonix Pharmaceuticals, Inc. Immunoglobulin chimeric monomer-dimer hybrids
US7404956B2 (en) 2003-05-06 2008-07-29 Syntonix Pharmaceuticals, Inc. Immunoglobulin chimeric monomer-dimer hybrids
US20090192076A1 (en) * 2007-12-28 2009-07-30 Baxter International Inc. Recombinant vwf formulations
WO2010091122A1 (en) 2009-02-03 2010-08-12 Amunix, Inc. Extended recombinant polypeptides and compositions comprising same
WO2010144508A1 (en) 2009-06-08 2010-12-16 Amunix Operating Inc. Glucose-regulating polypeptides and methods of making and using same
WO2010144502A2 (en) 2009-06-08 2010-12-16 Amunix Operating Inc. Growth hormone polypeptides and methods of making and using same
US20110046061A1 (en) 2009-02-03 2011-02-24 Amunix Operating, Inc. Coagulation factor VII compositions and methods of making and using same
WO2011028344A2 (en) 2009-08-25 2011-03-10 Amunix Operating Inc. Interleukin-1 receptor antagonist compositions and methods of making and using same
US20110077199A1 (en) 2009-02-03 2011-03-31 Amunix, Inc. Growth hormone polypeptides and methods of making and using same
US20110172146A1 (en) 2009-02-03 2011-07-14 Amunix Operating, Inc. Growth hormone polypeptides and methods of making and using same
US20110183907A1 (en) * 2008-06-24 2011-07-28 Thomas Weimer Factor viii, von willebrand factor or complexes thereof with prolonged in vivo half-life
US20120289468A1 (en) * 2009-11-13 2012-11-15 Grifols Therapeutics Inc. Von willebrand factor (vwf)-containing preparations, and methods, kits, and uses related thereto
WO2013122617A1 (en) 2012-02-15 2013-08-22 Amunix Operating Inc. Factor viii compositions and methods of making and using same

Family Cites Families (77)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
KR910006424B1 (ko) 1985-08-21 1991-08-24 인코텍스 비.브이 편성브리프(brief) 제조방법
DE3720246A1 (de) 1987-06-19 1988-12-29 Behringwerke Ag Faktor viii:c-aehnliches molekuel mit koagulationsaktivitaet
US20060122376A1 (en) 1991-02-07 2006-06-08 Chiron Corporation Protein complexes having factor VIII:C activity and production thereof
US5846951A (en) 1991-06-06 1998-12-08 The School Of Pharmacy, University Of London Pharmaceutical compositions
US6037452A (en) 1992-04-10 2000-03-14 Alpha Therapeutic Corporation Poly(alkylene oxide)-Factor VIII or Factor IX conjugate
US5643575A (en) 1993-10-27 1997-07-01 Enzon, Inc. Non-antigenic branched polymer conjugates
US6818439B1 (en) 1994-12-30 2004-11-16 Chiron Corporation Methods for administration of recombinant gene delivery vehicles for treatment of hemophilia and other disorders
GB9722131D0 (en) 1997-10-20 1997-12-17 Medical Res Council Method
US6358703B1 (en) 1998-12-10 2002-03-19 Bayer Corporation Expression system for factor VIII
US7829085B2 (en) 1999-07-14 2010-11-09 Life Sciences Research Partners Vzw Methods of treating hemostasis disorders using antibodies binding the C1 domain of factor VIII
CA2378473A1 (en) 1999-07-23 2001-02-01 The Regents Of The University Of California Modulation of platelet activation
EP2206720A1 (en) 2000-04-12 2010-07-14 Human Genome Sciences, Inc. Albumin fusion proteins
AU2001258536A1 (en) 2000-05-16 2001-11-26 Lipoxen Technologies Limited Derivatisation of proteins in aqueous solution
JP2001326635A (ja) 2000-05-16 2001-11-22 Matsushita Electric Ind Co Ltd インターネットの課金システム
US7211395B2 (en) 2001-03-09 2007-05-01 Dyax Corp. Serum albumin binding moieties
TW503179B (en) 2001-05-07 2002-09-21 Benq Corp Ink jetting device having bubble valve and the method thereof
JP2003110596A (ja) 2001-09-28 2003-04-11 Hitachi Ltd データ通信サービス提供方法
US20080194481A1 (en) 2001-12-21 2008-08-14 Human Genome Sciences, Inc. Albumin Fusion Proteins
EP2261250B1 (en) 2001-12-21 2015-07-01 Human Genome Sciences, Inc. GCSF-Albumin fusion proteins
KR101271635B1 (ko) 2001-12-21 2013-06-12 휴먼 게놈 사이언시즈, 인코포레이티드 알부민 융합 단백질
AU2003275103A1 (en) 2002-09-17 2004-04-08 Diffusion Science, Inc. Electrochemical generation, storage and reaction of hydrogen and oxygen using gas permeable catalyst-coated hollow microspheres
WO2004075923A2 (en) 2003-02-26 2004-09-10 Nektar Therapeutics Al, Corporation Polymer-factor viii moiety conjugates
CA2515798A1 (en) 2003-02-27 2004-09-10 Her Majesty The Queen In Right Of Canada, As Represented By The Minister Of National Research Council Of Canada Peptide inhibitors of thrombin as potent anticoagulants
CA2515989C (en) 2003-02-28 2009-09-15 Kuraray Co., Ltd. Curable resin composition
PT1624891E (pt) 2003-05-06 2010-01-05 Syntonix Pharmaceuticals Inc Proteínas quiméricas de factor de coagulação-fc destinadas ao tratamento da hemofilia
WO2005016974A1 (en) 2003-08-12 2005-02-24 Lipoxen Technologies Limited Sialic acid derivatives for protein derivatisation and conjugation
CN1871252A (zh) * 2003-09-05 2006-11-29 Gtc生物治疗学公司 在转基因哺乳动物奶中生产融合蛋白的方法
US7566701B2 (en) 2004-09-07 2009-07-28 Archemix Corp. Aptamers to von Willebrand Factor and their use as thrombotic disease therapeutics
CA2591852A1 (en) 2004-12-27 2006-07-06 Baxter International Inc. Polymer-von willebrand factor-conjugates
GB0516091D0 (en) 2005-08-04 2005-09-14 Haemostatix Ltd Therapeutic agent
MX2008001865A (es) 2005-08-12 2008-04-15 Human Genome Sciences Inc Proteinas de fusion de albumina.
US7846445B2 (en) 2005-09-27 2010-12-07 Amunix Operating, Inc. Methods for production of unstructured recombinant polymers and uses thereof
EP1816201A1 (en) 2006-02-06 2007-08-08 CSL Behring GmbH Modified coagulation factor VIIa with extended half-life
EP1996937A4 (en) 2006-03-06 2009-04-08 Amunix Inc GENETIC PACKS AND USES THEREOF
EP1867660A1 (en) 2006-06-14 2007-12-19 CSL Behring GmbH Proteolytically cleavable fusion protein comprising a blood coagulation factor
AU2007260185B2 (en) 2006-06-14 2013-01-31 Csl Behring Gmbh Proteolytically cleavable fusion protein comprising a blood coagulation factor
US7939632B2 (en) 2006-06-14 2011-05-10 Csl Behring Gmbh Proteolytically cleavable fusion proteins with high molar specific activity
JP2010503396A (ja) 2006-09-14 2010-02-04 ヒューマン ジノーム サイエンシーズ, インコーポレイテッド アルブミン融合タンパク質
US8969532B2 (en) 2006-10-03 2015-03-03 Novo Nordisk A/S Methods for the purification of polypeptide conjugates comprising polyalkylene oxide using hydrophobic interaction chromatography
US20100041872A1 (en) 2006-10-04 2010-02-18 Defrees Shawn Glycerol linked pegylated sugars and glycopeptides
AU2007338298B2 (en) 2006-12-22 2013-02-07 Csl Behring Gmbh Modified coagulation factors with prolonged in vivo half-life
EP1935430A1 (en) 2006-12-22 2008-06-25 CSL Behring GmbH Modified coagulation factors with prolonged in vivo half-life
ATE502114T1 (de) 2007-06-21 2011-04-15 Univ Muenchen Tech Biologisch aktive proteine mit erhöhter in-vivo- und/oder in-vitro-stabilität
US8933197B2 (en) 2007-08-15 2015-01-13 Amunix Operating Inc. Compositions comprising modified biologically active polypeptides
CN101965409A (zh) 2007-11-01 2011-02-02 罗切斯特大学 具有增加的稳定性的重组因子viii
CA2704234A1 (en) 2007-11-09 2009-05-14 Baxter International Inc. Modified recombinant factor viii and von willebrand factor and methods of use
KR100981092B1 (ko) 2008-02-29 2010-09-08 고려대학교 산학협력단 제8 혈액응고 인자와 폰 빌리 블란트 인자 변이체의 재조합발현 벡터 시스템
JP5499018B2 (ja) * 2008-03-25 2014-05-21 ジョンソン コントロールズ テクノロジー カンパニー 縫製の代わりに接着剤を使用する車両トリムの応用
JP2012510060A (ja) 2008-11-24 2012-04-26 バイエル・ヘルスケア・エルエルシー シリカをベースとする活性化部分トロンボプラスチン時間アッセイにおけるpeg化血液凝固因子の活性の測定方法
WO2010111414A1 (en) 2009-03-24 2010-09-30 Bayer Healthcare Llc Factor viii variants and methods of use
EP3061460A1 (en) 2009-04-10 2016-08-31 Tufts Medical Center, Inc. Par-1 activation by metalloproteinase-1 (mmp-1)
US8450905B2 (en) * 2009-07-23 2013-05-28 New Scale Technologies Methods for controlling velocity of at least partially resonant actuators systems and systems thereof
KR20120061898A (ko) 2009-08-20 2012-06-13 체에스엘 베링 게엠베하 출혈성 장애의 치료요법 및 예방 치료에 있어서의 비정맥내 투여를 위한 알부민 융합 응고 인자
JP5544219B2 (ja) 2009-09-24 2014-07-09 富士フイルム株式会社 内視鏡システム
HRP20171739T1 (hr) 2009-11-20 2018-03-09 Tonix Pharma Holdings Limited Postupci i kompozicije za liječenje simptoma povezanih s posttraumatskim stresnim poremećajem korištenjem ciklobenzaprina
PL3326643T3 (pl) 2009-12-06 2021-10-25 Bioverativ Therapeutics Inc. Chimeryczne i hybrydowe polipeptydy czynnika VIII-FC oraz sposoby ich zastosowania
US20110312881A1 (en) 2009-12-21 2011-12-22 Amunix, Inc. Bifunctional polypeptide compositions and methods for treatment of metabolic and cardiovascular diseases
US20130040888A1 (en) 2010-02-16 2013-02-14 Novo Nordisk A/S Factor VIII Molecules With Reduced VWF Binding
CN105153313A (zh) 2010-02-16 2015-12-16 诺沃—诺迪斯克有限公司 因子viii融合蛋白
WO2011123830A2 (en) 2010-04-02 2011-10-06 Amunix Operating Inc. Alpha 1-antitrypsin compositions and methods of making and using same
TWI619713B (zh) 2010-04-21 2018-04-01 普雷辛肯公司 用於激酶調節的化合物和方法及其適應症
RU2561465C2 (ru) 2010-05-20 2015-08-27 Аллерган, Инк. Разрушаемые клостридиальные токсины
EP2591101B1 (en) 2010-07-09 2018-11-07 Bioverativ Therapeutics Inc. Systems for factor viii processing and methods thereof
SG10201505217WA (en) 2010-07-09 2015-08-28 Biogen Hemophilia Inc Chimeric clotting factors
US20130017997A1 (en) 2010-08-19 2013-01-17 Amunix Operating Inc. Factor VIII Compositions and Methods of Making and Using Same
DK2804623T3 (da) * 2012-01-12 2019-11-11 Bioverativ Therapeutics Inc Kimære faktor viii-polypeptider og anvendelser deraf
CA2864126A1 (en) 2012-02-15 2013-08-22 Biogen Idec Ma Inc. Recombinant factor viii proteins
JP2015515482A (ja) 2012-04-24 2015-05-28 ノヴォ ノルディスク アー/エス 血友病の治療に適する化合物
HRP20200007T1 (hr) * 2012-07-11 2020-03-20 Bioverativ Therapeutics Inc. Kompleks proteina faktora viii s xten i von willebrandovim faktorom, te njegova uporaba
US9832881B2 (en) * 2013-04-19 2017-11-28 Inktec Co., Ltd. Method of manufacturing transparent electrode film for display and transparent electrode film for display
EP2796145B1 (en) 2013-04-22 2017-11-01 CSL Ltd. A covalent complex of von willebrand factor and faktor viii linked by a disulphide bridge
US10272137B2 (en) * 2013-06-27 2019-04-30 The Board Of Regents Of The University Of Texas System Compositions and methods relating to myomaker-induced muscle cell fusion
WO2014210547A1 (en) 2013-06-28 2014-12-31 Biogen Idec Ma Inc. Thrombin cleavable linker
SG10201710616XA (en) 2013-06-28 2018-02-27 Biogen Ma Inc Thrombin cleavable linker with xten and its uses thereof
AU2015204646B2 (en) 2014-01-10 2020-08-27 Bioverativ Therapeutics Inc. Factor VIII chimeric proteins and uses thereof
EP3588013A1 (de) 2018-06-26 2020-01-01 XelectriX Power GmbH Verfahren zur abgabe von elektrischer energie

Patent Citations (116)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4215051A (en) 1979-08-29 1980-07-29 Standard Oil Company (Indiana) Formation, purification and recovery of phthalic anhydride
US4713339A (en) 1983-01-19 1987-12-15 Genentech, Inc. Polycistronic expression vector construction
US4757006A (en) 1983-10-28 1988-07-12 Genetics Institute, Inc. Human factor VIII:C gene and recombinant methods for production
US4965199A (en) 1984-04-20 1990-10-23 Genentech, Inc. Preparation of functional human factor VIII in mammalian cells using methotrexate based selection
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4683202B1 (https=) 1985-03-28 1990-11-27 Cetus Corp
US5981216A (en) 1985-04-01 1999-11-09 Alusuisse Holdings A.G. Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same
US4868112A (en) 1985-04-12 1989-09-19 Genetics Institute, Inc. Novel procoagulant proteins
WO1987004187A1 (en) 1986-01-03 1987-07-16 Genetics Institute, Inc. METHOD FOR PRODUCING FACTOR VIII:c-TYPE PROTEINS
US5595886A (en) 1986-01-27 1997-01-21 Chiron Corporation Protein complexes having Factor VIII:C activity and production thereof
US6228620B1 (en) 1986-01-27 2001-05-08 Chiron Corporation Protein complexes having factor VIII:C activity and production thereof
US5789203A (en) 1986-01-27 1998-08-04 Chiron Corporation Protein complexes having factor VIII:C activity and production thereof
US4683195B1 (https=) 1986-01-30 1990-11-27 Cetus Corp
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
US4800159A (en) 1986-02-07 1989-01-24 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences
US5610278A (en) 1986-06-24 1997-03-11 Novo Nordisk A/S Process for producing a coagulation active complex of factor VIII fragments
US5543502A (en) 1986-06-24 1996-08-06 Novo Nordisk A/S Process for producing a coagulation active complex of factor VIII fragments
US4965188A (en) 1986-08-22 1990-10-23 Cetus Corporation Process for amplifying, detecting, and/or cloning nucleic acid sequences using a thermostable enzyme
WO1988003558A1 (en) 1986-11-14 1988-05-19 Genetics Institute, Inc. Eucaryotic expression system
WO1988007089A1 (en) 1987-03-18 1988-09-22 Medical Research Council Altered antibodies
US5648260A (en) 1987-03-18 1997-07-15 Scotgen Biopharmaceuticals Incorporated DNA encoding antibodies with altered effector functions
WO1988008035A1 (en) 1987-04-06 1988-10-20 Genetics Institute, Inc. IMPROVED METHOD FOR PRODUCING FACTOR VIII:c-TYPE PROTEINS
US6060447A (en) 1987-05-19 2000-05-09 Chiron Corporation Protein complexes having Factor VIII:C activity and production thereof
US6316226B1 (en) 1987-06-12 2001-11-13 Baxter Trading Gmbh Proteins with Factor VIII activity: process for their preparation using genetically-engineered cells and pharmaceutical compositions containing them
US5171844A (en) 1987-06-12 1992-12-15 Gist-Brocades N.W. Proteins with factor viii activity: process for their preparation using genetically-engineered cells and pharmaceutical compositions containing them
US6346513B1 (en) 1987-06-12 2002-02-12 Baxter Trading Gmbh Proteins with factor VIII activity: process for their preparation using genetically-engineered cells and pharmaceutical compositions containing them
US5112950A (en) 1987-08-11 1992-05-12 Transgene S.A. Factor viii analog, preparation process, and pharmaceutical composition containing it
US4994371A (en) 1987-08-28 1991-02-19 Davie Earl W DNA preparation of Christmas factor and use of DNA sequences
US5834250A (en) 1988-10-28 1998-11-10 Genentech, Inc. Method for identifying active domains and amino acid residues in polypeptides and hormone variants
US5004803A (en) 1988-11-14 1991-04-02 Genetics Institute, Inc. Production of procoagulant proteins
WO1991009122A1 (en) 1989-12-15 1991-06-27 Kabivitrum Ab A recombinant human factor viii derivative
US5658570A (en) 1991-07-25 1997-08-19 Idec Pharmaceuticals Corporation Recombinant antibodies for human therapy
US5364771A (en) 1992-04-07 1994-11-15 Emory University Hybrid human/porcine factor VIII
US6376463B1 (en) 1992-04-07 2002-04-23 Emory University Modified factor VIII
US5859204A (en) 1992-04-07 1999-01-12 Emory University Modified factor VIII
WO1993020093A1 (en) 1992-04-07 1993-10-14 Emory University Hybrid human/porcine factor viii
WO1994011503A2 (en) 1992-11-13 1994-05-26 Genetics Institute, Inc. Chimeric factor viii
US5972885A (en) 1993-07-05 1999-10-26 Pharmacia & Upjohn Aktiebolag Method for treatment of hemophilia by extravascular administration of factor VIII deletion derivatives
WO1996014339A1 (en) 1994-11-05 1996-05-17 The Wellcome Foundation Limited Antibodies
US6485726B1 (en) 1995-01-17 2002-11-26 The Brigham And Women's Hospital, Inc. Receptor specific transepithelial transport of therapeutics
US6086875A (en) 1995-01-17 2000-07-11 The Brigham And Women's Hospital, Inc. Receptor specific transepithelial transport of immunogens
US6030613A (en) 1995-01-17 2000-02-29 The Brigham And Women's Hospital, Inc. Receptor specific transepithelial transport of therapeutics
US6121022A (en) 1995-04-14 2000-09-19 Genentech, Inc. Altered polypeptides with increased half-life
US5739277A (en) 1995-04-14 1998-04-14 Genentech Inc. Altered polypeptides with increased half-life
US6096871A (en) 1995-04-14 2000-08-01 Genentech, Inc. Polypeptides altered to contain an epitope from the Fc region of an IgG molecule for increased half-life
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US6998253B1 (en) 1995-04-14 2006-02-14 Genentech, Inc. Altered polypeptides with increased half-life
US6048720A (en) 1995-09-29 2000-04-11 Pharmacia & Upjohn Ab Conjugates of a polypeptide and a biocompatible polymer
US6458563B1 (en) 1996-06-26 2002-10-01 Emory University Modified factor VIII
WO1998005787A1 (en) 1996-08-02 1998-02-12 Bristol-Myers Squibb Company A method for inhibiting immunoglobulin-induced toxicity resulting from the use of immunoglobulins in therapy and in vivo diagnosis
WO1998023289A1 (en) 1996-11-27 1998-06-04 The General Hospital Corporation MODULATION OF IgG BINDING TO FcRn
US6821505B2 (en) 1997-03-03 2004-11-23 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
US6251632B1 (en) 1997-03-06 2001-06-26 Queen's University At Kingston Canine factor VIII gene, protein and methods of use
US6242195B1 (en) 1998-04-02 2001-06-05 Genentech, Inc. Methods for determining binding of an analyte to a receptor
WO1999051642A1 (en) 1998-04-02 1999-10-14 Genentech, Inc. Antibody variants and fragments thereof
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
US6528624B1 (en) 1998-04-02 2003-03-04 Genentech, Inc. Polypeptide variants
US6538124B1 (en) 1998-04-02 2003-03-25 Genentech, Inc. Polypeptide variants
WO1999058572A1 (en) 1998-05-08 1999-11-18 Cambridge University Technical Services Limited Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis
WO2000009560A2 (en) 1998-08-17 2000-02-24 Abgenix, Inc. Generation of modified molecules with increased serum half-lives
WO2000032767A1 (en) 1998-12-03 2000-06-08 MAX-PLANCK-Gesellschaft zur Förderung der Wissenschaften e.V. RECOMBINANT SOLUBLE Fc RECEPTORS
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
WO2000042072A2 (en) 1999-01-15 2000-07-20 Genentech, Inc. Polypeptide variants with altered effector function
WO2002044215A2 (en) 2000-12-01 2002-06-06 Cockbain, Julian Hybrid antibodies
US7083784B2 (en) 2000-12-12 2006-08-01 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
WO2002060919A2 (en) 2000-12-12 2002-08-08 Medimmune, Inc. Molecules with extended half-lives, compositions and uses thereof
WO2003074569A2 (en) 2002-03-01 2003-09-12 Immunomedics, Inc. Bispecific antibody point mutations for enhancing rate of clearance
US7317091B2 (en) 2002-03-01 2008-01-08 Xencor, Inc. Optimized Fc variants
US20030235536A1 (en) 2002-03-15 2003-12-25 The Brigham And Women's Hospital, Inc. Central airway administration for systemic delivery of therapeutics
WO2003077834A2 (en) 2002-03-15 2003-09-25 The Brigham And Women's Hospital, Inc. Central airway administration for systemic delivery of therapeutics
WO2004016750A2 (en) 2002-08-14 2004-02-26 Macrogenics, Inc. FcϜRIIB-SPECIFIC ANTIBODIES AND METHODS OF USE THEREOF
WO2004029207A2 (en) 2002-09-27 2004-04-08 Xencor Inc. Optimized fc variants and methods for their generation
WO2004035752A2 (en) 2002-10-15 2004-04-29 Protein Design Labs, Inc. ALTERATION OF FcRn BINDING AFFINITIES OR SERUM HALF-LIVES OF ANTIBODIES BY MUTAGENESIS
WO2004044859A1 (en) 2002-11-14 2004-05-27 Gary Michael Wilson Warning unit
WO2004063351A2 (en) 2003-01-09 2004-07-29 Macrogenics, Inc. IDENTIFICATION AND ENGINEERING OF ANTIBODIES WITH VARIANT Fc REGIONS AND METHODS OF USING SAME
US7041635B2 (en) 2003-01-28 2006-05-09 In2Gen Co., Ltd. Factor VIII polypeptide
WO2004074455A2 (en) 2003-02-20 2004-09-02 Applied Molecular Evolution Fc REGION VARIANTS
US20070237765A1 (en) 2003-03-03 2007-10-11 Xencor, Inc. Fc Variants Having Increased Affinity for FcyRl
US20070231329A1 (en) 2003-03-03 2007-10-04 Xencor, Inc. Fc Variants Having Increased Affinity for FcyRIIb
US20070243188A1 (en) 2003-03-03 2007-10-18 Xencor, Inc. Fc Variants Having Decreased Affinity for FcyRlla
US20080057056A1 (en) 2003-03-03 2008-03-06 Xencor, Inc. Fc Variants with Increased Affinity for FcyRIIC
US20070248603A1 (en) 2003-03-03 2007-10-25 Xencor, Inc. Fc Variants with Increased Affinity for FcyRlla
US20070286859A1 (en) 2003-03-03 2007-12-13 Xencor, Inc. Fc Variants Having Decreased Affinity for FcyRl
US20070237766A1 (en) 2003-03-03 2007-10-11 Xencor, Inc. Fc Variants Having Increased Affinity for FcyRllla
US20070237767A1 (en) 2003-03-03 2007-10-11 Xencor, Inc. Fc Variants Having Decreased Affinity for FcyRllla
WO2004099249A2 (en) 2003-05-02 2004-11-18 Xencor, Inc. Optimized fc variants and methods for their generation
US7348004B2 (en) 2003-05-06 2008-03-25 Syntonix Pharmaceuticals, Inc. Immunoglobulin chimeric monomer-dimer hybrids
US7404956B2 (en) 2003-05-06 2008-07-29 Syntonix Pharmaceuticals, Inc. Immunoglobulin chimeric monomer-dimer hybrids
US7862820B2 (en) 2003-05-06 2011-01-04 Syntonix Pharmaceuticals, Inc. Immunoglobulin chimeric monomer-dimer hybrids
WO2005040217A2 (en) 2003-10-17 2005-05-06 Cambridge University Technical Services Limited Antibodies having a mutated amino acid residue at position 268 (ch2 region) in constant regions
US20050100990A1 (en) 2003-10-31 2005-05-12 American National Red Cross Factor VIII compositions and methods
WO2005047327A2 (en) 2003-11-12 2005-05-26 Biogen Idec Ma Inc. NEONATAL Fc RECEPTOR (FcRn)-BINDING POLYPEPTIDE VARIANTS, DIMERIC Fc BINDING PROTEINS AND METHODS RELATED THERETO
WO2005077981A2 (en) 2003-12-22 2005-08-25 Xencor, Inc. Fc POLYPEPTIDES WITH NOVEL Fc LIGAND BINDING SITES
WO2005070963A1 (en) 2004-01-12 2005-08-04 Applied Molecular Evolution, Inc Fc region variants
WO2005092925A2 (en) 2004-03-24 2005-10-06 Xencor, Inc. Immunoglobulin variants outside the fc region
WO2005123780A2 (en) 2004-04-09 2005-12-29 Protein Design Labs, Inc. Alteration of fcrn binding affinities or serum half-lives of antibodies by mutagenesis
WO2006085967A2 (en) 2004-07-09 2006-08-17 Xencor, Inc. OPTIMIZED ANTI-CD20 MONOCONAL ANTIBODIES HAVING Fc VARIANTS
WO2006019447A1 (en) 2004-07-15 2006-02-23 Xencor, Inc. Optimized fc variants
WO2006047350A2 (en) 2004-10-21 2006-05-04 Xencor, Inc. IgG IMMUNOGLOBULIN VARIANTS WITH OPTIMIZED EFFECTOR FUNCTION
US20090192076A1 (en) * 2007-12-28 2009-07-30 Baxter International Inc. Recombinant vwf formulations
US20110183907A1 (en) * 2008-06-24 2011-07-28 Thomas Weimer Factor viii, von willebrand factor or complexes thereof with prolonged in vivo half-life
US20100239554A1 (en) 2009-02-03 2010-09-23 Amunix Inc. a Delaware Corporation Extended recombinant polypeptides and compositions comprising same
WO2010091122A1 (en) 2009-02-03 2010-08-12 Amunix, Inc. Extended recombinant polypeptides and compositions comprising same
US20100323956A1 (en) 2009-02-03 2010-12-23 Amunix, Inc. Glucose-regulating polypeptides and methods of making and using same
US20110077199A1 (en) 2009-02-03 2011-03-31 Amunix, Inc. Growth hormone polypeptides and methods of making and using same
US20110046061A1 (en) 2009-02-03 2011-02-24 Amunix Operating, Inc. Coagulation factor VII compositions and methods of making and using same
US20110172146A1 (en) 2009-02-03 2011-07-14 Amunix Operating, Inc. Growth hormone polypeptides and methods of making and using same
WO2010144502A2 (en) 2009-06-08 2010-12-16 Amunix Operating Inc. Growth hormone polypeptides and methods of making and using same
WO2010144508A1 (en) 2009-06-08 2010-12-16 Amunix Operating Inc. Glucose-regulating polypeptides and methods of making and using same
WO2011028228A1 (en) 2009-08-24 2011-03-10 Amunix Operating Inc. Coagulation factor vii compositions and methods of making and using same
WO2011028229A1 (en) 2009-08-24 2011-03-10 Amunix Operating Inc. Coagulation factor ix compositions and methods of making and using same
US20110046060A1 (en) 2009-08-24 2011-02-24 Amunix Operating, Inc., Coagulation factor IX compositions and methods of making and using same
WO2011028344A2 (en) 2009-08-25 2011-03-10 Amunix Operating Inc. Interleukin-1 receptor antagonist compositions and methods of making and using same
US20120289468A1 (en) * 2009-11-13 2012-11-15 Grifols Therapeutics Inc. Von willebrand factor (vwf)-containing preparations, and methods, kits, and uses related thereto
WO2013122617A1 (en) 2012-02-15 2013-08-22 Amunix Operating Inc. Factor viii compositions and methods of making and using same

Non-Patent Citations (59)

* Cited by examiner, † Cited by third party
Title
"Current Protocols in Molecular Biology", 1992, JOHN WILEY & SONS
"Oxford Dictionary Of Biochemistry And Molecular Biology", 2000, OXFORD UNIVERSITY PRESS
"Sustained and Controlled Release Drug Delivery Systems", 1978, MARCEL DEKKER, INC.
AMAU ET AL., PROT EXPR AND PURIF, vol. 48, 2006, pages 1 - 13
ARMOUR ET AL., EUR. J. IMMUNOL., vol. 29, 1999, pages 2613
BURMEISTER ET AL., NATURE, vol. 372, 1994, pages 379
CAMERON ET AL., THROMB. HAEMOST., vol. 79, 1998, pages 317 - 22
CAPON ET AL., NATURE, vol. 337, 1989, pages 525
DUMONT ET AL., BLOOD, vol. 119, no. 13, 13 January 2012 (2012-01-13), pages 3024 - 3030
EATON ET AL., BIOCHEMISTRY, vol. 25, 1986, pages 8343 - 8347
FRIEND ET AL., TRANSPLANTATION, vol. 68, 1999, pages 1632
GITSCHIER, J. ET AL., NATURE, vol. 312, 1984, pages 337 - 342
GOUDEMAND J ET AL., J THROMB HAEMOST, vol. 3, 2005, pages 2219 - 27
GRAW ET AL., NAT. REV. GENET., vol. 6, no. 6, 2005, pages 488 - 501
HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1999, CS.H.L. PRESS, PUB.
HEALEY, J. F. ET AL., BLOOD, vol. 88, 1996, pages 4209 - 4214
HENRIK, A. ET AL., ISTH MEETING, 2011
HO ET AL., GENE, vol. 77, 1989, pages 51
HOEBEN R.C. ET AL., J. BIOL. CHEM., vol. 265, no. 13, 1990, pages 7318 - 7323
HORTON ET AL., METHODS ENZYMOL., vol. 217, 1993, pages 270
ISRAEL ET AL., IMMUNOLOGY, vol. 92, 1997, pages 69
KASUDA, A ET AL., J. THROMB. HAEMOST., vol. 6, 2008, pages 1352 - 1359
KOBAYASHI ET AL., AM. J. PHYSIOL. RENAL PHYSIOL., vol. 282, 2002, pages F358
KRIEGLER, M.: "PCR Protocols: A Guide to Methods and Applications", 1990, W.H. FREEMAN CO.
LAGNER, BEHRING INST. MITT., no. 82, 1988, pages 16 - 25
LARRICK ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 160, 1989, pages 1250
LENTING ET AL., BLOOD, vol. 92, no. 11, 1998, pages 3983 - 96
LENTING ET AL., J. THROMB. HAEMOST., vol. 5, no. 7, 2007, pages 1353 - 60
LILLICRAP, D., THROMB. RES., vol. 4, 2008, pages 2 - 8
LIU, T. ET AL., ISTH MEETING ABSTRACT #P-WE-131, 2011
LIU, T. ET AL., ISTH MEETING, ABSTRACT #P-M-035, 2007
LOGANSHENK, PROC NATL ACAD SCI USA, vol. 81, 1984, pages 3655
MACKETT ET AL., J VIROL, vol. 49, 1984, pages 857
MEI ET AL., MOL. BIOTECHNOL., vol. 34, no. 2, 2006, pages 165 - 78
MEULIEN P. ET AL., PROTEIN ENG, vol. 2, no. 4, 1988, pages 301 - 6
MIAO, H.Z. ET AL., BLOOD, vol. 103, 2004, pages 3412 - 3419
MOUNT ET AL., BLOOD, vol. 99, no. 8, 2002, pages 2670
MURRY, E. J.: "Sequences of Proteins of Immunological Interest", vol. 7, 1991, U.S. DEPARTMENT OF PUBLIC HEALTH
NEUMANN, EMBO J, vol. 1, 1982, pages 841
PANICALI ET AL., PROC NATL ACAD SCI USA, vol. 79, 1982, pages 4927
PAUL, S.: "Antibody Engineering: A Practical Approach (Practical Approach Series", vol. 169, 1996, HUMANA PR
PIPE, S.W. ET AL., J. THROMB. HAEMOST., vol. 9, 2011, pages 2235 - 2242
ROUTLEDGE ET AL., TRANSPLANTATION, vol. 60, 1995, pages 847
RUBERTI, F. ET AL., J. IMMUNOL. METHODS, vol. 173, 1994, pages 33
RUTHER ET AL., EMBO J, vol. 2, 1983, pages 1791
SAMBROOK ET AL.: "Fritsch and Maniatis, Molecular Cloning", vol. 2, 1989, GREENE PUBLISH. ASSOC. & WILEY INTERSCIENCE
SARVER ET AL., DNA, vol. 6, 1987, pages 553 - 564
SCHELLENBERGER ET AL.: "A RECOMBINANT POLYPEPTIDE EXTENDS THE IN VIVO HALF-LIFE OF PEPTIDES AND PROTEINSIN A TUNABLE MANNER", NATURE BIOTECHNOLOGY, vol. 27, no. 12, 1 December 2009 (2009-12-01), pages 1186 - 1190, XP002665891, DOI: 10.1038/NBT.1588 *
SHIELDS ET AL., J. BIOL. CHEM., vol. 276, 1995, pages 6591
SHIELDS ET AL., J. BIOL. CHEM., vol. 276, 2001, pages 6591
SIMONSEN C C ET AL., PROC NATL ACAD SCI USA, vol. 80, 1983, pages 2495 - 9
SMITHWATERMAN, ADVANCES IN APPLIED MATHEMATICS, vol. 2, 1981, pages 482 - 489
STORY ET AL., J. EXP. MED., vol. 180, 1994, pages 2377
TOOLE ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 83, 1986, pages 5939 - 5942
TOOLE, J. J. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 83, 1986, pages 5939 - 5942
WARDGHETIE, THERAPEUTIC IMMUNOLOGY, vol. 2, 1995, pages 77
WEINER M.A.CAIRO, M.S.: "Disorders of Coagulation", 2001, ELSEVIER HEALTH SCIENCES, article "Pediatric Hematology Secrets, Lee, M.T., 12"
WIGLER ET AL., CELL, vol. 14, 1978, pages 725
ZHOUR ET AL., BLOOD, 6 April 2012 (2012-04-06)

Cited By (68)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9376672B2 (en) 2009-08-24 2016-06-28 Amunix Operating Inc. Coagulation factor IX compositions and methods of making and using same
US9758776B2 (en) 2009-08-24 2017-09-12 Amunix Operating Inc. Coagulation factor IX compositions and methods of making and using same
US11370827B2 (en) 2012-01-12 2022-06-28 Bioverativ Therapeutics Inc. Chimeric factor VIII polypeptides and uses thereof
US10421798B2 (en) 2012-02-15 2019-09-24 Bioverativ Therapeutics Inc. Factor VIII compositions and methods of making and using same
US11685771B2 (en) 2012-02-15 2023-06-27 Bioverativ Therapeutics Inc. Recombinant factor VIII proteins
US10370430B2 (en) 2012-02-15 2019-08-06 Bioverativ Therapeutics Inc. Recombinant factor VIII proteins
US11091534B2 (en) 2012-07-11 2021-08-17 Bioverativ Therapeutics Inc. Factor VIII complex with XTEN and von Willebrand Factor protein, and uses thereof
US10138291B2 (en) 2012-07-11 2018-11-27 Bioverativ Therapeutics Inc. Factor VIII complex with XTEN and von Willebrand Factor protein, and uses thereof
US11787851B2 (en) 2013-02-15 2023-10-17 Bioverativ Therapeutics Inc. Optimized factor VIII gene
US11642398B2 (en) 2013-03-15 2023-05-09 Bioverativ Therapeutics Inc. Factor IX polypeptide formulations
EP4368194A3 (en) * 2013-06-28 2024-07-31 Bioverativ Therapeutics Inc. Thrombin cleavable linker with xten and its uses thereof
EP3013358A4 (en) * 2013-06-28 2017-03-22 Biogen MA Inc. Thrombin cleavable linker with xten and its uses thereof
US10548953B2 (en) 2013-08-14 2020-02-04 Bioverativ Therapeutics Inc. Factor VIII-XTEN fusions and uses thereof
US11192936B2 (en) 2014-01-10 2021-12-07 Bioverativ Therapeutics Inc. Factor VIII chimeric proteins and uses thereof
US12275970B2 (en) 2014-06-30 2025-04-15 Bioverativ Therapeutics Inc. Optimized factor IX gene
US10688157B2 (en) 2015-05-22 2020-06-23 CSL Behring Lengnau AG Truncated von Willebrand factor polypeptides for treating hemophilia
WO2016188907A1 (en) * 2015-05-22 2016-12-01 Csl Behring Recombinant Facility Ag Truncated von willebrand factor polypeptides for treating hemophilia
US10745680B2 (en) 2015-08-03 2020-08-18 Bioverativ Therapeutics Inc. Factor IX fusion proteins and methods of making and using same
WO2017050820A1 (en) * 2015-09-22 2017-03-30 Novo Nordisk A/S Fviii fusion proteins
CN105567733A (zh) * 2016-01-11 2016-05-11 佛山安普泽生物医药股份有限公司 CHO细胞表达凝血酶-Fc融合蛋白的方法
WO2017129630A1 (en) * 2016-01-26 2017-08-03 INSERM (Institut National de la Santé et de la Recherche Médicale) Anti-vwf d'd3 single-domain antibodies and polypeptides comprising thereof
US10626186B2 (en) 2016-01-26 2020-04-21 Inserm (Institut National De La Sante Et De La Recherche Medicale) Anti-VWF D'D3 single-domain antibodies and methods of use
WO2017136358A1 (en) 2016-02-01 2017-08-10 Bioverativ Therapeutics Inc. Optimized factor viii genes
EP4137570A1 (en) 2016-02-01 2023-02-22 Bioverativ Therapeutics Inc. Optimized factor viii genes
US11753461B2 (en) 2016-02-01 2023-09-12 Bioverativ Therapeutics Inc. Optimized factor VIII genes
WO2017197048A1 (en) * 2016-05-11 2017-11-16 Amunix Operating Inc. Albumin binding conjugate compositions and methods of making and using same
US11046749B2 (en) 2016-06-24 2021-06-29 Mogam Institute For Biomedical Research Chimera protein comprising FVIII and vWF factors, and use thereof
WO2017222337A1 (ko) * 2016-06-24 2017-12-28 재단법인 목암생명과학연구소 Fviii 및 vwf 인자를 포함하는 키메라 단백질 및 그 용도
EP3476937A4 (en) * 2016-06-24 2019-12-04 Mogam Institute for Biomedical Research CHIMERIC PROTEIN WITH FVIII AND VWF FACTORS AND USE THEREOF
US12257288B2 (en) 2016-12-02 2025-03-25 Bioverativ Therapeutics Inc. Methods of inducing immune tolerance to clotting factors
US12161696B2 (en) 2016-12-02 2024-12-10 Bioverativ Therapeutics Inc. Methods of treating hemophilic arthropathy using chimeric clotting factors
WO2018102760A1 (en) 2016-12-02 2018-06-07 Bioverativ Therapeutics Inc. Methods of inducing immune tolerance to clotting factors
WO2018102743A1 (en) 2016-12-02 2018-06-07 Bioverativ Therapeutics Inc. Methods of treating hemophilic arthropathy using chimeric clotting factors
US11339204B2 (en) 2017-05-04 2022-05-24 Imperial College Innovations Ltd. Truncated VWF
WO2019032898A1 (en) 2017-08-09 2019-02-14 Bioverativ Therapeutics Inc. NUCLEIC ACID MOLECULES AND USES THEREOF
IL272463B2 (en) * 2017-08-09 2025-12-01 Bioverativ Therapeutics Inc Nucleic acid molecules and uses thereof
TWI904068B (zh) * 2017-08-09 2025-11-11 美商生物化學醫療公司 核酸分子及其用途
IL272463B1 (en) * 2017-08-09 2025-08-01 Bioverativ Therapeutics Inc Nucleic acid molecules and uses thereof
US12168776B2 (en) 2017-08-09 2024-12-17 Bioverativ Therapeutics Inc. Nucleic acid molecules and uses thereof
WO2019152692A1 (en) 2018-02-01 2019-08-08 Bioverativ Therapeutics, Inc. Use of lentiviral vectors expressing factor viii
AU2019270184B2 (en) * 2018-05-18 2025-05-22 Bioverativ Therapeutics Inc. Methods of treating hemophilia A
RU2812863C2 (ru) * 2018-05-18 2024-02-05 Байоверетив Терапьютикс Инк. Способы лечения гемофилии a
EP4585260A2 (en) 2018-05-18 2025-07-16 Bioverativ Therapeutics Inc. Methods of treating hemophilia a
US12030925B2 (en) 2018-05-18 2024-07-09 Bioverativ Therapeutics Inc. Methods of treating hemophilia A
EP4585260A3 (en) * 2018-05-18 2025-08-13 Bioverativ Therapeutics Inc. Methods of treating hemophilia a
WO2019222682A1 (en) 2018-05-18 2019-11-21 Bioverativ Therapeutics Inc. Methods of treating hemophilia a
US20190375822A1 (en) * 2018-05-18 2019-12-12 Bioverativ Therapeutics Inc. Methods of treating hemophilia a
US12364774B2 (en) 2018-08-09 2025-07-22 Bioverativ Therapeutics Inc. Nucleic acid molecules and uses thereof for non-viral gene therapy
WO2020033863A1 (en) 2018-08-09 2020-02-13 Bioverativ Therapeutics Inc. Nucleic acid molecules and uses thereof for non-viral gene therapy
CN110950964B (zh) * 2018-09-26 2021-06-18 安源医药科技(上海)有限公司 突变型单链人凝血因子viii融合蛋白及其制备方法与用途
CN113105562B (zh) * 2018-09-26 2023-12-01 安源医药科技(上海)有限公司 突变型单链人凝血因子viii在制备融合蛋白中的应用
CN110950964A (zh) * 2018-09-26 2020-04-03 安源医药科技(上海)有限公司 突变型单链人凝血因子viii融合蛋白及其制备方法与用途
CN113105562A (zh) * 2018-09-26 2021-07-13 安源医药科技(上海)有限公司 突变型单链人凝血因子viii在制备融合蛋白中的应用
US20220033475A1 (en) * 2018-10-23 2022-02-03 The Children's Hospital Of Philadelphia Compositions and methods for modulating factor viii function
US12252528B2 (en) * 2018-10-23 2025-03-18 The Children's Hospital Of Philadelphia Compositions and methods for modulating Factor VIII function
WO2020187969A1 (en) 2019-03-19 2020-09-24 CSL Behring Lengnau AG Factor ix variants and uses thereof in therapy
US12577552B2 (en) 2019-03-19 2026-03-17 CSL Innovation Pty Ltd Factor IX variants and uses thereof in therapy
WO2020215010A1 (en) 2019-04-17 2020-10-22 Codiak Biosciences, Inc. Compositions of exosomes and aav
EP3736286A1 (en) 2019-05-09 2020-11-11 Biotest AG Single chain factor viii molecule
WO2020225405A1 (en) 2019-05-09 2020-11-12 Biotest Ag Single chain factor viii molecule
WO2020257462A1 (en) 2019-06-19 2020-12-24 Bioverativ Therapeutics Inc. Recombinant factor viii-fc for treating hemophilia and low bone mineral density
WO2021067389A1 (en) 2019-09-30 2021-04-08 Bioverativ Therapeutics Inc. Lentiviral vector formulations
US12403164B2 (en) 2019-09-30 2025-09-02 Bioverativ Therapeutics Inc. Lentiviral vector formulations
US12173307B2 (en) 2020-06-24 2024-12-24 Bioverativ Therapeutics Inc. Methods for the purification of viral vectors
WO2021262963A1 (en) 2020-06-24 2021-12-30 Bioverativ Therapeutics Inc. Methods for the removal of free factor viii from preparations of lentiviral vectors modified to express said protein
WO2023028456A1 (en) 2021-08-23 2023-03-02 Bioverativ Therapeutics Inc. Optimized factor viii genes
WO2023028440A2 (en) 2021-08-23 2023-03-02 Bioverativ Therapeutics Inc. Baculovirus expression system
WO2023056331A1 (en) 2021-09-30 2023-04-06 Bioverativ Therapeutics Inc. Nucleic acids encoding factor viii polypeptides with reduced immunogenicity

Also Published As

Publication number Publication date
CN114736305A (zh) 2022-07-12
EP3091997A1 (en) 2016-11-16
FR24C1052I2 (fr) 2026-04-03
EP4389139A3 (en) 2024-10-16
SG10201805924PA (en) 2018-08-30
CN116731201A (zh) 2023-09-12
EP4389139A2 (en) 2024-06-26
IL282168B2 (en) 2023-03-01
KR20160103136A (ko) 2016-08-31
LT3091997T (lt) 2022-08-25
NZ721544A (en) 2022-10-28
EP4176894A1 (en) 2023-05-10
JP2022118129A (ja) 2022-08-12
SG11201605242YA (en) 2016-07-28
CN116621991A (zh) 2023-08-22
FI4176894T3 (fi) 2024-05-29
HRP20240640T1 (hr) 2024-08-02
JP6749836B2 (ja) 2020-09-02
CN114736305B (zh) 2023-05-05
AU2015204646A1 (en) 2016-07-14
MX2016008958A (es) 2016-09-29
JP6906882B2 (ja) 2021-07-21
FIC20240043I1 (sv) 2024-12-11
LTPA2024536I1 (https=) 2025-01-10
RS63583B1 (sr) 2022-10-31
CN106456718A (zh) 2017-02-22
JP7104194B2 (ja) 2022-07-20
AU2020277146B2 (en) 2024-05-16
JP2020156520A (ja) 2020-10-01
NL301303I2 (nl) 2025-06-18
MX389878B (es) 2025-03-19
HUE059820T2 (hu) 2022-12-28
NO2024057I1 (no) 2024-12-12
HRP20220960T1 (hr) 2022-10-28
IL282168B (en) 2022-11-01
US20170073393A1 (en) 2017-03-16
PT3091997T (pt) 2022-09-29
ES2982051T3 (es) 2024-10-14
US11192936B2 (en) 2021-12-07
DK3091997T5 (da) 2024-10-14
MY192481A (en) 2022-08-23
SI4176894T1 (sl) 2024-07-31
BR122023020301A2 (pt) 2023-12-12
MY204756A (en) 2024-09-11
US20250289869A1 (en) 2025-09-18
IL282168A (en) 2021-05-31
RS65533B1 (sr) 2024-06-28
EP4176894B1 (en) 2024-02-28
EP3091997B1 (en) 2022-07-06
JP7612637B2 (ja) 2025-01-14
HUS2400043I1 (hu) 2025-01-28
CN117106095A (zh) 2023-11-24
DK3091997T3 (da) 2022-09-26
CY1125614T1 (el) 2026-02-25
MX2022001134A (es) 2022-07-13
EA201691111A1 (ru) 2017-01-30
AU2020277146A1 (en) 2020-12-24
CY2024034I2 (el) 2026-02-25
JP2025036503A (ja) 2025-03-14
JP2017503509A (ja) 2017-02-02
PL4176894T3 (pl) 2024-07-22
UA120917C2 (uk) 2020-03-10
BR112016015512B1 (pt) 2023-12-19
CN106456718B (zh) 2025-11-18
HUE066567T2 (hu) 2024-08-28
IL246476A0 (en) 2016-08-31
SG10201913697UA (en) 2020-03-30
CY1127055T1 (el) 2026-02-25
CN120209161A (zh) 2025-06-27
CA2935954A1 (en) 2015-07-16
EP3091997A4 (en) 2017-07-26
LT4176894T (lt) 2024-06-10
KR102409250B1 (ko) 2022-06-14
BR112016015512A2 (pt) 2017-10-24
PL3091997T3 (pl) 2023-01-02
IL246476B (en) 2022-06-01
US20220275057A1 (en) 2022-09-01
SI3091997T1 (sl) 2022-10-28
FR24C1052I1 (fr) 2025-01-17
ES2927475T3 (es) 2022-11-07
AU2015204646B2 (en) 2020-08-27
PT4176894T (pt) 2024-05-21
PH12016501323B1 (en) 2022-04-29
PH12016501323A1 (en) 2016-08-15
CY2024034I1 (el) 2026-02-25
JP2021065240A (ja) 2021-04-30
DK4176894T3 (da) 2024-05-27
AU2024205200A1 (en) 2024-10-03

Similar Documents

Publication Publication Date Title
US20250289869A1 (en) Factor viii chimeric proteins and uses thereof
US20240400645A1 (en) Methods of treating hemophilia a
AU2020203063B2 (en) Thrombin cleavable linker with XTEN and its uses thereof
US12570691B2 (en) Purification of chimeric FVIII molecules
RU2812863C2 (ru) Способы лечения гемофилии a
CA2935954C (en) Factor viii chimeric proteins and uses thereof
EA044115B1 (ru) Химерные белки фактора viii и их применение
BR122023020301B1 (pt) Uso de uma proteína quimérica compreendendo uma proteína fviii

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15735473

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 201691111

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 246476

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 12016501323

Country of ref document: PH

ENP Entry into the national phase

Ref document number: 2935954

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: MX/A/2016/008958

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2016545930

Country of ref document: JP

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 15110673

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112016015512

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2015204646

Country of ref document: AU

Date of ref document: 20150109

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: NC2016/0000175

Country of ref document: CO

REEP Request for entry into the european phase

Ref document number: 2015735473

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 2015735473

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20167021744

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: A201607049

Country of ref document: UA

WWE Wipo information: entry into national phase

Ref document number: 201580009942.9

Country of ref document: CN

ENP Entry into the national phase

Ref document number: 112016015512

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20160701