WO2012050925A2 - Highly soluble leptins - Google Patents
Highly soluble leptins Download PDFInfo
- Publication number
- WO2012050925A2 WO2012050925A2 PCT/US2011/053774 US2011053774W WO2012050925A2 WO 2012050925 A2 WO2012050925 A2 WO 2012050925A2 US 2011053774 W US2011053774 W US 2011053774W WO 2012050925 A2 WO2012050925 A2 WO 2012050925A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- amino acid
- leptin
- chimeric polypeptide
- sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
- C07K14/5759—Products of obesity genes, e.g. leptin, obese (OB), tub, fat
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
- A61P15/08—Drugs for genital or sexual disorders; Contraceptives for gonadal disorders or for enhancing fertility, e.g. inducers of ovulation or of spermatogenesis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/575—Hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/22—Hormones
- A61K38/2264—Obesity-gene products, e.g. leptin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
Definitions
- the invention provides novel compounds that have demonstrated biological activity.
- the compounds also demonstrate surprising and significant improvement in physical properties, such as solubility and stability.
- the compounds of the invention are based on leptin sequences disclosed in U.S.
- the compounds are surprisingly highly soluble and do not demonstrate the propensity to aggregate, unlike the naturally occurring leptins.
- the physical properties of the compounds facilitate the preparation of soluble, pharmaceutically acceptable formulations and compositions, also provided by the invention.
- Diseases amenable to such treatment include lipodystrophy, dyslipidemia, hyperlipidemia, overweight, obesity, hypothalamic amenorrhea, Alzheimer's disease, leptin deficiency, fatty liver disease, diabetes (including type I and type II), nonalcoholic steatohepatitis (NASH), nonalcoholic fatty liver disease (NAFLD), metabolic syndrome X, and Huntington's Disease, or combinations thereof.
- chimeric polypeptide compounds having leptin biological activity, in addition to enhanced physical properties.
- the compounds are chimeric polypeptides which are based on a wild type seal leptin polypeptide wherein at least one contiguous region of 1-30 amino acids of a wild type seal leptin sequence has been replaced with a contiguous region of 1- 30 amino acids of a mature human leptin sequence.
- a method for treating a disease or disorder in a subject in need of treatment includes administering a chimeric polypeptide as described herein to the subject.
- composition which includes a chimeric polypeptide described herein in combination with a pharmaceutically acceptable excipient.
- polynucleotides encoding the chimeric polypeptide and their intermediates, expression vectors bearing such polynucleotides, host cells expressing such polynucleotides, and means for their expression, synthesis, post-translational modification and isolation.
- Figs. 1A-1C depict the effects of a daily administration of the indicated chimeric polypeptides described herein on food intake and change in body weight (% vehicle-corrected) upon administration to C57/B6 female mice as described in Example 4.
- Figure 1 A food intake.
- Figure IB change in body weight (% vehicle-corrected).
- Figure 1C dose response curve.
- Figs. 2A-2C depict the effects of a daily administration of the indicated chimeric polypeptides described herein on food intake and change in body weight (% vehicle-corrected) upon administration to C57/B6 female mice as described in Example 5.
- Figure 2A food intake.
- Figure 2B change in body weight (% vehicle-corrected).
- Figure 2C dose response curve. DETAILED DESCRIPTION OF THE INVENTION
- Obsity and “overweight” refer to mammals having a weight greater than normally expected, and may be determined by, e.g., physical appearance, body mass index (BMI) as known in the art, waist-to-hip circumference ratios, skinfold thickness, waist circumference, and the like.
- BMI body mass index
- the Centers for Disease Control and Prevention (CDC) define overweight as an adult human having a BMI of 25 to 29.9; and define obese as an adult human having a BMI of 30 or higher. Additional metrics for the determination of obesity exist. For example, the CDC states that a person with a waist-to-hip ratio greater than 1.0 is overweight.
- Lean body mass refers to the fat-free mass of the body, i.e., total body weight minus body fat weight is lean body mass. Lean body mass can be measured by methods such as hydrostatic weighing, computerized chambers, dual-energy X-ray absorptiometry, skin calipers, magnetic resonance imaging (MRI) and bioelectric impedance analysis (BIA) as known in the art.
- MRI magnetic resonance imaging
- BIOA bioelectric impedance analysis
- mammal refers to warm-blooded animals that generally have fur or hair, that give live birth to their progeny, and that feed their progeny with milk. Mammals include humans; companion animals (e.g., dogs, cats); farm animals (e.g., cows, horses, sheep, pigs, goats); wild animals; and the like.
- the mammal is a female.
- the mammal is a female human.
- the mammal is a cat or dog.
- the mammal is a diabetic mammal, e.g., a human having type 2 diabetes.
- the mammal is an obese diabetic mammal, e.g., an obese mammal having type 2 diabetes.
- subject in the context of methods described herein refers to a mammal.
- fragment in the context of polypeptides refers herein in the customary chemical sense to a portion of a polypeptide.
- a fragment can result from N-terminal deletion or C-terminal deletion of one or more residues of a parent polypeptide, and/or a fragment can result from internal deletion of one or more residues of a parent polypeptide.
- “Fragment” in the context of an antibody refers to a portion of an antibody which can be linked to a biologically active molecule to modulate solubility, distribution within a subject, and the like.
- leptin A200 described herein is a conjugate of an Fc antibody fragment with a leptin, as known in the art. See e.g.
- polypeptides refers, in the customary sense, to a polypeptide which serves as a reference structure prior to modification, e.g., insertion, deletion and/or substitution.
- Analog as used herein in the context of polypeptides refers to a compound that has insertions, deletions and/or substitutions of amino acids relative to a parent compound.
- An analog may have superior stability, solubility, efficacy, half-life, and the like.
- an analog is a compound having at least 50%, for example 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or even higher, sequence identity to the parent compound.
- Identity refers to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 50% identity, preferably 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region, when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a sequence comparison algorithms as known in the art, for example BLAST or BLAST 2.0.
- sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
- sequence comparison algorithm test and reference sequences are entered into a computer, subsequent coordinates are designated if necessary, and sequence algorithm program parameters are designated.
- sequence algorithm program parameters Preferably, default program parameters can be used, or alternative parameters can be designated.
- sequence comparison algorithm calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
- Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, 1981, Adv. Appl. Math. 2:482, by the homology alignment algorithm of Needleman & Wunsch, 1970, J. Mol. Biol. 48:443, by the search for similarity method of Pearson & Lipman, 1988, Proc. Nat'l. Acad. Sci. USA 85:2444, by computerized
- BLAST and BLAST 2.0 are used, as known in the art, to determine percent sequence identity for the nucleic acids and proteins of the invention.
- Software for performing BLAST analyses is publicly available through the web site of the National Center for Biotechnology Information.
- This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., Id.).
- HSPs high scoring sequence pairs
- T is referred to as the neighborhood word score threshold (Altschul et al., Id.).
- These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them.
- the word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased.
- Cumulative scores are calculated using, e.g., for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always>0) and N (penalty score for mismatching residues; always ⁇ 0).
- M forward score for a pair of matching residues; always>0
- N penalty score for mismatching residues; always ⁇ 0.
- a scoring matrix is used to calculate the cumulative score. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- W wordlength
- E expectation
- Leptins Leptins.
- leptins leptin active fragments, leptin analogs, and leptin derivatives
- leptin a leptin active fragment, a leptin analog, and a leptin derivative
- reference to “leptins” is meant to encompass leptins, leptin active fragments, leptin analogs, and leptin derivatives, as disclosed herein.
- a leptin is meant to encompass a leptin, a leptin active fragment, a leptin analog, and a leptin derivative, as disclosed herein.
- exemplary leptins which may be employed in the design, preparation, and use of the chimeric polypeptides disclosed herein include those which elicit one or more biological responses known in the art to be elicited when leptins are administered to subjects (see, e.g., published U.S. Patent application Nos. US 2007/0020284 and US 2008/0207512, U.S. Patent Nos. 6,309,853, and US 7,183,254, and PCT Published Application Nos.
- WO 96/005309, WO 98/28427, and WO 2009/064298 such as: reduction of food intake, reduction of body weight, reduction of body weight gain, induction of satiety, reduction of caloric availability, reduction of caloric efficiency, reduction of metabolic plateau, increase in insulin sensitivity, reduction of hyperlipidemia, correction of dyslipidemia, reduction of hypertriglyceridemia, amelioration of obesity, amelioration of overweight, amelioration of diabetes mellitus (including type I diabetes, type II diabetes, and gestational diabetes), amelioration of insulin resistance, amelioration of lipodystrophy conditions associated therewith, as well as other biological responses known in the art to be elicited upon administration of a leptin (see, e.g., published U.S.
- Leptins include, but are not limited to, the compounds described in U.S. Patent Nos. US 5,594,101, US 5,851,995, US 5,691,309, US 5,580,954, US 5,554,727, US 5,552,523, US 5,559,208, US 5,756,461, US 6,309,853, published U.S. Patent application No. US
- leptins include the following:
- Unprocessed Full-length Human Leptin i.e., includes 21-residue N-terminal signal sequence
- Xaa at position 28 is T or A ; and Xaa at position 29 is Q or absent (SEQ ID NO: 13).
- Unprocessed Full-length Platypus leptin i.e., includes 21-residue N-terminal signal sequence: A full length sequence of platypus leptin, including a 21-residue N-terminal signal sequence follows:
- Leptin A200 is an Fc antibody fragment condensation product with leptin, as known in the art. See e.g., Lo et al., 2005, Protein Eng. Design & Selection, 18: 1-10.
- the amino acid sequence of A200 is as follows:
- Leptin A300 is metreleptin with substitutions W101Q and W139Q (N-terminal ⁇ et counted as residue 1):
- Leptin A400 is metreleptin with the serine residue at position 78 replaced with a cysteine residue, as set forth following:
- Le tin A500 Research by a number of investigators including the inventors has focused on the effects on aggregation of residue substitution in leptin. See e.g., Ricci et al, 2006. "Mutational approach to improve physical stability of protein therapeutics susceptible to aggregation: Role of altered conformation in irreversible precipitation," Book Chapter. In: MISBEHAVING PROTEINS: PROTEIN (MIS)FOLDING, AGGREGATION, AND STABILITY, Murphy RM, Tsai AM, Eds., New York. Springer, pp. 331-350, which is incorporated herein by reference and for all purposes. Accordingly, leptin A500 with sequence following has been used in certain compounds and methods described herein:
- Leptin A100 Variants Variants of Leptin A100 with the following amino acid substitutions follow:
- W101Q, Gl 13E, M137I, W139Q, and G146E MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAV YQQILTSMPSR VIQISNDLENLRDLLHVLAFSKSCHLPQASGLETLDSLGEVLEASGYST EVVALSRLQGSLQDILQQLDLSPEC (SEQ ID NO: 41).
- a series of chimeric polypeptides are described. These chimeric polypeptides are based on a wild type seal leptin polypeptide wherein at least one contiguous region of 1-30 amino acids of a wild type seal leptin sequence has been replaced with a contiguous region of 1-30 amino acids of a mature human leptin sequence.
- a wild type seal leptin sequence includes the sequence of wild type seal leptin (SEQ ID NO:28) and the sequence of wild type seal leptin with an N-terminal methionine (SEQ ID NO: 31).
- a mature human leptin sequence useful for chimerizing wild type seal leptin as provided herein, includes the following sequences described above: mature human leptins (SEQ ID NO: 12), mature human leptins with N-terminal methionine (SEQ ID NO: 13), mature human leptin form 1 (SEQ ID NO:20), mature human leptin form 2 (SEQ ID NO:21), mature human leptin form 3 (SEQ ID NO:22), mature human leptin form 4 (SEQ ID NO:23), mature human leptin form 1 with N-terminal methionine (Metreleptin, or A100, SEQ ID NO:24), mature human leptin form 2 with N-terminal methionine (SEQ ID NO:25), mature human leptin form 3 with N-terminal methionine (SEQ ID NO:26), mature human leptin form 4 with N-terminal methionine (SEQ ID NO:27), A200 (SEQ ID NO
- a series of chimeric polypeptides are described wherein at least one contiguous region of 1-30 amino acids of a wild type seal leptin sequence (SEQ ID NO. 28 or SEQ ID NO:31) has been replaced with a contiguous region of 1- 30 amino acids of A100 (SEQ ID NO. 24).
- a contiguous region of 1-30 amino acids can comprise any naturally or non-naturally occurring amino acid. Any combination of amino acids can be employed without restriction. That is, two or more amino acids in a contiguous region can be replaced with a naturally occurring amino acid, a non-naturally occurring amino acid, a conservative substitution, a non-conservative substitution or any combination thereof.
- the chimeric polypeptides described herein have demonstrated biological activity, in addition to enhanced physical properties.
- the seal-human chimeric polypeptides show leptin activity in vitro and in vivo.
- the chimeric polypeptides also show enhanced stability and solubility compared to the mature human leptin polypeptides which are used to derive the sequences, as shown by the Examples.
- Leptin activity includes leptin binding activity and leptin functional activity.
- leptin analog compounds can have an IC50 of about 200 nM or less, about 100 nM or less, or about 50 nM or less, or about 5 nM or less, or about 1 nM or less, in a leptin binding assay, such as that described herein.
- IC50 refers in the customary sense to the half maximal inhibitory concentration of a compound inhibiting a biological or biochemical function.
- IC50 refers to the concentration of a test compound which competes half of a known ligand from a specified receptor.
- Leptin analog compounds can have an EC50 of about 20 nM or less, about 10 nM or less, about 5 nM or less, about 1 nM or less, or about 0.1 nM or less, in a leptin functional assay, such as that described herein.
- the term "EC50" refers in the customary sense to the effective concentration of a compound which induces a response halfway between a baseline response and maximum response, as known in the art.
- Helix 1 region of a mature human leptin polypeptide spans a contiguous region of 20 amino acids.
- Helix 1 and Helix 3 are antiparallel helices that form part of Binding Site II of leptin to its receptor. This site interacts with the cytokine receptor homology domain (CRH) of the leptin receptor and is thought to be a major receptor binding site, but not involved in receptor activation.
- CSH cytokine receptor homology domain
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide (SEQ ID NO:28), wherein the contiguous region spanning the amino acids at positions 3-22 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 5-24 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:52:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide with an N-terminal methionine (SEQ ID NO:31), wherein the contiguous region spanning the amino acids at positions 3-22 of SEQ ID NO: 31 has been replaced with a contiguous region spanning the amino acids at positions 5-24 of A 100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:53: Seal leptin with N-terminal methionine, and with amino acids 3-22 replaced with amino acids 5-24 (helix 1) of metreleptin, respectively:
- Helix 2 region of a mature human leptin polypeptide spans a region of 16 contiguous amino acids. This helix is buried in the 4-helix bundle as described in the original crystal structure paper by Zhang et al. (Nature 1997 387:206).
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide (SEQ ID NO:28), wherein the contiguous region spanning the amino acids at positions 50-65 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 52-67 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:54:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide with an N-terminal methionine (SEQ ID NO:31), wherein the contiguous region spanning the amino acids at positions 50-65 of SEQ ID NO: 31 has been replaced with a contiguous region spanning the amino acids at positions 52-67 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:55: Seal leptin with N-terminal methionine, and with amino acids 50-65 replaced with amino acids 52-67 (helix 2) of metreleptin, respectively:
- Helix 3 region of a mature human leptin polypeptide spans a contiguous region of 22 amino acids.
- Helix 3 and Helix 1 are antiparallel helices that form part of Binding Site II of leptin to its receptor. This site interacts with the cytokine receptor homology domain (CRH) of the leptin receptor and is thought to be a major receptor binding site, but not involved in receptor activation.
- CSH cytokine receptor homology domain
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide (SEQ ID NO:28), wherein the contiguous region spanning the amino acids at positions 71-92 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 73-94 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:29:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide with an N-terminal methionine (SEQ ID NO:31), wherein the contiguous region spanning the amino acids at positions 71-92 of SEQ ID NO: 31 has been replaced with a contiguous region spanning the amino acids at positions 73-94 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:32:
- Helix 4 region of a mature human leptin polypeptide spans a contiguous region of 22 amino acids. Helix 4 is thought to form parts of Binding Site I and Binding Site III of leptin, both of which are important for receptor activation. See, for example, Peelman et al., 2004, J. Biol. Chem. 279: 41038.
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide (SEQ ID NO:28), wherein the contiguous region spanning the amino acids at positions 120-141 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 122-143 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:56:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide with an N-terminal methionine (SEQ ID NO:31), wherein the contiguous region spanning the amino acids at positions 120-141 of SEQ ID NO:31 has been replaced with a contiguous region spanning the amino acids at positions 122-143 of A 100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:57:
- the AB Loop region of a mature human leptin polypeptide spans a contiguous region of 27 amino acids.
- the AB Loop is thought to form part of Binding Site III as well as a small portion of Binding Site I of leptin. See, for example, Peelman et al., 2004, J. Biol. Chem. 279: 41038. This region also contains the absolutely conserved motif GLDFIP.
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide (SEQ ID NO:28), wherein the contiguous region spanning the amino acids at positions 23-49 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 25-51 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:58:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide with an N-terminal methionine (SEQ ID NO:31), wherein the contiguous region spanning the amino acids at positions 23-49 of SEQ ID NO: 31 has been replaced with a contiguous region spanning the amino acids at positions 25-51 of A 100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:59:
- Loop 3-4 region of a mature human leptin polypeptide spans a contiguous region of 27 amino acids. Loop 3-4 is thought to contain a part of Binding Site III of leptin to its receptor. See, for example, Peelman et al, 2004, J. Biol. Chem. 279: 41038.
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide (SEQ ID NO:28), wherein the contiguous region spanning the amino acids at positions 93-119 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 95-121 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO: 60:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide with an N-terminal methionine (SEQ ID NO:31), wherein the contiguous region spanning the amino acids at positions 93-119 of SEQ ID NO:31 has been replaced with a contiguous region spanning the amino acids at positions 95-121 of A 100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:61 :
- polypeptides are described. These chimeric combination polypeptides are based on a wild type seal leptin polypeptide wherein two or more contiguous regions of 1-30 amino acids of a wild type seal leptin sequence (for example, SEQ ID NO:28 or SEQ ID NO:31) have been replaced at each region with a contiguous region of 1-30 amino acids of a mature human leptin sequence. Chimeric combination polypeptides can be engineered to demonstrate enhanced physical properties compared to the mature human leptin polypeptides which are used to derive the sequences, while retaining the biological activity of human leptin.
- a wild type seal leptin sequence for example, SEQ ID NO:28 or SEQ ID NO:31
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide (SEQ ID NO:28), wherein the contiguous region spanning the amino acids at positions 3-22 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 5-24 of A 100 (SEQ ID NO:24), and the contiguous region spanning the amino acids at positions 71-92 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 73-94 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:62:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide with an N-terminal methionine (SEQ ID NO:31), wherein the contiguous region spanning the amino acids at positions 3-22 of SEQ ID NO: 31 has been replaced with a contiguous region spanning the amino acids at positions 5-24 of A 100 (SEQ ID NO:24), and the contiguous region spanning the amino acids at positions 71-92 of SEQ ID NO:31 has been replaced with a contiguous region spanning the amino acids at positions 73-94 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:63:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide (SEQ ID NO:28), wherein the contiguous region spanning the amino acids at positions 71-92 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 73-94 of A 100 (SEQ ID NO:24), and the contiguous region spanning the amino acids at positions 23-49 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 25- 51 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:64:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide with an N-terminal methionine (SEQ ID NO:31), wherein the contiguous region spanning the amino acids at positions 71-92 of SEQ ID NO: 31 has been replaced with a contiguous region spanning the amino acids at positions 73-94 of A100 (SEQ ID NO:24), and the contiguous region spanning the amino acids at positions 23-49 of SEQ ID NO:31 has been replaced with a contiguous region spanning the amino acids at positions 25-51 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:65:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide (SEQ ID NO:28), wherein the contiguous region spanning the amino acids at positions 71-92 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 73-94 of A100 (SEQ ID NO:24), and the contiguous region spanning the amino acids at positions 93-119 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 95-121 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:66:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide with an N-terminal methionine (SEQ ID NO:31), wherein the contiguous region spanning the amino acids at positions 71-92 of SEQ ID NO: 31 has been replaced with a contiguous region spanning the amino acids at positions 73-94 of A100 (SEQ ID NO:24), and the contiguous region spanning the amino acids at positions 93-119 of SEQ ID NO:31 has been replaced with a contiguous region spanning the amino acids at positions 95-121 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:67:
- the present disclosure relates to chimeric polypeptides that are based on wild type seal leptin with an incorporated AB Loop sequence and an incorporated helix 4 sequence from mature human leptin.
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide (SEQ ID NO:28), wherein the contiguous region spanning the amino acids at positions 23-49 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 25-51 of A 100 (SEQ ID NO:24), and the contiguous region spanning the amino acids at positions 120-141 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 122- 143 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:68:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide with an N-terminal methionine (SEQ ID NO:31), wherein the contiguous region spanning the amino acids at positions 23-49 of SEQ ID NO: 31 has been replaced with a contiguous region spanning the amino acids at positions 25-51 of A 100 (SEQ ID NO:24), and the contiguous region spanning the amino acids at positions 120-141 of SEQ ID NO:31 has been replaced with a contiguous region spanning the amino acids at positions 122- 143 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:69:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide (SEQ ID NO:28), wherein the contiguous region spanning the amino acids at positions 23-49 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 25-51 of A 100 (SEQ ID NO:24), and the contiguous region spanning the amino acids at positions 93-119 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 95-121 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:70:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide with an N-terminal methionine (SEQ ID NO:31), wherein the contiguous region spanning the amino acids at positions 23-49 of SEQ ID NO: 31 has been replaced with a contiguous region spanning the amino acids at positions 25-51 of A 100 (SEQ ID NO:24), and the contiguous region spanning the amino acids at positions 93-119 of SEQ ID NO:31 has been replaced with a contiguous region spanning the amino acids at positions 95-121 of A100 (SEQ ID NO:24).
- SEQ ID NO:31 N-terminal methionine
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:71 : Seal leptin with N-terminal methionine, with amino acids 23-49 replaced with amino acids 25-51 (AB loop) of metreleptin, and with amino acids 93-119 replaced with amino acids 95- 121 (loop 3-4) of metreleptin, respectively:
- the present disclosure relates to chimeric polypeptides that are based on wild type seal leptin with an incorporated AB Loop sequence, an incorporated Loop 3-4 sequence, and an incorporated helix 3 sequence from mature human leptin.
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide (SEQ ID NO:28), wherein the contiguous region spanning the amino acids at positions 23-49 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 25-51 of A100 (SEQ ID NO:24), the contiguous region spanning the amino acids at positions 93-119 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 95-121 of A100 (SEQ ID NO:24), and the contiguous region spanning the amino acids at positions 71-92 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 73-94 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO: 72:
- a chimeric polypeptide comprises the amino acid sequence of a wild type seal leptin polypeptide with an N-terminal methionine (SEQ ID NO:31), wherein the contiguous region spanning the amino acids at positions 23-49 of SEQ ID NO: 31 has been replaced with a contiguous region spanning the amino acids at positions 25-51 of A 100 (SEQ ID NO:24), the contiguous region spanning the amino acids at positions 93-119 of SEQ ID NO:31 has been replaced with a contiguous region spanning the amino acids at positions 95-121 of A100 (SEQ ID NO:24), and the contiguous region spanning the amino acids at positions 71-92 of SEQ ID NO:28 has been replaced with a contiguous region spanning the amino acids at positions 73-94 of A100 (SEQ ID NO:24).
- a chimeric polypeptide comprises the sequence described in SEQ ID NO:73:
- the chimeric polypeptides provided by the invention contain a Cys to Ser amino acid substitution at position 30 of the wild type seal polypeptide sequence. According to some embodiments, the following chimeric polypeptides are provided:
- each of the polypeptides disclosed herein are also contemplated to include (optionally) a methionine at the N-terminus in frame with the naturally-occurring first amino acid thereof.
- a methionine at the N-terminus in frame with the naturally-occurring first amino acid thereof.
- metreleptin consists of mature human leptin to which has been added an N-terminal methionine, as disclosed in SEQ ID NO:24.
- a methionine residue may be included at the N-terminus of any of the amino acid sequences and Formulae disclosed herein throughout.
- chimeric polypeptide analogs are provided.
- a chimeric polypeptide analog can have at least 80%, for example 80%, 85%, 90%, 95%, 98% or even higher, sequence identity relative to a parent chimeric polypeptide.
- the parent chimeric polypeptide is a polypeptide set out in SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:33, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:71, SEQ ID NO:72, SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:77, SEQ ID NO:78, SEQ ID NO:79, SEQ ID NO:80, ID NO:29, S
- a chimeric polypeptide analog may have at least 80%, for example 80%, 85%, 90%, 95%, 98% or even higher, sequence identity relative to any chimeric polypeptide selected from the group consisting of SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, and SEQ ID NO:33.
- a chimeric polypeptide analog may have at least 80%, for example 80%, 85%, 90%, 95%, 98% or even higher, sequence identity relative to the chimeric polypeptide set forth in SEQ ID NO:33.
- a chimeric polypeptide analog may have at least 90% sequence identity relative to the a chimeric polypeptide set forth in SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, or SEQ ID NO:33. In some embodiments, a chimeric polypeptide analog may have at least 90% sequence identity relative to the chimeric polypeptide set forth in SEQ ID NO:33.
- chimeric polypeptide analogs may be designed, prepared, and used in accordance with the invention in which 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or even 21 amino acids of a chimeric polypeptide selected from the group consisting of: SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:33, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:71, SEQ ID NO:72, SEQ ID NO:73, SEQ ID NO:70
- the term “conservative” in the context of amino acid substitutions refers to substitution which maintains properties of charge type (e.g., anionic, cationic, neutral, polar and the like), hydrophobicity or hydrophilicity, bulk (e.g., van der Waals contacts and the like), and/or functionality (e.g., hydroxy, amine, sulhydryl and the like).
- charge type e.g., anionic, cationic, neutral, polar and the like
- hydrophobicity or hydrophilicity e.g., hydrophobicity or hydrophilicity
- bulk e.g., van der Waals contacts and the like
- functionality e.g., hydroxy, amine, sulhydryl and the like.
- non-conservative refers to an amino acid substitution which is not conservative.
- the invention provides chimeric polypeptide analogs comprising at least one contiguous region of 1-30 amino acids from a mature human leptin analog sequence that contains at least one amino acid substitution at a position where divergence is observed in a corresponding position in a leptin from another species.
- murine leptins, rat leptins, bovine leptins, porcine leptins, and rhesus monkey leptins are each substantially homologous to human leptins; in particular, the mature forms of these leptins are substantially homologous to mature leptins, and further, particularly near the N-terminal portion of the protein.
- leptins such as mature human leptin form 1 (SEQ ID NO:20) and metre leptin (SEQ ID NO:24), such as by substituting or otherwise altering amino acid residues at one or more positions in such sequences where divergence is observed in a corresponding mature mouse, rat, bovine, porcine, or rhesus monkey leptin.
- mature human leptins e.g., SEQ ID NO:20
- elicits biological responses in, for example, mice, rat, and monkey See, e.g., WO 98/28427, WO 2009/064298, US2007/0020284,
- leptin analogs may be designed and prepared in which one or more amino acids at positions which are divergent at the corresponding position(s) in a leptin from one or more of such species are substituted with the amino acid(s) at such corresponding divergent positions.
- a human mature leptin protein according to SEQ ID NO:20 wherein the first amino acid is valine and the amino acid at position 146 is cysteine one may substitute with another amino acid one or more of the amino acids at positions 32, 35, 50, 64, 68, 71, 74, 77, 89, 97, 100, 101, 105, 106, 107, 108, 111, 112, 118, 136, 138, 142, and 145 with the corresponding amino acid(s) found at the corresponding position(s) in SEQ ID NO:2 in order to design and prepare leptin analogs comprised by the chimeric polypeptides in accordance with the invention.
- another amino acid such as a conservative amino acid or a non-conservative amino acid
- Mature rat leptin differs from mature human leptin form 1 (SEQ ID NO:20) at the following positions: 4, 32, 33, 35, 50, 68, 71, 74, 77, 78, 89, 97, 100, 101, 102, 105, 106, 107, 108, 111, 112, 118, 136, 138 and 145.
- another amino acid such as a conservative amino acid or a non-conservative amino acid
- the positions from both mature rat leptin (SEQ ID NO: 16) and mature murine leptin form 1 (SEQ ID NO:2) which diverge from the mature human leptin form 1 (SEQ ID NO:20) are: 4, 32, 33, 35, 50, 64, 68, 71, 74, 77, 78, 89, 97, 100, 102, 105, 106, 107, 108, 111, 112, 118, 136, 138, 142, and 145.
- another amino acid such as a conservative amino acid or a non-conservative amino acid
- amino acids found in rhesus monkey mature leptin (SEQ ID NO: 14) which diverge from mature human leptin form 1 (SEQ ID NO:20) are (with amino acid residues noted in parentheses in one letter amino acid abbreviation): 8 (S), 35 (R), 48(V), 53(Q), 60(1), 66(1), 67(N), 68((L), 89(L), 100(L), 108(E), 112 (D), and 118 (L).
- a leptin such as mature human leptin form 1 (SEQ ID NO:20) having one or more of the rhesus monkey divergent amino acids replaced with another amino acid, such as the amino acids in parentheses, may be employed in designing and preparing leptin analogs comprised by the chimeric polypeptides in accordance with the invention.
- certain rhesus divergent amino acids are also those found in, for example, the above mature murine leptin form 1 (positions 35, 68, 89, 100 and 1 12).
- leptin analogs in which one or more amino acids at positions 4, 8, 32, 33, 35, 48, 50, 53, 60, 64, 66, 67, 68, 71 , 74, 77, 78, 89, 97, 100, 102, 105, 106, 107, 108, 1 1 1 , 1 12, 1 18, 136, 138, 142, and 145 of, e.g., mature human leptin form 1 (SEQ ID NO:20) are replaced by the corresponding amino acid(s) at such position(s) in murine or rhesus monkey leptins (e.g., SEQ ID NO:2 and/or SEQ ID NO: 14).
- SEQ ID NO:20 mature human leptin form 1
- chimeric polypeptide analogs may be designed and prepared to comprise contiguous regions of amino acids from human leptin analogs.
- the invention provides chimeric polypeptide analogs based on a wild type seal leptin polypeptide wherein at least one contiguous region of 1 -30 amino acids of a wild type seal leptin sequence has been replaced with a contiguous region of 1 -30 amino acids of a mature human leptin analog sequence, and wherein the mature human leptin analog sequence contains at least one amino acid substitution at a position where divergence is observed in a corresponding position in a leptin from another species.
- Chimeric polypeptide analogs comprising two or more contiguous regions of 1 -30 amino acids of a mature human leptin analog sequence are also provided.
- Chimeric polypeptides to which a chemical moiety is attached are polypeptide derivatives. Derivatization of chimeric polypeptides by attachment of one or more chemical moieties has been found to provide some advantage under certain circumstances, such as increasing the stability and circulation time of the therapeutic protein and decreasing
- Polypeptide derivatives may constitute polypeptides to which a chemical modification has been made of one or more of its amino acid side groups, a-carbon atoms, terminal amino group, or terminal carboxylic acid group.
- a chemical modification includes, but is not limited to, attaching one or more chemical moieties, creating new bonds, and removing one or more chemical moieties.
- Modifications at amino acid side groups include, without limitation, alkylation, acylation, ester formation, amide formation, maleimide coupling, acylation of lysine ⁇ -amino groups, N-alkylation of arginine, histidine, or lysine, alkylation of glutamic or aspartic carboxylic acid groups, and deamidation of glutamine or asparagine.
- Modifications of the terminal amino include, without limitation, the desamino, N-lower alkyl, N-di-lower alkyl, and N-acyl modifications.
- Modifications of the terminal amino include, without limitation, the desamino, N-lower alkyl, N-di-lower alkyl, and N-acyl modifications, such as alkylacyls, branched alkylacyls, alkylaryl-acyls.
- Modifications of the terminal carboxy group include, without limitation, the amide, lower alkyl amide, dialkyl amide, arylamide, alkylarylamide and lower alkyl ester modifications.
- Lower alkyl is C 1-C4 alkyl.
- one or more side groups, or terminal groups may be protected by protective groups known to the ordinarily- skilled synthetic chemist.
- the a-carbon of an amino acid may be mono- or dimethylated.
- Such derivatives include polypeptides conjugated to one or more water soluble polymer molecules, such as polyethylene glycol (“PEG”) or fatty acid chains of various lengths (e.g., stearyl, palmitoyl, octanoyl), by the addition of polyamino acids, such as poly-his, poly-arg, poly-lys, and poly-ala, or by addition of small molecule substituents include short alkyls and constrained alkyls (e.g., branched, cyclic, fused, adamantyl), and aromatic groups.
- the water soluble polymer molecules will have a molecular weight ranging from about 500 Daltons to about 60,000 Daltons.
- Such polymer-conjugations may occur singularly at the N- or C-terminus or at the side chains of amino acid residues within the sequence of a chimeric polypeptide as disclosed herein.
- Substitution of one or more amino acids with lysine, aspartic acid, glutamic acid, or cysteine may provide additional sites for derivatization. See, e.g., U.S. Patent Nos. 5,824,784 and 5,824,778.
- a chimeric polypeptide may be conjugated to one, two, or three polymer molecules.
- the water soluble polymer molecules are linked to an amino, carboxyl, or thiol group, and may be linked by N or C termini, or at the side chains of lysine, aspartic acid, glutamic acid, or cysteine.
- the water soluble polymer molecules may be linked with diamine and dicarboxylic groups.
- a chimeric polypeptide is conjugated to one, two, or three PEG molecules through an epsilon amino group on a lysine amino acid.
- Polypeptide derivatives also include polypeptides with chemical alterations to one or more amino acid residues.
- chemical alterations include amidation, glycosylation, acylation, sulfation, phosphorylation, acetylation, and cyclization.
- the chemical alterations may occur singularly at the N- or C-terminus or at the side chains of amino acid residues within the sequence of a leptin.
- the C-terminus of these peptides may have a free -OH or -NH 2 group.
- the N-terminal end may be capped with an
- cyclization can be through the formation of disulfide bridges. Alternatively, there may be multiple sites of chemical alteration along the polypeptide amino acid sequence.
- chimeric polypeptides are chemically altered to include a Bolton-Hunter group.
- Bolton-Hunter reagents are known in the art ("Radioimmunoassay and related methods," A. E. Bolton and W. M. Hunter, Chapter 26 of HANDBOOK OF EXPERIMENTAL IMMUNOLOGY, VOLUME I, IMMUNOCHEMISTRY, edited by D. M. Weir, Blackwell Scientific Publications, 1986), and may be used to introduce tyrosine-like moieties with a neutral linkage, through amino-terminal a-amino groups or ⁇ -amino groups of lysine.
- the N-terminal end of a polypeptide is modified with a Bolton-Hunter group.
- an internal lysine residue is modified with a Bolton-Hunter group.
- Bolton-Hunter reagents used for polypeptide modification are commercially available, and may include, but are not limited to, water-soluble Bolton-Hunter reagent, Sulfosuccinimidyl-3-[4- hydrophenyljpropionate (Pierce Biotechnology, Inc., Rockford, IL) and Bolton-Hunter reagent- 2, N-Succinimidyl 3-(4-hydroxy-3-iodophenyl) Priopionate (Wako Pure Chemical Industries, Ltd., Japan, catalog # 199-09341).
- An exemplary Bolton-Hunter group conjugated through an amide linkage to a polypeptide is illustrated below, wherein the dashed line passes through the amide bond:
- Polypeptides may be iodinated (such as radiolabeled with I) before or after Bolton- Hunter modification.
- Polypeptide derivatives may include one or more modifications of a "non-essential" amino acid residue.
- a "non-essential" amino acid residue is a residue that can be altered, e.g. , derivatized, without abolishing or substantially reducing the activity ⁇ e.g., the agonist activity) of the chimeric polypeptide.
- the chimeric polypeptides of the invention may include derivatizations of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acid residues; of these, one or more amino acid residues may be non-essential amino acid residues.
- polypeptides of the invention may be derivatized such that they include additions of at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acids without abolishing or substantially reducing the activity of the polypeptide. Additionally, such non-essential amino acid residues may be substituted with an amino acid residue that is amenable to derivatization as described throughout.
- amino acid As used throughout, “amino acid,” “amino acid residue” and the like refer to natural amino acids, unnatural amino acids, and modified amino acids. Unless stated to the contrary, any reference to an amino acid, generally or specifically by name, includes reference to both the D and the L stereoisomers if their structure allow such stereoisomeric forms.
- Natural amino acids include alanine (Ala), arginine (Arg), asparagine (Asn), aspartic acid (Asp), cysteine (Cys), glutamine (Gin), glutamic acid (Glu), glycine (Gly), histidine (His), isoleucine (He), leucine (Leu), Lysine (Lys), methionine (Met), phenylalanine (Phe), proline (Pro), serine (Ser), threonine (Thr), tryptophan (Trp), tyrosine (Tyr) and valine (Val).
- Unnatural amino acids include, but are not limited to homolysine, homoarginine, homoserine, azetidinecarboxylic acid, 2-aminoadipic acid, 3-aminoadipic acid, beta-alanine, aminoprop ionic acid, 2-aminobutyric acid, 4- aminobutyric acid, 6-aminocaproic acid, 2-aminoheptanoic acid, 2-aminoisobutyric acid, 3- aminoisbutyric acid, 2-aminopimelic acid, tertiary-butylglycine, 2,4-diaminoisobutyric acid, desmosine, 2,2'-diaminopimelic acid, 2,3-diaminopropionic acid, N-ethylglycine, N- ethylasparagine, homoproline, hydroxy lysine, allo-hydroxylysine, 3-hydroxyproline, 4- hydroxyproline, isodesmosine, allo-isoleucine, N-
- Additional unnatural amino acids include modified amino acid residues which are chemically blocked, reversibly or irreversibly, or chemically modified on their N-terminal amino group or their side chain groups, as for example, N-methylated D and L amino acids or residues wherein the side chain functional groups are chemically modified to another functional group.
- modified amino acids include methionine sulfoxide; methionine sulfone; aspartic acid- (beta-methyl ester), a modified amino acid of aspartic acid; N-ethylglycine, a modified amino acid of glycine; or alanine carboxamide, a modified amino acid of alanine. Additional residues that can be incorporated are described in Sandberg et al. , J. Med. Chem. 41 : 2481-91, 1998.
- chemical moieties suitable for such derivatization of the chimeric polypeptides include, for example, various water soluble polymers.
- the polymer will be pharmaceutically acceptable.
- One skilled in the art will be able to select the desired polymer based on such considerations as whether the polymer/protein conjugate will be used therapeutically, and if so, the desired dosage, circulation time, resistance to proteolysis, and other considerations.
- the effectiveness of the derivatization may be ascertained by administering the derivatized polypeptide, in the desired form ⁇ i.e., by osmotic pump, or, more preferably, by injection or infusion, or, further formulated for oral, pulmonary or nasal delivery, for example), and observing biological effects and biological responses as described herein.
- Such a water soluble polymer may be selected from the group consisting of, for example, polyethylene glycol, copolymers of ethylene glycol/propylene glycol,
- carboxymethylcellulose dextran
- polyvinyl alcohol polyvinyl pyrolidone
- poly-1, 3-dioxolane poly-l,3,6-trioxane
- ethylene/maleic anhydride copolymer polyaminoacids (either
- polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water. Also, succinate, styrene, and hydroxyethyl starch may also be used.
- chimeric polypeptides in accordance with the invention may be prepared by attaching polyaminoacids or branch point amino acids.
- the polyaminoacid may be an additional carrier protein, such as an Fc moiety, which can serve to also increase the circulation half life of the chimeric polypeptide.
- additional carrier protein such as an Fc moiety
- such polyaminoacids may be selected from the group consisting of serum albumin (such as human serum albumin), an additional antibody or portion thereof (e.g. the Fc region), or other polyaminoacids, e.g.
- polylysines As indicated below, the location of attachment of the polyaminoacid may be at the N-terminus of polypeptide, or C-terminus, or other places in between, and also may be connected by a chemical "linker" moiety to the polypeptide, such as a peptidic linker or a non-peptidic linker.
- the polymer may be of any molecular weight, and may be branched or unbranched.
- the preferred molecular weight is between about 2 kilodaltons (kDa) and about 100 kDa (the term "about” indicating that in preparations of polyethylene glycol, some molecules will weigh more, some less, than the stated molecular weight) for ease in handling and manufacturing.
- the polyethylene glycol is between about 2 kDa and about 60 kDa.
- the polyethylene glycol is between about 2 kDa and about 40 kDa.
- the polyethylene glycol is between about 5 kDa and about 40 kDa.
- the polyethylene glycol is between about 10 kDa and about 40 kDa. In certain embodiments, the polyethylene glycol is between about 5 kDa and about 30 kDa. In certain embodiments, the polyethylene glycol is between about 5 kDa and about 20 kDa. In certain embodiments, the polyethylene glycol is between about 10 kDa and about 20 kDa. Other sizes may be used, depending on the desired therapeutic profile (e.g., the duration of sustained release desired, solubility characteristics, the effects, if any, on biological activity, the ease in handling, the degree or lack of antigenicity and other known effects of the polyethylene glycol attached to a leptin and/or to a chimeric polypeptide of the invention).
- the desired therapeutic profile e.g., the duration of sustained release desired, solubility characteristics, the effects, if any, on biological activity, the ease in handling, the degree or lack of antigenicity and other known effects of the polyethylene glycol attached to a leptin and
- Additional considerations that may influence the selection of a PEG of a particular molecular weight which may be attached to a chimeric polypeptide to generate a chimeric derivative in accordance with the invention include the extent to which such a molecular weight PEG may: mitigate aggregation and/or increase the solubility of the chimeric polypeptide, when present in a pharmaceutically acceptable composition or formulation, or when exposed to physiological fluids or tissues upon administration to a subject (such as by injection); mitigate the incidence of injection site reactions caused by administration of the chimeric polypeptide upon administration to a subject by injection; mitigate the generation of neutralizing antibodies that may be raised against the chimeric polypeptide as a result of administration of such a chimeric polypeptide to a subject; and the like.
- the number of polymer molecules so attached may vary, and one skilled in the art will be able to ascertain the resultant effect on function.
- One may mono-derivatize, or may provide for a di-, tri-, tetra- or some combination of derivatization, with the same or different chemical moieties (e.g., polymers, such as different weights of polyethylene glycols).
- the proportion of polymer molecules to chimeric polypeptide molecules to be derivatized will vary, as will their concentrations in the reaction mixture.
- the optimum ratio in terms of efficiency of reaction in that there is no excess unreacted chimeric polypeptide or polymer, will be determined by factors such as the desired degree of derivatization (e.g., mono, di-, tri-, etc.), the molecular weight of the polymer selected, whether the polymer is branched or unbranched, and the reaction conditions.
- polyethylene glycol may be covalently bound through amino acid residues via a reactive group, such as, a free amino or carboxyl group.
- Reactive groups are those to which an activated polyethylene glycol molecule may be bound.
- the amino acid residues having a free amino group may include lysine residues and the N-terminal amino acid residue.
- Those having a free carboxyl group may include aspartic acid residues, glutamic acid residues, and the
- Sulfhydryl groups may also be used as a reactive group for attaching the polyethylene glycol molecule(s).
- Preferred for therapeutic purposes is attachment at an amino group, such as attachment at the N-terminus or lysine group. Attachment at residues important for receptor binding should be avoided if receptor binding is desired.
- polyethylene glycol as an illustration of the present compositions, one may select from a variety of polyethylene glycol molecules (by molecular weight, branching, etc.), the proportion of polyethylene glycol molecules to chimeric polypeptide molecules in the reaction mix, the type of pegylation reaction to be performed, and the method of obtaining the selected N-terminally pegylated protein.
- the method of obtaining the N-terminally pegylated preparation may be by purification of the N-terminally pegylated material from a population of pegylated protein molecules.
- Selective N-terminal chemical modification may be accomplished by reductive alkylation which exploits differential reactivity of different types of primary amino groups (lysine versus the N-terminal) available for derivatization in a particular protein. Under the appropriate reaction conditions, substantially selective derivatization of the protein at the N-terminus with a carbonyl group containing polymer is achieved.
- attachment of a water soluble polymer to a protein is controlled: the conjugation with the polymer takes place predominantly at the N-terminus of the protein and no significant modification of other reactive groups, such as the lysine side chain amino groups, occurs.
- the water soluble polymer may be of the type described above, and should have a single reactive aldehyde for coupling to the protein. Polyethylene glycol propionaldehyde, containing a single reactive aldehyde, may be used.
- nucleotide sequence is optimized for the desired expression host, e.g. based protein expression, codon optimization, restriction site content.
- nucleotide sequence can be optimized for E. coli based protein expression and for restriction site content. Based on the nucleotide sequence of interest, overlapping
- oligonucleotides can be provided for multistep PCR, as known in the art. These oligonucleotides can be used in multiple PCR reactions under conditions well known in the art to build the cDNA encoding the protein of interest. For one example is IX Amplitaq Buffer, 1.3 mM MgCl 2 , 200uM dNTPs, 4 U Amplitaq Gold, 0.2 uM of each primer (AmpliTaq Gold, ABI), with cycling parameters: (94C:30s, 58C: 1 min, 72C: lmin), 35 cycles.
- Restriction sites can be added to the ends of the PCR products for use in vector ligation as known in the art. Specific sites can include Ndel and Xhol, such that the cDNA can then be in the proper reading frame in a pET45b expression vector (Novagen). By using these sites, any N-terminal His Tags that are in this vector can be removed as the translation start site would then be downstream of the tag.
- verification can be conduct by sequencing using e.g., T7 promoter primer, T7 terminator primer and standard ABI BigDye Term v3.1 protocols as known in the art. Sequence information can be obtained from e.g., an ABI 3730 DNA Analyzer and can be analyzed using Vector NTI v.10 software
- Expression constructs can be designed in a modular manner such that linker sequences can be easily cut out and changed, as known in the art.
- Protease recognition sites known in the art or described herein, can be incorporated into constructs useful for the design, construction, manipulation and production of recombinant chimeric polypeptides described herein.
- chimeric polypeptides described herein may be prepared using biological, chemical, and/or recombinant DNA techniques that are known in the art. Exemplary methods are described herein and in US Patent No. 6,872,700; WO
- the chimeric polypeptides described herein may be prepared using standard solid- phase peptide synthesis techniques, such as an automated or semiautomated peptide synthesizer.
- the chimeric polypeptides may be produced by non-biological peptide synthesis using amino acids and/or amino acid derivatives having reactive side-chains protected, the non-biological peptide synthesis comprising step-wise coupling of the amino acids and/or the amino acid derivatives to form a polypeptide according to the first aspect having reactive side-chains protected, removing the protecting groups from the reactive side-chains of the polypeptide, and folding of the polypeptide in aqueous solution.
- normal amino acids e.g.
- glycine, alanine, phenylalanine, isoleucine, leucine and valine) and pre-protected amino acid derivatives are used to sequentially build a polypeptide sequence, in solution or on a solid support in an organic solvent.
- the protecting groups are removed and the polypeptide is allowed to fold in an aqueous solution.
- an alpha-N-carbamoyl protected amino acid and an amino acid attached to the growing peptide chain on a resin are coupled at RT in an inert solvent (e.g., dimethylformamide, N-methylpyrrolidinone, methylene chloride, and the like) in the presence of coupling agents (e.g., dicyclohexylcarbodiimide, 1-hydroxybenzo-triazole, and the like) in the presence of a base (e.g., diisopropylethylamine, and the like).
- an inert solvent e.g., dimethylformamide, N-methylpyrrolidinone, methylene chloride, and the like
- coupling agents e.g., dicyclohexylcarbodiimide, 1-hydroxybenzo-triazole, and the like
- a base e.g., diisopropylethylamine, and the like
- the alpha-N- carbamoyl protecting group is removed from the resulting peptide-resin using a reagent (e.g., trifluoroacetic acid, piperidine, and the like) and the coupling reaction repeated with the next desired N-protected amino acid to be added to the peptide chain.
- a reagent e.g., trifluoroacetic acid, piperidine, and the like
- Suitable N-protecting groups are well known in the art, such as t-butyloxycarbonyl (tBoc) fluorenylmethoxycarbonyl (Fmoc), and the like.
- tBoc t-butyloxycarbonyl
- Fmoc fluorenylmethoxycarbonyl
- the solvents, amino acid derivatives and 4-methylbenzhydryl-amine resin used in the peptide synthesizer may be purchased from Applied Biosystems Inc. (Foster City, Calif).
- Solid phase peptide synthesis can be used for the chimeric polypeptides, since in general solid phase synthesis is a straightforward approach with excellent scalability to commercial scale.
- Solid phase peptide synthesis may be carried out with an automatic peptide synthesizer (Model 430A, Applied Biosystems Inc., Foster City, Calif.) using the NMP/HOBt (Option 1) system and tBoc or Fmoc chemistry (See Applied Biosystems User's Manual for the ABI 430A Peptide Synthesizer, Version 1.3B Jul. 1, 1988, section 6, pp. 49-70, Applied Biosystems, Inc., Foster City, Calif.) with capping.
- an automatic peptide synthesizer Model 430A, Applied Biosystems Inc., Foster City, Calif.
- NMP/HOBt Option 1
- tBoc or Fmoc chemistry See Applied Biosystems User's Manual for the ABI 430A Peptide Synthesizer,
- Boc-peptide-resins may be cleaved with HF (-5°C to 0°C, 1 hour).
- the peptide may be extracted from the resin with alternating water and acetic acid, and the filtrates lyophilized.
- the Fmoc-peptide resins may be cleaved according to standard methods (e.g., Introduction to Cleavage Techniques, Applied Biosystems, Inc., 1990, pp. 6-12).
- Peptides may also be assembled using an Advanced Chem Tech
- Non-peptide compounds may be prepared by art-known methods. For example, phosphate-containing amino acids and peptides containing such amino acids, may be prepared using methods known in the art, such as described in Bartlett et al, 1986, Biorg. Chem. 14:356-377.
- the chimeric polypeptides may alternatively be produced by recombinant techniques well known in the art. See, e.g., Sambrook et al, 1989 ⁇ Id.). These chimeric polypeptides produced by recombinant technologies may be expressed from a polynucleotide.
- polynucleotides including DNA and RNA, that encode such chimeric polypeptides may be obtained from the wild-type cDNA, e.g. human leptin, taking into consideration the degeneracy of codon usage, and may further be engineered as desired to incorporate the indicated substitutions.
- polynucleotide sequences may incorporate codons facilitating transcription and translation of mRNA in microbial hosts. Such manufacturing sequences may readily be constructed according to the methods well known in the art. See, e.g., WO 83/04053, incorporated herein by reference in its entirety and for all purposes.
- the polynucleotides above may also optionally encode an N-terminal methionyl residue.
- Non- peptide compounds useful in the present invention may be prepared by art-known methods. For example, phosphate-containing amino acids and peptides containing such amino acids may be prepared using methods known in the art. See, e.g., Bartlett and Landen, 1986, Bioorg. Chem. 14: 356-77.
- a variety of expression vector/host systems may be utilized to contain and express a chimeric polypeptide coding sequence. These include, but are not limited to, microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (e.g., baculovirus); plant cell systems transfected with virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with bacterial expression vectors (e.g., Ti or pBR322 plasmid); or animal cell systems.
- microorganisms such as bacteria transformed with recombinant bacteriophage, plasmid or cosmid DNA expression vectors; yeast transformed with yeast expression vectors; insect cell systems infected with virus expression vectors (e.g., baculovirus); plant cell systems transfected with virus expression vectors (e.g., cauliflower mosaic virus, CaMV;
- Mammalian cells that are useful in recombinant protein productions include, but are not limited to, VERO cells, HeLa cells, Chinese hamster ovary (CHO) cell lines, COS cells (such as COS-7), WI 38, BHK, HepG2, 3T3, RIN, MDCK, A549, PC12, K562 and 293 cells.
- polynucleotide sequences are useful in generating new and useful viral and plasmid DNA vectors, new and useful transformed and transfected prokaryotic and eukaryotic host cells (including bacterial, yeast, and mammalian cells grown in culture), and new and useful methods for cultured growth of such host cells capable of expression of the present chimeric polypeptides.
- the polynucleotide sequences encoding chimeric polypeptides herein may be useful for gene therapy in instances where underproduction of chimeric polypeptides would be alleviated, or the need for increased levels of such would be met.
- the present invention also provides for processes for recombinant DNA production of the present chimeric polypeptides.
- a process for producing the chimeric polypeptides from a host cell containing nucleic acids encoding the chimeric polypeptide comprising: (a) culturing the host cell containing polynucleotides encoding the chimeric polypeptide under conditions facilitating the expression of the DNA molecule; and (b) obtaining the chimeric polypeptide.
- Host cells may be prokaryotic or eukaryotic and include bacteria, mammalian cells (such as Chinese Hamster Ovary (CHO) cells, monkey cells, baby hamster kidney cells, cancer cells or other cells), yeast cells, and insect cells.
- mammalian cells such as Chinese Hamster Ovary (CHO) cells, monkey cells, baby hamster kidney cells, cancer cells or other cells
- yeast cells such as yeast cells, and insect cells.
- Mammalian host systems for the expression of the recombinant protein also are well known to those of skill in the art. Host cell strains may be chosen for a particular ability to process the expressed protein or produce certain post-translation modifications that will be useful in providing protein activity. Such modifications of the polypeptide include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation and acylation. Post- translational processing, which cleaves a "prepro" form of the protein, may also be important for correct insertion, folding and/or function.
- a yeast system may be employed to generate the chimeric polypeptides of the present invention.
- the coding region of the chimeric polypeptides DNA is amplified by PCR.
- a DNA encoding the yeast pre-pro-alpha leader sequence is amplified from yeast genomic DNA in a PCR reaction using one primer containing nucleotides 1-20 of the alpha mating factor gene and another primer complementary to nucleotides 255-235 of this gene (Kurjan and Herskowitz, 1982, Cell, 30:933-43).
- the pre-pro-alpha leader coding sequence and chimeric polypeptide coding sequence fragments are ligated into a plasmid containing the yeast alcohol dehydrogenase (ADH2) promoter, such that the promoter directs expression of a fusion protein consisting of the pre-pro-alpha factor fused to the mature chimeric polypeptide.
- ADH2 yeast alcohol dehydrogenase
- the vector further includes an ADH2 transcription terminator downstream of the cloning site, the yeast "2-micron" replication origin, the yeast leu-2d gene, the yeast REP1 and REP2 genes, the E. coli beta-lactamase gene, and an E. coli origin of replication.
- the beta- lactamase and leu-2d genes provide for selection in bacteria and yeast, respectively.
- the leu-2d gene also facilitates increased copy number of the plasmid in yeast to induce higher levels of expression.
- the REP1 and REP2 genes encode proteins involved in regulation of the plasmid copy number.
- the DNA construct described in the preceding paragraph is transformed into yeast cells using a known method, e.g., lithium acetate treatment (Steams et al., 1990,. Meth. Enz. 185: 280- 297).
- the ADH2 promoter is induced upon exhaustion of glucose in the growth media (Price et al, 1987, Gene 55:287).
- the pre-pro-alpha sequence effects secretion of the fusion protein from the cells.
- the yeast KEX2 protein cleaves the pre-pro sequence from the mature chimeric polypeptides (Bitter et al, 1984, Proc. Natl. Acad. Sci. USA 81:5330-5334).
- Chimeric polypeptides of the invention may also be recombinantly expressed in yeast, e.g., Pichia, using a commercially available expression system, e.g., the Pichia Expression System (Invitrogen, San Diego, California), following the manufacturer's instructions. This system also relies on the pre-pro-alpha sequence to direct secretion, but transcription of the insert is driven by the alcohol oxidase (AOX1) promoter upon induction by methanol.
- AOX1 alcohol oxidase
- the secreted chimeric polypeptide is purified from the yeast growth medium by, e.g., the methods used to purify said chimeric polypeptide from bacterial and mammalian cell supernatants.
- the DNA encoding a chimeric polypeptide may be cloned into a baculovirus expression vector, e.g. pVL1393 (PharMingen, San Diego, California).
- This chimeric-polypeptide-encoding vector is then used according to the manufacturer's directions (PharMingen) or known techniques to infect Spodoptera frugiperda cells, grown for example in sF9 protein-free media, and to produce recombinant protein.
- the protein is purified and concentrated from the media using methods known in the art, e.g.
- heparin-Sepharose column (Pharmacia, Piscataway, New Jersey) and sequential molecular sizing columns (Amicon, Beverly, Massachusetts), and resuspended in appropriate solution, e.g. PBS.
- SDS-PAGE analysis can be used to characterize the protein, for example by showing a single band that confirms the size of the desired chimeric polypeptide, as can full amino acid amino acid sequence analysis, e.g. Edman sequencing on a Proton 2090 Peptide Sequencer, or confirmation of its N-terminal sequence.
- the DNA sequence encoding the predicted mature chimeric polypeptide may be cloned into a plasmid containing a desired promoter and, optionally, a leader sequence (see, e.g., Better et al, 1988, Science 240: 1041-1043). The sequence of this construct may be confirmed by automated sequencing.
- the plasmid is then transformed into E. coli, strain MCI 061, using standard procedures employing CaC12 incubation and heat shock treatment of the bacteria (Sambrook et al., Id.). The transformed bacteria are grown in LB medium supplemented with carbenicillin, and production of the expressed protein is induced by growth in a suitable medium. If present, the leader sequence will affect secretion of the mature chimeric polypeptide and be cleaved during secretion.
- the secreted recombinant chimeric polypeptide is purified from the bacterial culture media by the method described herein.
- the chimeric polypeptides may be expressed in an insect system.
- Insect systems for protein expression are well known to those of skill in the art.
- Autographa californica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign genes in Spodoptera frugiperda cells or in Trichoplusia larvae.
- the chimeric polypeptide coding sequence is cloned into a nonessential region of the virus, such as the polyhedrin gene, and placed under control of the polyhedrin promoter. Successful insertion of a chimeric polypeptide will render the polyhedrin gene inactive and produce recombinant virus lacking coat protein coat.
- the recombinant viruses are then used to infect S. frugiperda cells or Trichoplusia larvae in which a chimeric polypeptide of the present invention is expressed (Smith et al, 1983, J. Virol. 46:584; Engelhard et al, 1994, Proc. Natl. Acad. Scl USA 91:3224-3227).
- the DNA sequence encoding the chimeric polypeptides may be amplified by PCR and cloned into an appropriate vector, for example, pGEX-3X (Pharmacia, Piscataway, New Jersey).
- the pGEX vector is designed to produce a fusion protein comprising glutathione-S-transferase (GST), encoded by the vector, and a protein encoded by a DNA fragment inserted into the vector's cloning site.
- the primers for the PCR may be generated to include, for example, an appropriate cleavage site.
- the recombinant fusion protein may then be cleaved from the GST portion of the fusion protein.
- the pGEX-3X/ chimeric polypeptide construct is transformed into E. coli XL-1 Blue cells (Stratagene, La Jolla, California), and individual transformants are isolated and grown at 37°C in LB medium (supplemented with carbenicillin) to an optical density at wavelength 600 nm of 0.4, followed by further incubation for 4 hours in the presence of 0.5 mM Isopropyl beta-D-thiogalactopyranoside (Sigma Chemical Co., St. Louis, Missouri). Plasmid DNA from individual transformants is purified and partially sequenced using an automated sequencer to confirm the presence of the desired chimeric polypeptide-encoding gene insert in the proper orientation.
- the fusion protein when expected to be produced as an insoluble inclusion body in the bacteria, may be purified as described above or as follows. Cells are harvested by centrifugation; washed in 0.15 M NaCl, 10 mM Tris, pH 8, 1 mM EDTA; and treated with 0.1 mg/mL lysozyme (Sigma Chemical Co.) for 15 min. at RT. The lysate is cleared by sonication, and cell debris is pelleted by centrifugation for 10 min. at 12,000xg. The fusion protein-containing pellet is resuspended in 50 mM Tris, pH 8, and 10 mM EDTA, layered over 50% glycerol, and centrifuged for 30 min.
- the pellet is resuspended in standard phosphate buffered saline solution (PBS) free of Mg++ and Ca++.
- PBS phosphate buffered saline solution
- the fusion protein is further purified by fractionating the resuspended pellet in a denaturing SDS polyacrylamide gel (Sambrook et al, supra). The gel is soaked in 0.4 M KC1 to visualize the protein, which is excised and
- the GST/chimeric polypeptide fusion protein is produced in bacteria as a soluble protein, it may be purified using the GST Purification Module (Pharmacia Biotech). [0147] The fusion protein may be subjected to digestion to cleave the GST from the mature chimeric polypeptide.
- the digestion reaction (20-40 ⁇ g fusion protein, 20-30 units human thrombin (4000 U/mg (Sigma) in 0.5 mL PBS) is incubated 16-48 hrs. at RT and loaded on a denaturing SDS-PAGE gel to fractionate the reaction products.
- the gel is soaked in 0.4 M KC1 to visualize the protein bands.
- the identity of the protein band corresponding to the expected molecular weight of the chimeric polypeptide may be confirmed by partial amino acid sequence analysis using an automated sequencer (Applied Biosystems Model 473 A, Foster City,
- 293 cells may be co-transfected with plasmids containing the chimeric polypeptides cDNA in the pCMV vector (5' CMV promoter, 3' HGH poly A sequence) and pSV2neo (containing the neo resistance gene) by the calcium phosphate method.
- the vectors should be linearized with Seal prior to transfection.
- an alternative construct using a similar pCMV vector with the neo gene incorporated can be used.
- Stable cell lines are selected from single cell clones by limiting dilution in growth media containing 0.5 mg/mL G418 (neomycin-like antibiotic) for 10-14 days. Cell lines are screened for chimeric polypeptides expression by ELISA or Western blot, and high-expressing cell lines are expanded for large scale growth.
- G418 neomycin-like antibiotic
- the transformed cells are used for long-term, high-yield protein production and as such stable expression is desirable.
- the cells may be allowed to grow for 1-2 days in an enriched media before they are switched to selective media.
- the selectable marker is designed to confer resistance to selection, and its presence allows growth and recovery of cells that successfully express the introduced sequences.
- Resistant clumps of stably transformed cells can be proliferated using tissue culture techniques appropriate to the cell.
- a number of selection systems may be used to recover the cells that have been transformed for recombinant protein production.
- Such selection systems include, but are not limited to, HSV thymidine kinase, hypoxanthine-guanine phosphoribosyltransferase and adenine phosphoribosyltransferase genes, in tk-, hgprt- or aprt- cells, respectively.
- anti-metabolite resistance can be used as the basis of selection for dhfr, that confers resistance to methotrexate; gpt, that confers resistance to mycophenolic acid; neo, that confers resistance to the
- aminoglycoside, G418 also, that confers resistance to chlorsulfuron; and hygro, that confers resistance to hygromycin.
- Additional selectable genes that may be useful include trpB, which allows cells to utilize indole in place of tryptophan, or hisD, which allows cells to utilize histinol in place of histidine.
- Markers that give a visual indication for identification of transformants include anthocyanins, beta-glucuronidase and its substrate, GUS, and luciferase and its substrate, luciferin.
- chimeric polypeptides of the present invention may be produced using a combination of both automated peptide synthesis and recombinant techniques.
- a chimeric polypeptide of the present invention may contain a combination of modifications including deletion, substitution, insertion and derivatization by PEGylation (or other moiety, e.g. polymer, fatty acyl chain, C-terminal amidation).
- PEGylation or other moiety, e.g. polymer, fatty acyl chain, C-terminal amidation
- Such a chimeric polypeptide may be produced in stages. In the first stage, an intermediate chimeric polypeptide containing the modifications of deletion, substitution, insertion, and any combination thereof, may be produced by recombinant techniques as described.
- the intermediate chimeric polypeptide is PEGylated (or subjected to other chemical derivatization, e.g., acylation, C-terminal amidation) through chemical modification with an appropriate PEGylating reagent (e.g., from NeKtar Transforming Therapeutics, San Carlos, California) to yield the desired chimeric polypeptide derivative.
- an appropriate PEGylating reagent e.g., from NeKtar Transforming Therapeutics, San Carlos, California
- Peptides may be purified by any number of methods known in the art, including as described herein In one method peptides are purified by RP-HPLC (preparative and analytical) using a Waters Delta Prep 3000 system. A C4, C8 or C18 preparative column (10 ⁇ , 2.2X25 cm; Vydac, Hesperia, Calif.) may be used to isolate peptides, and purity may be determined using a C4, C8 or C18 analytical column (5 ⁇ , 0.46X25 cm; Vydac).
- Amino acid analyses may be performed on the Waters Pico Tag system and processed using the Maxima program.
- Peptides may be hydrolyzed by vapor-phase acid hydrolysis (115°C, 20-24 h). Hydrolysates may be derivatized and analyzed by standard methods (Cohen et al, THE PICO TAG METHOD: A MANUAL OF ADVANCED
- Plasma desorption ionization analysis using time of flight detection may be carried out on an Applied Biosystems Bio-Ion 20 mass spectrometer.
- Chimeric polypeptide expression assay Methods are available for assaying the level of protein expression by a host cell. Procedures useful for assaying the level of protein expression by a host cell are exemplified in the following typical protocol. About 25 ⁇ BL21 E. coli cells are transformed with 2ul plasmid DNA (expression vector for the chimeric polynucleotide). Cells can be plated and incubated overnight at 37 degrees C or at room temperature (RT) over a 48-hr period. A single colony can be selected and used to grow starter culture in 4 ml LB media with appropriate antibiotic for ⁇ 6 hrs.
- 2ul plasmid DNA expression vector for the chimeric polynucleotide
- Glycerol stocks can be prepared by adding lOOul 80% sterile glycerol to 900ul stock, which can then be mixed gently and stored at -80C. A 250 ⁇ sample can be removed for TCP uninduced sample. An aliquot, for example, 2 ml of Magic media containing appropriate antibiotic can be inoculated with 5 ⁇ starter culture, which can then be incubated overnight (up to 24 hrs) at 37C, 300 rpm. As known in the art, Magic Media is autoinducing.
- 60 ml Magic Media containing appropriate antibiotic can be inoculated with 60 ⁇ starter culture in a 250ml or 125 ml Thompson flask, which can then be incubated overnight (up to 24 hrs) at 30C, 300rpm. After incubation, 250 ⁇ culture can be removed from each tube and the cells pelleted. The cell can be resuspended in 1 ml 50 mM Tris pH 8, 150mM NaCl, to which can be added 0.1 volumes (lOOul) POP culture reagent and 1 ⁇ r-lysozyme (1 :750 dilution in r-lysozyme buffer). The mixture can be mixed well and incubated at least 10 min at RT.
- the preparation can then be centrifuged 10 min at 14000 x G.
- the supernatant (soluble fraction) can be removed and retained, and samples can be prepared for gel analysis (15 ⁇ + 5 ⁇ LDS).
- the remaining inclusion body pellet can be resuspended in 1ml 1% SDS with sonication.
- the sample can be prepared for gel analysis (15ul + 5 ⁇ LDS).
- 1.0 volumes POP culture reagent and 1 ⁇ r- lysozyme (1 :750 dilution in r-lysozyme buffer) can be added.
- the mixture can be mixed well and incubated at least 10 min at RT. These samples may not need to be centrifuged.
- the sample can then be prepared for gel analysis (15 ⁇ 1 + 5 ⁇ LDS).
- NU-PAGE gels (4-12%) non-reduced in 1XMES buffer can be run and stained with SimplyBlue microwave protocol. Destaining can be conducted overnight, as known in the art.
- a gel image can be retained, and analyzed to determine protein expression levels.
- Inclusion Body preparation For chimeric polypeptides that are found in the inclusion body fraction, the following procedure can be beneficial.
- the cell pellet can be resuspended in a minimum of 100 ml Lysis buffer for each 50 ml culture. Upon the addition of 30ml, a 10ml pipette can be used to resuspend, then the tube can be washed out with an additional 70ml.
- the resuspended cell solution can be multiply run, e.g., 4 passes, through a microfluidizer at 100 PSI (min) taking care to keep chamber in ice water through the entire process.
- the fluidized slurry can be centrifuged at 14000 x g, 20 min (e.g., JLA 10.5, 10,000rpm, using 250 ml Nalgene® bottles).
- the inclusion body pellet can be resuspended on ice in chilled lysis buffer with stir bar and stir plate for 1 hour at 4C after disruption with pipette tip.
- the pellet can be resuspended a second time in distilled H 2 0 with stir bar and stir plate for 1 hour at 4C after disruption with pipette tip, followed by centrifugation at 14000 x g, 15 min.
- the supernatant can be removed and discarded.
- the resultant can be stored at -80C.
- Inclusion body pellets can be solubilized in appropriate volume of solubilization buffer (8M urea or 8M guanidine, 50 mM Tris, 10 mM DTT, pH 7.75) for 1 hour at RT.
- solubilized pellets can be centrifuged for 20 min at 27 OOOg.
- Filtered (e.g., 0.4 um) supernatant can be transferred drop by drop into appropriate volume of refolding buffer (50 mM Tris-HCl, 1 M urea, 0.8 M arginine, 4 mM cysteine, 1 mM cystamine; pH 8) at RT.
- the result can then be placed at 4°C overnight or longer with gentle mixing.
- Samples can be concentrated and run on a gel filtration column (SuperdexTM 75 26/60) at 1-2 ml/min in 4C environment using a GE Healthsciences
- AKTAFPLCTM Appropriate protein containing fractions can be identified via SDS-PAGE, pooled and run through a second gel filtration column. Pooled protein can then be concentrated in Amicon filter to appropriate concentration and assayed for endotoxin levels using, e.g., Endosafe® PTS Reader (Charles River), as known in the art. Once a protein sample has passed the endotoxin criteria, it can be sterile filtered, dispensed into aliquots and run through quality control assays. Quality control assays can include analytical HPLC-SEC, non reducing SDS PAGE and RP HPLC - MS to obtain approximate mass.
- Proteins can be obtained in lxPBS (137 mM sodium chloride, 2.7 mM potassium chloride, 4.3 mM disodium phosphate, 1.4 mM monopotassium phosphate, pH7.2), distributed into aliquots and flash frozen for storage at -70 to -80 °C.
- Obesity and overweight are common and serious public health problems in the United States and throughout the world.
- Upper body obesity is the strongest risk factor known for type 2 diabetes mellitus and is a strong risk factor for cardiovascular disease.
- Obesity is a recognized risk factor for hypertension, atherosclerosis, congestive heart failure, stroke, gallbladder disease, osteoarthritis, sleep apnea, reproductive disorders such as polycystic ovarian syndrome, cancers of the breast, prostate, and colon, and increased incidence of complications of general anesthesia. See, e.g., Kopelman, 2000, Nature 404:635-43.
- Obesity reduces life-span and carries a serious risk of the co-morbidities listed above, as well disorders such as infections, varicose veins, acanthosis nigricans, eczema, exercise intolerance, insulin resistance, hypertension hypercholesterolemia, cholelithiasis, orthopedic injury, and thromboembolic disease. See e.g., Rissanen et al, 1990, Br. Med. J, 301:835-7. Obesity is also a risk factor for the group of conditions called insulin resistance syndrome, or "Syndrome X" and metabolic syndrome. The worldwide medical cost of obesity and associated disorders is enormous.
- the pathogenesis of obesity is believed to be multi-factoral.
- a problem is that, in obese subjects, nutrient availability and energy expenditure do not come into balance until there is excess adipose tissue.
- the central nervous system (CNS) controls energy balance and
- hypothalamus coordinates a variety of behavioral, autonomic and endocrine activities appropriate to the metabolic status of the animal.
- the mechanisms or systems that control these activities are broadly distributed across the forebrain (e.g., hypothalamus), hindbrain (e.g., brainstem), and spinal cord.
- metabolic (i.e., fuel availability) and cognitive (i.e., learned preferences) information from these systems is integrated and the decision to engage in appetitive (food seeking) and consummatory (ingestion) behaviors is either turned on (meal procurement and initiation) or turned off (meal termination).
- the hypothalamus is thought to be principally responsible for integrating these signals and then issuing commands to the brainstem.
- Brainstem nuclei that control the elements of the consummatory motor control system e.g., muscles responsible for chewing and swallowing.
- these CNS nuclei have literally been referred to as constituting the "final common pathway" for ingestive behavior.
- Neuroanatomical and pharmacological evidence support that signals of energy and nutritional homeostasis integrate in forebrain nuclei and that the consummatory motor control system resides in brainstem nuclei, probably in regions surrounding the trigeminal motor nucleus. There are extensive reciprocal connection between the hypothalamus and brainstem.
- CNS-directed anti-obesity therapeutics e.g., small molecules and peptides
- Obesity remains a poorly treatable, chronic, essentially intractable metabolic disorder. Accordingly, a need exists for new therapies useful in weight reduction and/or weight maintenance in a subject. Such therapies would lead to a profound beneficial effect on the subject's health.
- Methods and therapies employing the chimeric peptides disclosed herein, either alone or in combination with other anti-obesity agents see, e.g., WO 2009064298 and
- Le tin deficiency Leptin deficiency has been shown to result in obesity.
- leptin deficiency is congenital leptin deficiency, a rare genetic disorder. See Montaque et al, 1997, Nature 387: 903-908.
- Severe leptin deficiency can be a result of uncontrolled insulin- deficient diabetes mellitus that results from destruction of insulin-secreting ⁇ -cells. It is theorized that the lack of insulin leads to synthesis and storage of triglycerides in adipose tissue, which prevents weight gain and in turn dramatically reduces plasma leptin levels since leptin is synthesized in adipose tissue.
- Leptin deficiencies can be treated with leptin replacement therapy, such as via daily leptin or leptin agonist injections.
- leptin replacement therapy such as via daily leptin or leptin agonist injections.
- the chimeric polypeptides described herein can provide a more convenient and advantageous therapeutic treatment of such diseases and disorders.
- Diabetes and cardiovascular disease Diabetes mellitus is recognized as a complex, chronic disease in which 60% to 70% of all case fatalities among diabetic patients are a result of cardiovascular complications. Diabetes is not only considered a coronary heart disease risk equivalent but is also identified as an independent predictor of adverse events, including recurrent myocardial infarction, congestive heart failure, and death following a cardiovascular incident. The adoption of tighter glucose control and aggressive treatment for cardiovascular risk factors would be expected to reduce the risk of coronary heart disease complications and improve overall survival among diabetic patients. Yet, diabetic patients are two to three times more likely to experience an acute myocardial infarction than non-diabetic patients, and diabetic patients live eight to thirteen years less than non-diabetic patients.
- leptin can have direct benefit to treating diabetes, particularly in type I diabetes and type II diabetes, with or without the presence of obesity, and more particularly in conditions of low serum leptin. It has been reported that leptin replenishment reduced or prevented hyperinsulinemia, insulin resistance and hyperglycemia in various animal models of diabetes type 1 and 2 with or without attendant obesity. For example, high leptin plasma levels generated either by pharmacological administration of leptin or with adenoviral gene therapy reduced hyperglycemia and associated increases of plasma glucagon levels in STZ- induced diabetes, despite persistently low insulin levels.
- Lipid regulation diseases As known in the art, lipodystrophy is characterized by abnormal or degenerative conditions of the body's adipose tissue. Dyslipidemia is a disruption in the normal lipid component in the blood. It is believed that prolonged elevation of insulin levels can lead to dyslipidemia. Hyperlipidemia is the presence of raised or abnormal levels of lipids and/or lipoproteins in the blood. Hypothalamic amenorrhea is a condition in which menstruation stops for several months due to a problem involving the hypothalamus. It has been found that leptin replacement therapy in women with hypothalamic amenorrhea improves reproductive, thyroid, and growth hormone axes and markers of bone formation without causing adverse effects.
- Fatty liver disease e.g., nonalcoholic fatty liver disease (NAFLD) refers to a wide spectrum of liver disease ranging from simple fatty liver (steatosis), to nonalcoholic steatohepatitis (NASH), to cirrhosis
- Alzheimer's disease Alzheimer's disease
- AD Alzheimer's disease
- plaques and tangles in the brain which include dysregulation of the A-beta protein.
- brain lipids are intricately involved in A-beta-related pathogenic pathways, and that an important modulator of lipid homeostasis is leptin.
- leptin can modulate bidirectional A-beta kinesis, reducing its levels extracellularly.
- chronic administration of leptin to AD-transgenic animals reduced the brain A-beta load, underlying its therapeutic potential. See Fewlass et al, 2004, FASEB J, 18: 1870-1878.
- type 2 diabetes mellitus and AD share epidemiological and biochemical features in that both are characterized by insoluble protein aggregates with a fibrillar conformation - amylin in type 2 DM pancreatic islets, and ⁇ in AD brain. Without wishing to be bound by any theory, it is believed that similar toxic mechanisms may characterize type-2 DM and AD. See Lim et al., FEBSLett., 582:2188-2194.
- Metabolic syndrome X Metabolic Syndrome X is characterized by insulin resistance, dyslipidemia, hypertension, and visceral distribution of adipose tissue, and plays a pivotal role in the pathophysiology of type 2 diabetes. It has also been found to be strongly correlated with NASH, fibrosis, and cirrhosis of the liver. Accordingly, chimeric polypeptides described herein can be useful in the treatment of metabolic syndrome X.
- Huntington's Disease Huntington's Disease is an autosomal dominant
- Chimeric polypeptides described herein can be useful in the treatment of Huntington's Disease.
- a method for treating a disease or disorder in a subject is in need of treatment for the disease or disorder.
- the disease or disorder can be lipodystrophy, dyslipidemia, hyperlipidemia, overweight, obesity, hypothalamic amenorrhea, Alzheimer's disease, leptin deficiency, fatty liver disease or diabetes (including type I and type II).
- Additional diseases and disorders which can be treated by the compounds and methods described herein include nonalcoholic steatohepatitis (NASH), nonalcoholic fatty liver disease (NAFLD), metabolic syndrome X and Huntington's Disease.
- the method of treatment includes administration to the subject of a chimeric polypeptide as described herein in an amount effective to treatment the disease or disorder.
- Food intake is useful in the assessment of the utility of a compound as described herein.
- a number of metabolic pathologies are related to food intake (e.g., diabetes, obesity). Accordingly, an initial screening can be conducted to determine the extent to which food intake is modulated by administration of compounds described herein, and a positive initial screening can be useful in subsequent development of a compound.
- in vitro assays In vitro assays. Without wishing to be bound by any theory or mechanism of action, it is believed that correlations exist between the results of in vitro (e.g., receptor) assays, and the utility of agents for the treatment of metabolic diseases and disorders. Accordingly, in vitro assays (e.g., cell based assays) are useful as a screening strategy for potential metabolic agents, such as described herein. A variety of in vitro assays are known in the art, including those described as follows.
- Leptin binding can be measured by the potency of a test compound in displacing 125 I-recombinant-Leptin (murine) from the surface membrane expressing chimeric Leptin (Hu) - EPO (Mu) receptor presented by the 32D OBECA cell line (J Biol Chem 1998; 273(29): 18365-18373).
- Purified cell membranes can be prepared by homogenization from harvested confluent cell cultures of 32D OBECA cells. Membranes can be incubated with 125 I-rec-Murine -Leptin and increasing concentrations of test compound for 3 hours at ambient temperature in 96-well polystyrene plates.
- Bound and unbound ligand fractions can then be separated by rapid filtration onto 96-well GF/B plates pre-b locked for at least 60' in 0.5% PEI (poly ethylene imine). Glass fiber plates can then be dried, scintillant added, and CPM determined by reading on a multiwell scintillation counter capable of reading radiolabeled iodine.
- PEI poly ethylene imine
- Transducer and Activator of Transcription 5 can be measured following treatment of 32D- Keptin cells ectopically expressing chimeric Hu-Leptin Mu-EPO receptor with a test compound.
- the 32D-Keptin cells (identical to 32D-OBECA cells but maintained in culture with leptin) can be leptin weaned overnight and then treated with test compounds in 96-well plates for 30 minutes at 37°C followed by cell extraction.
- the pSTAT5 levels in the cell lysates can be determined using the Perkin Elmer AlphaScreen ® SureFire ® pSTAT5 assay kit in a 384-well format (ProxiplateTM 384 Plus).
- the efficacy of test compounds can be determined relative to the maximal signal in cell lysates from cells treated with Human leptin.
- compositions comprising compounds described herein in combination with a pharmaceutically acceptable excipient (e.g., carrier).
- pharmaceutically acceptable carrier refers to pharmaceutical excipients, for example, pharmaceutically, physiologically, acceptable organic or inorganic carrier substances suitable for enteral or parenteral application that do not deleteriously react with the active agent.
- suitable pharmaceutically acceptable carriers include water, salt solutions (e.g., Ringer's solution and the like), alcohols, oils, gelatins, and carbohydrates such as lactose, amy lose or starch, fatty acid esters, hydroxymethy cellulose, and polyvinyl pyrrolidine.
- Such preparations can be sterilized and, if desired, mixed with auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention.
- auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention.
- the chimeric polypeptides described herein can be administered alone or can be co-administered to a subject. Co-administration is meant to include simultaneous or sequential administration of the compounds individually or in combination (more than one compound). For example, it has been found that obesity can be beneficially treated with a combination therapy including a leptin (e.g., metreleptin) and certain other anti-obesity compounds. See e.g., U.S. Published Appl. No. 2008/0207512. Accordingly, a chimeric polypeptide described herein could be useful for treatment of obesity.
- a leptin e.g., metreleptin
- certain other anti-obesity compounds See e.g., U.S. Published Appl. No. 2008/0207512. Accordingly, a chimeric polypeptide described herein could be useful for treatment of obesity.
- the formulations and methods described herein further provide that the chimeric polypeptide is co-administered with one or more anti-diabetic agents, such as anti-hyperglycemia agents, e.g. insulin, amylins, pramlintide, metformin.
- anti-diabetic agents such as anti-hyperglycemia agents, e.g. insulin, amylins, pramlintide, metformin.
- the formulations and methods described herein further provide that the chimeric polypeptide is co-administered with one or more cholesterol and/or triglyceride lowering agents.
- exemplary agents include HMG CoA reductase inhibitors (e.g., atorvastatin, fluvastatin, lovastatin, pravastatin, rosuvastatin, simvastatin); bile ace sequestrants (e.g., colesevelam, cholestyramine, colestipol); fibrates (e.g., fenofibrate, clofibrate, gemfibrozil); ezetimibe, nicotinic acid, probucol, a lovastatin/niacin combination; an atorvastatin/amlodipine combination; and a simvastatin/ezetimibe combination.
- HMG CoA reductase inhibitors e.g., atorvastatin, fluvastatin,
- the individual chimeric polypeptides can be co-administered with other anti-obesity agents, such as exenatide or liraglutide.
- compositions for use as a medicament, i.e. for use in therapy, since the leptin compound is a therapeutically active compound.
- Compositions comprising a chimeric polypeptide, either liquid or dry form, and optionally at least one pharmaceutically acceptable carrier and/or excipient are also specifically contemplated and are exemplified herein.
- Co-administration can be achieved by separately administering the chimeric
- compositions can also be co-administered, when desired, with other active substances (e.g. to reduce metabolic degradation) as known in the art or other therapeutically active agents.
- other active substances e.g. to reduce metabolic degradation
- Amylins is a peptide hormone synthesized by pancreatic ⁇ -cells that is co- secreted with insulin in response to nutrient intake.
- the sequence of amylin is highly preserved across mammalian species, with structural similarities to calcitonin gene-related peptide (CGRP), the calcitonins, the intermedins, and adrenomedullin, as known in the art.
- CGRP calcitonin gene-related peptide
- the glucoregulatory actions of amylin complement those of insulin by regulating the rate of glucose appearance in the circulation via suppression of nutrient-stimulated glucagon secretion and slowing gastric emptying.
- pramlintide a synthetic and equipotent analogue of human amylin, reduces postprandial glucose excursions by suppressing
- rat amylin KCNTATCATQRLANFLVRSS NLGPVLPPTNVGSNTY (SEQ ID NO:86);
- human amylin KCNT ATCATQRLANFL VHS S NFGAILS STNVGSNT Y (SEQ ID NO:87); Pramlintide: KCNTATCATQRLANFLVHSS NFGPILPPTNVGSNTY (SEQ ID NO:88).
- Davalintide also known as "AC-2307” is a potent amylin agonist useful in the treatment of a variety of disease indications. See WO 2006/083254 and WO 2007/114838, each of which is incorporated by reference herein in its entirety and for all purposes.
- Davalintide is a chimeric peptide, having an N-terminal loop region of amylin or calcitonin and analogs thereof, an alpha-helical region of at least a portion of an alpha-helical region of calcitonin or analogs thereof or an alpha-helical region having a portion of an amylin alpha-helical region and a calcitonin alpha-helical region or analog thereof, and a C-terminal tail region of amylin or calcitonin.
- the sequences of human calcitonin, salmon calcitonin and davalintide follow:
- human calcitonin CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP (SEQ ID NO:89);
- salmon calcitonin CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP (SEQ ID NO:90);
- davalintide KCNTATCVLGRLSQELHRLQTYPRTNTGSNTY (SEQ ID NO:91).
- amylins and davalintide, and fragments and analogs thereof can require C-terminal amidation to elicit a full biological response. It is understood that amylin compounds such as those described herein which include amylins and/or davalintide, and fragment and analogs thereof, can be amidated at the C-terminal.
- Amylin agonist compounds include native amylin peptides, amylin analog peptides, and other compounds (e.g., small molecules) that have amylin agonist activity.
- the "amylin agonist compounds” can be derived from natural sources, can be synthetic, or can be derived from recombinant DNA techniques.
- Amylin agonist compounds have amylin agonist receptor binding activity and may comprise amino acids (e.g., natural, unnatural, or a combination thereof), peptide mimetics, chemical moieties, and the like. The skilled artisan will recognize amylin agonist compounds using amylin receptor binding assays or by measuring amylin agonist activity in soleus muscle assays.
- amylin agonist compounds will have an IC 50 of about 200 nM or less, about 100 nM or less, or about 50 nM or less, in an amylin receptor binding assay, such as that described herein, in US Patent No. 5,686,411, and US Publication No. 2008/0176804, the disclosures of which are incorporated by reference herein in their entireties and for all purposes.
- amylin agonist compounds will have an EC 50 of about 20 nM or less, about 15 nM or less, about 10 nM or less, or about 5 nM or less in a soleus muscle assay, such as that described herein and in US Patent No. 5,686,411.
- the amylin agonist compound has at least 90% or 100% sequence identity to
- the amylin agonist compound is a peptide chimera of amylin (e.g., human amylin, rat amylin, and the like) and calcitonin (e.g., human calcitonin, salmon calcitonin, and the like).
- amylin e.g., human amylin, rat amylin, and the like
- calcitonin e.g., human calcitonin, salmon calcitonin, and the like.
- Suitable and exemplary amylin agonist compounds are also described in US Publication No. 2008/0274952, the disclosure of which is incorporated by reference herein in its entirety and for all purposes.
- amylin analog as used herein is meant an amylin agonist that has at least 50% sequence identity, preferably at least 70%> sequence identity, to a naturally-occurring form of amylin, either rat or human or from any other species, and is derived from them by modifications including insertions, substitutions, extensions, and/or deletions of the reference amino acid sequence.
- the amylin analog sequence can have at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 90%, or 95% amino acid sequence identity with the reference amylin.
- the analog has 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or even 16 amino acid substitutions, insertions, extensions, and/or deletions relative to the reference compound.
- the amylin analog may comprise conservative or non-conservative amino acid substitutions (including non-natural amino acids and L and D forms). These analogs are preferably peptides, peptide derivatives or peptide mimics.
- Typical amylin analogs will be peptides, especially of 32- 37 amino acids, e.g. 27 to 45, especially 28 to 38, and even 31-36.
- Amylin analogs with identity to rat and human amylin include 25 ' 28 ' 29 Pro-h-amylin
- Amylin analogs include amino acid sequences of residues 1-37 of Formula (I) following, wherein up to 25% of the amino acids set forth in Formula (I) may be deleted or substituted with a different amino acid: X'-Xaa 1 -Cys 2 -Asn 3 -Thr 4 -Ala 5 -Thr 6 -Cys 7 -Ala 8 -Thr 9 -Gln 10 -Arg 11 - Leu 12 -Ala 13 -Asn 14 -Phe 15 -Leu 16 -Val 17 -His 18 -Ser 19 -Ser 20 - Xaa 21 - Asn 22 -Phe 23 - Xaa 24 - Xaa 25 - Xaa 26 - Xaa 27 - Xaa 28 - Xaa 29 -Thr 30 - Xaa 31 -Val 32 -Gly 33 -Ser 34 -Asn 35 -Thr 36 -T
- X' is hydrogen, an N-terminal capping group, or a linker to a duration enhancing
- Xaa is Lys or a bond
- Xaa is Lys, Cys, or Asn
- Xaa is Lys, Cys, or Gly
- Xaa is
- Xaa is Lys, Cys, or Pro
- Xaa is Lys, Cys, or He
- Xaa is Lys, Cys, or Leu
- Xaa is Lys, Cys, or Pro
- Xaa 29 is Lys, Cys, or Pro
- Xaa 31 is Lys, Cys, or Asn.
- the variable X represents a C-terminal functionality (e.g., a C-terminal cap).
- X is substituted or unsubstituted amino, substituted or unsubstituted alkylamino, substituted or unsubstituted dialkylamino, substituted or unsubstituted cycloalkylamino, substituted or unsubstituted arylamino, substituted or unsubstituted aralkylamino, substituted or unsubstituted alkyloxy, substituted or unsubstituted aryloxy, substituted or unsubstituted aralkyloxy, or hydroxyl.
- X is preferably amine thereby forming a C-terminal amide.
- up to 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45% or even 50% of the amino acids of residues 1-37 of Formula (I) are deleted or substituted in a polypeptide component according to Formula (I).
- the amylin analog component has 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or even 16 amino acid substitutions relative to the amino acid sequence set forth in Formula (I).
- the amylin analog has a sequence which has a defined sequence identity with respect to the residues 1-37 of the amino acid sequence according to Formula (I).
- the sequence identity between an amylin analgo described herein and residues 1-37 of Formula (I) is 50%>, 55%>, 60%>, 65%>, 70%>, 75%, 80%, 85%, 90%, 95% or even higher.
- up to 50%, 45%, 40%, 35%, 30%), 25%o, 20%), 15%), 10%), 5%> or even less of the amino acids set forth in residues 1-37 of Formula (I) may be deleted or substituted with a different amino acid.
- the sequence identity is within the range 75%>-100%>.
- the sequence identity is within the range 75%-90%. In some embodiments, the sequence identity is within the range 80%)-90%>. In some embodiments, the sequence identity is at least 75%>.
- the amylin analog has the sequence of residues 1-37 of Formula (I). [0194] In some embodiments, amylin analogs including those of Formula (I), form the basis of a polypeptide component to which one or more duration enhancing moieties are linked, optionally through a linker, to form an amylin polypeptide conjugate. Thus, the polypeptide component serves as a template ("polypeptide template") to which is attached, preferably by covalent attachment, one or more duration enhancing moieties.
- Linkage of the duration enhancing moiety to the polypeptide component can be through a linker as described herein.
- linkage of the duration enhancing moiety to the polypeptide component can be via a direct covalent bond.
- the duration enhancing moiety can be a water soluble polymer as described herein.
- a plurality of duration enhancing moieties are attached to the polypeptide component, in which case each linker to each duration enhancing moiety is independently selected from the linkers described herein.
- Amylin analogs useful as polypeptide components described herein include, but are not limited to, the compounds set forth in residues 1-37 of Formula (I) provided in Table 1 below. Unless indicated to the contrary, all peptides described herein, including peptides having an expressly provided sequence, are contemplated in both free carboxylate and amidated forms.
- linker in the context of attachment of duration enhancing moieties to a polypeptide component in an amylin polypeptide conjugate described herein, means a divalent species (-L-) covalently bonded in turn to a polypeptide component having a valency available for bonding and to a duration enhancing moiety having a valency available for bonding.
- the available bonding site on the polypeptide component is conveniently a side chain residue (e.g., lysine, cysteine, aspartic acid, and homologs thereof).
- the available bonding site on the polypeptide component is the side chain of a lysine or a cysteine residue.
- the available bonding site on the polypeptide component is the N-terminal amine. In some embodiments, the available bonding site on the polypeptide component is the C-terminal carboxyl. In some embodiments, the available bonding site on the polypeptide component is a backbone atom thereof.
- linking amino acid residue means an amino acid within residues 1-37 of Formula (I) to which a duration enhancing moiety is attached, optionally through a linker.
- compounds are provided having a linker covalently linking a polypeptide component with a duration enhancing moiety.
- the linker is optional; i.e., any linker may simply be a bond.
- the linker is attached at a side chain of the polypeptide component.
- the linker is attached to a backbone atom of the polypeptide component.
- an amylin polypeptide conjugate which is a derivative of pramlintide with SEQ ID NO:88 or an analog thereof, wherein the amino acid residue in position 1 is absent (i.e., des-Lys 1 ) and an amino acid residue in position 2 to 37 has been substituted with a lysine residue or cysteine residue and wherein said lysine residue or cysteine residue is linked to a polyethylene glycol polymer, optionally via a linker, wherein the amino acid numbering conforms with the amino acid number in SEQ ID NO: 88.
- the invention relates to an amylin polypeptide conjugate, which is a derivative of pramlintide with SEQ ID NO:88 or an analog thereof, wherein the amino acid residue in position 1 is absent (i.e., des-Lys 1 ) and wherein an amino acid residue in any one of position 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 31, 32, 33, 34, 35, 36, or 37 is substituted with a lysine residue and wherein said lysine residue is linked to a polyethylene glycol polymer, optionally via a linker.
- an amino acid residue in position 1 is absent (i.e., des-Lys 1 ) and wherein an amino acid residue in any one of position 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 31, 32, 33, 34, 35, 36, or 37 is substituted with a lysine residue and wherein
- the invention relates to an amylin polypeptide conjugate, which is a derivative of pramlintide with SEQ ID NO:88 or an analog thereof, wherein the amino acid residue in position 1 is absent (i.e., des-Lys 1 ) and wherein an amino acid residue in any one of position 21, 24-29, or 31 is substituted with a lysine residue and wherein said lysine residue is linked to a polyethylene glycol polymer, optionally via a linker.
- an amylin polypeptide conjugate which is a derivative of pramlintide with SEQ ID NO:88 or an analog thereof, wherein the amino acid residue in position 1 is absent (i.e., des-Lys 1 ) and wherein an amino acid residue in any one of position 21, 24-29, or 31 is substituted with a lysine residue and wherein said lysine residue is linked to a polyethylene glycol polymer, optionally via a linker.
- the invention relates to an amylin polypeptide conjugate, which is a derivative of pramlintide with SEQ ID NO:88 or an analog thereof, wherein the amino acid residue in position 1 is absent (i.e., des-Lys 1 ) and wherein an amino acid residue in position 21 is substituted with a lysine residue and wherein said lysine residue is linked to a polyethylene glycol polymer, optionally via a linker.
- the invention relates to an amylin polypeptide conjugate, which is a derivative of pramlintide with SEQ ID NO:88 or an analog thereof, wherein the amino acid residue in position 1 is absent (i.e., des-Lys 1 ) and wherein an amino acid residue in position 24 substituted with a lysine residue and wherein said lysine residue is linked to a polyethylene glycol polymer, optionally via a linker.
- the invention relates to an amylin polypeptide conjugate, which is a derivative of pramlintide with SEQ ID NO:88 or an analog thereof, wherein the amino acid residue in position 1 is absent (i.e., des-Lys 1 ) and wherein an amino acid residue in position 25 substituted with a lysine residue and wherein said lysine residue is linked to a polyethylene glycol polymer, optionally via a linker.
- the invention relates to an amylin polypeptide conjugate, which is a derivative of pramlintide with SEQ ID NO:88 or an analog thereof, wherein the amino acid residue in position 1 is absent (i.e., des-Lys 1 ) and wherein an amino acid residue in position 26 substituted with a lysine residue and wherein said lysine residue is linked to a polyethylene glycol polymer, optionally via a linker.
- the invention relates to an amylin polypeptide conjugate, which is a derivative of pramlintide with SEQ ID NO:88 or an analog thereof, wherein the amino acid residue in position 1 is absent (i.e., des-Lys 1 ) and wherein an amino acid residue in position 27 substituted with a lysine residue and wherein said lysine residue is linked to a polyethylene glycol polymer, optionally via a linker.
- the invention relates to an amylin polypeptide conjugate, which is a derivative of pramlintide with SEQ ID NO:88 or an analog thereof, wherein the amino acid residue in position 1 is absent (i.e., des-Lys 1 ) and wherein an amino acid residue in position 28 substituted with a lysine residue and wherein said lysine residue is linked to a polyethylene glycol polymer, optionally via a linker.
- the invention relates to an amylin polypeptide conjugate, which is a derivative of pramlintide with SEQ ID NO:88 or an analog thereof, wherein the amino acid residue in position 1 is absent (i.e., des-Lys 1 ) and wherein an amino acid residue in position 29 substituted with a lysine residue and wherein said lysine residue is linked to a polyethylene glycol polymer, optionally via a linker.
- the invention relates to an amylin polypeptide conjugate, which is a derivative of pramlintide with SEQ ID NO:88 or an analog thereof, wherein the amino acid residue in position 1 is absent (i.e., des-Lys 1 ) and wherein an amino acid residue in position 31 is substituted with a lysine residue and wherein said lysine residue is linked to a polyethylene glycol polymer, optionally via a linker.
- the duration enhancing moiety is a water-soluble polymer.
- a "water soluble polymer” means a polymer which is sufficiently soluble in water under physiologic conditions of e.g., temperature, ionic concentration and the like, as known in the art, to be useful for the methods described herein.
- a water soluble polymer can increase the solubility of a peptide or other biomolecule to which such water soluble polymer is attached. Indeed, such attachment has been proposed as a means for improving the circulating life, water solubility and/or antigenicity of administered proteins, in vivo. See e.g., U.S. Pat. No. 4,179,337; U.S. Published Appl. No. 2008/0032408.
- water-soluble polymers and attachment chemistries have been used towards this goal, such as polyethylene glycol, copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-l,3-dioxolane, poly-l,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and the like.
- polyethylene glycol copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-l,3-dioxolane, poly-l,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and the like.
- the linked duration enhancing moiety includes a polyethylene glycol.
- Polyethylene glycol (“PEG”) has been used in efforts to obtain therapeutically usable polypeptides. See e.g., Zalipsky, S., 1995, Bioconjugate Chemistry, 6: 150-165; Mehvar, R., 2000, J. Pharm. Pharmaceut. Sci., 3:125-136.
- PEG backbone (CH 2 CH 2 -0-) n , n: number of repeating monomers] is flexible and amphiphilic.
- the long, chain-like PEG molecule or moiety is believed to be heavily hydrated and in rapid motion when in an aqueous medium. This rapid motion is believed to cause the PEG to sweep out a large volume and prevents the approach and interference of other molecules.
- PEG polymer chains can protect such chemical entity from immune response and other clearance mechanisms.
- pegylation can lead to improved drug efficacy and safety by optimizing pharmacokinetics, increasing bioavailability, and decreasing immunogenicity and dosing frequency.
- “Pegylation” refers in the customary sense to conjugation of a PEG moiety with another compound.
- PEG polyethylene glycol polymer
- mPEG methoxy-PEG
- Typical attachment sites in proteins include primary amino groups, such as those on lysine residues or at the N-terminus, thiol groups, such as those on cysteine side-chains, and carboxyl groups, such as those on glutamate or aspartate residues or at the C-terminus. Common sites of attachment are to the sugar residues of glycoproteins, cysteines or to the N-terminus and lysines of the target polypeptide.
- pegylated and the like refer to covalent attachment of polyethylene glycol to a polypeptide or other biomolecule, optionally through a linker as described herein and/or as known in the art.
- a PEG moiety in an amylin polypeptide conjugate described herein has a nominal molecular weight within a specified range.
- the size of a PEG moiety is indicated by reference to the nominal molecular weight, typically provided in kilodaltons (kD).
- the molecular weight is calculated in a variety of ways known in the art, including number, weight, viscosity and "Z" average molecular weight. It is understood that polymers, such as PEG and the like, exist as a distribution of molecule weights about a nominal average value.
- the term "mPEG40KD" refers to a methoxy polyethylene glycol polymer having a nominal molecular weight of 40 kilodaltons. Reference to PEGs of other molecular weights follows this convention.
- the PEG moiety has a nominal molecular weight in the range 10-100 KD, 20-80 KD, 20-60 KD, or 20-40 KD.
- the PEG moiety has a nominal molecular weight of 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95 or even 100 KD.
- the PEG moiety has a molecular weight of 20, 25, 30, 40, 60 or 80 KD.
- PEG molecules useful for derivatization of polypeptides are typically classified into linear, branched and Warwick (i.e., PolyPEG®) classes of PEGs, as known in the art. Unless expressly indicated to the contrary, the PEG moieties described herein are linear PEGs.
- two arm branched refers to branched PEG moieties, as known in the art.
- a PEG moiety is attached to the backbone of the peptide.
- Cmpd 19 is the result of the conjugation of mPEG40KD to the N-terminal nitrogen of Cmpd 1.
- Cmpd 20 is the result of conjugation of mPEG40KD to the N-terminal nitrogen of Cmpd 2.
- Standard single letter abbreviations for amino acids can be used, as can standard three-letter abbreviations.
- Cmpd 24 is an analog of Cmpd 10 wherein the residue at position 26 of Cmpd 9 is substituted for lysine, and the pendant amine functionality of lysine 26 (i.e., K 26 ) is conjugated with a PEG40KD moiety.
- Exemplary compounds are provided in Table 2 below.
- the pharmaceutical compounds of the invention may be formulated with
- the chimeric polypeptides may be formulated into a stable, safe
- compositions contemplated for use in the methods of the invention may comprise approximately 0.01 to 1.0% (w/v), in certain cases 0.05 to 1.0%, of the chimeric polypeptide, approximately 0.02 to 0.5% (w/v) of an acetate, phosphate, citrate or glutamate buffer allowing a pH of the final composition of from about 3.0 to about 7.0; approximately 1.0 to 10% (w/v) of a carbohydrate or polyhydric alcohol tonicifier and, optionally, approximately 0.005 to 1.0% (w/v) of a preservative selected from the group consisting of m-cresol, benzyl alcohol, methyl, ethyl, propyl and butyl parabens and phenol. Such a preservative is generally included if the formulated peptide is to be included in a multiple use product.
- a pharmaceutical formulation of the present chimeric polypeptides may contain a range of concentrations of the compound(s), e.g., between about 0.01% to about 98%o w/w, or between about 1 to about 98%> w/w, or preferably between 80%> and 90%) w/w, or preferably between about 0.01% to about 50%> w/w, or more preferably between about 10% to about 25% w/w in these embodiments.
- a sufficient amount of water for injection may be used to obtain the desired concentration of solution.
- Additional tonicifying agents such as sodium chloride, as well as other known excipients, may also be present, if desired. In some cases, such excipients are useful in maintenance of the overall tonicity of the compound.
- An excipient may be included in the presently described formulations at various concentrations. For example, an excipient may be included in the concentration range from about 0.02% to about 20% w/w, preferably between about 0.02% and 0.5% w/w, about 0.02% to about 10% w/v, or about 1% to about 20% w/w.
- an excipient may be included in solid (including powdered), liquid, semi-solid or gel form.
- the pharmaceutical formulations may be composed in various forms, e.g., solid, liquid, semisolid or liquid.
- solid as used herein, is meant to encompass all normal uses of this term including, for example, powders and lyophilized formulations.
- the presently described formulations may be lyophilized.
- buffer when used with reference to hydrogen-ion concentration or pH, refer to the ability of a system, particularly an aqueous solution, to resist a change of pH on adding acid or alkali, or on dilution with a solvent.
- Characteristic of buffered solutions which undergo small changes of pH on addition of acid or base, is the presence either of a weak acid and a salt of the weak acid, or a weak base and a salt of the weak base.
- An example of the former system is acetic acid and sodium acetate.
- the change of pH is slight as long as the amount of hydronium or hydroxyl ion added does not exceed the capacity of the buffer system to neutralize it.
- a variety of liquid vehicles are suitable for use in the formulations of chimeric polypeptides, for example, water or an aqueous/organic solvent mixture or suspension.
- the stability of a chimeric polypeptide formulation for use as described herein is enhanced by maintaining the pH of the formulation in a range determined by methods known in the art.
- the pH of the formulation is maintained in the range of about 3.5 to 5.0, or about 3.5 to 6.5, in some embodiments from about 3.7 to 4.3, or about 3.8 to 4.2.
- pH may be about 4.0, about 5.0, about 6.0, about 7.0, about 8.0, about 9.0, or even higher.
- pH may be in the physiological range, pH 6-8, preferably pH 7-7.6.
- the buffer with the chimeric polypeptide is an acetate buffer (preferably at a final formulation concentration of from about 1-5 to about 60 mM), phosphate buffer (preferably at a final formulation concentration of from about 1-5 to about to about 30 mM) or glutamate buffer (preferably at a final formulation concentration of from about 1-5 to about to about 60 mM).
- the buffer is acetate (preferably at a final formulation concentration of from about 5 to about 30 mM).
- a stabilizer may be included in the formulations but is not necessarily needed. If included, however, a stabilizer useful in the practice of the present invention is a carbohydrate or a polyhydric alcohol.
- a suitable stabilizer useful in the practice of the present invention is approximately 1.0 to 10% (w/v) of a carbohydrate or polyhydric alcohol.
- the polyhydric alcohols and carbohydrates share the same feature in their backbones, i.e., -CHOH-CHOH-, which is responsible for stabilizing the proteins.
- the polyhydric alcohols include such compounds as sorbitol, mannitol, glycerol, and polyethylene glycols (PEGs). These compounds are straight-chain molecules.
- the carbohydrates such as mannose, ribose, sucrose, fructose, trehalose, maltose, inositol, and lactose, on the other hand, are cyclic molecules that may contain a keto or aldehyde group. These two classes of compounds have been demonstrated to be effective in stabilizing protein against denaturation caused by elevated temperature and by freeze-thaw or freeze-drying processes.
- Suitable carbohydrates include: galactose, arabinose, lactose or any other carbohydrate which does not have an adverse affect on a diabetic patient, i.e., the carbohydrate is not metabolized to form unacceptably large concentrations of glucose in the blood.
- Such carbohydrates are well known in the art as suitable for diabetics.
- Sucrose and fructose are suitable for use with the compound in non-diabetic applications (e.g. treating obesity).
- the compound is stabilized with a polyhydric alcohol such as sorbitol, mannitol, inositol, glycerol, xylitol, and
- mannitol is the preferred polyhydric alcohol in some embodiments.
- Another useful feature of the lyophilized formulations of the present invention is the maintenance of the tonicity of the lyophilized formulations described herein with the same formulation component that serves to maintain their stability.
- mannitol is the preferred polyhydric alcohol used for this purpose.
- USP United States Pharmacopeia
- bacteriostatic or fungistatic concentrations must be added to preparations contained in multiple dose containers. They must be present in adequate concentration at the time of use to prevent the multiplication of microorganisms inadvertently introduced into the preparation while
- Antimicrobial agents should be evaluated to ensure compatibility with all other components of the formula, and their activity should be evaluated in the total formula to ensure that a particular agent that is effective in one formulation is not ineffective in another. It is not uncommon to find that a particular antimicrobial agent will be effective in one formulation but not effective in another formulation.
- a preservative is, in the common pharmaceutical sense, a substance that prevents or inhibits microbial growth and may be added to pharmaceutical formulations for this purpose to avoid consequent spoilage of the formulation by microorganisms. While the amount of the preservative is not great, it may nevertheless affect the overall stability of the peptide.
- the preservative for use in the pharmaceutical compositions can range from 0.005 to 1.0% (w/v), in some embodiments range for each preservative, alone or in combination with others, is: benzyl alcohol (0.1-1.0%), or m-cresol (0.1-0.6%), or phenol (0.1-0.8%) or combination of methyl (0.05-0.25%) and ethyl or propyl or butyl (0.005%-0.03%) parabens.
- the parabens are lower alkyl esters of para-hydroxybenzoic acid.
- Chimeric polypeptides may not have a tendency to adsorb onto the glass in a glass container when in a liquid form, therefore, a surfactant may not be required to further stabilize the pharmaceutical formulation.
- a surfactant should be used in their formulation. These formulations may then be lyophilized. Surfactants frequently cause denaturation of protein, both of hydrophobic disruption and by salt bridge separation. Relatively low concentrations of surfactant may exert a potent denaturing activity, because of the strong interactions between surfactant moieties and the reactive sites on proteins. However, judicious use of this interaction can stabilize proteins against interfacial or surface denaturation.
- Surfactants which could further stabilize the chimeric polypeptide may optionally be present in the range of about 0.001 to 0.3% (w/v) of the total formulation and include polysorbate 80 (i.e., polyoxyethylene(20) sorbitan monooleate), CHAPS® (i.e., 3-[(3-cholamidopropyl) dimethylammonio] l-propanesulfonate), Brij® (e.g., Brij® 35, which is (polyoxyethylene (23) lauryl ether), poloxamer, or another non- ionic surfactant.
- polysorbate 80 i.e., polyoxyethylene(20) sorbitan monooleate
- CHAPS® i.e., 3-[(3-cholamidopropyl) dimethylammonio] l-propanesulfonate
- Brij® e.g., Brij® 35, which is (polyoxyethylene (23) lauryl ether), poloxamer, or another
- sodium chloride or other salt may also be desirable to add sodium chloride or other salt to adjust the tonicity of the pharmaceutical formulation, depending on the tonicifier selected. However, this is optional and depends on the particular formulation selected. Parenteral formulations preferably may be isotonic or substantially isotonic.
- a preferred vehicle for parenteral products is water.
- Water of suitable quality for parenteral administration can be prepared either by distillation or by reverse osmosis.
- Water for injection is the preferred aqueous vehicle for use in the pharmaceutical formulations.
- additional ingredients may include, e.g., wetting agents, emulsifiers, oils, antioxidants, bulking agents, tonicity modifiers, chelating agents, metal ions, oleaginous vehicles, proteins (e.g., human serum albumin, gelatin or proteins) and a zwitterion (e.g., an amino acid such as betaine, taurine, arginine, glycine, lysine and histidine).
- proteins e.g., human serum albumin, gelatin or proteins
- a zwitterion e.g., an amino acid such as betaine, taurine, arginine, glycine, lysine and histidine.
- polymer solutions, or mixtures with polymers provide the opportunity for controlled release of the peptide.
- Such additional ingredients should not adversely affect the overall stability of the pharmaceutical formulation of the present invention.
- Containers are also an integral part of the formulation of an injection and may be considered a component, for there is no container that is totally inert, or does not in some way affect the liquid it contains, particularly if the liquid is aqueous. Therefore, the selection of a container for a particular injection must be based on a consideration of the composition of the container, as well as of the solution, and the treatment to which it will be subjected. Adsorption of the peptide to the glass surface of the vial can also be minimized, if necessary, by use of borosilicate glass, for example, Wheaton Type I borosilicate glass #33 (Wheaton Type 1-33) or its equivalent (Wheaton Glass Co.).
- borosilicate glass for example, Wheaton Type I borosilicate glass #33 (Wheaton Type 1-33) or its equivalent (Wheaton Glass Co.).
- borosilicate glass vials and cartridges acceptable for manufacture include Kimbel Glass Co., West Co., Bunder Glas GMBH and Form a Vitrum.
- the biological and chemical properties of the compound may be stabilized by formulation and lyophilization in a Wheaton Type 1-33 borosilicate serum vial to a final concentration of 0.1 mg/ml and 10 mg/ml of the compound in the presence of 5% mannitol, and 0.02% Tween 80.
- each vial is preferably sealed with a rubber stopper closure held in place by an aluminum band.
- Stoppers for glass vials such as, West 4416/50, 4416/50 (Teflon faced) and 4406/40, Abbott 5139 or any equivalent stopper can be used as the closure for pharmaceutical for injection.
- these stoppers are compatible with the peptide as well as the other components of the formulation.
- the peptide can be lyophilized in to vials, syringes or cartridges for subsequent reconstitution.
- Liquid formulations of the present invention can be filled into one or two chambered cartridges, or one or two chamber syringes.
- Typical sterilization processes include filtration, steam (moist heat), dry heat, gases (e.g., ethylene oxide,
- Filtration is the preferred method of sterilization for liquid formulations of the present invention.
- the sterile filtration involves filtration through 0.45 um and 0.22 um (1 or 2) which may be connected in series. After filtration, the solution is filled into appropriate vials or containers.
- the chimeric polypeptides described herein are administered peripherally to the subjects.
- the liquid pharmaceutical formulations of the present invention are intended for parenteral administration. Suitable routes of administration include intramuscular, intravenous, subcutaneous, intradermal, intraarticular, intrathecal and the like.
- the subcutaneous route of administration is preferred.
- mucosal delivery is also preferred. These routes include, but are not limited to, oral, nasal, sublingual, pulmonary and buccal routes which may include administration of the peptide in liquid, semi-solid or solid form.
- parenteral controlled release delivery can be achieved by forming polymeric microcapsules, matrices, solutions, implants and devices and administering them parenterally or by surgical means. Examples of controlled release formulations are described in U.S. Pat. Nos. 6,368,630, 6,379,704, and 5,766,627, which are incorporated herein by reference. These dosage forms may have a lower bioavailability due to entrapment of some of the peptide in the polymer matrix or device. See e.g., U.S. Pat. Nos.
- the compounds may be provided in dosage unit form containing an amount of the chimeric polypeptide that will be effective in one or multiple doses.
- an effective amount of the chimeric polypeptide will vary with many factors including the age and weight of the subject, the subject's physical condition, the condition to be treated, and other factors known in the art.
- An effective amount of the chimeric polypeptides will also vary with the particular combination administered. As described herein, administration of the chimeric polypeptides in combination may allow for a reduced amount of any of the administered chimeric polypeptides to be an effective amount.
- compositions provided herein include compositions wherein the active ingredient is contained in a therapeutically effective amount, i.e., in an amount effective to achieve its intended purpose.
- the actual amount effective for a particular application will depend, inter alia, on the condition being treated. For example, when administered in methods to treat diabetes, such compositions will contain an amount of active ingredient effective to achieve the desired result (e.g. decreasing fasting blood glucose in a subject).
- compositions will contain an amount of active ingredient effective to achieve the desired result (e.g. decrease the body mass).
- the dosage and frequency (single or multiple doses) of compound administered can vary depending upon a variety of factors, including route of administration; size, age, sex, health, body weight, body mass index, and diet of the recipient; nature and extent of symptoms of the disease being treated (e.g., the disease responsive to compounds described herein); presence of other diseases or other health-related problems; kind of concurrent treatment; and complications from any disease or treatment regimen.
- Other therapeutic regimens or agents can be used in conjunction with the methods and compounds of the invention.
- Therapeutically effective amounts for use in humans may be determined from animal models. For example, a dose for humans can be formulated to achieve a concentration that has been found to be effective in animals. The dosage in humans can be adjusted by monitoring one or more physiological parameters, including but not limited to blood sugar and body mass, and adjusting the dosage upwards or downwards, as described above and known in the art. [0245] Dosages may be varied depending upon the requirements of the patient and the compound being employed. The dose administered to a patient, in the context of the present invention, should be sufficient to affect a beneficial therapeutic response in the patient over time. The size of the dose also will be determined by the existence, nature, and extent of any adverse side effects.
- the dosage range is 0.001% to 10% w/v. In another embodiment, the dosage range is 0.1 % to 5% w/v.
- typical doses may contain from a lower limit of about 0.1 mg to an upper limit of about 200 mg of the pharmaceutical compound per day. Also contemplated are other dose ranges such as 1 mg to 100 mg of the compound per dose, and 3 mg to 70 mg per dose.
- the doses per day may be delivered in discrete unit doses, or provided continuously in a 24 hour period or any portion of that the 24 hours.
- Dosage amounts and intervals can be adjusted individually to provide levels of the administered compound effective for the particular clinical indication being treated. This will provide a therapeutic regimen that is commensurate with the severity of the individual's disease state.
- an effective prophylactic or therapeutic treatment regimen can be planned that does not cause substantial toxicity and yet is entirely effective to treat the clinical symptoms demonstrated by the particular patient.
- This planning should involve the careful choice of active compound by considering factors such as compound potency, relative bioavailability, patient body weight, presence and severity of adverse side effects, preferred mode of administration, and the toxicity profile of the selected agent.
- the ratio between toxicity and therapeutic effect for a particular compound is its therapeutic index and can be expressed as the ratio between LD 50 (the amount of compound lethal in 50% of the population) and ED 50 (the amount of compound effective in 50% of the population).
- LD 50 the amount of compound lethal in 50% of the population
- ED 50 the amount of compound effective in 50% of the population.
- Compounds that exhibit high therapeutic indices are preferred.
- Therapeutic index data obtained from cell culture assays and/or animal studies can be used in formulating a range of dosages for use in humans.
- the dosage of such compounds preferably lies within a range of plasma concentrations that include the ED 50 with little or no toxicity.
- the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized. See, e.g.
- Protein sequences were designed and back translated using commercial software to DNA sequence for cloning into an E. coli expression vector. Sequences were either obtained as oligonucleotides and stitched together using standard PCR amplification techniques, or they were digested from existing expression constructs using standard restriction enzymes and then ligated back together. Sequences expressing the protein of interest were placed in pET45 with a T7 promoter for inducible expression. After constructs were verified by sequencing, the vector DNA was purified and transformed into an expression host, typically BL21(DE3). A single colony was selected to grow a starter culture in 4 ml LB media for ⁇ 6 hrs.
- Glycerol stocks were prepared by adding lOOul 80% glycerol to 900ul stock and store at -80C. Optionally, 500 ul uninduced sample was retained for gel analysis. A 60 ml culture (magic media) was inoculated using 60ul starter culture in a 125ml Thompson flask and incubated @ 30C overnight. Remove 250 ul sample for analysis. Spin down and freeze cell pellet for later processing.
- Bacterial cells were harvested and subsequently lysed to isolate inclusion bodies. Since the protein was present in the inclusion bodies, these were solubilized and the protein refolded at 4C. Proteins were then separated using size exclusion chromatography until only a single band remained and endotoxin levels were acceptable for in vivo testing. Analytical HPLC, RP-LC-MS and SDS-PAGE gel were run as quality control measures on the final protein. Protein was distributed to predetermined aliquots and stored at -80C.
- Example 2 Biological and pharmaceutical properties
- chimeric polypeptides described herein have comparable, and some even superior, properties compared with A100 (Compound 37, SEQ ID NO:24). These properties include biological properties such as leptin binding activity, leptin functional activity, and food intake in mice, and pharmaceutical properties such as solubility in neutral pH.
- Solubility was measured with the following assay: proteins were concentrated at 4C, spun to remove precipitates, then allowed to equilibrate at room temperature overnight. They were filtered to remove precipitates and then the concentration was determined by measuring absorbance at OD280 and using the theoretical molar extinction coefficient.
- chimeric polypeptides described herein have comparable, and some even superior, physical stability compared with A100 (Compound 37, SEQ ID NO:24).
- HPLC reverse phase high performance liquid chromatography
- UV spectrometry UV spectrometry
- DLS dynamic light scattering
- the dose responses measured for chimeric polypeptides of the invention are comparable to the dose responses measured for the seal leptin (Cmpd 38) and human leptin (Cmpd 37) from which the chimeric polypeptides are derived.
- Embodiment 1 A chimeric polypeptide comprising a wild type seal leptin polypeptide wherein at least one contiguous region of 1-30 amino acids of a wild type seal leptin sequence has been replaced with a contiguous region of 1-30 amino acids of a mature human leptin sequence.
- Embodiment 2 The chimeric polypeptide according to Embodiment 1, wherein two or more contiguous regions of 1-30 amino acids of a wild type seal leptin sequence have been replaced at each region with a contiguous region of 1-30 amino acids of a mature human leptin sequence.
- Embodiment 3 The chimeric polypeptide according to Embodiment 1 or 2, wherein a wild type seal leptin sequence comprises the amino acid sequence of SEQ ID NO:28 or SEQ ID NO:31.
- Embodiment 4 The chimeric polypeptide according to any one of Embodiments 1- 3, wherein a mature human leptin sequence comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, and SEQ ID NO:51.
- Embodiment 5 The chimeric polypeptide of any one of Embodiments 1-4, wherein a mature human leptin sequence comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, and SEQ ID NO:51, wherein the mature human leptin
- Embodiment 6 The chimeric polypeptide of any one of Embodiments 1-5, wherein a mature human leptin sequence comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, and SEQ ID NO:51, wherein the mature human leptin
- Embodiment 7 The chimeric polypeptide of any one of Embodiments 1-6, wherein a mature human leptin sequence comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, and SEQ ID NO:51, wherein the mature human leptin
- Embodiment 8 The chimeric polypeptide of any one of Embodiments 1-7, wherein a mature human leptin sequence comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, and SEQ ID NO:51, wherein the mature human leptin
- Embodiment 9 The chimeric polypeptide of any one of Embodiments 1-8, wherein a mature human leptin sequence comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, and SEQ ID NO:51, wherein the mature human leptin
- Embodiment 10 The chimeric polypeptide of any one of Embodiments 1-9, wherein a mature human leptin sequence comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, and SEQ ID NO:51, wherein the mature human leptin
- Embodiment 11 The chimeric polypeptide of any one of Embodiments 1-10, wherein a mature human leptin sequence comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, and SEQ ID NO:51, wherein the mature human leptin
- Embodiment 12 The chimeric polypeptide of any one of Embodiments 1-11, wherein a mature human leptin sequence comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, and SEQ ID NO:51, wherein the mature human leptin
- Embodiment 13 The chimeric polypeptide of any one of Embodiments 1-12, wherein a mature human leptin sequence comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, and SEQ ID NO:51, wherein the mature human leptin
- Embodiment 14 The chimeric polypeptide of any one of Embodiments 1-13, wherein a mature human leptin sequence comprises an amino acid sequence selected from the group consisting of: SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, and SEQ ID NO:51, wherein the mature human leptin
- Embodiment 16 The chimeric polypeptide of any one of Embodiments 1-15, wherein the chimeric polypeptide comprises an amino acid sequence with at least 80% identity with an amino acid sequence selected from the group consisting of: SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:33, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:71, SEQ ID NO:72, SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:75
- Embodiment 17 The chimeric polypeptide of any one of Embodiments 1-16, wherein the chimeric polypeptide comprises an amino acid sequence with at least 80% identity with an amino acid sequence selected from the group consisting of: SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:33.
- Embodiment 18 The chimeric polypeptide of any one of Embodiments 1-17, wherein the chimeric polypeptide comprises an amino acid sequence with at least 80% identity the amino acid sequence of SEQ ID NO:33.
- Embodiment 19 The chimeric polypeptide of any one of Embodiments 1-18, wherein the chimeric polypeptide comprises an amino acid sequence with at least 90% identity the amino acid sequence of SEQ ID NO:33.
- Embodiment 20 The chimeric polypeptide of any one of Embodiments 1-19, wherein the chimeric polypeptide comprises an amino acid sequence selected from the group consisting of: SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:33, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:71, SEQ ID NO:72, SEQ ID NO:73, SEQ ID NO:74, SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:
- Embodiment 21 The chimeric polypeptide of any one of Embodiments 1-20, wherein the chimeric polypeptide comprises an amino acid sequence selected from the group consisting of: SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:32, SEQ ID NO:33.
- Embodiment 22 The chimeric polypeptide of any one of Embodiments 1-21, wherein the chimeric polypeptide comprises the amino acid sequence of SEQ ID NO:29.
- Embodiment 23 The chimeric polypeptide of any one of Embodiments 1-21, wherein the chimeric polypeptide comprises the amino acid sequence of SEQ ID NO:30.
- Embodiment 24 The chimeric polypeptide of any one of Embodiments 1-21, wherein the chimeric polypeptide comprises the amino acid sequence of SEQ ID NO:32.
- Embodiment 25 The chimeric polypeptide of any one of Embodiments 1-21, wherein the chimeric polypeptide comprises the amino acid sequence of SEQ ID NO:33.
- Embodiment 26 A method for treating a disease or disorder in a subject, comprising administering a chimeric polypeptide of any one of Embodiments 1 to 25 to a subject in need thereof in an amount effective to treat said disease or disorder.
- Embodiment 27 The method according to Embodiment 26, wherein the disease or disorder is disease or disorder is selected from the group consisting of: lipodystrophy, dyslipidemia, hyperlipidemia, overweight, obesity, hypothalamic amenorrhea, Alzheimer's disease, leptin deficiency, fatty liver disease, diabetes (including type I and type II), nonalcoholic steatohepatitis (NASH), nonalcoholic fatty liver disease (NAFLD), metabolic syndrome X and Huntington's Disease.
- the disease or disorder is disease or disorder is selected from the group consisting of: lipodystrophy, dyslipidemia, hyperlipidemia, overweight, obesity, hypothalamic amenorrhea, Alzheimer's disease, leptin deficiency, fatty liver disease, diabetes (including type I and type II), nonalcoholic steatohepatitis (NASH), nonalcoholic fatty liver disease (NAFLD), metabolic syndrome X and Huntington's Disease.
- Embodiment 28 The method of Embodiment 26 or Embodiment 27, wherein the disease or disorder is lipodystrophy, dyslipidemia, hyperlipidemia, overweight, obesity, hypothalamic amenorrhea, Alzheimer's disease, leptin deficiency, fatty liver disease or diabetes.
- Embodiment 29 The method of any one of Embodiments 26-28, wherein the disease or disorder is type I diabetes or type II diabetes.
- Embodiment 30 The method of any one of Embodiments 26-28, wherein the disease or disorder is obesity.
- Embodiment 31 The method of any one of Embodiments 26-28, wherein the disease or disorder is lipodystrophy or leptin deficiency.
- Embodiment 32 A pharmaceutical composition comprising a chimeric polypeptide according to any one of Embodiments 1-25 and a pharmaceutically acceptable excipient.
- Xaa at position 28 is T or A ; and Xaa at position 29 is Q or absent (SEQ ID NO: 13).
- VPIQKVQDDTKTLIKTIVTRINDISHASVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQ QILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYS TEWALSRLQGSLQDMLWQLDLSPGC SEQ ID NO:23.
- MPIQRVQDDTKTLIKTIITRINDISPPQGVCSRPRVAGLDFIPRVQSVRTLSGMDQILATYQ QILTSLQSRSWQIANDLANLRALLRLLASAKSCPVPRARGSDTIKGLGNVLRASVHS TEWALSRLKAALQDMLRQLDRNPGC SEQ ID NO:31.
- MPIQRVQDDTKTLIKTIITRINDISPPQGVCSRPRVAGLDFIPRVQSVRTLSGMDQILATYQ QILTSLQSRNVIQISNDLENLRDLLHVLAFSKSCPVPRARGSDTIKGLGNVLRASVHST EWALSRLKAALQDMLRQLDRNPGC SEQ ID NO:32.
- MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAV YQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCSLPQASGLETLDSLGEVLEASG YSTEWALSRLQGSLQDILQQLDLSPEC SEQ ID NO: 40).
- MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAV YQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCSLPQTSGLETLDSLGGVLEASG YSTEWALSRLQGSLQDILQQLDVSPEC (SEQ ID NO: 48).
- MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAV YQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCSLPQTSGLETLDSLGEVLEASGY STEWALSRLQGSLQDMLWQLDLSPEC (SEQ ID NO: 49).
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Gastroenterology & Hepatology (AREA)
- Endocrinology (AREA)
- Obesity (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Diabetes (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Child & Adolescent Psychology (AREA)
- Hematology (AREA)
- Reproductive Health (AREA)
- Biomedical Technology (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Hospice & Palliative Care (AREA)
- Gynecology & Obstetrics (AREA)
- Pregnancy & Childbirth (AREA)
- Psychiatry (AREA)
- Psychology (AREA)
- Emergency Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (15)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DK11833075.2T DK2621515T3 (en) | 2010-09-28 | 2011-09-28 | Chimeric seal-human leptin polypeptide with increased solubility |
| EP17163203.7A EP3241558B1 (en) | 2010-09-28 | 2011-09-28 | Highly soluble leptins |
| MX2013003472A MX349054B (es) | 2010-09-28 | 2011-09-28 | Leptinas altamente solubles. |
| JP2013531786A JP6174489B2 (ja) | 2010-09-28 | 2011-09-28 | 高可溶性レプチン |
| ES11833075.2T ES2630031T3 (es) | 2010-09-28 | 2011-09-28 | Un polipéptido de leptina pinnípedo-humano quimérico con solubilidad aumentada |
| BR122021020041-6A BR122021020041B1 (pt) | 2010-09-28 | 2011-09-28 | Polipeptídeo quimérico, seu uso e composição que o compreende |
| PL17163203T PL3241558T3 (pl) | 2010-09-28 | 2011-09-28 | Wysoce rozpuszczalne leptyny |
| EA201390474A EA024507B1 (ru) | 2010-09-28 | 2011-09-28 | Хорошо растворимые лептины |
| CA2813038A CA2813038C (en) | 2010-09-28 | 2011-09-28 | Highly soluble leptins |
| BR112013007385-3A BR112013007385B1 (pt) | 2010-09-28 | 2011-09-28 | Polipeptídeo quimérico, seu uso e composição que o compreende |
| CN201180056939.4A CN103547590B (zh) | 2010-09-28 | 2011-09-28 | 高度可溶性瘦蛋白 |
| EP11833075.2A EP2621515B1 (en) | 2010-09-28 | 2011-09-28 | A chimeric seal-human leptin polypeptide with increased solubility |
| US13/852,521 US20130203661A1 (en) | 2010-09-28 | 2013-03-28 | Highly soluble leptins |
| US14/703,523 US10087228B2 (en) | 2010-09-28 | 2015-05-04 | Chimeric leptin polypeptide and method of using the same |
| CY20171100690T CY1119023T1 (el) | 2010-09-28 | 2017-06-28 | Ενα χιμαιρικο πολυπεπτιδιο λεπτινης φωκιας - ανθρωπου με αυξημενη διαλυτοτητα |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US38740210P | 2010-09-28 | 2010-09-28 | |
| US61/387,402 | 2010-09-28 | ||
| US42209110P | 2010-12-10 | 2010-12-10 | |
| US61/422,091 | 2010-12-10 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US13/852,521 Continuation US20130203661A1 (en) | 2010-09-28 | 2013-03-28 | Highly soluble leptins |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2012050925A2 true WO2012050925A2 (en) | 2012-04-19 |
| WO2012050925A3 WO2012050925A3 (en) | 2012-07-05 |
Family
ID=45938879
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2011/053774 Ceased WO2012050925A2 (en) | 2010-09-28 | 2011-09-28 | Highly soluble leptins |
| PCT/US2011/053786 Ceased WO2012050930A2 (en) | 2010-09-28 | 2011-09-28 | Engineered polypeptides having enhanced duration of action |
Family Applications After (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2011/053786 Ceased WO2012050930A2 (en) | 2010-09-28 | 2011-09-28 | Engineered polypeptides having enhanced duration of action |
Country Status (14)
| Country | Link |
|---|---|
| US (6) | US20130274182A1 (enExample) |
| EP (4) | EP2621515B1 (enExample) |
| JP (5) | JP6174489B2 (enExample) |
| CN (2) | CN103403019B (enExample) |
| BR (3) | BR122021020041B1 (enExample) |
| CA (3) | CA2813087C (enExample) |
| CY (2) | CY1119023T1 (enExample) |
| DK (3) | DK2621515T3 (enExample) |
| EA (2) | EA024507B1 (enExample) |
| ES (3) | ES2641869T3 (enExample) |
| MX (2) | MX351128B (enExample) |
| PL (1) | PL3241558T3 (enExample) |
| PT (2) | PT2621515T (enExample) |
| WO (2) | WO2012050925A2 (enExample) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016034604A1 (en) * | 2014-09-04 | 2016-03-10 | Novo Nordisk A/S | Novel amylin and calcitonin receptor agonist |
| WO2018049424A1 (en) | 2016-09-12 | 2018-03-15 | Aegerion Pharmaceuticals, Inc. | Methods of detecting anti-leptin neutralizing antibodies |
| US11535659B2 (en) | 2010-09-28 | 2022-12-27 | Amryt Pharmaceuticals Inc. | Engineered polypeptides having enhanced duration of action |
Families Citing this family (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN110437321A (zh) | 2010-07-09 | 2019-11-12 | 阿菲博迪公司 | 多肽 |
| DK2729160T3 (da) | 2011-07-08 | 2019-07-01 | Aegerion Pharmaceuticals Inc | Manipulerede polypeptider, der har forbedret virkningstid og reduceret immunogenicitet |
| US20150133373A1 (en) * | 2012-03-28 | 2015-05-14 | Amylin Pharmaceuticals, Llc | Transmucosal delivery of engineered polypeptides |
| JP6590695B2 (ja) * | 2012-09-25 | 2019-10-16 | アフィボディ・アーベー | アルブミン結合ポリペプチド |
| JP2016519108A (ja) | 2013-04-18 | 2016-06-30 | アルモ・バイオサイエンシーズ・インコーポレイテッド | インターロイキン−10を疾病及び疾患の治療に用いる方法 |
| WO2014204816A2 (en) | 2013-06-17 | 2014-12-24 | Armo Biosciences, Inc. | Method for assessing protein identity and stability |
| CA2920679A1 (en) | 2013-08-30 | 2015-03-05 | Armo Biosciences, Inc. | Methods of using interleukin-10 for treating diseases and disorders |
| CN105848674A (zh) | 2013-11-11 | 2016-08-10 | 阿尔莫生物科技股份有限公司 | 将白细胞介素-10用于治疗疾病和病症的方法 |
| WO2015091957A1 (en) | 2013-12-20 | 2015-06-25 | Affibody Ab | Engineered albumin binding polypeptide |
| US10293043B2 (en) | 2014-06-02 | 2019-05-21 | Armo Biosciences, Inc. | Methods of lowering serum cholesterol |
| CA2963989A1 (en) | 2014-10-14 | 2016-04-21 | Armo Biosciences, Inc. | Interleukin-15 compositions and uses thereof |
| CN107106655A (zh) | 2014-10-22 | 2017-08-29 | 阿尔莫生物科技股份有限公司 | 使用白细胞介素‑10治疗疾病和病症的方法 |
| WO2016126615A1 (en) | 2015-02-03 | 2016-08-11 | Armo Biosciences, Inc. | Methods of using interleukin-10 for treating diseases and disorders |
| CN107847583A (zh) | 2015-05-28 | 2018-03-27 | 阿尔莫生物科技股份有限公司 | 用于治疗癌症的聚乙二醇化白细胞介素‑10 |
| CN108137653B (zh) * | 2015-08-05 | 2021-07-13 | 陕西麦科奥特科技有限公司 | 有抗凝血和抗血小板活性的多靶点化合物及制法和用途 |
| US10286079B2 (en) | 2015-09-22 | 2019-05-14 | The Regents Of The University Of California | Modified cytotoxins and their therapeutic use |
| AU2016326392B2 (en) | 2015-09-22 | 2021-02-11 | The Regents Of The University Of California | Modified cytotoxins and their therapeutic use |
| BR112018006263A2 (pt) | 2015-10-02 | 2018-10-16 | Memorial Sloan Kettering Cancer Center | inibidor de tonsl, molécula pequena, uso de uma molécula pequena ou de um inibidor, cristal tridimensional, métodos para selecionar ou desenhar uma molécula pequena, para identificar um inibidor de ligação de ard de tonsl à histona h4, para predizer o efeito de inibição de tonsl e para identificar um inibidor de tonsl e/ou determinar o efeito inibitório de um inibidor putativo de tonsl, sequência de polinucleotídeo ou sequência de aminoácidos isolada, e, polipeptídeo mutante de tonsl. |
| KR20230173731A (ko) * | 2017-01-30 | 2023-12-27 | 알렉시온 파마슈티칼스, 인코포레이티드 | 1가 항-프로페르딘 항체 및 항체 단편 |
| JP2021520822A (ja) * | 2018-04-13 | 2021-08-26 | マサチューセッツ インスティテュート オブ テクノロジー | 毛髪の修復および長期にわたる色の保持のための改変された処置 |
| EP3711772A1 (en) * | 2019-03-20 | 2020-09-23 | Oslo Universitetssykehus HF | Recombinant proteins and fusion proteins |
| WO2023049357A2 (en) * | 2021-09-24 | 2023-03-30 | The Uab Research Foundation | Control of subunit stoichiometry in single-chain msp nanopores |
| US12466883B1 (en) * | 2024-05-13 | 2025-11-11 | Lumen Bioscience, Inc. | Leptin compositions and methods of making and using the same to support weight loss and/or maintenance |
Citations (39)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4002531A (en) | 1976-01-22 | 1977-01-11 | Pierce Chemical Company | Modifying enzymes with polyethylene glycol and product produced thereby |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| WO1983004053A1 (en) | 1982-05-06 | 1983-11-24 | Applied Molecular Genetics, Inc. | The manufacture and expression of large structural genes |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| WO1996005309A2 (en) | 1994-08-17 | 1996-02-22 | The Rockefeller University | Modulators of body weight, corresponding nucleic acids and proteins, and diagnostic and therapeutic uses thereof |
| WO1996023517A1 (en) | 1995-01-31 | 1996-08-08 | Eli Lilly And Company | Anti-obesity proteins |
| US5552523A (en) | 1995-01-31 | 1996-09-03 | Eli Lilly And Company | Anti-obesity proteins |
| US5554727A (en) | 1995-01-31 | 1996-09-10 | Eli Lilly And Company | Anti-obesity proteins |
| US5559208A (en) | 1995-01-31 | 1996-09-24 | Eli Lilly And Company | Anti-obesity proteins |
| US5580954A (en) | 1995-01-31 | 1996-12-03 | Eli Lilly And Company | Anti-obesity proteins |
| US5594101A (en) | 1995-03-03 | 1997-01-14 | Eli Lilly And Company | Anti-obesity proteins |
| WO1997002004A2 (en) | 1995-06-30 | 1997-01-23 | Eli Lilly And Company | Methods for treating diabetes |
| US5686411A (en) | 1991-03-08 | 1997-11-11 | Amylin Pharmaceuticals, Inc. | Amylin agonist peptides and uses therefor |
| US5691309A (en) | 1995-01-31 | 1997-11-25 | Eli Lilly And Company | Anti-obesity proteins |
| WO1998012224A1 (en) | 1996-09-20 | 1998-03-26 | Hoechst Aktiengesellschaft | Use of leptin antagonists for treating insulin resistance in type ii diabetes |
| US5766627A (en) | 1993-11-16 | 1998-06-16 | Depotech | Multivescular liposomes with controlled release of encapsulated biologically active substances |
| WO1998028427A1 (en) | 1996-12-20 | 1998-07-02 | Amgen Inc. | Ob fusion protein compositions and methods |
| US5824784A (en) | 1994-10-12 | 1998-10-20 | Amgen Inc. | N-terminally chemically modified protein compositions and methods |
| WO1998055139A1 (en) | 1997-06-06 | 1998-12-10 | Smithkline Beecham Plc | Use of leptin antagonists for the treatment of diabetes |
| US5851995A (en) | 1995-01-31 | 1998-12-22 | Eli Lilly And Company | Anti-obesity proteins |
| US6296842B1 (en) | 2000-08-10 | 2001-10-02 | Alkermes Controlled Therapeutics, Inc. | Process for the preparation of polymer-based sustained release compositions |
| US6368630B1 (en) | 1992-03-12 | 2002-04-09 | Alkermes Controlled Therapeutics, Inc. | Modulated release from biocompatible polymers |
| US6379703B1 (en) | 1998-12-30 | 2002-04-30 | Alkermes Controlled Therapeutics Inc., Ii | Preparation of microparticles having a selected release profile |
| US6379704B2 (en) | 2000-05-19 | 2002-04-30 | Alkermes Controlled Therapeutics Inc. Ii | Method for preparing microparticles having a selected polymer molecular weight |
| WO2004039832A2 (en) | 2002-10-31 | 2004-05-13 | Albany Medical College | Leptin-related peptides |
| US6872700B1 (en) | 1999-01-14 | 2005-03-29 | Amylin Pharmaceuticals, Inc. | Methods for glucagon suppression |
| WO2006083254A1 (en) | 2004-02-11 | 2006-08-10 | Amylin Pharmaceuticals, Inc. | Amylin family peptides and methods for making and using them |
| US20070020284A1 (en) | 1995-11-22 | 2007-01-25 | Amgen, Inc. | OB fusion protein compositions and methods |
| US7183254B2 (en) | 2001-10-22 | 2007-02-27 | Amgen, Inc. | Use of leptin for treating human lipoatrophy and method of determining predisposition to said treatment |
| WO2007114838A1 (en) | 2006-03-31 | 2007-10-11 | Amylin Pharmaceuticals, Inc. | Amylin and amylin agonists for treating psychiatric diseases and disorders |
| US20070238669A1 (en) | 2006-01-11 | 2007-10-11 | Bristol-Myers Squibb Company | Human glucagon-like-peptide-1 modulators and their use in the treatment of diabetes related conditions |
| WO2007140284A2 (en) | 2006-05-26 | 2007-12-06 | Bristol-Myers Squibb Company | N-terminally modified glp-1 receptor modulators |
| WO2007139941A2 (en) | 2006-05-26 | 2007-12-06 | Amylin Pharmaceuticals, Inc. | Composition and methods for treatment of congestive heart failure |
| US20080032408A1 (en) | 2000-04-06 | 2008-02-07 | Affymetrix, Inc. | Tag Nucleic Acids and Probe Arrays |
| WO2008082274A1 (en) | 2007-01-05 | 2008-07-10 | Hanmi Pharmaceutical Co., Ltd. | An insulinotropic complex using an immunoglobulin fragment |
| US20080176804A1 (en) | 2004-03-04 | 2008-07-24 | Amylin Pharmaceuticals, Inc. | Methods for Affecting Body Composition |
| US20080207512A1 (en) | 2004-11-01 | 2008-08-28 | Amylin Pharmaceuticals, Inc. | Methods for Treating Obesity and Obesity Related and Disorders |
| WO2009011544A2 (en) | 2007-07-16 | 2009-01-22 | Hanmi Pharmaceutical Co., Ltd. | Insulinotropic peptide derivative wherein its n-terminal amino acid is modified |
| WO2009064298A1 (en) | 2007-11-14 | 2009-05-22 | Amylin Pharmaceuticals, Inc. | Methods for treating obesity and obesity related diseases and disorders |
Family Cites Families (117)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4572208A (en) | 1983-06-29 | 1986-02-25 | Utah Medical Products, Inc. | Metabolic gas monitoring apparatus and method |
| KR850004274A (ko) | 1983-12-13 | 1985-07-11 | 원본미기재 | 에리트로포이에틴의 제조방법 |
| US4703008A (en) | 1983-12-13 | 1987-10-27 | Kiren-Amgen, Inc. | DNA sequences encoding erythropoietin |
| NZ210501A (en) | 1983-12-13 | 1991-08-27 | Kirin Amgen Inc | Erythropoietin produced by procaryotic or eucaryotic expression of an exogenous dna sequence |
| US6319685B1 (en) | 1984-09-27 | 2001-11-20 | Unigene Laboratories, Inc. | Alpha-amidating enzyme compositions and processes for their production and use |
| FI78231C (fi) | 1984-11-21 | 1989-07-10 | Instrumentarium Oy | Maetanordning foer metaboliska storheter anslutbar till en respirator. |
| US4695463A (en) | 1985-05-24 | 1987-09-22 | Warner-Lambert Company | Delivery system for active ingredients and preparation thereof |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| US4810643A (en) | 1985-08-23 | 1989-03-07 | Kirin- Amgen Inc. | Production of pluripotent granulocyte colony-stimulating factor |
| JPS63500636A (ja) | 1985-08-23 | 1988-03-10 | 麒麟麦酒株式会社 | 多分化能性顆粒球コロニー刺激因子をコードするdna |
| US4904584A (en) | 1987-12-23 | 1990-02-27 | Genetics Institute, Inc. | Site-specific homogeneous modification of polypeptides |
| US5075222A (en) | 1988-05-27 | 1991-12-24 | Synergen, Inc. | Interleukin-1 inhibitors |
| US5166322A (en) | 1989-04-21 | 1992-11-24 | Genetics Institute | Cysteine added variants of interleukin-3 and chemical modifications thereof |
| AU6541090A (en) | 1989-10-16 | 1991-05-16 | Amgen, Inc. | Stem cell factor |
| US5372808A (en) | 1990-10-17 | 1994-12-13 | Amgen Inc. | Methods and compositions for the treatment of diseases with consensus interferon while reducing side effect |
| ATE169031T1 (de) | 1991-04-05 | 1998-08-15 | Univ Washington | Zellrezeptor spezifische monoklonale antikörper gegen stammzell-faktor-rezeptor |
| NZ244778A (en) | 1991-10-21 | 1994-03-25 | Ortho Pharma Corp | Peg imidates and protein derivatives thereof |
| US5581476A (en) | 1993-01-28 | 1996-12-03 | Amgen Inc. | Computer-based methods and articles of manufacture for preparing G-CSF analogs |
| US6288030B1 (en) | 1993-12-22 | 2001-09-11 | Amgen Inc. | Stem cell factor formulations and methods |
| US6048837A (en) | 1994-08-17 | 2000-04-11 | The Rockefeller University | OB polypeptides as modulators of body weight |
| US6001968A (en) | 1994-08-17 | 1999-12-14 | The Rockefeller University | OB polypeptides, modified forms and compositions |
| US5827734A (en) | 1995-01-20 | 1998-10-27 | University Of Washington | Materials and methods for determining ob protein in a biological sample |
| US5569744A (en) | 1995-01-31 | 1996-10-29 | Eli Lilly And Company | Anti-obesity proteins |
| US5525705A (en) | 1995-01-31 | 1996-06-11 | Eli Lilly And Company | Anti-obesity proteins |
| US5567803A (en) | 1995-01-31 | 1996-10-22 | Eli Lilly And Company | Anti-obesity proteins |
| US5569743A (en) | 1995-01-31 | 1996-10-29 | Eli Lilly And Company | Anti-obesity proteins |
| US5563243A (en) | 1995-01-31 | 1996-10-08 | Eli Lilly And Company | Anti-obesity proteins |
| US5552524A (en) | 1995-01-31 | 1996-09-03 | Eli Lilly And Company | Anti-obesity proteins |
| US5563244A (en) | 1995-01-31 | 1996-10-08 | Eli Lilly And Company | Anti-obesity proteins |
| US5563245A (en) | 1995-01-31 | 1996-10-08 | Eli Lilly And Company | Anti-obesity proteins |
| US5552522A (en) | 1995-01-31 | 1996-09-03 | Eli Lilly And Company | Anti-obesity proteins |
| CA2211656A1 (en) | 1995-01-31 | 1996-08-08 | Margret B. Basinski | Anti-obesity proteins |
| AU4766596A (en) | 1995-01-31 | 1996-08-21 | Eli Lilly And Company | Ob gene product antibodies |
| US5594104A (en) | 1995-01-31 | 1997-01-14 | Eli Lilly And Company | Anti-obesity proteins |
| US5532336A (en) | 1995-01-31 | 1996-07-02 | Eli Lilly And Company | Anti-obesity proteins |
| US5574133A (en) | 1995-01-31 | 1996-11-12 | Eli Lilly And Company | Anti-obesity proteins |
| US5567678A (en) | 1995-01-31 | 1996-10-22 | Eli Lilly And Company | Anti-obesity proteins |
| US5521283A (en) | 1995-01-31 | 1996-05-28 | Eli Lilly And Company | Anti-obesity proteins |
| US5719266A (en) | 1995-03-17 | 1998-02-17 | Eli Lilly And Company | Anti-obesity proteins |
| EP0736599A3 (en) | 1995-04-03 | 1996-12-11 | Takeda Chemical Industries Ltd | The rat obesity gene, its gene product and its production |
| AU5539596A (en) | 1995-04-06 | 1996-10-23 | Amylin Pharmaceuticals, Inc. | Anti-obesity agents |
| US5840517A (en) * | 1995-04-26 | 1998-11-24 | Eli Lilly And Company | Process for preparing obesity protein analogs |
| US5614379A (en) | 1995-04-26 | 1997-03-25 | Eli Lilly And Company | Process for preparing anti-obesity protein |
| GB9509164D0 (en) | 1995-05-05 | 1995-06-28 | Smithkline Beecham Plc | Novel compounds |
| ES2093593T1 (es) | 1995-05-05 | 1997-01-01 | Hoffmann La Roche | Proteinas obesas (ob) recombinantes. |
| WO1996035787A1 (en) | 1995-05-08 | 1996-11-14 | Chiron Corporation | Nucleic acids for treating obesity |
| JP2001501906A (ja) | 1995-05-26 | 2001-02-13 | イーライ・リリー・アンド・カンパニー | Rhesus obタンパク質およびdna |
| WO1996040912A1 (en) | 1995-06-07 | 1996-12-19 | Amgen Inc. | Ob protein compositions and method |
| US5581005A (en) | 1995-06-16 | 1996-12-03 | The Procter & Gamble Company | Method for manufacturing cobalt catalysts |
| AU6284896A (en) | 1995-06-22 | 1997-01-22 | Eli Lilly And Company | Obesity protein intermediates and their preparation and use |
| GB2302559B (en) | 1995-06-23 | 1998-06-03 | Draftex Ind Ltd | Opening arrangements and methods for closure members |
| DE69632684T2 (de) | 1995-06-27 | 2005-06-09 | Takeda Pharmaceutical Co. Ltd. | Verfahren zur herstellung von zubereitungen mit verzögerter freisetzung |
| EP0865294B1 (en) | 1995-08-17 | 2004-02-18 | Amgen Inc. | Methods of reducing or maintaining reduced levels of blood lipids using ob protein compositions |
| WO1997016550A1 (en) | 1995-11-02 | 1997-05-09 | Bristol-Myers Squibb Company | Polypeptide fragments derived from the obese gene product |
| ES2217327T3 (es) | 1995-11-22 | 2004-11-01 | Amgen Inc., | Proteina ob para aumentar la masa de tejido magro. |
| AU1406497A (en) | 1995-12-06 | 1997-06-27 | Schering Corporation | Mutational variants of mammalian ob gene proteins |
| US6369027B1 (en) | 1995-12-22 | 2002-04-09 | Amgen Inc. | Osteoprotegerin |
| GB9526733D0 (en) * | 1995-12-30 | 1996-02-28 | Delta Biotechnology Ltd | Fusion proteins |
| EP0877627A1 (en) | 1996-01-25 | 1998-11-18 | Eli Lilly And Company | Obesity protein analog compounds and formulations thereof |
| US6013009A (en) | 1996-03-12 | 2000-01-11 | Karkanen; Kip Michael | Walking/running heart rate monitoring system |
| WO1997038014A1 (en) | 1996-04-04 | 1997-10-16 | Amgen Inc. | Fibulin pharmaceutical compositions and related methods |
| US6025324A (en) | 1996-05-15 | 2000-02-15 | Hoffmann-La Roche Inc. | Pegylated obese (ob) protein compositions |
| AR008765A1 (es) | 1996-06-06 | 2000-02-23 | Smithkline Beecham Plc | Un peptido o un derivado, analogo o variante, funcional del mismo, un peptido recombinante o sintetico del mismo, una secuencia nucleotidica y vectorque la contiene, una celula huesped transformada, un procedimiento para su preparacion, una composicion farmaceutica que lo comprende, un compuesto del |
| US5922678A (en) | 1996-06-28 | 1999-07-13 | Eli Lilly And Company | Methods for treating diabetes |
| JP2001501177A (ja) | 1996-08-30 | 2001-01-30 | アムジエン・インコーポレーテツド | Obタンパク質受容体をアップレギュレートすることによりobタンパク質に対する個体の感受性を増加させる方法 |
| WO1998016545A1 (en) | 1996-10-11 | 1998-04-23 | Eli Lilly And Company | Therapeutic proteins |
| WO1998024896A2 (en) | 1996-12-06 | 1998-06-11 | F. Hoffmann-La Roche Ag | Muteins of obese protein |
| US6309360B1 (en) | 1997-03-17 | 2001-10-30 | James R. Mault | Respiratory calorimeter |
| AU6569998A (en) * | 1997-03-20 | 1998-10-12 | Eli Lilly And Company | Obesity protein formulations |
| ES2235336T3 (es) | 1997-06-13 | 2005-07-01 | Gryphon Therapeutics, Inc. | Ligacion quimica nativa en fase solida de peptidos desprotegidos o protegidos en la cisteina n-terminal en solucion acuosa. |
| EP1091440B1 (en) | 1998-05-29 | 2010-06-02 | JGC Catalysts and Chemicals Ltd. | Method of manufacturing photoelectric cell |
| PT1107793E (pt) | 1998-08-10 | 2005-02-28 | Amgen Inc | Conjugados de dextrano-leptina, composicoes farmaceuticas e processos relacionados |
| AU6396999A (en) | 1998-10-02 | 2000-04-26 | Amgen, Inc. | Method to determine a predisposition to leptin treatment |
| US6420339B1 (en) | 1998-10-14 | 2002-07-16 | Amgen Inc. | Site-directed dual pegylation of proteins for improved bioactivity and biocompatibility |
| US6660843B1 (en) | 1998-10-23 | 2003-12-09 | Amgen Inc. | Modified peptides as therapeutic agents |
| CA2359840C (en) | 1999-02-12 | 2012-10-23 | Amgen Inc. | Glycosylated leptin compositions and related methods |
| US6475984B2 (en) * | 1999-04-29 | 2002-11-05 | The Nemours Foundation | Administration of leptin |
| TW514510B (en) | 1999-06-11 | 2002-12-21 | Tanita Seisakusho Kk | Method and apparatus for measuring distribution of body fat |
| US6468222B1 (en) | 1999-08-02 | 2002-10-22 | Healthetech, Inc. | Metabolic calorimeter employing respiratory gas analysis |
| US6258932B1 (en) | 1999-08-09 | 2001-07-10 | Tripep Ab | Peptides that block viral infectivity and methods of use thereof |
| EP1214351A2 (en) * | 1999-09-22 | 2002-06-19 | Genset | Methods of screening for compounds that modulate the lsr-leptin interaction and their use in the prevention and treatment of obesity-related diseases |
| US6530886B1 (en) | 1999-10-08 | 2003-03-11 | Tanita Corporation | Method and apparatus for measuring subcutaneous fat using ultrasonic wave |
| US7057015B1 (en) * | 1999-10-20 | 2006-06-06 | The Salk Institute For Biological Studies | Hormone receptor functional dimers and methods of their use |
| JP2001199887A (ja) | 1999-11-10 | 2001-07-24 | Takeda Chem Ind Ltd | 体重増加抑制剤 |
| CN1423566A (zh) | 1999-11-10 | 2003-06-11 | 武田药品工业株式会社 | 体重增加抑制剂 |
| US20050287153A1 (en) * | 2002-06-28 | 2005-12-29 | Genentech, Inc. | Serum albumin binding peptides for tumor targeting |
| CA2405550A1 (en) * | 2000-04-12 | 2001-10-25 | Human Genome Sciences, Inc. | Albumin fusion proteins |
| TW515705B (en) | 2000-05-31 | 2003-01-01 | Yamato Scale Co Ltd | Visceral fat meter |
| US6492117B1 (en) | 2000-07-12 | 2002-12-10 | Gendaq Limited | Zinc finger polypeptides capable of binding DNA quadruplexes |
| US6475158B1 (en) | 2000-10-24 | 2002-11-05 | Korr Medical Technologies, Inc. | Calorimetry systems and methods |
| US6899892B2 (en) | 2001-12-19 | 2005-05-31 | Regents Of The University Of Minnesota | Methods to reduce body fat |
| AU2002364586A1 (en) | 2001-12-21 | 2003-07-30 | Delta Biotechnology Limited | Albumin fusion proteins |
| JPWO2004039853A1 (ja) | 2002-11-01 | 2006-03-02 | 株式会社トクヤマ | 重合性組成物、その硬化体の製造法および光学物品 |
| EP1667724A2 (en) * | 2003-09-19 | 2006-06-14 | Novo Nordisk A/S | Albumin-binding derivatives of therapeutic peptides |
| TW200526254A (en) * | 2003-09-19 | 2005-08-16 | Novo Nordisk As | Novel GLP-1 derivatives |
| US8263084B2 (en) | 2003-11-13 | 2012-09-11 | Hanmi Science Co., Ltd | Pharmaceutical composition for treating obesity-related disease comprising insulinotropic peptide conjugate |
| CA2589800A1 (en) | 2004-12-02 | 2006-06-08 | Domantis Limited | Bispecific domain antibodies targeting serum albumin and glp-1 or pyy |
| US7898623B2 (en) | 2005-07-04 | 2011-03-01 | Semiconductor Energy Laboratory Co., Ltd. | Display device, electronic device and method of driving display device |
| GB0524788D0 (en) * | 2005-12-05 | 2006-01-11 | Affibody Ab | Polypeptides |
| JP5252435B2 (ja) | 2006-03-15 | 2013-07-31 | ノボ・ノルデイスク・エー/エス | アミリン誘導体 |
| CN101113175A (zh) * | 2007-04-28 | 2008-01-30 | 中国科学院西北高原生物研究所 | 鼠兔家族瘦素蛋白及其cDNA序列 |
| DE08786222T1 (de) | 2007-07-31 | 2010-11-25 | Affibody Ab | Neue albuminbindende zusammensetzungen, verfahren und anwendungen |
| GB0715216D0 (en) | 2007-08-03 | 2007-09-12 | Asterion Ltd | Leptin |
| EP2036923A1 (en) | 2007-09-11 | 2009-03-18 | Novo Nordisk A/S | Improved derivates of amylin |
| EP2195034A2 (en) * | 2007-09-27 | 2010-06-16 | Amylin Pharmaceuticals, Inc. | Peptide-peptidase inhibitor conjugates and methods of making and using same |
| CA2712606A1 (en) * | 2008-02-08 | 2009-08-13 | Ambrx, Inc. | Modified leptin polypeptides and their uses |
| US8501686B2 (en) | 2008-06-05 | 2013-08-06 | University Of Michigan | Method of treating fatty liver diseases and conditions in non-lipodystrophic subjects |
| WO2010046357A1 (en) | 2008-10-21 | 2010-04-29 | Novo Nordisk A/S | Amylin derivatives |
| WO2010054699A1 (en) * | 2008-11-17 | 2010-05-20 | Affibody Ab | Conjugates of albumin binding domain |
| BRPI1006943A2 (pt) | 2009-01-22 | 2021-06-15 | Unigene Laboratories Inc. | peptídeo, composição farmacêutica que compreende o peptídeo e método para supressão do apetite, prevenção ou tratamento de uma condição de sobrepeso ou obesidade, ou para tratar diabetes |
| WO2010091122A1 (en) | 2009-02-03 | 2010-08-12 | Amunix, Inc. | Extended recombinant polypeptides and compositions comprising same |
| WO2011152694A2 (en) * | 2010-06-04 | 2011-12-08 | Sk Chemicals Co., Ltd. | Fusion protein having factor vii activity |
| CN110437321A (zh) | 2010-07-09 | 2019-11-12 | 阿菲博迪公司 | 多肽 |
| EP3028720A1 (en) | 2010-09-28 | 2016-06-08 | Amylin Pharmaceuticals, LLC | Engineered polypeptides having enhanced duration of action |
| EA024507B1 (ru) * | 2010-09-28 | 2016-09-30 | Амилин Фармасьютикалс, Ллк | Хорошо растворимые лептины |
| CN104271588B (zh) | 2011-07-08 | 2017-10-10 | 安米林药品有限责任公司 | 具有增强的作用持续时间和降低的免疫原性的工程改造的多肽 |
| DK2729160T3 (da) | 2011-07-08 | 2019-07-01 | Aegerion Pharmaceuticals Inc | Manipulerede polypeptider, der har forbedret virkningstid og reduceret immunogenicitet |
-
2011
- 2011-09-28 EA EA201390474A patent/EA024507B1/ru unknown
- 2011-09-28 EP EP11833075.2A patent/EP2621515B1/en active Active
- 2011-09-28 ES ES11833080.2T patent/ES2641869T3/es active Active
- 2011-09-28 CA CA2813087A patent/CA2813087C/en active Active
- 2011-09-28 MX MX2013003482A patent/MX351128B/es active IP Right Grant
- 2011-09-28 CN CN201180057153.4A patent/CN103403019B/zh active Active
- 2011-09-28 JP JP2013531786A patent/JP6174489B2/ja active Active
- 2011-09-28 CA CA3138758A patent/CA3138758A1/en active Pending
- 2011-09-28 DK DK11833075.2T patent/DK2621515T3/en active
- 2011-09-28 JP JP2013531789A patent/JP2014502252A/ja active Pending
- 2011-09-28 ES ES17163203T patent/ES2873253T3/es active Active
- 2011-09-28 MX MX2013003472A patent/MX349054B/es active IP Right Grant
- 2011-09-28 DK DK11833080.2T patent/DK2621519T3/en active
- 2011-09-28 EP EP17174544.1A patent/EP3305315A1/en not_active Withdrawn
- 2011-09-28 PT PT118330752T patent/PT2621515T/pt unknown
- 2011-09-28 WO PCT/US2011/053774 patent/WO2012050925A2/en not_active Ceased
- 2011-09-28 PT PT118330802T patent/PT2621519T/pt unknown
- 2011-09-28 EP EP17163203.7A patent/EP3241558B1/en active Active
- 2011-09-28 ES ES11833075.2T patent/ES2630031T3/es active Active
- 2011-09-28 BR BR122021020041-6A patent/BR122021020041B1/pt active IP Right Grant
- 2011-09-28 EA EA201390497A patent/EA032917B1/ru unknown
- 2011-09-28 WO PCT/US2011/053786 patent/WO2012050930A2/en not_active Ceased
- 2011-09-28 BR BR112013007388-8A patent/BR112013007388B1/pt active IP Right Grant
- 2011-09-28 EP EP11833080.2A patent/EP2621519B1/en active Active
- 2011-09-28 CN CN201180056939.4A patent/CN103547590B/zh active Active
- 2011-09-28 DK DK17163203.7T patent/DK3241558T3/da active
- 2011-09-28 PL PL17163203T patent/PL3241558T3/pl unknown
- 2011-09-28 BR BR112013007385-3A patent/BR112013007385B1/pt active IP Right Grant
- 2011-09-28 CA CA2813038A patent/CA2813038C/en active Active
-
2013
- 2013-03-28 US US13/852,671 patent/US20130274182A1/en not_active Abandoned
- 2013-03-28 US US13/852,521 patent/US20130203661A1/en not_active Abandoned
-
2015
- 2015-05-04 US US14/703,523 patent/US10087228B2/en active Active
- 2015-07-15 US US14/800,537 patent/US20160137709A1/en not_active Abandoned
-
2016
- 2016-12-02 JP JP2016235165A patent/JP6608799B2/ja active Active
-
2017
- 2017-02-28 JP JP2017036849A patent/JP6412183B2/ja active Active
- 2017-06-28 CY CY20171100690T patent/CY1119023T1/el unknown
- 2017-09-26 CY CY20171101013T patent/CY1119498T1/el unknown
-
2019
- 2019-10-24 JP JP2019193539A patent/JP2020033366A/ja active Pending
-
2020
- 2020-01-24 US US16/751,538 patent/US11535659B2/en active Active
-
2022
- 2022-10-25 US US18/049,445 patent/US20230115655A1/en not_active Abandoned
Patent Citations (43)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4002531A (en) | 1976-01-22 | 1977-01-11 | Pierce Chemical Company | Modifying enzymes with polyethylene glycol and product produced thereby |
| WO1983004053A1 (en) | 1982-05-06 | 1983-11-24 | Applied Molecular Genetics, Inc. | The manufacture and expression of large structural genes |
| EP0401384A1 (en) | 1988-12-22 | 1990-12-12 | Kirin-Amgen, Inc. | Chemically modified granulocyte colony stimulating factor |
| US5824778A (en) | 1988-12-22 | 1998-10-20 | Kirin-Amgen, Inc. | Chemically-modified G-CSF |
| US5686411A (en) | 1991-03-08 | 1997-11-11 | Amylin Pharmaceuticals, Inc. | Amylin agonist peptides and uses therefor |
| US6368630B1 (en) | 1992-03-12 | 2002-04-09 | Alkermes Controlled Therapeutics, Inc. | Modulated release from biocompatible polymers |
| US5766627A (en) | 1993-11-16 | 1998-06-16 | Depotech | Multivescular liposomes with controlled release of encapsulated biologically active substances |
| WO1996005309A2 (en) | 1994-08-17 | 1996-02-22 | The Rockefeller University | Modulators of body weight, corresponding nucleic acids and proteins, and diagnostic and therapeutic uses thereof |
| US6309853B1 (en) | 1994-08-17 | 2001-10-30 | The Rockfeller University | Modulators of body weight, corresponding nucleic acids and proteins, and diagnostic and therapeutic uses thereof |
| US5824784A (en) | 1994-10-12 | 1998-10-20 | Amgen Inc. | N-terminally chemically modified protein compositions and methods |
| US5580954A (en) | 1995-01-31 | 1996-12-03 | Eli Lilly And Company | Anti-obesity proteins |
| US5851995A (en) | 1995-01-31 | 1998-12-22 | Eli Lilly And Company | Anti-obesity proteins |
| US5559208A (en) | 1995-01-31 | 1996-09-24 | Eli Lilly And Company | Anti-obesity proteins |
| US5691309A (en) | 1995-01-31 | 1997-11-25 | Eli Lilly And Company | Anti-obesity proteins |
| US5554727A (en) | 1995-01-31 | 1996-09-10 | Eli Lilly And Company | Anti-obesity proteins |
| US5552523A (en) | 1995-01-31 | 1996-09-03 | Eli Lilly And Company | Anti-obesity proteins |
| WO1996023517A1 (en) | 1995-01-31 | 1996-08-08 | Eli Lilly And Company | Anti-obesity proteins |
| US5594101A (en) | 1995-03-03 | 1997-01-14 | Eli Lilly And Company | Anti-obesity proteins |
| US5756461A (en) | 1995-06-30 | 1998-05-26 | Eli Lilly And Company | Methods for treating diabetes |
| WO1997002004A2 (en) | 1995-06-30 | 1997-01-23 | Eli Lilly And Company | Methods for treating diabetes |
| US20070020284A1 (en) | 1995-11-22 | 2007-01-25 | Amgen, Inc. | OB fusion protein compositions and methods |
| WO1998012224A1 (en) | 1996-09-20 | 1998-03-26 | Hoechst Aktiengesellschaft | Use of leptin antagonists for treating insulin resistance in type ii diabetes |
| WO1998028427A1 (en) | 1996-12-20 | 1998-07-02 | Amgen Inc. | Ob fusion protein compositions and methods |
| WO1998055139A1 (en) | 1997-06-06 | 1998-12-10 | Smithkline Beecham Plc | Use of leptin antagonists for the treatment of diabetes |
| US6379703B1 (en) | 1998-12-30 | 2002-04-30 | Alkermes Controlled Therapeutics Inc., Ii | Preparation of microparticles having a selected release profile |
| US6872700B1 (en) | 1999-01-14 | 2005-03-29 | Amylin Pharmaceuticals, Inc. | Methods for glucagon suppression |
| US20080032408A1 (en) | 2000-04-06 | 2008-02-07 | Affymetrix, Inc. | Tag Nucleic Acids and Probe Arrays |
| US6379704B2 (en) | 2000-05-19 | 2002-04-30 | Alkermes Controlled Therapeutics Inc. Ii | Method for preparing microparticles having a selected polymer molecular weight |
| US6296842B1 (en) | 2000-08-10 | 2001-10-02 | Alkermes Controlled Therapeutics, Inc. | Process for the preparation of polymer-based sustained release compositions |
| US7183254B2 (en) | 2001-10-22 | 2007-02-27 | Amgen, Inc. | Use of leptin for treating human lipoatrophy and method of determining predisposition to said treatment |
| WO2004039832A2 (en) | 2002-10-31 | 2004-05-13 | Albany Medical College | Leptin-related peptides |
| WO2006083254A1 (en) | 2004-02-11 | 2006-08-10 | Amylin Pharmaceuticals, Inc. | Amylin family peptides and methods for making and using them |
| US20080274952A1 (en) | 2004-02-11 | 2008-11-06 | Amylin Pharmaceuticals, Inc. | Amylin Family Peptides And Methods For Making And Using Them |
| US20080176804A1 (en) | 2004-03-04 | 2008-07-24 | Amylin Pharmaceuticals, Inc. | Methods for Affecting Body Composition |
| US20080207512A1 (en) | 2004-11-01 | 2008-08-28 | Amylin Pharmaceuticals, Inc. | Methods for Treating Obesity and Obesity Related and Disorders |
| US20070238669A1 (en) | 2006-01-11 | 2007-10-11 | Bristol-Myers Squibb Company | Human glucagon-like-peptide-1 modulators and their use in the treatment of diabetes related conditions |
| WO2007114838A1 (en) | 2006-03-31 | 2007-10-11 | Amylin Pharmaceuticals, Inc. | Amylin and amylin agonists for treating psychiatric diseases and disorders |
| WO2007139941A2 (en) | 2006-05-26 | 2007-12-06 | Amylin Pharmaceuticals, Inc. | Composition and methods for treatment of congestive heart failure |
| WO2007140284A2 (en) | 2006-05-26 | 2007-12-06 | Bristol-Myers Squibb Company | N-terminally modified glp-1 receptor modulators |
| WO2008082274A1 (en) | 2007-01-05 | 2008-07-10 | Hanmi Pharmaceutical Co., Ltd. | An insulinotropic complex using an immunoglobulin fragment |
| WO2009011544A2 (en) | 2007-07-16 | 2009-01-22 | Hanmi Pharmaceutical Co., Ltd. | Insulinotropic peptide derivative wherein its n-terminal amino acid is modified |
| WO2009064298A1 (en) | 2007-11-14 | 2009-05-22 | Amylin Pharmaceuticals, Inc. | Methods for treating obesity and obesity related diseases and disorders |
Non-Patent Citations (37)
| Title |
|---|
| ABUCHOWSKI ET AL.: "Enzymes as Drugs", 1981, pages: 367 - 383 |
| ABUCHOWSKI: "ENZYMES AS DRUGS", 1981, pages: 367 - 383 |
| ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
| ALTSCHUL ET AL., NUCI. ACIDS RES., vol. 25, 1977, pages 3389 - 3402 |
| AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1995 |
| AVIS ET AL.: "PHARMACEUTICAL DOSAGE FORMS: PARENTERAL MEDICATIONS, 2nd ed.", vol. 1, 1992, MERCEL DEKKER |
| BARTLETT ET AL., BIORG. CHEM., vol. 14, 1986, pages 356 - 377 |
| BARTLETT; LANDEN, BIOORG. CHEM, vol. 14, 1986, pages 356 - 77 |
| BELCHEVA, N. ET AL., BIOCONJUGATE CHEM., vol. 10, 1999, pages 932 - 937 |
| BETTINGER, T. ET AL., BIOCONJUGATE CHEM, vol. 9, 1998, pages 842 - 846 |
| BLOMHOFF, H. K. ET AL., BIOCHIM BIOPHYS ACTA, vol. 757, 1983, pages 202 - 208 |
| CHAN, T.-H. ET AL., J. ORG. CHEM.,, vol. 62, 1997, pages 3500 - 3504 |
| CHENG, T.-L. ET AL., BIOCONJUGATE CHEM.,, vol. 10, 1999, pages 520 - 528 |
| D. M. WEIR: "HANDBOOK OF EXPERIMENTAL IMMUNOLOGY, VOLUME I, IMMUNOCHEMISTRY", vol. I, 1986, BLACKWELL SCIENTIFIC PUBLICATIONS, article A. E. BOLTON; W. M. HUNTER: "Radioimmunoassay and related methods (chapter 26)" |
| E. W. MARTIN, REMINGTON'S PHARMACEUTICAL SCIENCES |
| FEWLASS ET AL., FASEB J., vol. 18, 2004, pages 1870 - 1878 |
| HENIKOFF; HENIKOFF, PROC. NATL. ACAD. SCI. USA, vol. 89, 1989, pages 10915 |
| HUANG, S.-Y. ET AL., BIOCONJUGATE CHEM., vol. 9, 1998, pages 612 - 617 |
| IKEJIMA ET AL., HEPATOLOGY RES., vol. 33, 2005, pages 151 - 154 |
| LIM, FEBSLETT., vol. 582, 2008, pages 2188 - 2194 |
| MALIK ET AL., EXP. HEMATOL., vol. 20, 1992, pages 1028 - 1035 |
| MEHVAR, R., J. PHARM. PHARMACEUT. SCI., vol. 3, 2000, pages 125 - 136 |
| MURAKAMI, BIOCHEM. BIOPHYS. RES. COMM, vol. 209, 1995, pages 944 - 952 |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| PEARSON; LIPMAN, PROC. NAT'L. ACAD. SCI. USA, vol. 85, 1988, pages 2444 |
| PEELMAN ET AL., J. BIOL. CHEM., vol. 279, 2004, pages 41038 |
| REUTER, J. D. ET AL., BIOCONJUGATE CHEM., vol. 10, 1999, pages 271 - 278 |
| RICCI ET AL.: "MISBEHAVING PROTEINS: PROTEIN (MIS)FOLDING, AGGREGATION, AND STABILITY", 2006, SPRINGER, article "Mutational approach to improve physical stability of protein therapeutics susceptible to aggregation: Role of altered conformation in irreversible precipitation", pages: 331 - 350 |
| SAMBROOK ET AL.: "MOLECULAR CLONING: A LABORATORY MANUAL, 2nd ed.", 1989, COLD SPRING HARBOR |
| SANDBERG ET AL., J. MED, CHEM, vol. 41, 1998, pages 2481 - 91 |
| SCHWARZ, J. B. ET AL., J. AMER. CHEM. SOC, vol. 121, 1999, pages 2662 - 2673 |
| See also references of EP2621515A4 |
| SMITH; WATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 |
| WANG ET AL., J. OF PARENTERAL SCI. AND TECH., TECHNICAL REPORT NO. 10, 1988, pages 2 S |
| XU, B. ET AL., LANGMUIR, vol. 13, 1998, pages 2447 - 2456 |
| ZALIPSKY, S., BIOCONJUGATE CHEMISTRY, vol. 6, 1995, pages 150 - 165 |
| ZHANG ET AL., NATURE, vol. 387, 1997, pages 206 |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11535659B2 (en) | 2010-09-28 | 2022-12-27 | Amryt Pharmaceuticals Inc. | Engineered polypeptides having enhanced duration of action |
| WO2016034604A1 (en) * | 2014-09-04 | 2016-03-10 | Novo Nordisk A/S | Novel amylin and calcitonin receptor agonist |
| US9593149B2 (en) | 2014-09-04 | 2017-03-14 | Novo Nordisk A/S | Amylin and calcitonin receptor agonist |
| US10174082B2 (en) | 2014-09-04 | 2019-01-08 | Novo Nordisk A/S | Amylin and calcitonin receptor agonist |
| WO2018049424A1 (en) | 2016-09-12 | 2018-03-15 | Aegerion Pharmaceuticals, Inc. | Methods of detecting anti-leptin neutralizing antibodies |
| US10775386B2 (en) | 2016-09-12 | 2020-09-15 | Aegerion Pharmaceuticals, Inc. | Methods of detecting anti-leptin neutralizing antibodies |
| US11709166B2 (en) | 2016-09-12 | 2023-07-25 | Amryt Pharmaceuticals Inc. | Methods of detecting anti-leptin neutralizing antibodies |
| EP4283304A2 (en) | 2016-09-12 | 2023-11-29 | Amryt Pharmaceuticals Inc. | Methods of detecting anti-leptin neutralizing antibodies |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20230115655A1 (en) | Engineered polypeptides having enhanced duration of action | |
| US9879063B2 (en) | Engineered polypeptides having enhanced duration of action and reduced immunogenicity | |
| HK1188711A (en) | A chimeric seal-human leptin polypeptide with increased solubility | |
| HK1188711B (en) | A chimeric seal-human leptin polypeptide with increased solubility | |
| HK1188924A (en) | Leptin-abd fusion polypeptides with enhanced duration of action | |
| HK1188924B (en) | Leptin-abd fusion polypeptides with enhanced duration of action | |
| BR122022002534B1 (pt) | Polipeptídeo quimérico, seu uso e composição que o compreende | |
| HK1196093B (en) | Engineered polypeptides having enhanced duration of action and reduced immunogenicity | |
| HK1196093A (en) | Engineered polypeptides having enhanced duration of action and reduced immunogenicity |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| DPE2 | Request for preliminary examination filed before expiration of 19th month from priority date (pct application filed from 20040101) | ||
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 11833075 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2013/003472 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2013531786 Country of ref document: JP Kind code of ref document: A Ref document number: 2813038 Country of ref document: CA |
|
| REEP | Request for entry into the european phase |
Ref document number: 2011833075 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2011833075 Country of ref document: EP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201390474 Country of ref document: EA |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112013007385 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112013007385 Country of ref document: BR Kind code of ref document: A2 Effective date: 20130327 |