WO2012032433A1 - 4-1bb binding molecules - Google Patents

4-1bb binding molecules Download PDF

Info

Publication number
WO2012032433A1
WO2012032433A1 PCT/IB2011/053761 IB2011053761W WO2012032433A1 WO 2012032433 A1 WO2012032433 A1 WO 2012032433A1 IB 2011053761 W IB2011053761 W IB 2011053761W WO 2012032433 A1 WO2012032433 A1 WO 2012032433A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
mor
human
amino acid
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/IB2011/053761
Other languages
English (en)
French (fr)
Inventor
Bianca Ahrens
Sangita M. Baxi
Simon Paul Bergqvist
Regis Doyonnas
Robert Lee Dufield
Mark William Elliott
Timothy Scott Fisher
Richard Michael Jerome
Heather Laurence Jones
Cris Kamperschroer
Kathrin Ladetzki-Baehs
Victoria Alexandria Love
Theodore Lawrence Oliphant
Adekunle Olatunbosun Onadipe
Wenning Qin
Vinay Radhakrishnan
Allison Karlyn Rohner
Leslie Lynne Sharp
Michael Tesar
Kristin Elizabeth Thomas
Libbey Anne Yates
Daisy Marie Ziegemeier
Moritz Zulley
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Pfizer Inc
Original Assignee
Pfizer Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to NZ607710A priority Critical patent/NZ607710A/en
Priority to KR1020137008907A priority patent/KR101527297B1/ko
Priority to EP18189743.0A priority patent/EP3441404A1/en
Priority to JP2013527708A priority patent/JP6105470B2/ja
Application filed by Pfizer Inc filed Critical Pfizer Inc
Priority to BR112013005699-1A priority patent/BR112013005699B1/pt
Priority to HK14100600.6A priority patent/HK1187627B/xx
Priority to PL11764859T priority patent/PL2614082T3/pl
Priority to MX2013002709A priority patent/MX337040B/es
Priority to MX2015014566A priority patent/MX374682B/es
Priority to CN201180054004.2A priority patent/CN103221428B/zh
Priority to ES11764859T priority patent/ES2699648T3/es
Priority to SG2013014451A priority patent/SG188313A1/en
Priority to RU2013110576/10A priority patent/RU2551963C2/ru
Priority to SI201131611T priority patent/SI2614082T1/sl
Priority to PH1/2020/550156A priority patent/PH12020550156A1/en
Priority to EP11764859.2A priority patent/EP2614082B1/en
Priority to CA2810359A priority patent/CA2810359C/en
Priority to KR1020137016205A priority patent/KR101527300B1/ko
Priority to DK11764859.2T priority patent/DK2614082T3/en
Priority to PH1/2013/500395A priority patent/PH12013500395B1/en
Priority to AU2011300445A priority patent/AU2011300445B2/en
Publication of WO2012032433A1 publication Critical patent/WO2012032433A1/en
Priority to IL225001A priority patent/IL225001A/en
Anticipated expiration legal-status Critical
Priority to IL247054A priority patent/IL247054B/en
Priority to IL250386A priority patent/IL250386A0/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/02Peptides of undefined number of amino acids; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2887Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62DNA sequences coding for fusion proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567Framework region [FR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/74Inducing cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/75Agonist effect on antigen
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present disclosure relates to antibodies, and particularly antibodies that bind to human 4-1 BB.
  • 4-1 BB (also referred to as CD137, TNFRSF9, etc) is a transmembrane protein of the Tumor Necrosis Factor receptor superfamily (TNFRS).
  • TNFSF Tumor Necrosis Factor receptor superfamily
  • Current understanding of 4- 1 BB indicates that expression is generally activation dependent and is present in a broad subset of immune cells including activated NK and NKT cells, regulatory T cells, dendritic cells (DC), stimulated mast cells, differentiating myeloid cells, monocytes, neutrophils, and eosinophils (Wang, 2009, Immunological Reviews 229: 192-215).
  • 4- 1 BB expression has also been demonstrated on tumor vasculature (Broil, 2001 , Amer. J Clin. Pathol.
  • the ligand that stimulates 4-1 BB i.e., 4- 1 BB Ligand (4-1 BBL) is expressed on activated antigen-presenting cells (APCs), myeloid progenitor cells, and hematopoietic stem cells.
  • Human 4-1 BB is a 255 amino acid protein (Accession No. NM_001561 ; NP_001552).
  • the complete human 4-1 BB amino acid sequence is provided in SEQ ID NO:68.
  • the protein comprises a signal sequence (amino acid residues 1-17), followed by an extracellular domain (169 amino acids), a transmembrane region (27 amino acids), and an intracellular domain (42 amino acids) (Cheuk ATC et al. 2004 Cancer Gene Therapy 1 1 : 215-226).
  • the receptor is expressed on the cell surface in monomer and dimer forms and likely trimerizes with 4-1 BB ligand to signal.
  • 4-1 BB promotes enhanced cellular proliferation, survival, and cytokine production
  • 4-1 BB agonist mAbs increase costimulatory molecule expression and markedly enhance cytolytic T lymphocyte responses, resulting in anti-tumor efficacy in various models.
  • 4-1 BB agonist mAbs have demonstrated efficacy in prophylactic and therapeutic settings.
  • 4-1 BB monotherapy and combination therapy tumor models have established durable antitumor protective T cell memory responses (Lynch, 2008, Immunol Rev. 22: 277-286).
  • 4- 1 BB agonists also have been shown to inhibit autoimmune reactions in a variety of art- recognized autoimmunity models (Vinay, 2006, J Mol Med 84:726-736). This dual activity of 4-1 BB offers the potential to provide anti-tumor activity while dampening autoimmune side effects that can be associated with immunotherapy approaches that break immune tolerance.
  • the disclosure provides isolated antibodies that bind to human
  • the isolated antibody binds human 4-1 BB at an epitope comprising amino acid residues 1 15 - 156 of SEQ ID NO: 68.
  • the antibody comprises the H-CDR1 amino acid sequence of SEQ ID NO: 29, H-CDR2 amino acid sequence of SEQ ID NO: 30, and H-CDR3 amino acid sequence of SEQ ID NO: 31.
  • the antibody comprises the L-CDR1 amino acid sequence of SEQ ID NO: 34, L-CDR2 amino acid sequence of SEQ ID NO: 35, and L-CDR3 amino acid sequence of SEQ ID NO: 36.
  • the isolated antibody binds human 4-1 BB with a K D of 600 nM or less, 100 nM or less, 50 nM or less, 10 nM or less, 5 nM or less, or 1 nM or less, for the human 4-1 BB extracellular domain as measured with the BIACore assay described in this disclosure.
  • the isolated antibody comprises: (a) an H-CDR1 as set forth in SEQ I D NO:1 , SEQ ID NO:15, or SEQ ID NO:29; (b) an H-CDR2 as set forth in SEQ ID NO:2, SEQ ID NO:16, or SEQ ID NO:30; and (c) an H-CDR3 as set forth in SEQ ID NO:3, SEQ ID NO: 17, or SEQ ID NO:31.
  • the isolated antibody comprises:: (a) an L-CDR1 as set forth in SEQ ID NO:6, SEQ ID NO: 20, or SEQ I D NO:34; (b) an L-CDR2 as set forth in SEQ ID NO:7, SEQ ID NO:21 , or SEQ ID NO:35; and (c) an L-CDR3 as set forth in SEQ ID NO:8, SEQ ID NO:22, SEQ ID NO:36, or SEQ ID NO: 55.
  • the isolated antibody comprises: (a) an H-CDR1 as set forth in SEQ ID NO:1 , SEQ ID NO:15, or SEQ ID NO:29; (b) an H-CDR2 as set forth in SEQ ID NO:2, SEQ ID NO:16, or SEQ ID NO:30; and (c) an H-CDR3 as set forth in SEQ ID NO:3, SEQ ID NO: 17, or SEQ ID NO:31 ; and further comprises: (d) an L-CDR1 as set forth in SEQ ID NO:6, SEQ ID NO: 20, or SEQ ID NO:34; (e) an L-CDR2 as set forth in SEQ ID NO:7, SEQ ID NO:21 , or SEQ ID NO:35; and (f) an L-CDR3 as set forth in SEQ ID NO:8, SEQ ID NO:22, SEQ ID NO:36, or SEQ ID NO: 55.
  • the isolated antibody is selected from the group consisting of:
  • an antibody or antigen-binding portion thereof comprising: an H-CDR1 as set forth in SEQ ID NO:1 , an H-CDR2 as set forth in SEQ ID NO:2, and an H-CDR3 as set forth in SEQ ID NO:3;
  • an antibody or antigen-binding portion thereof comprising an H-CDR1 as set forth in SEQ ID NO:15, an H-CDR2 as set forth in SEQ ID NO:16, and an H-CDR3 as set forth in SEQ ID NO: 17, and
  • an antibody or antigen-binding portion thereof comprising an H-CDR1 as set forth in SEQ ID NO:29, an H-CDR2 as set forth in SEQ ID NO:30, and an H-CDR3 as set forth in SEQ ID NO:31 .
  • the disclosure provides an isolated antibody, or antigen- binding portion thereof, that specifically binds human 4-1 BB, wherein said antibody or antigen-binding portion is selected from the group consisting of:
  • an antibody or antigen-binding portion thereof comprising an L-CDR1 as set forth in SEQ ID NO:6, an L-CDR2 as set forth in SEQ I D NO:7, and an L-CDR3 as set forth in SEQ ID NO:8.
  • an antibody or antigen-binding portion thereof comprising an L-CDR1 as set forth in SEQ ID NO:20, an L-CDR2 as set forth in SEQ ID NO:21 , and an L-CDR3 as set forth in SEQ ID NO:22.
  • an antibody or antigen-binding portion thereof comprising an L-CDR1 as set forth in SEQ ID NO:34, an L-CDR2 as set forth in SEQ ID NO:35, and an L-CDR3 as set forth in SEQ ID NO:36; and (d) an antibody or antigen-binding portion thereof, comprising an L-CDR1 as set forth in SEQ ID NO:34, an L-CDR2 as set forth in SEQ ID NO:35, and an L-CDR3 as set forth in SEQ ID NO:55.
  • the isolated antibody is selected from the group consisting of:
  • an antibody or antigen-binding portion thereof comprising: an H-CDR1 as set forth in SEQ ID NO: 1 , an H-CDR2 as set forth in SEQ ID NO:2, an H-CDR3 as set forth in SEQ ID NO:3; an L-CDR1 as set forth in SEQ ID NO:6, an L-CDR2 as set forth in SEQ ID NO:7, and an L-CDR3 as set forth in SEQ ID NO:8;
  • an antibody or antigen-binding portion thereof comprising an H-CDR1 as set forth in SEQ ID NO:15, an H-CDR2 as set forth in SEQ ID NO:16, an H-CDR3 as set forth in SEQ ID NO:17; an L-CDR1 as set forth in SEQ ID NO:20, an L-CDR2 as set forth in SEQ ID NO:21 , and an L-CDR3 as set forth in SEQ ID NO:22.
  • an antibody or antigen-binding portion thereof comprising an H-CDR1 as set forth in SEQ ID NO:29, an H-CDR2 as set forth in SEQ ID NO:30, an H-CDR3 as set forth in SEQ ID NO:31 ; an L-CDR1 as set forth in SEQ ID NO:34, an L-CDR2 as set forth in SEQ ID NO:35, and an L-CDR3 as set forth in SEQ ID NO:36; and
  • an antibody or antigen-binding portion thereof comprising an H-CDR1 as set forth in SEQ ID NO:29, an H-CDR2 as set forth in SEQ ID NO:30, an H-CDR3 as set forth in SEQ ID NO:31 ; an L-CDR1 as set forth in SEQ ID NO:34, an L-CDR2 as set forth in SEQ ID NO:35, and an L-CDR3 as set forth in SEQ ID NO:55.
  • the isolated antibody comprises a V H chain amino acid sequence as set forth in SEQ ID NO:4, SEQ ID NO:18, SEQ ID NO:32, and SEQ ID NO:43 .
  • the isolated antibody comprises a V L chain amino acid sequence as set forth in SEQ ID NO:9, SEQ ID NO:23, SEQ ID NO:37, SEQ ID NO:45, SEQ ID NO:51 , SEQ ID NO:56, SEQ ID NO:60, or SEQ ID NO:64 .
  • the isolated antibody comprises a V H domain amino acid sequence as set forth in any one of SEQ I D NOs:4, 18, 32, and :43, and further comprises a V L domain amino acid sequence as set forth in any one of SEQ ID NOs:9, SEQ ID NO: 23, SEQ ID NO: 37, SEQ ID NO: 45, SEQ ID NO: 51 , SEQ ID NO: 56, SEQ ID NO: 60, and SEQ ID NO: 64 .
  • the isolated antibody is selected from the group consisting of: (a) an antibody comprising a V H chain amino acid sequence as set forth in SEQ ID NO:4 and a V L chain amino acid sequence as set forth in SEQ ID NO:9;
  • an antibody comprising a V H chain amino acid sequence as set forth in SEQ ID NO:43 and a V L chain amino acid sequence as set forth in SEQ ID NO:45, SEQ ID NO:51 , SEQ ID NO: 60, or SEQ ID NO: 64.
  • the isolated antibody provided by the present disclosure comprises a V H chain that is encoded by (i) a nucleic acid sequence comprising SEQ ID NO:1 1 , SEQ ID NO:25, SEQ ID NO:39, SEQ ID NO:47, or (ii) a nucleic acid sequences that hybridizes under high stringency conditions to the complementary strand of SEQ ID NO:1 1 , SEQ ID NO:25, SEQ ID NO:39, or SEQ ID NO:47.
  • the isolated antibody comprises a V L chain that is encoded by (i) a nucleic acid sequence comprising SEQ ID NO:12, SEQ ID NO:26, SEQ ID NO:40, SEQ ID NO:48, SEQ ID NO:53, SEQ ID NO:58, SEQ ID NO:62, or SEQ ID NO:66, or (ii) a nucleic acid sequences that hybridizes under high stringency conditions to the complementary strand of SEQ ID NO:12, SEQ ID NO:26, SEQ ID NO:40, SEQ ID NO:48, SEQ ID NO:53, SEQ ID NO:58, SEQ ID NO:62, or SEQ ID NO:66.
  • an isolated antibody that competes, and/or cross-competes for binding to human 4-1 BB with an illustrative antibody selected from MOR-6032, MOR-7361 , MOR-7480, MOR-7480.1 , MOR-7480.2, MOR 7483, MOR-7483.1 , or MOR-7483.2.
  • the disclosure provides an isolated antibody that binds to the same epitope on human 4-1 BB as an illustrative antibody selected from MOR-6032, MOR- 7361 , MOR-7480, MOR-7480.1 , MOR-7480.2, MOR 7483, MOR-7483.1 , or MOR- 7483.2.
  • the present disclosure provides an isolated antibody that binds human 4-1 BB, comprising a heavy chain variable region that is the product of, or derived from, a human V H 3-23 gene, V H 1 -69 gene, or V H 5.
  • the present disclosure provides an isolated antibody that binds human 4-1 BB, comprising a light chain variable region that is the product of, or derived from, a human VL A3 or A1-13 gene.
  • the isolated antibodies described herein have one or more of the following properties or characteristics:
  • c) bind to human 4-1 BB or cynomolgus 4-1 BB but not rat, or mouse 4-1 BB;
  • d) are an IgG, such as lgG1 , lgG2, lgG3, or lgG4;
  • e are human antibodies, or humanized antibodies.
  • the present disclosure provides an antigen-binding portion of any of the antibody provided by the present disclosure.
  • the antigen-binding portion is Fab or scFv fragment.
  • the present disclosure provides a derivative of any of the antibodies provided by the present disclosure.
  • the disclosure provides an isolated nucleic acid that encodes a V H chain of an antibody or antigen-binding portion thereof that bind human 4- 1 BB, which is selected from the group consisting of:
  • nucleic acid sequence that encodes a V H chain amino acid sequence as set forth in SEQ ID NO:4, SEQ ID NO:18, SEQ ID NO:32, or SEQ ID NO:43;
  • nucleic acid sequence that hybridizes under high stringency conditions to the complementary strand of a nucleic acid sequence as set forth in SEQ ID NO:1 1 , SEQ ID NO:25, SEQ ID NO:39, or SEQ ID NO:47.
  • the disclosure provides an isolated nucleic acid that encodes a V L chain of an antibody or antigen-binding portion thereof that binds human 4-1 BB, which is selected from the group consisting of:
  • nucleic acid sequence that encodes a V L chain amino acid sequence as set forth in SEQ ID NO:9, SEQ ID NO:23, SEQ ID NO:37, SEQ ID NO:45, SEQ ID NO:51 , SEQ ID NO:56, SEQ ID NO:60, or SEQ ID NO:64;
  • nucleic acid sequence as set forth in SEQ ID NO:12, SEQ ID NO:26, SEQ ID NO:40, SEQ ID NO:48, SEQ ID NO:53, SEQ ID NO:58, SEQ ID NO: 62, or SEQ ID NO:66; or
  • nucleic acid sequences that hybridizes under high stringency conditions to the complementary strand of a nucleic acid sequence as set forth in SEQ ID NO: 12, SEQ ID NO:26, SEQ ID NO:40, SEQ ID NO:48, SEQ ID NO:53, SEQ ID NO:58, SEQ ID NO: 62, or SEQ ID NO:66.
  • the disclosure provides a vector comprising any of the nucleic acids described herein.
  • the disclosure provides a host cell comprising any of the vectors described herein.
  • host cells can be bacterial or mammalian.
  • the disclosure provides a pharmaceutical composition
  • a pharmaceutical composition comprising any of the antibodies, antigen-binding portions thereof, or a derivative thereof, and a pharmaceutically acceptable carrier.
  • the disclosure further provides methods for treating abnormal cell growth in a subject in need thereof, comprising administering to the subject an effective amount of a binding molecule of the disclosure or pharmaceutical composition described herein.
  • the disclosure further provides methods of reducing tumor cell metastasis in a subject, comprising administering to said subject an effective amount of a binding molecule, or pharmaceutical compositions described herein.
  • the disclosure provides a use of any of the binding molecules, or a pharmaceutical composition described herein, for the manufacture of a medicament for the treatment of abnormal cell growth in a subject in need thereof.
  • the disclosure provides a binding molecule, or a pharmaceutical composition, as described herein, for use in the treatment of abnormal cell growth in a subject in need thereof.
  • the disclosure provides a binding molecule, or a pharmaceutical composition, as described herein, for use in the treatment of tumor cell metastasis in a subject in need thereof.
  • the disclosure provides a use of any of the binding molecules, or a pharmaceutical composition described herein, for the manufacture of a medicament for the treatment of tumor cell metastasis in a subject in need thereof.
  • Figure 1 is four column graphs showing the mean fluorescence intensity of unstimulated (black) and PHA stimulated (light grey) primary PBMC from human (upper left), cynomolgus (upper right), dog (lower left), and rat (lower right) incubated with the indicated 4-1 BB antibody or control antibody conjugated to Alexafluor 647.
  • the panel demonstrates binding to human and cynomolgus PBMC stimulated with PHA.
  • Figure 2 is two line graphs showing luciferase reporter activity in 4-1 BB expressing 293T cells that have been stimulated with several concentrations of 4-1 BB specific mAb or isotype control mAb.
  • the left panel demonstrates reporter activity in cells that express cynomolgus 4-1 BB.
  • the right panel demonstrates activity in cells that express human 4-1 BB.
  • the data is expressed as fold stimulation above isotype control.
  • Figure 3 are line graphs showing the concentration of human IL-2 present in cell culture media following 72 hours of stimulation of human T cells with anti- CD3 and several concentrations of 4-1 BB antibodies.
  • Each panel (A and B) represents an individual donor.
  • Figure 4 is a scattergram showing the expansion of human peripheral blood mononuclear cells in mice that have been treated with 4-1 BB mAb or isotype control mAb. Data is expressed as the percentage of cells expressing human CD45 in the peripheral blood of individual NSG mice on study days 24-28 that had been injected with six million human peripheral blood mononuclear cells on day 0 and injected with 1 mg/kg 4-1 BB mAb or isotype control mAb on day 9. Statistical significance was determined using a two tailed Mann-Whitney test * p ⁇ 0.05, ** p ⁇ 0.005. No HBPT refers to animals that were not injected with human cells.
  • Figure 5 is two column graphs showing the change in proliferating CD8 central memory T cells at several time points following administration of 4-1 BB mAb in cynomolgus monkeys. Data is shown as columns representing individual animals designated as (dose level-animal number) and is represented as intra-animal change in the number of ⁇ -67+ cells relative to pre study number ⁇ [(#Ki-67+ cells on indicated study day - #Ki-67+ cells at pre dose)/#Ki-67+ cells at pre dose] * 100 ⁇ .
  • CD8 central memory cells were identified as CD3+, CD8+, CD28+ and CD95+.
  • Figure 6 are line graphs showing the growth of tumors injected subcutaneously with tumor cells (PC3, left panel; LOVO, right panel) and human peripheral blood mononuclear cells on study day 0. Mice were injected with 10 mg/kg of the indicated 4- 1 BB mAbs on day 0.
  • Figure 7 Left panel is a scattergram showing the percentage of PBMC that are positive for both the T cell surface marker CD8+ and have incorporated the BrdU nucleoside analog following treatment of 4-1 BB knock in mice with 4-1 BB mAb or vehicle control.
  • the right panel is a line graph showing the growth of murine melanoma tumors injected subcutaneously into 4-1 BB knock in mice and treated with the indicated concentration of 4-1 BB mAb.
  • Figure 8 shows alignments of Amino Acid Sequences of the heavy Chain Variable Regions and Light Chain Variable Regions (with CDRs underlined) with Relevant Germline Sequences.
  • 4-1 BB antibody refers to an antibody, as defined herein, capable of binding to human 4-1 BB receptor.
  • 4-1 BB and 4-1 BB receptor are used interchangeably in the present application, and include the human 4-1 BB receptor, as well as variants, isoforms, and species homologs thereof. Accordingly, a binding molecule, as defined and disclosed herein, may also bind 4-1 BB from species other than human. In other cases, a binding molecule may be completely specific for the human 4-1 BB and may not exhibit species or other types of cross-reactivity.
  • the articles “a” and “an” refer to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, "an element” means one element or more than one element.
  • agonist refers to a binding molecule, as defined herein, which upon binding to 4-1 BB, (1 ) stimulates or activates 4-1 BB, (2) enhances, increases, promotes, induces, or prolongs an activity, function, or presence of 4-1 BB, or (3) enhances, increases, promotes, or induces the expression of 4-1 BB.
  • amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to the naturally occurring amino acids.
  • Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, gamma-carboxyglutamate, and O-phosphoserine.
  • amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid but the C-terminal carboxy group, the N-terminal amino group, or side chain functional group has been chemically modified to another functional group.
  • amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions similarly to a naturally occurring amino acid.
  • antibody is an art-recognized term and refers to an antigen-binding protein (i.e, immunoglobulin) having a basic four-polypeptide chain structure consisting of two identical heavy (H) chains and two identical light (L) chains. Each L chain is linked to an H chain by one covalent disulfide bond, while the two H chains are linked to each other by one or more disulfide bonds depending on the H chain isotype.
  • Each heavy chain has, at the N-terminus, a variable region (abbreviated herein as V H ) followed by a constant region.
  • the heavy chain constant region is comprised of three domains, Cm, CH2 and CH3- Each light chain has, at the N-terminus, a variable region (abbreviated herein as V L ) followed by a constant region at its other end.
  • the light chain constant region is comprised of one domain, C
  • the V L is aligned with the V H and the CL is aligned with the first constant domain of the heavy chain (CH1 ).
  • the pairing of a V H and V L together forms a single antigen-binding site.
  • An IgM antibody consists of 5 of the basic heterotetramer units along with an additional polypeptide called J chain, and therefore contains 10 antigen binding sites, while secreted IgA antibodies can polymerize to form polyvalent assemblages comprising 2-5 of the basic 4-chain units along with J chain.
  • the VH and V L regions can be further subdivided into regions of hypervariability, termed complementarity determining regions (CDR), interspersed with regions that are more conserved, termed framework regions (FR).
  • CDR regions can be determined using the Kabat or Chothia numbering systems, both of which are well known to those of skill in the art. See, e.g. Kabat, E. A., et al.
  • Each VH and V L is composed of three CDRs and four FRs, arranged from amino- terminus to carboxy-terminus in the following order: FR1 , CDR1 , FR2, CDR2, FR3, CDR3, FR4. Throughout the present disclosure, the three CDRs of the heavy chain are referred to as H-CDR1 , H-CDR2, and H-CDR3.
  • variable regions of the heavy and light chains contain a binding domain that interacts with an antigen.
  • the constant regions of the antibodies may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (e.g., effector cells) and the first component (Clq) of the classical complement system.
  • the variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D" region of about 10 or more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2 nd ed. Raven Press, N.Y. (1989)).
  • the L chain from any vertebrate species can be assigned to one of two clearly distinct types, called kappa and lambda, based on the amino acid sequences of their constant domains.
  • antibodies can be assigned to different classes or isotypes. There are five classes of antibodies: IgA, IgD, IgE, IgG, and IgM, having heavy chains designated a (alpha), ⁇ (delta), ⁇ (epsilon), ⁇ (gamma), and ⁇ (mu), respectively.
  • the IgG class of antibody can be further classified into four subclasses lgG1 , lgG2, lgG3, and lgG4 by the gamma heavy chains, Y1 - Y4, respectively.
  • antibody derivative or “derivative” of an antibody refers to a molecule that is capable of binding to the same antigen (e.g., 4-1 BB) that the antibody binds to and comprises an amino acid sequence of the antibody linked to an additional molecular entity.
  • the amino acid sequence of the antibody that is contained in the antibody derivative may be a full-length heavy chain, a full-length light chain, any portion or portions of a full-length heavy chain, any portion or portions of the full-length light chain of the antibody, any other fragment(s) of an antibody, or the complete antibody.
  • the additional molecular entity may be a chemical or biological molecule. Examples of additional molecular entities include chemical groups, amino acids, peptides, proteins (such as enzymes, antibodies), and chemical compounds.
  • the additional molecular entity may have any utility, such as for use as a detection agent, label, marker, pharmaceutical or therapeutic agent.
  • the amino acid sequence of an antibody may be attached or linked to the additional molecular entity by chemical coupling, genetic fusion, noncovalent association, or otherwise.
  • antibody derivative also encompasses chimeric antibodies, humanized antibodies, and molecules that are derived from modifications of the amino acid sequences of a 4-1 BB antibody, such as conservation amino acid substitutions, additions, and insertions.
  • antigen-binding fragment or "antigen binding portion” of an antibody refers to one or more portions of an antibody that retain the ability to bind to the antigen that the antibody bonds to (e.g., 4-1 BB).
  • antigen-binding fragment include (i) a Fab fragment, a monovalent fragment consisting of the V L , V H , CL and Cm domains; (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and Cm domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al., Nature 341 :544-546 (1989)), which consists of a VH domain; and (vi) an isolated complementarity determining region (CDR).
  • CDR complementarity determining region
  • binding molecule encompasses (1 ) antibody, (2) antigen-binding fragment of an antibody, and (3) derivative of an antibody, each as defined herein.
  • binding 4-1 BB refers to the binding of a binding molecule, as defined herein, to the human 4-1 BB in an in vitro assay, such as a BIAcore assay as described in Example 6, with an affinity (KD) of 500 nM or less.
  • chimeric antibody refers to an antibody that comprises amino acid sequences derived from different animal species, such as those having a variable region derived from a human antibody and a murine immunoglobulin constant region.
  • Compet for binding refers to the interaction of two antibodies in their binding to a binding target.
  • a first antibody competes for binding with a second antibody if binding of the first antibody with its cognate epitope is detectably decreased in the presence of the second antibody compared to the binding of the first antibody in the absence of the second antibody.
  • the alternative, where the binding of the second antibody to its epitope is also detectably decreased in the presence of the first antibody can, but need not, be the case. That is, a first antibody can inhibit the binding of a second antibody to its epitope without that second antibody inhibiting the binding of the first antibody to its respective epitope.
  • each antibody detectably inhibits the binding of the other antibody with its cognate epitope whether to the same, greater, or lesser extent, the antibodies are said to "cross-compete" with each other for binding of their respective epitope(s).
  • epitope refers to a part of an antigen to which an antibody (or antigen- binding fragment thereof) binds.
  • Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents.
  • An epitope can include various numbers of amino acids in a unique spatial conformation. Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance.
  • germline refers to the nucleotide sequences of the antibody genes and gene segments as they are passed from parents to offspring via the germ cells.
  • the germline sequence is distinguished from the nucleotide sequences encoding antibodies in mature B cells which have been altered by recombination and hypermutation events during the course of B cell maturation.
  • glycosylation sites refers to amino acid residues which are recognized by a eukaryotic cell as locations for the attachment of sugar residues.
  • the amino acids where carbohydrate, such as oligosaccharide, is attached are typically asparagine (N- linkage), serine (O-linkage), and threonine (O-linkage) residues.
  • the specific site of attachment is typically signaled by a sequence of amino acids, referred to herein as a "glycosylation site sequence".
  • the glycosylation site sequence for N-linked glycosylation is: -Asn-X-Ser- or -Asn-X-Thr-, where X may be any of the conventional amino acids, other than proline.
  • N-linked and O-linked refer to the chemical group that serves as the attachment site between the sugar molecule and the amino acid residue. N-linked sugars are attached through an amino group; O-linked sugars are attached through a hydroxyl group.
  • glycan occupancy refers to the existence of a carbohydrate moiety linked to a glycosylation site (i.e., the glycan site is occupied). Where there are at least two potential glycosylation sites on a polypeptide, either none (0-glycan site occupancy), one (1 -glycan site occupancy) or both (2-glycan site occupancy) sites can be occupied by a carbohydrate moiety.
  • host cell refers to a cellular system which can be engineered to generate proteins, protein fragments, or peptides of interest.
  • Host cells include, without limitation, cultured cells, e.g., mammalian cultured cells derived from rodents (rats, mice, guinea pigs, or hamsters) such as CHO, BHK, NSO, SP2/0, YB2/0; or human tissues or hybridoma cells, yeast cells, and insect cells, and cells comprised within a transgenic animal or cultured tissue.
  • rodents rats, mice, guinea pigs, or hamsters
  • rodents rats, mice, guinea pigs, or hamsters
  • rodents rats, mice, guinea pigs, or hamsters
  • rodents rats, mice, guinea pigs, or hamsters
  • rodents rats, mice, guinea pigs, or
  • human antibody refers to an antibody in which the entire amino acid sequences of the light chains and heavy chains are from the human immunoglobulin genes.
  • a human antibody may contain murine carbohydrate chains if produced in a mouse, in a mouse cell or in a hybridoma derived from a mouse cell.
  • Human antibodies may be prepared in a variety of ways known in the art.
  • humanized antibody refers to a chimeric antibody that contains amino acid residues derived from human antibody sequences.
  • a humanized antibody may contain some or all of the CDRs from a non-human animal antibody while the framework and constant regions of the antibody contain amino acid residues derived from human antibody sequences.
  • an antibody refers to any one of the antibodies described in the disclosure and designated as MOR-6032, MOR-7361 , MOR-7480, MOR-7480.1 , MOR-7480.2, MOR-7483, MOR-7483.1 , and MOR-7483.2.
  • These antibodies may be in any class (e.g., IgA, IgD, IgE, IgG, and IgM).
  • each antibody identified above encompasses antibodies in all five classes that have the same amino acid sequences for the V
  • the antibodies in the IgG class may be in any subclass (e.g., lgG1 lgG2, lgG3, and lgG4).
  • each antibody identified above in the IgG subclass encompasses antibodies in all four subclasses that have the same amino acid sequences for the V L and V H regions.
  • the amino acid sequences of the heavy chain constant regions of human antibodies in the five classes, as well as in the four IgG subclasses, are known in the art.
  • the amino acid sequences of the human lgG1 and lgG2 constant regions are provided in SEQ ID NOs: 69 and 71 , respectively.
  • the amino acid sequence of the full length heavy chain for the lgG2 subclass of each of the illustrative antibodies is provided in the disclosure.
  • isolated antibody or "isolated binding molecule” refers to an antibody or a binding molecule, as defined herein, that: (1 ) is not associated with naturally associated components that accompany it in its native state; (2) is free of other proteins from the same species; (3) is expressed by a cell from a different species; or (4) does not occur in nature.
  • isolated antibodies include a 4-1 BB antibody that has been affinity purified using 4-1 BB, a 4-1 BB antibody that has been generated by hybridomas or other cell line in vitro, and a 4-1 BB antibody derived from a transgenic animal.
  • isolated nucleic acid refers to a nucleic acid molecule of genomic, cDNA, or synthetic origin, or a combination thereof, which is separated from other nucleic acid molecules present in the natural source of the nucleic acid.
  • isolated includes nucleic acid molecules which are separated from the chromosome with which the genomic DNA is naturally associated.
  • an "isolated" nucleic acid is free of sequences which naturally flank the nucleic acid (i.e., sequences located at the 5' and 3' ends of the nucleic acid of interest.
  • k a refers to the association rate constant of a particular antibody- antigen interaction
  • k d refers to the dissociation rate constant of a particular antibody-antigen interaction
  • K D refers to the equilibrium dissociation constant of a particular antibody-antigen interaction. It is obtained from the ratio of kd to k a (i.e,. kd/k a ) and is expressed as a molar concentration (M). K D is used as a measure for the affinity of an antibody's binding to its binding partner. The smaller the K D , the more tightly bound the antibody is, or the higher the affinity between antibody and the antigen. For example, an antibody with a nanomolar (nM) dissociation constant binds more tightly to a particular antigen than an antibody with a micromolar ( ⁇ ) dissociation constant. K D values for antibodies can be determined using methods well established in the art.
  • One method for determining the K D of an antibody is by using surface plasmon resonance, typically using a biosensor system such as a Biacore ® system.
  • a biosensor system such as a Biacore ® system.
  • An assay procedure using the BIACORETM system (BIAcore assay) is described in the Examples section of this disclosure.
  • mammal refers to any animal species of the Mammalia class. Examples of mammals include: humans; laboratory animals such as rats, mice, simians and guinea pigs; domestic animals such as cats, dogs, rabbits, cattle, sheep, goats, horses, and pigs; and captive wild animals such as lions, tigers, elephants, and the like.
  • the term "monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations which include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies. The modifier "monoclonal" is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies may be prepared by the hybridoma methodology or may be made using recombinant DNA methods in bacterial, eukaryotic animal or plant cells (see, e.g., U.S. Pat. No. 4,816,567). Monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in Clackson et al., Nature, 352:624-628 (1991 ) and Marks et al., J. Mol. Biol., 222:581 -597 (1991 ), for example.
  • prevent refers to preventing or delaying the onset of the disease, or preventing the manifestation of clinical or subclinical symptoms thereof.
  • recombinant antibody refers to an antibody that is prepared, expressed, created or isolated by recombinant means, such as antibodies isolated from an animal that is transgenic for another species' immunoglobulin genes, antibodies expressed using a recombinant expression vector transfected into a host cell, antibodies isolated from a recombinant, combinatorial antibody library, or antibodies prepared, expressed, created or isolated by any other means that involves splicing of immunoglobulin gene sequences to other DNA sequences.
  • sequence identity between two polypeptide sequences indicates the percentage of amino acids that are identical between the sequences.
  • the amino acid sequence identity of polypeptides can be determined conventionally using known computer programs such as Bestfit, FASTA, or BLAST (see, e.g. Pearson, Methods Enzymol. 183:63-98 (1990); Pearson, Methods Mol. Biol. 132:185-219 (2000); Altschul et al., J. Mol. Biol. 215:403-410 (1990); Altschul et al., Nucelic Acids Res. 25:3389-3402 (1997)).
  • the parameters are set such that the percentage of identity is calculated over the full length of the reference amino acid sequence and that gaps in homology of up to 5% of the total number of amino acid residues in the reference sequence are allowed.
  • This aforementioned method in determining the percentage of identity between polypeptides is applicable to all proteins, fragments, or variants thereof disclosed herein.
  • binding molecule as defined herein, (e.g., an antibody) with its binding partner (e.g., an antigen) refers to the ability of the binding molecule to discriminate between an antigen of interest from an animal species and the antigen orthologue from a different animal species under a given set of conditions.
  • a 4-1 BB binding molecule is said to specifically bind to human 4-1 BB if it binds to human 4-1 BB at an EC50 that is below 50 percent of the EC50 at which it binds 4-1 BB of rat or mouse as determined in an in vitro assay . Binding specificity of an antibody can be determined using methods known in the art. Examples of such methods include FACS using PHA stimulated primary cells, Western blots, ELISA-, RIA-, ECL-, IRMA-tests and peptide scans.
  • binding molecule as defined herein, (e.g., an antibody) with its binding partner (e.g., an antigen) refers to the ability of the binding molecule to discriminate between an antigen of interest from an animal species (such as human 4-1 BB) and a different antigen from the same animal species (such as human CD40) under a given set of conditions.
  • a 4-1 BB binding molecule is said to selectively bind to human 4-1 BB if it binds to human 4-1 BB at an EC50 that is below 10 percent of the EC50 at which it binds to human CD40 or human CD134 as determined in an in vitro assay.
  • the desirable or beneficial effect may include reduced frequency or severity of one or more symptoms of the disease (i.e., tumor growth and/or metastasis, or other effect mediated by the numbers and/or activity of immune cells, and the like), or arrest or inhibition of further development of the disease, condition, or disorder.
  • the desirable or beneficial effect may include inhibition of further growth or spread of cancer cells, death of cancer cells, inhibition of reoccurrence of cancer, reduction of pain associated with the cancer, or improved survival of the mammal.
  • the effect can be either subjective or objective.
  • the mammal may note improved vigor or vitality or decreased pain as subjective symptoms of improvement or response to therapy.
  • the clinician may notice a decrease in tumor size or tumor burden based on physical exam, laboratory parameters, tumor markers or radiographic findings.
  • Some laboratory signs that the clinician may observe for response to treatment include normalization of tests, such as white blood cell count, red blood cell count, platelet count, erythrocyte sedimentation rate, and various enzyme levels.
  • the clinician may observe a decrease in a detectable tumor marker.
  • other tests can be used to evaluate objective improvement, such as sonograms, nuclear magnetic resonance testing and positron emissions testing.
  • vector refers to a nucleic acid molecule capable of transporting a foreign nucleic acid molecule.
  • the foreign nucleic acid molecule is linked to the vector nucleic acid molecule by a recombinant technique, such as ligation or recombination. This allows the foreign nucleic acid molecule to be multiplied, selected, further manipulated or expressed in a host cell or organism.
  • a vector can be a plasmid, phage, transposon, cosmid, chromosome, virus, or virion.
  • One type of vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome (e.g., non-episomal mammalian vectors).
  • vectors are capable of autonomous replication in a host cell into which it is introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
  • expression vectors generally have control sequences that drive expression of the expressible foreign nucleic acids.
  • Simpler vectors known as “transcription vectors,” are only capable of being transcribed but not translated: they can be replicated in a target cell but not expressed.
  • the term “vector” encompasses all types of vectors regardless of their function. Vectors capable of directing the expression of expressible nucleic acids to which they are operatively linked are commonly referred to "expression vectors.”
  • the present disclosure provides isolated binding molecules that bind to human 4- 1 BB, including 4-1 BB antibodies, antigen-binding fragments of the 4-1 BB antibodies, and derivatives of the 4-1 BB antibodies.
  • the present disclosure provides an isolated antibody that binds to human 4-1 BB at an epitope within amino acid residues 1 15 - 156 of SEQ ID No: 68.
  • the isolated antibody comprises the H-CDR1 amino acid sequence of SEQ ID NO: 29, H-CDR2 amino acid sequence of SEQ ID NO: 30, and H- CDR3 amino acid sequence of SEQ ID NO: 31 .
  • the isolated antibody comprises the L-CDR1 amino acid sequence of SEQ ID NO: 34, L- CDR2 amino acid sequence of SEQ ID NO: 35, and L-CDR3 amino acid sequence of SEQ ID NO: 36.
  • the antibodies described herein above have one or more biological properties described herein below.
  • the disclosure provides an isolated antibody that binds to human 4-1 BB, wherein said antibody comprises: (a) an H-CDR1 as set forth in SEQ ID NO:1 , SEQ ID NO:15, or SEQ ID NO:29; (b) an H-CDR2 as set forth in SEQ ID NO:2, SEQ ID NO: 16, or SEQ ID NO:30; and (c) an H-CDR3 as set forth in SEQ ID NO:3, SEQ ID NO: 17, or SEQ I D NO:31.
  • the disclosure provides an isolated antibody that binds to human 4-1 BB, wherein said antibody comprises: (a) an L-CDR1 as set forth in SEQ ID NO:6, SEQ ID NO: 20, or SEQ ID NO:34; (b) an L-CDR2 as set forth in SEQ ID NO:7, SEQ ID NO:21 , or SEQ ID NO:35; and (c) an L-CDR3 as set forth in SEQ ID NO:8, SEQ ID NO:22, SEQ ID NO:36, or SEQ ID NO: 55.
  • an L-CDR1 as set forth in SEQ ID NO:6, SEQ ID NO: 20, or SEQ ID NO:34
  • an L-CDR2 as set forth in SEQ ID NO:7, SEQ ID NO:21 , or SEQ ID NO:35
  • an L-CDR3 as set forth in SEQ ID NO:8, SEQ ID NO:22, SEQ ID NO:36, or SEQ ID NO: 55.
  • the disclosure provides an isolated antibody that binds to human 4-1 BB, wherein said antibody comprises: (a) an H-CDR1 as set forth in SEQ ID NO:1 , SEQ ID NO:15, or SEQ ID NO:29; (b) an H-CDR2 as set forth in SEQ ID NO:2, SEQ ID NO: 16, or SEQ ID NO:30; and (c) an H-CDR3 as set forth in SEQ ID NO:3, SEQ ID NO: 17, or SEQ ID NO:31 ; and further comprises: (d) an L-CDR1 as set forth in SEQ ID NO:6, SEQ ID NO: 20, or SEQ ID NO:34; (e) an L-CDR2 as set forth in SEQ ID NO:7, SEQ ID NO:21 , or SEQ ID NO:35; and (f) an L-CDR3 as set forth in SEQ ID NO:8, SEQ ID NO:22, SEQ ID NO:36, or SEQ ID NO: 55.
  • the disclosure provides an isolated antibody that binds to human 4-1 BB, wherein said antibody is selected from the group consisting of:
  • an antibody comprising an H-CDR1 as set forth in SEQ ID NO:29, an H-CDR2 as set forth in SEQ ID NO:30, and an H-CDR3 as set forth in SEQ ID NO:31.
  • the disclosure provides an isolated antibody that binds to human 4-1 BB, wherein said antibody is selected from the group consisting of: (a) an antibody comprising an L-CDR1 as set forth in SEQ ID NO:6, an L-CDR2 as set forth in SEQ ID NO:7, and an L-CDR3 as set forth in SEQ I D NO:8;
  • an antibody comprising an L-CDR1 as set forth in SEQ ID NO:20, an L-CDR2 as set forth in SEQ ID NO:21 , and an L-CDR3 as set forth in SEQ ID NO:22;
  • an antibody comprising an L-CDR1 as set forth in SEQ ID NO:34, an L-CDR2 as set forth in SEQ ID NO:35, and an L-CDR3 as set forth in SEQ ID NO:36;
  • an antibody comprising an L-CDR1 as set forth in SEQ ID NO:34, an L-CDR2 as set forth in SEQ ID NO:35, and an L-CDR3 as set forth in SEQ ID NO:55.
  • the disclosure provides an isolated antibody that binds to the human 4-1 BB, wherein said antibody is selected from the group consisting of:
  • an antibody comprising an H-CDR1 as set forth in SEQ ID NO:1 , an H-CDR2 as set forth in SEQ ID NO:2, an H-CDR3 as set forth in SEQ ID NO:3; an L-CDR1 as set forth in SEQ ID NO:6, an L-CDR2 as set forth in SEQ ID NO:7, and an L-CDR3 as set forth in SEQ ID NO:8;
  • an antibody comprising an H-CDR1 as set forth in SEQ ID NO:15, an H-CDR2 as set forth in SEQ ID NO: 16, an H-CDR3 as set forth in SEQ ID NO:17; an L-CDR1 as set forth in SEQ ID NO:20, an L-CDR2 as set forth in SEQ ID NO:21 , and an L-CDR3 as set forth in SEQ ID NO:22;
  • an antibody comprising an H-CDR1 as set forth in SEQ ID NO:29, an H- CDR2 as set forth in SEQ ID NO:30, an H-CDR3 as set forth in SEQ ID NO:31 ; an L- CDR1 as set forth in SEQ ID NO:34, an L-CDR2 as set forth in SEQ ID NO:35, and an L-CDR3 as set forth in SEQ ID NO:36; and
  • an antibody comprising an H-CDR1 as set forth in SEQ ID NO:29, an H-CDR2 as set forth in SEQ ID NO:30, an H-CDR3 as set forth in SEQ ID NO:31 ; an L-CDR1 as set forth in SEQ ID NO:34, an L-CDR2 as set forth in SEQ ID NO:35, and an L-CDR3 as set forth in SEQ ID NO:55.
  • the disclosure provides an isolated antibody that binds to human 4-1 BB, wherein said antibody comprises a V H chain amino acid sequence as set forth in SEQ ID NO:4, SEQ ID NO:18, SEQ ID NO:32, or SEQ ID NO:43 .
  • the disclosure provides an isolated antibody that binds to human 4-1 BB, wherein said antibody comprises a V L chain amino acid sequence as set forth in SEQ ID NO:9, SEQ ID NO:23, SEQ ID NO:37, SEQ ID NO:45, SEQ ID NO:51 , SEQ ID NO:56, SEQ ID NO:60, or SEQ ID NO:64 .
  • the disclosure provides an isolated antibody that binds to human 4-1 BB, wherein said antibody comprises (1 ) a V H chain amino acid sequence as set forth in SEQ ID NO:4, SEQ ID NO:18 , SEQ ID NO:32, or SEQ ID NO:43, and (2) a VL chain amino acid sequence as set forth in SEQ ID NO:9, SEQ ID NO:23, SEQ ID NO:37, SEQ ID NO:45, SEQ ID NO:51 , SEQ ID NO:56, SEQ ID NO:60, or SEQ ID NO:64 .
  • the disclosure provides an isolated antibody that binds to human 4-1 BB, wherein said antibody is selected from the group consisting of:
  • an antibody comprising a V H chain amino acid sequence as set forth in SEQ ID NO:32 and a V L chain amino acid sequence as set forth in SEQ ID NO:37 or SEQ ID NO 56;
  • an antibody comprising a V H chain amino acid sequence as set forth in SEQ ID NO:43 and a V L chain amino acid sequence as set forth in SEQ ID NO:45, SEQ ID NO:51 , SEQ ID NO: 60, or SEQ ID NO: 64.
  • the antibodies described herein above including antibodies described with reference to epitope binding and antibodies described with reference to specific amino acid sequences of CDRs or variable regions, have at least one of the following functional properties: (a) bind to human 4-1 BB with a K D of 500 nM or less; (b) have agonist activity on human 4-1 BB; (c) do not bind to human CD40 receptor at concentration up to 1000 nM; (d) do not bind to human CD134 receptor at concentrations up to 1000 nM; (e) do not bind to rat, or mouse 4-1 BB at concentrations up to 100 nM; (h) are capable of inhibiting tumor cell growth; and (i) have therapeutic effect on a cancer.
  • the antibodies specifically bind to human 4-1 BB with a K D of 500 nM or less, 100 nM or less, 50 nM or less, 10 nM or less, 5 nM or less, or 1 nM or less, for the human 4-1 BB extracellular domain as measured with the BIACore assay described in this disclosure.
  • the antibody is a human antibody or humanized antibody that specifically binds to human 4- 1 BB with a K D of 500 nM or less, 100 nM or less, 50 nM or less, 10 nM or less, 5 nM or less, or 1 nM or less, for the human 4-1 BB extracellular domain as measured with the BIACore assay described in this disclosure.
  • the antibody is a human antibody that specifically and selectively binds to human 4-1 BB.
  • the antibodies described herein above comprise a heavy chain variable region from a particular germline heavy chain immunoglobulin gene and/or a light chain variable region from a particular germline light chain immunoglobulin gene, such as an antibody comprising a heavy chain variable region that is the product of, or derived from, a human V H 1-69 gene, V H 3-23 gene, or V H 5 gene.
  • exemplary antibodies include MOR-7480.1 , MOR-7480.2, MOR-7483.1 , and MOR-7483.2, each of which contains amino acids that derived from human germline V H 5 gene.
  • the antibodies described herein above comprise a light chain variable region that is derived from a human V L A3 gene.
  • the antibodies described herein above comprise a heavy chain variable region that is the product of, or derived from, a human V H 1-69 gene, V H 3-23 gene, or VH 5 gene, and further comprise a light chain variable region that is the product of, or derived from, a human V L A3 gene, wherein the antibody or portion thereof specifically binds to human 4-1 BB.
  • Exemplary antibodies include MOR-7480.1 , MOR-7480.2, MOR-7483.1 , and MOR-7483.2, each of which contains amino acids that derived from human germline V H 5 gene and V L A3 gene, respectively.
  • a human antibody comprises heavy or light chain variable regions that is "derived from” a particular germline sequence if the variable regions of the antibody are obtained from a system that uses human germline immunoglobulin genes.
  • Such systems include immunizing a transgenic mouse carrying human immunoglobulin genes with the antigen of interest or screening a human immunoglobulin gene library displayed on phage with the antigen of interest.
  • a human antibody that is "derived from” a human germline immunoglobulin sequence can be identified as such by comparing the amino acid sequence of the human antibody to the amino acid sequences of human germline immunoglobulins and selecting the human germline immunoglobulin sequence that is closest in sequence (i.e., greatest % identity) to the sequence of the human antibody.
  • a human antibody that is "derived from" a particular human germline immunoglobulin sequence may contain amino acid differences as compared to the germline sequence, due to, for example, naturally- occurring somatic mutations or intentional introduction of site-directed mutation.
  • a selected human antibody typically is at least 90% identical in amino acid sequence to an amino acid sequence encoded by a human germline immunoglobulin gene and contains amino acid residues that identify the human antibody as being human when compared to the germline immunoglobulin amino acid sequences of other species ⁇ e.g., murine germline sequences).
  • a human antibody may be at least 95%, or even at least 96%, 97%, 98%, or 99% identical in amino acid sequence to the amino acid sequence encoded by the germline immunoglobulin gene.
  • the human antibody is identical in amino acid sequence to the amino acid sequence encoded by the germline Ig gene.
  • a human antibody derived from a particular human germline sequence will display no more than 10 amino acid differences from the amino acid sequence encoded by the human germline immunoglobulin gene.
  • the human antibody may display no more than 5, or even no more than 4, 3, 2, or 1 amino acid differences from the amino acid sequence encoded by the germline immunoglobulin gene. Alignments of the amino acid sequences of variable regions of the illustrative antibodies and the relevant germlines are provided in Figure 6.
  • the disclosure provides isolated antibodies that compete or cross-compete for binding to human 4-1 BB with any of the illustrative antibodies of the disclosure, such as MOR-6032, MOR-7361 , MOR-7480, MOR-7480.1 , MOR-7480.2, MOR-7483, MOR-7483.1 , or MOR-7483.2.
  • the disclosure provides isolated antibodies that compete or cross-compete for binding to the same epitope on the human 4-1 BB with any of the illustrative antibodies of the disclosure.
  • the ability of an antibody to compete cross-compete for binding with another antibody can be determined using standard binding assays known in the art, such as BIAcore analysis, ELISA assays, or flow cytometry.
  • an illustrative antibody of the disclosure can bind to human 4-1 BB under saturating conditions and then measure the ability of the test antibody to bind to the 4-1 BB. If the test antibody is able to bind to the 4-1 BB at the same time as the illustrative antibody, then the test antibody binds to a different epitope as the illustrative antibody. However, if the test antibody is not able to bind to the 4-1 BB at the same time, then the test antibody binds to the same epitope, an overlapping epitope, or an epitope that is in close proximity to the epitope bound by the illustrative antibody. This experiment can be performed using various methods, such as ELISA, RIA, FACS or surface plasmon resonance.
  • the 4-1 BB antibodies described herein can be in any class, such as IgG, IgM, IgE, IgA, or IgD. It is preferred that the 4-1 BB antibodies are in the IgG class, such as lgG1 , lgG2, lgG3, or lgG4 subclass, more preferably lgG2 subclass.
  • a 4-1 BB antibody can be converted from one class or subclass to another class or subclass using methods known in the art.
  • An exemplary method for producing an antibody in a desired class or subclass comprises the steps of isolating a nucleic acid encoding a heavy chain of an 4-1 BB antibody and a nucleic acid encoding a light chain of a 4-1 BB antibody, isolating the sequence encoding the V H region, ligating the V H sequence to a sequence encoding a heavy chain constant region of the desired class or subclass, expressing the light chain gene and the heavy chain construct in a cell, and collecting the 4-1 BB antibody.
  • antibodies provided by the present disclosure can be monoclonal or polyclonal, but preferably monoclonal.
  • Examples of specific isolated antibodies provided by the present disclosure include the following illustrative antibodies: MOR-6032, MOR-7361 , MOR-7480, MOR-
  • nucleotide and amino acid sequences of the heavy chain variable region, full length heavy chain for the lgG2 subclass, light chain variable region, and full length light chain of these antibodies are provided in this disclosure; an index of the SEQ ID NOs for these sequences is provided in Table 1.
  • amino acid sequences of the CDRs of these illustrative antibodies are shown in Table 2.
  • Antibodies of the present disclosure can be produced by techniques known in the art, including conventional monoclonal antibody methodology e.g., the standard somatic cell hybridization technique (See e.g., Kohler and Milstein, Nature 256:495 (1975), viral or oncogenic transformation of B lymphocytes, or recombinant antibody technologies as described in detail herein below.
  • conventional monoclonal antibody methodology e.g., the standard somatic cell hybridization technique (See e.g., Kohler and Milstein, Nature 256:495 (1975), viral or oncogenic transformation of B lymphocytes, or recombinant antibody technologies as described in detail herein below.
  • Hybridoma production is a very well-established procedure.
  • the common animal system for preparing hybridomas is the murine system. Immunization protocols and techniques for isolation of immunized splenocytes for fusion are known in the art. Fusion partners (e.g., murine myeloma cells) and fusion procedures are also known.
  • One well-known method that may be used for making human 4-1 BB antibodies provided by the present disclosure involves the use of a XenoMouseTM animal system. XenoMouseTM mice are engineered mouse strains that comprise large fragments of human immunoglobulin heavy chain and light chain loci and are deficient in mouse antibody production.
  • the animal is immunized with a 4-1 BB antigen.
  • the 4-1 BB antigen is isolated and/or purified 4-1 BB, preferably 4-1 BB. It may be a fragment of 4-1 BB, such as the extracellular domain of 4-1 BB, particularly a 4-1 BB extracellular domain fragment comprising amino acid resides 1 15 - 156 of SEQ ID NO: 68.
  • Immunization of animals can be carried out by any method known in the art. See, e.g., Harlow and Lane, Antibodies: A Laboratory Manual, New York: Cold Spring Harbor Press, 1990.
  • the 4-1 BB antigen may be administered with an adjuvant to stimulate the immune response.
  • adjuvants include complete or incomplete Freund's adjuvant, RIBI (muramyl dipeptides) or ISCOM (immunostimulating complexes).
  • lymph node and/or splenic B cells are immortalized.
  • Methods of immortalizing cells include, but are not limited to, transferring them with oncogenes, inflecting them with the oncogenic virus cultivating them under conditions that select for immortalized cells, subjecting them to carcinogenic or mutating compounds, fusing them with an immortalized cell, e.g., a myeloma cell, and inactivating a tumor suppressor gene. See, e.g., Harlow and Lane, supra. If fusion with myeloma cells is used, the myeloma cells preferably do not secrete immunoglobulin polypeptides (a non-secretory cell line).
  • Immortalized cells are screened using 4-1 BB, a portion thereof, or a cell expressing 4-1 BB.
  • 4-1 BB antibody-producing cells e.g., hybridomas
  • Hybridomas can be expanded in vivo in syngeneic animals, in animals that lack an immune system, e.g., nude mice, or in cell culture in vitro. Methods of selecting, cloning and expanding hybridomas are well known to those of ordinary skill in the art.
  • Antibodies of the disclosure can also be prepared using phage display methods.
  • phage display methods for isolating human antibodies are established in the art, such as the HuCAL ® Libraries as described further in Example 1. See also, for example: Achim Knappik, et al: Fully Synthetic Human Combinatorial Antibody Libraries (HuCAL) Based on Modular Consensus Frameworks and CDRs Randomized with Trinucleotides. J. Mol. Biol. (2000) 296, 57-86.
  • the present disclosure provides antigen-binding fragments of any of the 4-1 BB antibodies provided by the present disclosure.
  • the antigen-binding fragment may comprise any sequences of the antibody.
  • the antigen-binding fragment comprises the amino acid sequence of: (1 ) a light chain of a 4-1 BB antibody; (2) a heavy chain of a 4-1 BB antibody; (3) a variable region from the light chain of a 4-1 BB antibody; (4) a variable region from the heavy chain of a 4-1 BB antibody; (5) one or more CDRs (two, three, four, five, or six CDRs) of a 4-1 BB antibody; or (6) three CDRs from the light chain and three CDRs from the heavy chain of a 4-1 BB antibody.
  • the disclosure provides an antigen-binding fragment of an antibody selected from: MOR-6032, MOR-7361 , MOR-7480, MOR- 7480.1 , MOR-7480.2, MOR-7483, MOR-7483.1 , or MOR-7483.2.
  • the antigen-binding fragments of an 4- 1 BB antibody include: (i) a Fab fragment, which is a monovalent fragment consisting of the V
  • scFv single chain antibody
  • the antigen-binding fragment is a Fab fragment selected from the group consisting of Fab-6032, Fab-7361 , Fab-7480, and Fab-7483.
  • the present disclosure provides derivatives of any of the 4-1 BB antibodies provided by the present disclosure.
  • the antibody derivative is derived from modifications of the amino acid sequences of an illustrative antibody ("parent antibody") of the disclosure while conserving the overall molecular structure of the parent antibody amino acid sequence.
  • Amino acid sequences of any regions of the parent antibody chains may be modified, such as framework regions, CDR regions, or constant regions. Types of modifications include substitutions, insertions, deletions, or combinations thereof, of one or more amino acids of the parent antibody.
  • the antibody derivative comprises an V H region that is at least 65%, at least 75%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to an amino acid sequence as set forth in any of SEQ ID NOs: 4, 18, 32, or 43.
  • the antibody derivative comprises an V L region that is at least 65%, at least 75%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to an amino acid sequence as set forth in any of SEQ ID NOs: 9, 23, 37, 45, 51 , 56, 60, or 64.
  • the derivative comprises 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15 conservative or non- conservative substitutions, and/or 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 12, 13, 14, or 15 additions and/or deletions to an amino acid sequence as set forth in any of SEQ ID NOs: 4, 18, 32, 43, 9, 23, 37, 45, 51 , 56, 60, or 64.
  • Amino acid substitutions encompass both conservative substitutions and non- conservative substitutions.
  • conservative amino acid substitution means a replacement of one amino acid with another amino acid where the two amino acids have similarity in certain physico-chemical properties such as polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues involved.
  • substitutions typically may be made within each of the following groups: (a) nonpolar (hydrophobic) amino acids, such as alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, and methionine; (b) polar neutral amino acids, such as glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine; (c) positively charged (basic) amino acids, such as arginine, lysine, and histidine; and (d) negatively charged (acidic) amino acids, such as aspartic acid and glutamic acid.
  • nonpolar amino acids such as alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, and methionine
  • polar neutral amino acids such as glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine
  • the present disclosure provides an antibody derivative that contains the V H and V
  • framework sequences can be obtained from public DNA databases or published references that include germline antibody gene sequences.
  • germline DNA sequences for human heavy and light chain variable region genes can be found in the Genbank database or in the "VBase" human germline sequence database (Kabat, E. A., et al., Sequences of Proteins of Immunological Interest, Fifth Edition, U.S.
  • Framework sequences that may be used in constructing an antibody derivative include those that are structurally similar to the framework sequences used by illustrative antibodies of the disclosure, e.g., similar to the V H 3-23 framework sequences and/or the V L A3 or A1 -13 framework sequences used by illustrative antibodies of the disclosure.
  • the H-CDR1 , H-CDR2, and H-CDR3 sequences, and the L- CDR1 , L-CDR2, and L-CDR3 sequences of an illustrative antibody can be grafted onto framework regions that have the identical sequence as that found in the germline immunoglobulin gene from which the framework sequence derive, or the CDR sequences can be grafted onto framework regions that contain one or more mutations as compared to the germline sequences.
  • the antibody derivative is a chimeric antibody which comprises an amino acid sequence of an illustrative antibody of the disclosure.
  • one or more CDRs from one or more illustrative human antibodies are combined with CDRs from an antibody from a non-human animal, such as mouse or rat.
  • all of the CDRs of the chimeric antibody are derived from one or more illustrative antibodies.
  • the chimeric antibody comprises one, two, or three CDRs from the heavy chain variable region or from the light chain variable region of an illustrative antibody. Chimeric antibodies can be generated using conventional methods known in the art.
  • Another type of modification is to mutate amino acid residues within the CDR1 , CDR2 and/or CDR3 regions of the V H and/or V L chain.
  • Site-directed mutagenesis or PCR-mediated mutagenesis can be performed to introduce the mutation(s) and the effect on antibody binding, or other functional property of interest, can be evaluated in in vitro or in vivo assays known in the art. Typically, conservative substitutions are introduced.
  • the mutations may be amino acid additions and/or deletions. Moreover, typically no more than one, two, three, four or five residues within a CDR region are altered.
  • the antibody derivative comprises 1 , 2, 3, or 4 amino acid substitutions in the H-CDRs and/or in the light chain CDRs.
  • the amino acid substitution is to change one or more cysteines in an antibody to another residue, such as, without limitation, alanine or serine.
  • the cysteine may be a canonical or non-canonical cysteine.
  • the antibody derivative has 1 , 2, 3, or 4 conservative amino acid substitutions in the H-CDR regions relative to the amino acid sequences of an illustrative antibody.
  • _ regions are made to decrease the immunogenicity of the antibody.
  • One approach is to "backmutate" one or more framework residues to the corresponding germline sequence.
  • An antibody that has undergone somatic mutation may contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody framework sequences to the germline sequences from which the antibody is derived.
  • the somatic mutations can be "backmutated" to the germline sequence by, for example, site-directed mutagenesis or PCR-mediated mutagenesis.
  • modifications may also be made within the Fc region of an illustrative antibody, typically to alter one or more functional properties of the antibody, such as serum half-life, complement fixation, Fc receptor binding, and/or antigen-dependent cellular cytotoxicity.
  • the hinge region of CH1 is modified such that the number of cysteine residues in the hinge region is altered, e.g., increased or decreased. This approach is described further in U.S. Patent No. 5,677,425.
  • the number of cysteine residues in the hinge region of CH1 is altered to, for example, facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
  • the Fc hinge region of an antibody is mutated to decrease the biological half life of the antibody.
  • an antibody of the disclosure may be modified to alter its potential glycosylation site or pattern.
  • Both illustrative antibodies MOR-7480 and MOR-7483, and any germlined variants thereof, and antibodies that comprise the amino acid sequences of the heavy chain variable region of MOR-7480 and MOR-7483 comprise a potential N-linked glycosylation site (NYS) at asparagine 59 in the heavy chain variable domain.
  • IgG versions of these antibodies further comprise a second N-linked glycosylation site in the heavy chain Fc domain. More specifically, for the lgG2 version of these antibodies, the Fc N-linked glycosylation site (NST) occurs at asparagine 292 in the heavy chain CH2 domain.
  • NST Fc N-linked glycosylation site
  • each heavy chain can comprise 0-, 1- (at either Fab or Fc) or 2- glycan occupancy such that an antibody comprising two heavy and two light chains can comprise any combination ranging from 0-glycan occupancy (i.e., no glycosylation at any of four potential glycosylation sites) to 4-glycan occupancy (i.e., glycosylated at both Fab and Fc sites in each chain).
  • the present disclosure provide an derivative of an 4-1 BB antibody of the disclosure that contains at least one mutation in an variable region of a light chain or heavy chain that changes the pattern of glycosylation in the variable region.
  • Such an antibody derivative may have an increased affinity and/or a modified specificity for binding an antigen.
  • the mutations may add a novel glycosylation site in the V region, change the location of one or more V region glycosylation site(s), or remove a pre-existing V region glycosylation site.
  • the present disclosure provides a derivative of an 4-1 BB antibody having a potential N-linked glycosylation site at asparagine 59 in the heavy chain variable region, wherein the potential N-linked glycosylation site in one heavy chain variable region is removed.
  • the present disclosure provides a derivative of a 4- 1 BB antibody having a potential N-linked glycosylation site at asparagine 59 in the heavy chain variable region, wherein the potential N-linked glycosylation site in both heavy chain variable regions is removed.
  • the present disclosure provides an antibody derivative that comprises a 4-1 BB antibody, or antigen-binding fragment thereof, as described herein, linked to an additional molecular entity.
  • additional molecular entities include pharmaceutical agents, peptides or proteins, detection agent or labels, and antibodies.
  • the antibody derivative comprises an antibody of the disclosure linked to a pharmaceutical agent.
  • pharmaceutical agents include cytotoxic agents or other cancer therapeutic agents, and radioactive isotopes.
  • cytotoxic agents include taxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1 -dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologs thereof.
  • Therapeutic agents also include, for example, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6- thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechlorethamine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and anti-mitotic agents (e.g.,
  • radioactive isotopes that can be conjugated to antibodies for use diagnostically or therapeutically include, but are not limited to, iodine 131 , indium 111 , yttrium 90 and lutetium 177 .
  • Methods for linking an antibody to a pharmaceutical agent are known in the art, such as using various linker technologies. Examples of linker types include hydrazones, thioethers, esters, disulfides and peptide-containing linkers.
  • linkers and methods for linking therapeutic agents to antibodies see also Saito et al., Adv. Drug Deliv. Rev. 55:199-215 (2003); Trail, et al., Cancer Immunol. Immunother.
  • the antibody derivative is a 4-1 BB antibody multimer, which is a multimeric form of a 4-1 BB antibody, such as antibody dimers, trimers, or higher-order multimers of monomeric antibodies.
  • Individual monomers within an antibody multimer may be identical or different.
  • individual antibodies within a multimer may have the same or different binding specificities.
  • Multimerization of antibodies may be accomplished through natural aggregation of antibodies. For example, some percentage of purified antibody preparations (e.g., purified lgG1 molecules) spontaneously form protein aggregates containing antibody homodimers, and other higher-order antibody multimers.
  • antibody homodimers may be formed through chemical linkage techniques known in the art, such as through using crosslinking agents. Suitable crosslinkers include those that are heterobifunctional, having two distinctly reactive groups separated by an appropriate spacer (such as m-maleimidobenzoyl-N-hydroxysuccinimide ester, succinimidyl 4-
  • a "single-chain antibody” consists of a single polypeptide chain comprising a V L domain linked to a V H domain wherein V L domain and V H domain are paired to form a monovalent molecule.
  • Single chain antibody can be prepared according to method known in the art (see, for example, Bird et al., (1988) Science 242:423-426 and Huston et al., (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
  • a “diabody” consists of two chains, each chain comprising a heavy chain variable region connected to a light chain variable region on the same polypeptide chain connected by a short peptide linker, wherein the two regions on the same chain do not pair with each other but with complementary domains on the other chain to form a bispecific molecule.
  • Methods of preparing diabodies are known in the art (See, e.g., Holliger P. et al., (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448, and Poljak R. J. et al., (1994) Structure 2:1 121 -1 123).
  • Domain antibodies are small functional binding units of antibodies, corresponding to the variable regions of either the heavy or light chains of antibodies. Domain antibodies are well expressed in bacterial, yeast, and mammalian cell systems. Further details of domain antibodies and methods of production thereof are known in the art (see, for example, U.S. Patent Nos. 6,291 , 158; 6,582,915; 6,593,081 ; 6, 172,197; 6,696,245; European Patents 0368684 & 0616640; WO05/035572, WO04/101790, WO04/081026, WO04/058821 , WO04/003019 and WO03/002609). Nanobodies are derived from the heavy chains of an antibody.
  • a nanobody typically comprises a single variable domain and two constant domains (CH2 and CH3) and retains antigen-binding capacity of the original antibody.
  • Nanobodies can be prepared by methods known in the art (See e.g., U.S. Patent No. 6,765,087, U.S. Patent No. 6,838,254, WO 06/079372). Unibodies consist of one light chain and one heavy chain of a lgG4 antibody. Unibodies may be made by the removal of the hinge region of lgG4 antibodies. Further details of unibodies and methods of preparing them may be found in WO2007/059782.
  • nucleic acid molecule that comprises a nucleotide sequence encoding an amino acid sequence of a binding molecule provided by the present disclosure.
  • the amino acid sequence encoded by the nucleotide sequence may be any portion of an antibody, such as a CDR, a sequence comprising one, two, or three CDRs, a variable region of a heavy chain, variable region of a light chain, or may be a full-length heavy chain or full length light chain.
  • a nucleic acid of the disclosure can be, for example, DNA or RNA, and may or may not contain intronic sequences.
  • the nucleic acid is a cDNA molecule.
  • the disclosure provides an isolated nucleic acid molecule that comprises or consists of a nucleotide sequence encoding an amino acid sequence selected from the group consisting of: (1 ) amino acid sequence of a H-CDR3 or L- CRD3 of an illustrative antibody; (2) a variable region of a heavy chain or variable region of a light chain of an illustrative antibody; or (3) a full length heavy chain or full length light chain of an illustrative antibody.
  • the nucleic acid molecule comprises or consists of a nucleotide sequence that encodes an amino acid sequence as set forth in any one of SEQ I D NOs: 1 - 10, 15- 24, 29 - 38, 43, 44, 45, 46, 51 , 52, 55-57, 60, 61 , 64, and 65.
  • the nucleic acid molecule comprises or consists of nucleotide sequence selected from the group consisting of SEQ I D NOs: 1 1 -14, 25-28, 39-42, 47-50, 53, 54, 58, 59, 62, 63, 66, and 67.
  • Nucleic acids of the disclosure can be obtained using any suitable molecular biology techniques.
  • cDNAs encoding the light and heavy chains of the antibody made by the hybridoma can be obtained by PCR amplification or cDNA cloning techniques.
  • the nucleic acid encoding the antibody can be recovered from the library.
  • the isolated DNA encoding the V H region can be converted to a full-length heavy chain gene by operatively linking the V H -encoding DNA to another DNA molecule encoding heavy chain constant regions (CH1 , CH2 and CH3).
  • the sequences of human heavy chain constant region genes are known in the art (see e.g., Kabat el al. (1991 ) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91 -3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification.
  • the heavy chain constant region can be an IgG 1 , lgG2, lgG3, lgG4, IgA, IgE, IgM or IgD constant region, but most preferably is an lgG1 or lgG4 constant region.
  • the lgG1 constant region sequence can be any of the various alleles or allotypes known to occur among different individuals, such as Gm(1 ), Gm(2), Gm(3), and Gm(17). These allotypes represent naturally occurring amino acid substitution in the lgG1 constant regions.
  • the V H -encoding DNA can be operatively linked to another DNA molecule encoding only the heavy chain CH 1 constant region.
  • the isolated DNA encoding the V L region can be converted to a full-length light chain gene (as well as a Fab light chain gene) by operatively linking the V L -encoding DNA to another DNA molecule encoding the light chain constant region, CL.
  • the sequences of human light chain constant region genes are known in the art (see e.g., Kabat et al. (1991 ) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242) and DNA fragments encompassing these regions can be obtained by standard PCR amplification.
  • the light chain constant region can be a kappa or lambda constant region.
  • the V H - and V L -encoding DNA fragments are operatively linked to another fragment encoding a flexible linker, e.g., encoding the amino acid sequence (Gly 4 -Ser) 3 , such that the V H and V L sequences can be expressed as a contiguous single-chain protein, with the V L and V H regions joined by the flexible linker (see e.g., Bird et al., Science 242:423-426 (1988); Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883 (1988); and McCafferty et al., Nature 348:552-554 (1990)).
  • a flexible linker e.g., encoding the amino acid sequence (Gly 4 -Ser) 3 , such that the V H and V L sequences can be expressed as a contiguous single-chain protein, with the V L and V H regions joined by the flexible linker (see e.g.,
  • the present disclosure further provides a vector that comprises a nucleic acid molecule provided by the present disclosure.
  • the nucleic acid molecule may encode a portion of a light chain or heavy chain (such as a CDR or a variable region), a full-length light or heavy chain, polypeptide that comprises a portion or full-length of a heavy or light chain, or an amino acid sequence of an antibody derivative or antigen-binding fragment.
  • the vector is an expression vector useful for the expression of a binding molecule, such as an antibody or an antigen binding fragment thereof.
  • DNAs encoding partial or full- length light and heavy chains are inserted into expression vectors such that the DNA molecules are operatively linked to transcriptional and translational control sequences.
  • operatively linked means that an antibody gene is ligated into a vector such that transcriptional and translational control sequences within the vector serve their intended function of regulating the transcription and translation of the DNA molecule.
  • the expression vector and expression control sequences are chosen to be compatible with the expression host cell used.
  • the antibody light chain gene and the antibody heavy chain gene can be inserted into separate vector or, more typically, both genes are inserted into the same expression vector.
  • the antibody genes are inserted into the expression vector by any suitable methods (e.g., ligation of complementary restriction sites on the antibody gene fragment and vector, or blunt end ligation if no restriction sites are present).
  • the light and heavy chain variable regions of the antibodies described herein can be used to create full-length antibody genes of any antibody isotype and subclass by inserting them into expression vectors already encoding heavy chain constant and light chain constant regions of the desired isotype and subclass such that the V H segment is operatively linked to the CH segment(s) within the vector and the V K segment is operatively linked to the CL segment within the vector.
  • the recombinant expression vector can encode a signal peptide that facilitates secretion of the antibody chain from a host cell.
  • the antibody chain gene can be cloned into the vector such that the signal peptide is linked in-frame to the amino terminus of the antibody chain gene.
  • the signal peptide can be an immunoglobulin signal peptide or a heterologous signal peptide ⁇ i.e., a signal peptide from a non-immunoglobulin protein).
  • the expression vectors of the disclosure typically carry regulatory sequences that control the expression of the antibody chain genes in a host cell.
  • regulatory sequence is intended to include promoters, enhancers and other expression control elements (e.g., polyadenylation signals) that control the transcription or translation of the antibody chain genes.
  • Such regulatory sequences are described, for example, in Goeddel (Gene Expression Technology. Methods in Enzymology 185, Academic Press, San Diego, CA (1990)). It will be appreciated by those skilled in the art that the design of the expression vector, including the selection of regulatory sequences, may depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc.
  • regulatory sequences for mammalian host cell expression include viral elements that direct high levels of protein expression in mammalian cells, such as promoters and/or enhancers derived from cytomegalovirus (CMV), Simian Virus 40 (SV40), adenovirus, (e.g., the adenovirus major late promoter (AdMLP) and polyoma.
  • CMV cytomegalovirus
  • SV40 Simian Virus 40
  • AdMLP adenovirus major late promoter
  • nonviral regulatory sequences may be used, such as the ubiquitin promoter or ⁇ -globin promoter.
  • regulatory elements composed of sequences from different sources such as the SR promoter system, which contains sequences from the SV40 early promoter and the long terminal repeat of human T cell leukemia virus type 1 (Takebe, Y. et al. (1988) Mol. Cell. Biol. 8:466-472).
  • the expression vectors may carry additional sequences, such as sequences that regulate replication of the vector in host cells (e.g., origins of replication) and selectable marker genes.
  • the selectable marker gene facilitates selection of host cells into which the vector has been introduced (see, e.g., U.S. Pat. Nos. 4,399,216, 4,634,665 and 5,179,017, all by Axel et al.).
  • the selectable marker gene confers resistance to drugs, such as G418, hygromycin or methotrexate, on a host cell into which the vector has been introduced.
  • Selectable marker genes include the dihydrofolate reductase (DHFR) gene (for use in dhfr- host cells with methotrexate selection/amplification) and the neo gene (for G418 selection).
  • DHFR dihydrofolate reductase
  • the expression vector(s) encoding the heavy and light chains is transfected into a host cell by any suitable techniques.
  • the various forms of the term "transfection" are intended to encompass a wide variety of techniques commonly used for the introduction of exogenous DNA into a prokaryotic or eukaryotic host cell, e.g., electroporation, calcium-phosphate precipitation, DEAE- dextran transfection and the like.
  • electroporation e.g., electroporation, calcium-phosphate precipitation, DEAE- dextran transfection and the like.
  • it is possible to express the antibodies of the disclosure in either prokaryotic or eukaryotic host cells expression of antibodies in eukaryotic cells, and typically mammalian host cells, is most typical.
  • the present disclosure further provides a host cell containing a nucleic acid molecule provided by the present disclosure.
  • the host cell can be virtually any cell for which expression vectors are available. It may be, for example, a higher eukaryotic host cell, such as a mammalian cell, a lower eukaryotic host cell, such as a yeast cell, and may be a prokaryotic cell, such as a bacterial cell.
  • Introduction of the recombinant nucleic acid construct into the host cell can be effected by calcium phosphate transfection, DEAE, dextran mediated transfection, electroporation or phage infection.
  • Suitable prokaryotic hosts for transformation include E. coli, Bacillus subtilis, Salmonella typhimurium and various species within the genera Pseudomonas, Streptomyces, and Staphylococcus.
  • Mammalian host cells for expressing a binding molecule of the disclosure include, for example, Chinese Hamster Ovary (CHO) cells (including dhfr- CHO cells, described in Urlaub and Chasin, Proc. Natl. Acad. Sci. USA 77:4216-4220 (1980), used with a DHFR selectable marker, e.g., as described in Kaufman and Sharp, J. Mol. Biol. 159:601 -621 (1982), NSO myeloma cells, COS cells and Sp2 cells.
  • CHO Chinese Hamster Ovary
  • GS glucose synthetase gene expression system
  • WO 87/04462 WO 89/01036
  • EP 338,841 GS gene expression system
  • the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody in the host cells or secretion of the antibody into the culture medium in which the host cells are grown.
  • Antibodies can be recovered from the culture medium using any suitable protein purification methods.
  • the present disclosure provides a composition containing a binding molecule provided by the disclosure.
  • the composition is a pharmaceutical composition comprising a binding molecule and a pharmaceutically acceptable carrier.
  • the compositions can be prepared by conventional methods known in the art.
  • compositions comprising any of the binding molecules, any of the antibodies, any of the antigen-binding portions thereof, or a derivative thereof, as described herein together with one or more pharmaceutically acceptable excipients, diluents, or carriers as required to prepare the dosage forms for the effective delivery of the binding molecule.
  • the present disclosure provides a composition comprising an antibody, or an antigen-binding portion thereof, provided by the present disclosure and a pharmaceutically acceptable carrier, wherein said antibody or an antigen-binding portion comprises a variable domain comprising the CDR amino acid sequence set forth in SEQ ID NO:30, and wherein said composition comprises not more than about 1 1 %, 10%, 8%, 5%, 3%, or 2% of said antibody, or antigen-binding portion, that is glycosylated at the asparagine of said amino acid sequence compared with the total amount of antibody, or antigen-binding portion thereof, present in said composition.
  • the composition comprises at least about 2% of said antibody, or antigen-binding portion, that is glycosylated at the asparagine of said amino acid sequence of SEQ ID NO:30 compared with the total amount of antibody, or antigen- binding portion thereof, present in said composition.
  • excipient means the substances used to formulate active pharmaceutical ingredients into pharmaceutical formulations; in a preferred embodiment, an excipient does not lower or interfere with the primary therapeutic effect of the active pharmaceutical ingredients.
  • an excipient is therapeutically inert.
  • the term “excipient” encompasses carriers, diluents, vehicles, solubilizers, stabilizers, bulking agents, acidic or basic pH-adjusting agents and binders. Excipients can also be those substances present in a pharmaceutical formulation as an indirect or unintended result of the manufacturing process.
  • excipients are approved for or considered to be safe for human and animal administration, i.e., GRAS substances (generally regarded as safe). GRAS substances are listed by the Food and Drug administration in the Code of Federal Regulations (CFR) at 21 CFR 182 and 21 CFR 184, incorporated herein by reference.
  • pharmaceutically acceptable carrier refers to any inactive substance that is suitable for use in a formulation for the delivery of a binding molecule.
  • a carrier may be an antiadherent, binder, coating, disintegrant, filler or diluent, preservative (such as antioxidant, antibacterial, or antifungal agent), sweetener, absorption delaying agent, wetting agent, emulsifying agent, buffer, and the like.
  • Suitable pharmaceutically acceptable carriers include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like) dextrose, vegetable oils (such as olive oil), saline, buffer, buffered saline, and isotonic agents such as sugars, polyalcohols, sorbitol, and sodium chloride.
  • buffering agent refers to a pharmaceutically acceptable excipient, which stabilizes the pH of a pharmaceutical preparation.
  • Suitable buffers are well known in the art and can be found in the literature. For example, histidine buffers, glycine buffers, tris or acetate buffers, and/or the respective free acids or bases thereof, as well as mixtures of the various salts and/or acids and bases thereof can be employed.
  • buffers are histidine buffers, i.e. buffers having histidine,
  • L-histidine as buffering agent.
  • a particular buffer is L-histidine/HCI buffer, comprising L-histidine, L-histidine monohydrochloride, or mixtures of L-histidine and L- histidine monohydrochloride.
  • the L-histidine buffers are generally used at a
  • the L-histidine monohydrochloride buffers are generally used at a concentration of about 0.1 mg/ml to about 10 mg/ml, about 1 mg/ml to about 5 mg/ml, or about 2 mg/ml to about 4 mg/ml.
  • the pH can be adjusted to a value in the range from about 4.0 to about 7.0, or about 5.0 to about 6.0, with an acid or a base known in the art, e.g. hydrochloric acid, acetic acid, phosphoric acid, sulfuric acid and citric acid, sodium hydroxide and potassium hydroxide.
  • an acid or a base known in the art, e.g. hydrochloric acid, acetic acid, phosphoric acid, sulfuric acid and citric acid, sodium hydroxide and potassium hydroxide.
  • the present invention relates to a pharmaceutical composition comprising: 0.1 to 1 mg/ml of L-Histidine; 1 to 5 mg/ml of L-Histidine monohydrochloride; 50 to 100 mg/ml of Trehalose dehydrate; 0.01 to 0.1 mg/mL of Disodium EDTA
  • the concentration of the binding molecule comprised in the composition according to the invention is in the range of about 10 to about 22 mg/ml.
  • the buffering agent comprised in the
  • composition according to the invention is a histidine buffer, for example, a L- histidine/HCI buffer, or an acetate buffer or a sodium acetate buffer.
  • the buffering agent is L-histidine/HCI.
  • the buffer is at a concentration of about 0.1 mM to about 50 mM, or from 1 mM to about 25 mM.
  • the pH of a composition of the invention may be chosen from the following ranges: from 3 to 10, or from 4 to 9.
  • the buffering agent provides a pH of 5.0 to 6.0 or 5.5 ⁇ 0.3. Routine pH adjustments inside or outside of these ranges may be necessary to improve solubility or stability of the polypeptide or other components of the composition.
  • the composition comprises a polysorbate, for example, polysorbate 20 or polysorbate 80.
  • the polysorbate 80 is at a concentration of 0.01 to 10 mg/ml, 0.5 to 5 mg/ml or 0.1 to 0.5 mg/ml.
  • At least one stabilizer comprised in the composition according to the invention is selected from the group of salts, for example, sodium chloride, saccharides, trehalose dihydrate or sucrose, and amino acids, such as arginine hydrochloride.
  • at least one stabilizer is at a concentration of 10 to 200 mg/ml, 20 to 150 mg/ml, or 50 to 100 mg/ml.
  • chelating agent generally refers to an excipient that can form at least one bond (e.g., covalent, ionic, or otherwise) to a metal ion.
  • a chelating agent is typically a multidentate ligand that can be used in selected liquid compositions as a stabilizer to complex with species, which might promote instability.
  • compounds that can act as a chelating agent will have electron-rich functional groups. Suitable electron-rich functional groups include carboxylic acid groups, hydroxy groups and amino groups. Arrangement of these groups in aminopolycarboxylic acids, hydroxypolycarboxylic acids, hydroxyaminocarboxylic acids, and the like, result in moieties that have the capacity to bind metal.
  • the present invention is not intended to be limited to chelating agents that enhance antibody stability primarily by the chelating agent's ability to form bonds with a metal ion. Therefore, the present invention is not intended to be limited by the specific mechanism by which the chelating agent stabilizes the compositions of the present invention and the excipients termed chelating agents herein may achieve their antibody stability enhancing properties primarily through mechanisms that are altogether unrelated to the chelating agent's ability to form bonds with a metal ion.
  • Chelating agents that are suitable for use in the present invention, include, but are not limited to, aminopolycarboxylic acids, hydroxyaminocarboxylic acids, N- substituted glycines, 2-(2-amino-2-oxoethyl) aminoethane sulfonic acid (BES), deferoxamine (DEF), citric acid, niacinamide, and desoxycholates.
  • suitable aminopolycarboxylic acids include ethylenediaminetetraacetic acid (EDTA),
  • DTPA diethylenetriamine pentaacetic acid 5
  • NTA nitrilotriacetic acid
  • ADA N-2-acetamido- 2-iminodiacetic acid
  • bis(aminoethyl)glycolether ⁇ , ⁇ , ⁇ ', ⁇ '-tetraacetic acid-
  • EGTA trans-diaminocyclohexane tetraacetic acid
  • DCTA trans-diaminocyclohexane tetraacetic acid
  • glutamic acid glutamic acid
  • aspartic acid examples include N- hydroxyethyliminodiacetic acid (HIMDA), ⁇ , ⁇ -bis-hydroxyethylglycine (bicine) and N- (trishydroxymethyl) 10 glycine (tricine).
  • HIMDA N- hydroxyethyliminodiacetic acid
  • ⁇ , ⁇ -bis-hydroxyethylglycine bicine
  • N- (trishydroxymethylmethyl) 10 glycine tricine
  • An example of a suitable N-substituted glycine is glycylglycine.
  • An example of a suitable desoxycholate is sodium
  • Chelating agents used in the invention can be present, where possible, as the free acid or free base form of the compound (e.g., referred to interchangeably herein as "EDTA” or “edetate”) or as a corresponding salt form (e.g., the corresponding acid addition salt or base addition salt, such as disodium edetate).
  • EDTA free acid or free base form of the compound
  • a corresponding salt form e.g., the corresponding acid addition salt or base addition salt, such as disodium edetate
  • Suitable acid addition salts e.g., include alkali metal salts (e.g., sodium or potassium salts), alkaline earth metal salts (e.g., calcium), and salts can be prepared using other weakly bound metal ions.
  • suitable salts of EDTA include dipotassium edetate, disodium edetate, edetate calcium disodium, sodium edetate, trisodium edetate, and potassium edetate; and a suitable salt of deferoxamine (DEF) is deferoxamine mesylate (DFM).
  • DEF deferoxamine mesylate
  • Chelating agents used in the invention can be present as an anhydrous, solvated or hydrated form of the compound or corresponding salt. Where the chelating agent is in a solvated or hydrated form, it can be present in varying states of solvation or hydration (including, e.g., anhydrous, hydrated, dihydrated, and trihydrated forms).
  • a suitable hydrate of EDTA is disodium EDTA dihydrate.
  • the disodium EDTA dihydrate is at a concentration of 0.001 to 5 mg/ml, 0.01 to 2 mg/ml, and 0.02 to 0.5 mg/ml.
  • the chelating agent can reduce or prevent aggregation of the antibodies in the compositions described herein. Such chelating agents can reduce or prevent degradation of an antibody that is formulated without the protection of a chelating agent.
  • compositions can generally be tailored to the specific intended route of administration. Multiple techniques of administering a compound exist in the art including, but not limited to, oral, aerosol, parenteral, and topical administration.
  • the compositions may be in any suitable forms, such as liquid, semi-solid, and solid dosage forms.
  • liquid dosage forms include solution (e.g., injectable and infusible solutions), microemulsion, liposome, dispersion, or suspension.
  • solid dosage forms include tablet, pill, capsule, microcapsule, and powder.
  • a particular form of the composition suitable for delivering a binding molecule is a sterile liquid, such as a solution, suspension, or dispersion, for injection or infusion.
  • Sterile solutions can be prepared by incorporating the antibody in the required amount in an appropriate carrier, followed by sterilization microfiltration.
  • dispersions are prepared by incorporating the antibody into a sterile vehicle that contains a basic dispersion medium and other carriers.
  • methods of preparation include vacuum drying and freeze-drying (lyophilization) to yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
  • compositions can be prepared by conventional techniques known in the art.
  • the relative amount of a binding molecule included in the composition will vary depending upon a number of factors, such as the specific binding molecule and carriers used, dosage form, and desired release and pharmacodynamic characteristics.
  • the composition comprises a binding molecule wherein said binding molecule concentration is between 1 to 100 mg/ml, between 5 to 50 mg/ml, or between 10 to 22 mg/ml.
  • the amount of a binding molecule in a single dosage form will generally be that amount which produces a therapeutic effect, but may also be a lesser amount. Generally, this amount will range from about 0.01 percent to about 99 percent, from about 0.1 percent to about 70 percent, or from about 1 percent to about 30 percent relative to the total weight of the dosage form.
  • one or more additional therapeutic agents may be included in the composition.
  • additional therapeutic agents are described herein below.
  • the suitable amount of the additional therapeutic agent to be included in the composition can be readily selected by a person skilled in the art, and will vary depending on a number of factors, such as the particular agent and carriers used, dosage form, and desired release and pharmacodynamic characteristics.
  • the amount of the additional therapeutic agent included in a single dosage form will generally be that amount of the agent which produces a therapeutic effect, but may be a lesser amount as well.
  • Binding molecules and pharmaceutical compositions provided by the present disclosure are useful for therapeutic, diagnostic, or other purposes, such as enhancing an immune response, treating cancer, enhancing efficacy of other cancer therapy, enhancing vaccine efficacy, or treating autoimmune diseases.
  • the present disclosure provides methods of using the binding molecules or pharmaceutical compositions.
  • the present disclosure provides a method of treating a disorder in a mammal, which comprises administering to the mammal in need of treatment a therapeutically effective amount of a binding molecule provided by the disclosure.
  • the binding molecule may be a 4-1 BB agonist or antagonist.
  • the binding molecule is a 4-1 BB agonist.
  • the mammal is a human.
  • the disorder is a cancer.
  • cancers where 4- 1 BB is implicated may be treated or prevented with a method provided by the disclosure.
  • lung cancers such as bronchogenic carcinoma (e.g., squamous cell carcinoma, small cell carcinoma, large cell carcinoma, and adenocarcinoma), alveolar cell carcinoma, bronchial adenoma, chondromatous hamartoma (noncancerous), and sarcoma (cancerous); heart cancer such as myxoma, fibromas, and rhabdomyomas; bone cancers such as osteochondromas, condromas, chondroblastomas, chondromyxoid fibromas, osteoid osteomas, giant cell tumors, chondrosarcoma, multiple myeloma, osteosarcoma, fibrosarcomas, malignant fibrous histiocytomas, Ewing's
  • bronchogenic carcinoma e.g., squamous cell carcinoma, small
  • the disorder is an autoimmune disease.
  • autoimmune diseases that may be treated with the binding molecules include autoimmune encephalomyelitis, lupus erythematosus, and rheumatoid arthritis.
  • the binding molecule may also be used to treat inflammation (such as allergic asthma) and chronic graft-versus-host disease,
  • the present disclosure provides a method of enhancing an immune response in a mammal, which comprises administering to the mammal a therapeutically effective amount of a binding molecule provided by the disclosure.
  • the binding molecule is a 4-1 BB antibody or antigen-binding fragment thereof and the mammal is a human.
  • the binding molecule is 4-1 BB agonist antibody or an antigen-binding fragment thereof.
  • the term "enhancing immune response" or its grammatical variations means stimulating, evoking, increasing, improving, or augmenting any response of a mammal's immune system.
  • the immune response may be a cellular response (i.e.
  • cytotoxic T lymphocyte mediated such as cytotoxic T lymphocyte mediated
  • a humoral response i.e. antibody mediated response
  • enhancement of immune response include increased CD4+ helper T cell activity and generation of cytolytic T cells.
  • the enhancement of immune response can be assessed using a number of in vitro or in vivo measurements known to those skilled in the art, including, but not limited to, cytotoxic T lymphocyte assays, release of cytokines (for example IL-2 production), regression of tumors, survival of tumor bearing animals, antibody production, immune cell proliferation, expression of cell surface markers, and cytotoxicity.
  • the binding molecule is used to enhance the immune response of a human to a microbal pathogen (such as a virus).
  • the binding molecule is used to enhance the immune response of a human to a vaccine.
  • the binding molecule may be a 4-1 BB agonist or antagonist.
  • the binding molecule is a 4-1 BB agonist.
  • the method enhances a cellular immune response, particularly a cytotoxic T cell response.
  • the cellular immune response is a T helper cell response.
  • the immune response is a cytokine production, particularly IL-2 production.
  • the binding molecule may be used to enhance the immune response of a human to a microbial pathogen (such as a virus) or to a vaccine.
  • the binding molecule may be a 4-1 BB agonist or antagonist.
  • the binding molecule is a 4-1 BB agonist.
  • the binding molecules may be administered alone as monotherapy, or administered in combination with one or more additional therapeutic agents or therapies.
  • the present disclosure provides a combination therapy, which comprises a binding molecule in combination with one or more additional therapies or therapeutic agents for separate, sequential or simultaneous administration.
  • additional therapy refers to a therapy which does not employ a binding molecule provided by the disclosure as a therapeutic agent.
  • additional therapeutic agent refers to any therapeutic agent other than a binding molecule provided by the disclosure.
  • the present disclosure provides a combination therapy for treating cancer in a mammal, which comprises administering to the mammal a therapeutically effective amount of a binding molecule provided by the disclosure in combination with one or more additional therapeutic agents.
  • the mammal is a human.
  • cancer therapeutic agents may be used in combination with a binding molecule provided by the present disclosure.
  • One of ordinary skill in the art will recognize the presence and development of other cancer therapies which can be used in combination with the methods and binding molecules of the present disclosure, and will not be restricted to those forms of therapy set forth herein.
  • Examples of categories of additional therapeutic agents that may be used in the combination therapy for treating cancer include (1 ) chemotherapeutic agents, (2) immunotherapeutic agents, and (3) hormone therapeutic agents.
  • chemotherapeutic agent refers to a chemical or biological substance that can cause death of cancer cells, or interfere with growth, division, repair, and/or function of cancer cells.
  • chemotherapeutic agents include those that are disclosed in WO 2006/088639, WO 2006/129163, and US 20060153808, the disclosures of which are incorporated herein by reference.
  • chemotherapeutic agents include: (1 ) alkylating agents, such as chlorambucil (LEUKERAN), mcyclophosphamide (CYTOXAN), ifosfamide (IFEX), mechlorethamine hydrochloride (MUSTARGEN), thiotepa (THIOPLEX), streptozotocin (ZANOSAR), carmustine (BICNU, GLIADEL WAFER), lomustine (CEENU), and dacarbazine (DTIC- DOME); (2) alkaloids or plant vinca alkaloids, including cytotoxic antibiotics, such as doxorubicin (ADRIAMYCIN), epirubicin (ELLENCE, PHARMORUBICI N), daunorubicin (CERUBIDINE, DAUNOXOME), nemorubicin, idarubicin (IDAMYCIN PFS, ZAVEDOS), mitoxantrone (DHAD, NOVANTRONE).
  • alkylating agents
  • dactinomycin actinomycin D, COSMEGEN
  • plicamycin plicamycin
  • mitomycin mitomycin
  • BLENOXANE vinorelbine tartrate
  • VELBAN vinblastine
  • ONCOVIN vincristine
  • ELDISINE bleomycin
  • antimetabolites such as capecitabine (XELODA), cytarabine (CYTOSAR-U), fludarabine (FLUDARA), gemcitabine (GEMZAR), hydroxyurea (HYDRA), methotrexate (FOLEX, MEXATE, TREXALL), nelarabine (ARRANON), trimetrexate (NEUTREXIN), and pemetrexed (ALIMTA)
  • Pyrimidine antagonists such as 5-fluorouracil (5-FU); capecitabine (XELODA), raltitrexed (TOMUDEX), tegafur- uracil (
  • immunotherapeutic agents refers to a chemical or biological substance that can enhance an immune response of a mammal.
  • immunotherapeutic agents include: bacillus Calmette-Guerin (BCG); cytokines such as interferons; vaccines such as MyVax personalized immunotherapy, Onyvax-P, Oncophage, GRNVAC1 , Favld, Provenge, GVAX, Lovaxin C, BiovaxlD, GMXX, and NeuVax; and antibodies such as alemtuzumab (CAMPATH), bevacizumab (AVASTIN), cetuximab (ERBITUX), gemtuzunab ozogamicin (MYLOTARG), ibritumomab tiuxetan (ZEVALIN), panitumumab (VECTIBIX), rituximab (RITUXAN, MABTHERA), trastuzumab (HERCEPTIN), tos
  • BCG bac
  • hormone therapeutic agent refers to a chemical or biological substance that inhibits or eliminates the production of a hormone, or inhibits or counteracts the effect of a hormone on the growth and/or survival of cancerous cells.
  • agents suitable for the methods herein include those that are disclosed in US200701 17809.
  • hormone therapeutic agents include tamoxifen (NOLVADEX), toremifene (Fareston), fulvestrant (FASLODEX), anastrozole (ARIMIDEX), exemestane (AROMAS IN), letrozole (FEMARA), megestrol acetate (MEGACE), goserelin (ZOLADEX), and leuprolide (LUPRON).
  • binding molecules of this disclosure may also be used in combination with non-drug hormone therapies such as (1 ) surgical methods that remove all or part of the organs or glands which participate in the production of the hormone, such as the ovaries, the testicles, the adrenal gland, and the pituitary gland, and (2) radiation treatment, in which the organs or glands of the patient are subjected to radiation in an amount sufficient to inhibit or eliminate the production of the targeted hormone.
  • non-drug hormone therapies such as (1 ) surgical methods that remove all or part of the organs or glands which participate in the production of the hormone, such as the ovaries, the testicles, the adrenal gland, and the pituitary gland
  • radiation treatment in which the organs or glands of the patient are subjected to radiation in an amount sufficient to inhibit or eliminate the production of the targeted hormone.
  • the combination therapy for treating cancer also encompasses the combination of a binding molecule with surgery to remove a tumor.
  • the binding molecule may be administered to the mammal before, during, or after the surgery.
  • the combination therapy for treating cancer also encompasses combination of a binding molecule with radiation therapy, such as ionizing (electromagnetic) radiotherapy (e.g., X-rays or gamma rays) and particle beam radiation therapy (e.g., high linear energy radiation).
  • radiation therapy such as ionizing (electromagnetic) radiotherapy (e.g., X-rays or gamma rays) and particle beam radiation therapy (e.g., high linear energy radiation).
  • the source of radiation can be external or internal to the mammal.
  • the binding molecule may be administered to the mammal before, during, or after the radiation therapy.
  • enteral route refers to the administration via any part of the gastrointestinal tract.
  • enteral routes include oral, mucosal, buccal, and rectal route, or intragastric route.
  • Parenteral route refers to a route of administration other than enteral route.
  • parenteral routes of administration examples include intravenous, intramuscular, intradermal, intraperitoneal, intratumor, intravesical, intraarterial, intrathecal, intracapsular, intraorbital, intracardiac, transtracheal, intraarticular, subcapsular, subarachnoid, intraspinal, epidural and intrasternal, subcutaneous, or topical administration.
  • the antibodies and compositions of the disclosure can be administered using any suitable method, such as by oral ingestion, nasogastric tube, gastrostomy tube, injection, infusion, implantable infusion pump, and osmotic pump.
  • the suitable route and method of administration may vary depending on a number of factors such as the specific antibody being used, the rate of absorption desired, specific formulation or dosage form used, type or severity of the disorder being treated, the specific site of action, and conditions of the patient, and can be readily selected by a person skilled in the art
  • a “therapeutically effective amount” of a binding molecule refers to an amount that is effective for an intended therapeutic purpose.
  • a “therapeutically effective amount” is any amount that is effective in stimulating, evoking, increasing, improving, or augmenting any response of a mammal's immune system.
  • a “therapeutically effective amount” is any amount that is sufficient to cause any desirable or beneficial effect in the mammal being treated.
  • desirable or beneficial effects include inhibition of further growth or spread of cancer cells, death of cancer cells, inhibition of reoccurrence of cancer, reduction of pain associated with the cancer, or improved survival of the mammal.
  • the therapeutically effective amount of a 4-1 BB antibody usually ranges from about 0.001 to about 500 mg/kg, and more usually about 0.01 to about 100 mg/kg, of the body weight of the mammal.
  • the amount can be about 0.3 mg/kg, 1 mg/kg, 3 mg/kg, 5 mg/kg, 10 mg/kg, 50 mg/kg, or 100 mg/kg of body weight of the mammal.
  • the therapeutically effective amount of a 4-1 BB antibody is in the range of about 0.01 - 30 mg/kg of body weight of the mammal.
  • the therapeutically effective amount of a 4-1 BB antibody is in the range of about 0.05 - 15 mg/kg of body weight of the mammal.
  • the precise dosage level to be administered can be readily determined by a person skilled in the art and will depend on a number of factors, such as the type, and severity of the disorder to be treated, the particular binding molecule employed, the route of administration, the time of administration, the duration of the treatment, the particular additional therapy employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
  • a binding molecule or composition is usually administered on multiple occasions. Intervals between single doses can be, for example, weekly, monthly, every three months or yearly.
  • An exemplary treatment regimen entails administration once per week, once every two weeks, once every three weeks, once every four weeks, once a month, once every three months or once every three to six months.
  • Typical dosage regimens for a 4-1 BB antibody include 1 mg/kg body weight or 3 mg/kg body weight via intravenous administration, using one of the following dosing schedules: (i) every four weeks for six dosages, then every three months; (ii) every three weeks; (iii) 3 mg/kg body weight once followed by 1 mg/kg body weight every three weeks.
  • EXAMPLE 1 GENERATION OF FAB FRAGMENTS THAT BIND TO
  • Certain antibodies provided by the present invention were originally generated from Fabs that bind to human 4-1 BB.
  • the Fabs were selected from a phage display library, the MorphoSys HuCAL GOLD ® phagemid library, following alternating panning on 4-1 BB FC and cells expressing human 4-1 BB. These Fabs include those that are designated as “Fab-6032,” “Fab-7361 ,” “Fab-7480,” and “Fab-7483.”
  • 4-1 BB antibodies MOR-6032, MOR-7361 , MOR-7480, and MOR-7483 disclosed in this application were generated from “Fab-6032,” “Fab-7361 ,” “Fab-7480,” and "Fab-7483, respectively.
  • amino acid sequence of the light chain variable region and heavy chain variable region of a given Fab are identical to the amino acid sequence of the light chain variable region and heavy chain variable region, respectively, of an illustrative antibody the designation of which shares the same numerical number with the designation of the Fab.
  • Fab-7480 and antibody MOR-7480 have identical amino acid sequences for their light chain variable region and heavy chain variable region, respectively.
  • the phagemid library is based on the HuCAL ® concept (Knappik et al., 2000, J. Mol. Biol. 296(1 ):57-86) and employs the CysDisplayTM technology for displaying the Fab on the phage surface (Lohning, WO 01/05950).
  • HuCAL GOLD ® provides the option of performing selections with six single sub-libraries each comprising one VH (VH1 , VH2, VH3, VH4, VH5, VH6) master gene combined with all seven VL master genes or performing selections using combined phage pools. Phage for the 1 st round of pannings were prepared by Hyperphage ( ⁇ 13 ⁇ 07 ⁇ ⁇ , obtained from Progen, Heidelberg, Germany).
  • HuCAL GOLD ® is described in detail in Christine Rothe, et. al, J. Mol. Biol. (2008) 376, 1 182-1200.
  • Solid phase panning was performed using recombinant human 4-1 BB-Fc (R&D Systems, Cat. No. 838-4B; Minneapolis, MN).
  • EXAMPLE 2 CHARACTERIZATIONS OF FABS
  • the affinity (as expressed as K D ) of the four Fabs was determined using the SET method using an instrumentation from Meso Scale Discovery ("MSD"). Monomer fractions of antibody protein were used (at least 90% monomer content, analyzed by analytical SEC; Superdex75 (Amersham Pharmacia) for Fab, or Tosoh G3000SWXL (Tosoh Bioscience) for IgG, respectively).
  • Affinity determination in solution was basically performed as described in the literature (Friguet et al. 1985). In order to improve the sensitivity and accuracy of the SET method, it was transferred from classical ELISA to ECL based technology (Haenel et al. 2005).
  • Standard MSD plates were coated with 0.05 g/ml human 4-1 BB in PBS (30 ⁇ _ ⁇ / ⁇ ), incubated overnight, and blocked with 3% BSA in PBS for 1 hour. After washing the plate with assay buffer, the equilibrated samples were transferred to those plates (30 ⁇ _ per well) and incubated for 20 minutes. After washing, 30 Uwe ⁇ of the MSD Sulfo-tag labeled detection antibody (goat anti-human (Fab)2 ) in a final dilution of 1 :1500 was added to the MSD plate and incubated for 30 min on an Eppendorf shaker (700 rpm).
  • MSD Sulfo-tag labeled detection antibody goat anti-human (Fab)2
  • monomeric Fab fractions (at least 90% monomer content, analyzed by analytical SEC; Superdex75, Amersham Pharmacia) were used as analyte. Binding to immobilized antigen was analyzed using a BIAcore3000 instrument (Biacore, Sweden).
  • the kinetic rate constants k on and k 0ff were determined with serial dilutions of the respective Fab binding to covalently immobilized antigen CD137/ HUMAN 4-1 BB using the Biacore 3000 instrument (Biacore, Uppsala, Sweden).
  • EDC-NHS amine coupling chemistry was used for covalent antigen immobilization standard EDC-NHS amine coupling chemistry.
  • Kinetic measurements were done in HBS-EP (10mM HEPES; pH 7.4; 150mM NaCI; 3mM EDTA; Tween20 0.005%) at a flow rate of 20 ⁇ /minute using Fab concentrations ranging from about 16 to 500 nM.
  • the injection time for each concentration was 1 minute, followed by at least 3 minutes dissociation phase.
  • For regeneration one or more 5 ⁇ injections of Glycine/HCI pH2 were used.
  • IgGs were injected as samples on a F1 sensor chip with a low density of covalently immobilized human 4-1 BB (approx. 130 RU) using a 2 n serial dilution with concentrations ranging from 16 to 500 nM.
  • Sensorgrams were evaluated using a bivalent fit model a qualitatively compared to rank the corresponding K D values. All sensorgrams were fitted using BIA evaluation software 3.1 (Biacore). Results are presented in Table 3.
  • the binding of the four Fabs was determined using standard FACS assay techniques on HEK293 cells stably transfected and expressing human 4-1 BB as well as 300.19 (murine B-cell line) negative control cells. The results are presented in Table 3.
  • Fabs obtained from the panning as described herein including Fab- 6032, Fab-7361 , Fab-7480, and Fab-7483, were selected for conversion into full length antibodies in lgG1 and lgG4 formats for further characterizations as described in this example.
  • the four illustrative antibodies identified in this example ie., MOR-6032, MOR-7361 , MOR-7480, and MOR-7483, were converted from Fab-6032, Fab- 7361 , Fab-7480, and Fab-7483, respectively.
  • the antibodies in IgG format were expressed and purified, and then characterized in ELISA, FACS, and luciferase reporter gene assays. 3A. Conversion to IgG
  • variable domain fragments of heavy (VH) and light chains (VL) were subcloned from Fab expression vectors into appropriate pMorph ® _hlgG vectors for human lgG1 and human lgG4.
  • Transient expression of full length human IgG was performed in HKB1 1 cells, which were transfected with IgG heavy and light chain expression vectors at a 1 :1 ratio.
  • Cell culture supernatant was harvested after transfection and upscaled to 3-fold transfection volume, respectively.
  • Supernatant was cleared by centrifugation and filtration, and then subjected to standard protein A affinity chromatography (MabSelect SURE, GE Healthcare). Proteins were eluted and neutralized. Further downstream processing involved buffer exchange and sterile filtration. Protein concentrations were determined by UV-spectrophotometry. Purity of IgG was analyzed under denaturing, reducing and denaturing, non-reducing conditions in SDS-PAGE or by using Agilent BioAnalyzer. HP-SEC was performed to analyze IgG preparations in native state.
  • IgGs were used for ELISA binding characterization on human 4-1 BB/Fc and mouse 4-I BB/Fc in a direct coated setup.
  • Table 4 sets out the ELISA binding results for antibodies MOR-6032, MOR-7361 , MOR-7480, and MOR-7483, all in lgG1 format.
  • the selectivity of antibodies for 4-1 BB was assessed against extracellular domain protein of 4-1 BB and other members of the TNFR superfamily. These receptors included CD40 (TNFRSF5) and OX-40 (CD134, TNFRSF4). IgGs were used for FACS binding characterization on negative control HEK293 cells, as well as HEK293T-h4-1 BB cells stably transfected and expressing human 4-1 BB, and 300.19 stably transfected cells expressing OX-40, and 300.19 cells stably transfected and expressing CD40.
  • the FACS binding results for antibodies MOR-6032, MOR-7361 , MOR-7480, and MOR- 7483, all in lgG1 format, are presented in Table 5. No significant binding to OX-40 or CD40 was observed at concentrations up to 1000 nM, demonstrating that the antibodies are at least 100-fold more selective for 4-1 BB versus other related family members tested.
  • IgGs were also characterized for binding in a luciferase reporter gene assay using HEK293T-h4-1 BB cells in a plate bound assay, a soluble binding assay, and cross-linked binding assay.
  • Table 6 sets out the results of the luciferase reporter gene assay for antibodies MOR-6032, MOR-7361 , MOR-7480, and MOR-7483, all in lgG1 format.
  • nucleotide and amino acid sequences of the heavy chain variable region, full length heavy chain of the lgG2 subclass, light chain variable region, and full length light chain of antibodies MOR-6032, MOR-7361 , MOR-7480, MOR-7480.1 , MOR-7480.2, MOR-7483, MOR-7483.1 , and MOR-7483.2 are provided in this disclosure; an index of the SEQ ID NOs for these sequences is provided in Table 1.
  • MOR-6032 heavy chain immunoglobulin sequence Comparison of the MOR-6032 heavy chain immunoglobulin sequence to the known human germline immunoglobulin heavy chain sequences demonstrated that the MOR-6032 heavy chain utilizes a V H segment from human germline V H 1-69, a D segment from the human germline 4-23, and a JH segment from human germline JH 4a.
  • EXAMPLE 5 GERMLINED VERSIONS OF ANTIBODIES MOR-7480 and MOR-7483
  • MOR-7480 and MOR-7483 antibodies In order to minimize immunogenicity of the MOR-7480 and MOR-7483 antibodies, several amino acid residues were mutated back to germline sequence, as follows.
  • a germlined version of MOR-7480, designated MOR-7480.1 was prepared by returning two amino acids in the FR1 region of the heavy variable chain to germline sequence. More specifically, Q at amino acid residue number 1 was returned to the germline E, and K at amino acid residue number 19 was returned to R. The two amino acid residues that were changed in the heavy chain variable region can be seen by comparing the amino acid sequence of MOR-7480 (SEQ ID NO:32) with MOR-7480.1 (SEQ ID NO:43).
  • MOR-7480 In the light chain variable region of MOR-7480, five amino acids in the FR1 region (D1 S, I2Y, A13S,R19S, S21T), two amino acids in the FR2 region (A42S, V45L), and one in the FR3 region (E80M) were reverted to germline sequence. The eight amino acids that were changed in the light chain variable region can be seen by comparing the amino acid sequence of MOR-7480 (SEQ ID NO:37) with that of MOR- 7480.1 (SEQ ID NO:45). Moreover, a third version of MOR-7480 was prepared by starting with the light chain variable region sequence of MOR-7480.1 (SEQ ID NO:45) and reverting L45 back to V to produce MOR-7480.2 (SEQ ID NO:51 ).
  • a "germlined” version of MOR-7483, designated MOR-7483.1 was prepared by backmutating two amino acids in the FR1 region of the heavy variable chain to germline sequence.
  • the germlined versions can be prepared by starting with the germline version of the antibody chain and then changing the desired amino acids in the CDRs, or any combination of mutations starting from any version.
  • Q at amino acid residue number 1 was returned to the germline E, and K at amino acid residue number 19 was returned to R.
  • the two amino acid residues that were changed in the heavy chain variable region can be seen by comparing the sequence of MOR- 7483 (SEQ ID NO:32) with MOR-7483.1 (SEQ ID NO:43).
  • MOR-7483.1 SEQ ID NO:60
  • MOR-7483.2 SEQ ID NO:64
  • Binding kinetics of certain antibodies binding human 4-1 BB were measured by surface plasmon resonance (SPR) technology using a Biacore 3000 instrument (GE Healthcare).
  • Recombinant human 4-1 BB/Fc Chimera protein comprising amino acids 24 - 186 of SEQ ID NO: 68 was purchased from R&D Systems Inc. (#838-4B).
  • the lyophilized protein was dissolved in a buffer containing 150 mM NaCI, 25mM HEPES pH 8.0, 6 mM MgCI 2 , 0.005% polysorbate 20, and 0.5 mM sodium azide to a final concentration of 80 nM based on the predicted molecular weight (44.8 kDa) provided by the R&D Systems.
  • the Fc portion of the molecule was cleaved by treatment with Bovine Factor Xa (Pierce, #32521 ) in 150 mM NaCI, 25mM HEPES pH 8.0, 6 mM MgCI 2 , 0.005% polysorbate 20, 0.5mM sodium azide, using a 20 hour incubation at 22°C with a 3% Factor Xa (3 ⁇ g Factor Xa per 100 ⁇ g 4-1 BB chimera).
  • the 4-1 BB portion of the molecule comprises amino acid residues 24 though 186 of the human 4-1 BB protein.
  • Binding experiments were carried out at 25°C in a running buffer comprising 150 mM NaCI, 25mM HEPES pH 8.0, 6 mM MgCI 2 , 0.005% polysorbate 20, and 0.5 mM sodium azide.
  • Antibodies were immobilized by standard amine coupling to a CM5 sensorchip (GE Healthcare) using a 0.1 mg/mL solution of the antibody in 10 mM sodium acetate at pH 5.0.
  • the 4-1 BB was injected at a range of concentrations from 80 nM to 0.16 nM, at a 50 ⁇ _/ ⁇ . ⁇ flow rate, for 3.6 minutes followed by a 26 minute dissociation period using the Kinject feature of the Biacore 3000 instrument.
  • the bound complex was regenerated by a 1 minute pulse of 10 mM phosphoric acid in water. Data analysis was performed using the Scrubber2 software (BioLogic Software). Sensograms were fit to a simple 1 :1 Langmuir binding model. The antibodies were shown to reversibly bind to recombinant human 4-1 BB. The results (average values) are presented in Table 7.
  • Human 4-1 BB IgGI Fc chimera (R&D Systems, Minneapolis, MN) was resuspended with Dulbecco's Phosphate Buffered Saline (DPBS) containing 0.1 % bovine serum albumin (BSA) to 0.2mg/ml and diluted with DPBS to a final concentration of 0.03 ug/ml.
  • DPBS Dulbecco's Phosphate Buffered Saline
  • BSA bovine serum albumin
  • Nunc-lmmuno Maxisorp 96 well plates were coated with 0.1 ml per well of the recombinant 4-1 BB chimera leaving empty wells for nonspecific binding controls and incubated at 4°C overnight.
  • the 4-1 BB solution was removed and the plates were washed three times with 0.2ml wash buffer (0.05% Tween-20 in DPBS).
  • 0.2ml blocking buffer (5% BSA, 0.05% Tween-20 in DPBS) was added to all wells and incubated at 4°C for 1 hour with mixing. The blocking buffer was removed and plates washed three times with 0.2ml wash buffer. Serial dilutions of the 4-1 BB test antibodies were prepared in DPBS and 0.1 ml diluted Ab was added per well. Plates were incubated 1.5 hour at room temperature. Antibody solution was removed and the plates washed three times with 0.2ml wash buffer per well.
  • Horseradish peroxidase labeled goat anti-human IgG, F(ab')2 specific F(ab')2 antibody was diluted 1 :5000 with DPBS and added 0.1 ml per well. The plates were incubated 1 hour at room temperature and washed with 0.2ml per well wash buffer. 0.1 ml SureBlue TMB microwell peroxidase substrate (Kirkegaard & Perry Labs, Gaithersburg, MD) was added and incubated for 20 minutes at room temperature.
  • Antibodies were tested for their ability to block the binding of the human 4- 1 BB_lgG1 Fc chimera to plate bound recombinant 4-1 BB ligand (4-1 BBL).
  • Recombinant human 4-1 BB ligand Biosource/lnvitrogen, Carlsbad, CA
  • DPBS + 0.1 % bovine serum albumin was resuspended to 0.2 mg/mL in DPBS + 0.1 % bovine serum albumin and then diluted to 1 ⁇ g/mL in DPBS.
  • Nunc-lmmuno MaxiSorp surface 96 well plates were coated with 0.1 mL/well of the 4- 1 BBL solution overnight at 4 ° C.
  • Blocking buffer (1 % bovine serum albumin, 0.05% Tween-20 in DPBS) added and incubated at room temperature for 2 hours.
  • the antibody stocks were diluted in a range from 8 ng/mL to 6 ⁇ g/mL in DPBS.
  • Recombinant human 4-1 BB_lgG1 Fc (R&D Systems, Minneapolis, MN) was resuspended to 0.2 mg/mL in DPBS + 0.1 % bovine serum albumin and then diluted to 0.02 ⁇ g/mL in DPBS.
  • the blocked 4-1 BBL coated plates were washed three times with 0.2 mL wash buffer (0.05% Tween 20 in DPBS). 60 ⁇ antibody dilutions were added along with 60 ⁇ 4-1 BB_lgG1 Fc chimera and incubated at room temperature for 1 .5 hours. Plates were washed as described previously. Horseradish peroxidase anti- 6xHistidine tag antibody (R&D Systems, Minneapolis MN #MAB050H) was diluted 1 :1000 in DPBS, 50 ⁇ of the resulting solution added to the wells of the washed plates, and incubated at room temperature for 1 hour.
  • the species-cross reactivity of the exemplary antibodies was measured using phytohemagglutinin (PHA) stimulated primary peripheral blood mononuclear cells (PBMC) of human, cynomolgus monkey (cyno), dog, and rat.
  • PHA phytohemagglutinin
  • PBMC peripheral blood mononuclear cells
  • cyno cynomolgus monkey
  • rat rat
  • Cells were isolated according to the procedure described below. Cells (-5.0x10 5 cells/tube) were washed once in cold wash buffer (PBS, 2% FBS and 0.02% sodium azide) and 100 ⁇ /tube of Alexa Fluor 647 conjugated control or 4-1 BB reactive antibodies at 15.5 ⁇ g/mL (100 nM) was added to each sample along with labeled species specific T cell marker antibodies.
  • the T cell marker antibodies utilized are as follows, FITC anti-human CD3e (BD Pharmingen, #555332), FITC anti-rat CD3e (BD Pharmingen, #559975), FITC anti- rabbit CD4 + FITC anti-rabbit CD8 (AbD Serotec, #MCA799F and #MCA1576F), FITC anti-dog CD3e (AbD Serotec, #MCA1774F), and PerCP anti-human/cyno CD3e (BD Pharmingen, #552851 ).
  • the cells were incubated in the dark with fluorochrome antibodies on ice for 30 minutes, washed three times and resuspended in 0.3 ml wash buffer for analysis. Antibody staining was measured and analyzed using a Becton Dickinson FACS Calibur and FlowJo 8.8.2 software.
  • PBMC peripheral blood mononuclear cells
  • PBMCs were incubated for 10 minutes at room temperature and T cells were eluted with column buffer, washed one time and resuspended TCM at 2x10 6 cells/mL consisting of RPMI 1640 (Sigma, St Louis, MO) supplemented with 10% fetal bovine serum (Sigma, St. Louis, MO) and L-glutamine (2 mM), Hepes (10 mM), penicillin (100 U/ml), streptomycin (50 ug/ml) (Gibco, Grand Island, NY.).
  • Cvnomolqus PBMCs Isolation of Cvnomolqus PBMCs. Cynomolgus whole blood (Bioreclamation; Hicksville, NY) was collected in sodium citrate CPT vacutainer tubes (BD; Franklin Lakes, NJ) and then spun at 1500 x g for 20 minutes at room temperature. Tubes were shipped overnight at 4°C. The PBMC fraction was collected from the CPT tubes and washed 2x with PBS containing 5mM EDTA. Following the wash step, PBMCs were counted and readjusted to 2x10 6 cells/mL in tissue culture medium (TCM).
  • TCM tissue culture medium
  • TCM consisted of RPMI 1640 (Sigma, St Louis, MO) supplemented with 10% fetal bovine serum (Sigma, St Louis, MO) and L-glutamine (2 mM), HEPES (10 mM), penicillin (100 U/mL), streptomycin (50 ⁇ g/mL) purchased from Gibco (Grand Island, NY.). Cells were stimulated with 10 ⁇ g/mL PHA 2-3 days to induce expression of 4-1 BB.
  • Canine PBMCs Isolation of Canine PBMCs.
  • Canine whole blood was drawn into heparinized vacutainer tubes (BD; Franklin Lakes, NJ) and diluted 1 :2 with PBS containing 5mM EDTA. After mixing, 4 mL of the diluted blood was carefully layered over 3mL Lympholyte-Mammal (Cedarlane Laboratories, Westbury, NY) and centrifuged 800 x g for 20 minutes at 25°C.
  • the PBMC interface was collected, washed twice with PBS and resuspended to 2x10 6 cells/mL in TCM containing PHA at 10 ⁇ g/mL (Remel, Lenexa, KS). The cells were cultured for 48-72 hours prior to testing for antibody binding by flow cytometry.
  • Rat whole blood was drawn into heparinized vacutainer tubes (BD; Franklin Lakes, NJ) and diluted 1 :3 with PBS containing 5 mM EDTA. After mixing, 6 mL of the diluted blood was carefully layered over 4.5ml Lympholyte-Mammal (Cedarlane Laboratories, Westbury, NY) and centrifuged 800 x g for 20 minutes at 25°C. The PBMC interface was collected, washed twice with PBS and resuspended to 2x10 6 cells/mL in TCM containing PHA at 10 ⁇ g/mL (Remel, Lenexa, KS). The cells were cultured for 48-72 hours prior to testing for antibody binding by flow cytometry.
  • the binding results are provided in Figure 1.
  • the antibodies were found to bind to the human and cyno 4-1 BB with high affinity, while binding to dog and rat 4-1 BB was not observed at concentrations of 100 nM, the highest concentration tested.
  • Viral preparations were established by transient transfection of roughly 40-50% confluent 293T cells in T-75 flasks. Following culture, the viral supernatant was then sterile filtered, and subjected to concentration. The concentrated virus was collected and stored at -80°C.
  • the puromycin selected pools were stained with 100nM dilution of the unlabeled primary antibody on ice for 30 min, followed by two washes with FACS buffer, and 1 :200 dilution species specific PE labeled donkey anti-lgG (H+L) F(ab') 2 .
  • Cells were analyzed by FACS using a BD FACS Calibur and FlowJo 8.8.6 software.
  • the geometric mean fluorescence of each receptor expressing pool was normalized to staining of parental cells and expressed as fold staining and an EC50 for dose response was determined.
  • the EC50 summary is shown in Table 1 1. Greater than 5 fold decrease in binding for both MOR_7480.2 and MOR_7480 for the human 4-1 BB mutant N&E.5 was noted.
  • 293T cells expressing human 4-1 BB along with a stably integrated NFkB luciferase reporter were prepared.
  • Cells were harvested, washed and resuspended into phenol red free complete medium (DMEM containing 10% fetal bovine serum, HEPES buffer, nonessential amino acids and L-glutamine) at density of 0.6 X 10 6 cells/ml_.
  • 50 ⁇ of cells were plated into each assay well of a white 96 well plate (PerkinElmer, Waltham, MA).
  • Test antibodies were added to each well in the presence 2.5:1 ratio of a cross linking antibody Fab' goat anti-human IgG Fc (Jackson ImmunoResearch, West Grove, PA). The plate was incubated 5 hours at 37°C.
  • 75 ⁇ of Bright-Glo Luciferase reagent Promega, Madison Wl
  • was added and the amount of luciferase activity was measured using a Packard TopCount NXT scintillation
  • 293T cells expressing cynomologous monkey 4-1 BB were prepared by viral transduction and selection of a stable pool with 2 ⁇ g/ml puromycin. Cyno 4-1 BB expressing 293T cells were plated in a T-75 flask to roughly 60-70% confluency then transfected with 10 ⁇ g pLuc_6xNFkB plus O. ⁇ g pRL-CMV as a transfection control. Transfections were performed using Fugene 6 transfection reagent (Roche Indianapolis, IN) at a 6 ⁇ Fugene to 1 ⁇ g plasmid DNA ratio according to manufacturer instructions.
  • DMEM phenol red free complete medium
  • Test antibodies were added to each well in the presence 2.5:1 ratio of a cross linking Fab' goat anti-human IgG Fc antibody (Jackson ImmunoResearch, West Grove, PA). The plate was incubated 5 hours at 37°C.
  • Nunc Maxisorp 96 well plates were UV sterilized prior to plate coating.
  • Test antibodies were diluted in PBS to 60 ⁇ g/ml. 0.2ml of the diluted Ab was divided to 2 wells of a polypropylene 96 well plate and serially diluted 1 :3. 50 ⁇ of the diluted Ab were added to the sterile Maxisorp 96 well assay plate and immediately 50 ⁇ of 20 ⁇ g/ml anti-human CD3e clone UCHT1 was added (Biolegend San Diego, CA). All plates were then incubated overnight at 4°C. The following day, Ab coated plates were washed 1x with PBS and 0.15ml RPMI complete media was added to the wells of the Nunc Maxisorp plates.
  • Human T cells were isolated as described previously elsewhere herein and 50 ⁇ purified T cells at 2 x 10 6 cells/ml (100,000 cells/well) were added to each well. Cells were incubated at 37°C, 5%C0 2 for 3 days. Supernatant from each well was collected and either assayed immediately or stored at -20°C prior to assay. Supernatants were diluted with complete media prior to IL-2 ELISA assay (R&D Systems, Minneapolis, MN). Results are presented in Figure 3.
  • EXAMPLE 7 HUMAN LEUKOCYTE EXPANSION INDUCED BY 4- 1 BB ANTIBODIES IN VIVO
  • mice with the NOD genetic background carrying the severe combined immunodeficient (SCID) mutation and deficiency in the IL-2 receptor common gamma chain are able to support the engraftment of large number of human peripheral blood leukocytes (huPBL) and maintain engraftment for at least 30 days (King, 2008, Clin. Immunol. 126:303-314).
  • SCID severe combined immunodeficient
  • This mouse model also known as huPBL-NSG model, was used to assess the functional effect of in vivo systemic administration of the antibodies on human immune cells.
  • 6 million freshly isolated human PBMCs were adoptively transferred via intraveinous injection into NOD.Cg-Prkdc scld Il2 rg tmiw j i /Sz j (MSG) host mice.
  • MSG NOD.Cg-Prkdc scld Il2 rg tmiw j i /Sz j
  • MOR7480.1 treatment of cynomolgus monkeys increased proliferation among cytotoxic central memory T cells (CD8 TC M ) in PBMC samples.
  • Cynomolgus monkeys (2 animals per dose level) were given a single intravenous injection of MOR7480.1 at the indicated dose.
  • PBMC were harvested 7 days prior to the antibody dose (pre dose) and on the indicated study days relative to administration of MOR7480.1 (on Study Day 1 ).
  • PBMC were stained with antibodies for CD3, CD4, CD8, CD28, CD95, and Ki-67 and analyzed via flow cytometry. Data was collected on a Canto II (Beckton Dickinson) and analyzed using DIVA software (Becton Dickinson).
  • CD8 central memory cells were identified as CD3+, CD8+, CD28+ and CD95+. Data is shown for individual animals designated as (dose level-animal number) and is represented as intra-animal change in the number of Ki-67+ cells relative to pre study number ⁇ [(#Ki-67+ cells on indicated study day - #Ki-67+ cells at pre dose)/#Ki-67+ cells at pre dose] * 100 ⁇ . As shown in figure 5, A 1.5 fold or greater increase in proliferating central memory T cells during the first 7-13 days of study was noted in at least one animal of all groups treated with 0.3 mg/kg or greater.
  • EXAMPLE 8 ANTI-TUMOR ACTIVITY OF 4-1 BB ANTIBODIES (IN VIVO MODEL)
  • the PC3 human prostate or LOVO human colon cell line was obtained from American Type Culture Collection and was cultured in RPMI-1640 (Invitrogen) enriched with the following Invitrogen supplements: L-Glutamine, Sodium pyruvate, non-essential amino acids, penicillin/streptomycin, Hepes, and 10% heat inactivated fetal bovine serum (FBS; Cat. No. F2442, Sigma Aldrich). Cells were grown to confluency in T-225 Falcon flasks. Subsequently, cells were trypsinized (Trypsin 0.25%-EDTA; Cat. No. 2500-056, Invitrogen) and growth was scaled up in Hyperflasks (Cat. No.
  • PBMCs Peripheral blood lymphocytes
  • Accuspin tubes in accordance with the manufactures' protocol (Cat. No. A0561-100x 15 ml, Aldrich).
  • Counted cell suspensions were combined such that each mouse received an injection of 1 .5x 10 6 PBMCs and 3 x 10 6 tumor cells in a single bolus injection of 0.2 mL in PBS. The combined cell suspension was washed twice with cold PBS, placed on ice and immediately injected into prepared mice.
  • Percent tumor growth inhibition was measured on the final day of the study and is calculated as 100- ⁇ 1 -(Treated fi na i day/Control fj na i day) ⁇ - Similar results were observed when tumors were measured on day 6 post injection, and the animals were randomized according to tumor volume, and given a single 4-1 BB mAb dose on day 7 post implantation. For most studies, each group contained 8 mice.
  • BAC Bacterial artificial chromosome
  • a retrieval vector was assembled on the pBR322 backbone such that, when opened by Xba1 digestion, the two murine/human chimeric homology arms (400 bps each) will retrieve from the human 4-1 BB BAC clone the 19,994 bps of human 4-1 BB genomic sequence beginning with the translation start codon ATG located in exon 2 and ending with the stop codon TGA in exon 8.
  • a neomycin expression cassette under the control of the PGK/EM7 promoters was assembled and flanked by 100 base pairs (bps) of sequences homologous to intron 2 sequences of the human 4-1 BB gene. This neomycin expression cassette was then targeted into the retrieved human 4-1 BB genomic fragment obtained in step 1.
  • the retrieved human 4-1 BB genomic fragment carrying the neomycin expression cassette was targeted into a murine BAC clone to replace the murine 4-1 BB gene with the modified human 4-1 BB genomic fragment from ATG start codon to TGA stop codon.
  • This BAC targeting vector was electroporated into a mouse embryonic stem cell line on the C57BL/6NTAC background (PRX-BL6N #1 , Primogenix, Why, MO.) following a standard protocol and clones surviving G418 (also known as geneticin) selection were screened by two Taqman assays against intron 2 and exon 8 of the murine 4-1 BB gene to identify clones that had been modified at the murine 4-1 BB locus by a homologous recombination mechanism Of the 1 16 ES clones screened, 7 clones were found to have lost one allele of the murine 4-1 BB locus (targeting efficiency 6%).
  • FISH Karyotype analysis and in situ hybridization
  • Both clones LH 15 and LH80 were injected into blastocysts of the BALB/c strain and embryos implanted into the CD1 pseudopregnant female mice to carry to term. Male chimeras were mated to the Ella-cre mice on C57BL 6 background to remove the neomycin resistance cassette and mice homozygous for the human 4-1 BB gene were used in study.
  • 4-1 BB Knock-in mice The ability of 4-1 BB agonist mAbs to induce lymphocyte proliferation was assessed in 4-1 BB Knock-in mice.
  • 4-1 BB Knock-in mice were dosed via intraperitoneal injection with 30 mg/kg of MOR7480.1 on study Day 0 (for weekly dosing animals received 4-1 BB mAb injections on Day 0 and Day7). 24 hours prior to sample collection, animals were injected intraperitoneal ⁇ with 2 mg BrdU. At the indicated day post dose, peripheral blood samples were collected via intracardiac puncture. PBMC were stained with antibodies against CD3, CD4, CD8, and BrdU and assessed via flow cytometry. Results are presented in Figure 7 panel A.
  • B16 -OVA luc a melanoma line that has been engineered to express the ovalbumin (OVA) model antigen and luciferase (luc).
  • OVA ovalbumin
  • luc luciferase
  • NSYAIS - SEQ ID No 2 H-CDR2 of MOR-6032 antibody
  • DIELTQPPSVSVAPGQTARISCSGDNIGSKYVSWYQQKPGQAPVLVIYSDSERPSGIPE RFSGSNSGNTATLTISGTQAEDEADYYCQSWDGSISRVFGGGTKLTVLqqpkaapsvtlfpp sseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsltpeqwkshrsyscqvthegst vektvaptecs
  • SEQ ID No 42 Nucleic Acid Sequence of Full Length Light Chain of MOR-7480 antibody
  • SEQ ID No 60 Amino Acid Sequence of V L of MOR-7483.1 antibody SYELTQPPSVSVSPGQTASITCSGDNIGDQYAHWYQQKPGQSPVLVIYQDKNRPSGIP ERFSGSNSGNTATLTISGTQAMDEADYYCSTYTFVGFTTVFGGGTKLTVL

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biotechnology (AREA)
  • Zoology (AREA)
  • Wood Science & Technology (AREA)
  • Epidemiology (AREA)
  • Microbiology (AREA)
  • General Engineering & Computer Science (AREA)
  • Oncology (AREA)
  • Mycology (AREA)
  • Plant Pathology (AREA)
  • Physics & Mathematics (AREA)
  • Cell Biology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
PCT/IB2011/053761 2010-09-09 2011-08-26 4-1bb binding molecules Ceased WO2012032433A1 (en)

Priority Applications (24)

Application Number Priority Date Filing Date Title
SG2013014451A SG188313A1 (en) 2010-09-09 2011-08-26 4-1bb binding molecules
EP18189743.0A EP3441404A1 (en) 2010-09-09 2011-08-26 4-1bb binding molecules
JP2013527708A JP6105470B2 (ja) 2010-09-09 2011-08-26 4−1bb結合分子
SI201131611T SI2614082T1 (sl) 2010-09-09 2011-08-26 Molekule, ki vežejo 4-1BB
BR112013005699-1A BR112013005699B1 (pt) 2010-09-09 2011-08-26 Anticorpo isolado ou porção de ligação ao antígeno do mesmo que se liga ao 4-1bb humano, combinação, usos dos mesmos, bem como composição farmacêutica, molécula de ácido nucleico isolada e vetor
HK14100600.6A HK1187627B (en) 2010-09-09 2011-08-26 4-1bb binding molecules
PL11764859T PL2614082T3 (pl) 2010-09-09 2011-08-26 Cząsteczki wiążące 4-1BB
MX2013002709A MX337040B (es) 2010-09-09 2011-08-26 Moleculas de union a 4-1bb.
MX2015014566A MX374682B (es) 2010-09-09 2011-08-26 Moléculas de unión a 4-1bb.
CN201180054004.2A CN103221428B (zh) 2010-09-09 2011-08-26 4-1bb结合分子
ES11764859T ES2699648T3 (es) 2010-09-09 2011-08-26 Moléculas de unión a 4-1BB
DK11764859.2T DK2614082T3 (en) 2010-09-09 2011-08-26 4-1BB BINDING MOLECULES
RU2013110576/10A RU2551963C2 (ru) 2010-09-09 2011-08-26 Молекулы, связывающиеся с 4-1вв
NZ607710A NZ607710A (en) 2010-09-09 2011-08-26 4-1bb binding molecules
PH1/2020/550156A PH12020550156A1 (en) 2010-09-09 2011-08-26 4-1bb binding molecules
EP11764859.2A EP2614082B1 (en) 2010-09-09 2011-08-26 4-1bb binding molecules
CA2810359A CA2810359C (en) 2010-09-09 2011-08-26 4-1bb binding molecules
KR1020137016205A KR101527300B1 (ko) 2010-09-09 2011-08-26 4-1bb 결합 분자
KR1020137008907A KR101527297B1 (ko) 2010-09-09 2011-08-26 4-1bb 결합 분자
PH1/2013/500395A PH12013500395B1 (en) 2010-09-09 2011-08-26 4-1bb binding molecules
AU2011300445A AU2011300445B2 (en) 2010-09-09 2011-08-26 4-1BB binding molecules
IL225001A IL225001A (en) 2010-09-09 2013-02-28 Antibody to the extracellular area of human bb1–4, pharmacological preparations containing it, and its use in the preparation of cancer drugs
IL247054A IL247054B (en) 2010-09-09 2016-08-01 bb1–4 binding molecules
IL250386A IL250386A0 (en) 2010-09-09 2017-02-01 1–4bb binding molecules

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US38121010P 2010-09-09 2010-09-09
US61/381,210 2010-09-09

Publications (1)

Publication Number Publication Date
WO2012032433A1 true WO2012032433A1 (en) 2012-03-15

Family

ID=44759732

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2011/053761 Ceased WO2012032433A1 (en) 2010-09-09 2011-08-26 4-1bb binding molecules

Country Status (27)

Country Link
US (5) US8337850B2 (https=)
EP (2) EP3441404A1 (https=)
JP (4) JP6105470B2 (https=)
KR (2) KR101527300B1 (https=)
CN (2) CN105481983B (https=)
AR (2) AR082916A1 (https=)
AU (3) AU2011300445B2 (https=)
BR (1) BR112013005699B1 (https=)
CA (1) CA2810359C (https=)
CO (1) CO6690759A2 (https=)
DK (1) DK2614082T3 (https=)
ES (1) ES2699648T3 (https=)
HU (1) HUE041958T2 (https=)
IL (3) IL225001A (https=)
MX (2) MX337040B (https=)
MY (2) MY177065A (https=)
NZ (4) NZ700891A (https=)
PE (1) PE20131465A1 (https=)
PH (2) PH12020550156A1 (https=)
PL (1) PL2614082T3 (https=)
PT (1) PT2614082T (https=)
RU (2) RU2710717C2 (https=)
SG (3) SG10201912092VA (https=)
SI (1) SI2614082T1 (https=)
TW (4) TWI520969B (https=)
WO (1) WO2012032433A1 (https=)
ZA (1) ZA201502914B (https=)

Cited By (352)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2012145183A3 (en) * 2011-04-19 2013-03-14 Pfizer Inc. Combinations of anti-4-1bb antibodies and adcc-inducing antibodies for the treatment of cancer
WO2015069703A1 (en) * 2013-11-06 2015-05-14 Bristol-Myers Squibb Company Immunotherapeutic dosing regimens and combinations thereof
WO2015100282A1 (en) 2013-12-24 2015-07-02 Bristol-Myers Squibb Company Tricyclic compounds as anticancer agents
WO2015187835A2 (en) 2014-06-06 2015-12-10 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
WO2016081748A2 (en) 2014-11-21 2016-05-26 Bristol-Myers Squibb Company Antibodies against cd73 and uses thereof
WO2016106266A1 (en) 2014-12-22 2016-06-30 Bristol-Myers Squibb Company TGFβ RECEPTOR ANTAGONISTS
WO2016127052A1 (en) 2015-02-05 2016-08-11 Bristol-Myers Squibb Company Cxcl11 and smica as predictive biomarkers for efficacy of anti-ctla4 immunotherapy
WO2016140884A1 (en) 2015-03-02 2016-09-09 Rigel Pharmaceuticals, Inc. TGF-β INHIBITORS
WO2016161279A1 (en) 2015-04-03 2016-10-06 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase for the treatment of cancer
WO2016162505A1 (en) 2015-04-08 2016-10-13 F-Star Biotechnology Limited Her2 binding agent therapies
WO2016168149A1 (en) 2015-04-13 2016-10-20 Five Prime Therapeutics, Inc. Combination therapy for cancer
WO2016183114A1 (en) 2015-05-11 2016-11-17 Bristol-Myers Squibb Company Tricyclic compounds as anticancer agents
WO2016183115A1 (en) 2015-05-12 2016-11-17 Bristol-Myers Squibb Company 5h-pyrido[3,2-b]indole compounds as anticancer agents
WO2016183118A1 (en) 2015-05-12 2016-11-17 Bristol-Myers Squibb Company Tricyclic compounds as anticancer agents
WO2016184882A1 (en) * 2015-05-18 2016-11-24 Pieris Pharmaceuticals Gmbh Anti-cancer fusion polypeptide
WO2016196228A1 (en) 2015-05-29 2016-12-08 Bristol-Myers Squibb Company Antibodies against ox40 and uses thereof
WO2017019757A1 (en) 2015-07-28 2017-02-02 Bristol-Myers Squibb Company Tgf beta receptor antagonists
WO2017035118A1 (en) 2015-08-25 2017-03-02 Bristol-Myers Squibb Company Tgf beta receptor antagonists
US9598422B2 (en) 2014-11-05 2017-03-21 Flexus Biosciences, Inc. Immunoregulatory agents
WO2017069291A1 (en) 2015-10-23 2017-04-27 Canbas Co., Ltd. Peptides and peptidomimetics in combination with t cell activating and/or checkpoint inhibiting agents for cancer treatment
US9643972B2 (en) 2014-11-05 2017-05-09 Flexus Biosciences, Inc. Immunoregulatory agents
WO2017079117A1 (en) 2015-11-02 2017-05-11 Five Prime Therapeutics, Inc. Cd80 extracellular domain polypeptides and their use in cancer treatment
WO2017087678A2 (en) 2015-11-19 2017-05-26 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
WO2017091577A1 (en) 2015-11-23 2017-06-01 Five Prime Therapeutics, Inc. Fgfr2 inhibitors alone or in combination with immune stimulating agents in cancer treatment
WO2017077085A3 (en) * 2015-11-04 2017-06-22 Cancer Research Technology Immunomodulatory antibodies
WO2017106291A1 (en) 2015-12-15 2017-06-22 Bristol-Myers Squibb Company Cxcr4 receptor antagonists
WO2017152085A1 (en) 2016-03-04 2017-09-08 Bristol-Myers Squibb Company Combination therapy with anti-cd73 antibodies
WO2017184619A2 (en) 2016-04-18 2017-10-26 Celldex Therapeutics, Inc. Agonistic antibodies that bind human cd40 and uses thereof
WO2017205745A1 (en) * 2016-05-27 2017-11-30 Abbvie Biotherapeutics Inc. Anti-4-1bb antibodies and their uses
WO2017220989A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
WO2018013818A2 (en) 2016-07-14 2018-01-18 Bristol-Myers Squibb Company Antibodies against tim3 and uses thereof
WO2018017633A1 (en) 2016-07-21 2018-01-25 Bristol-Myers Squibb Company TGF Beta RECEPTOR ANTAGONISTS
WO2018033798A1 (en) 2016-08-17 2018-02-22 Compugen Ltd. Anti-tigit antibodies, anti-pvrig antibodies and combinations thereof
WO2018129332A1 (en) 2017-01-06 2018-07-12 Iovance Biotherapeutics, Inc. Expansion of tumor infiltrating lymphocytes (tils) with tumor necrosis factor receptor superfamily (tnfrsf) agonists and therapeutic combinations of tils and tnfrsf agonists
WO2018132279A1 (en) 2017-01-05 2018-07-19 Bristol-Myers Squibb Company Tgf beta receptor antagonists
WO2018136700A1 (en) 2017-01-20 2018-07-26 Arcus Biosciences, Inc. Azolopyrimidine for the treatment of cancer-related disorders
WO2018146317A1 (en) 2017-02-10 2018-08-16 Genmab B.V. Polypeptide variants and uses thereof
WO2018183608A1 (en) 2017-03-31 2018-10-04 Five Prime Therapeutics, Inc. Combination therapy for cancer using anti-gitr antibodies
WO2018186924A1 (en) 2017-01-17 2018-10-11 The University Of Chicago Dysfunctional antigen-specific cd8+ t cells in the tumor microenvironment
EP3258959A4 (en) * 2015-02-22 2018-10-17 Sorrento Therapeutics, Inc. Antibody therapeutics that bind cd137
WO2018195397A2 (en) 2017-04-21 2018-10-25 Kyn Therapeutics Indole ahr inhibitors and uses thereof
WO2018201014A1 (en) 2017-04-28 2018-11-01 Five Prime Therapeutics, Inc. Methods of treatment with cd80 extracellular domain polypeptides
WO2018209049A1 (en) 2017-05-12 2018-11-15 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2018213377A1 (en) 2017-05-17 2018-11-22 Arcus Biosciences, Inc. Quinazoline-pyrazole derivatives for the treatment of cancer-related disorders
WO2018220446A1 (en) 2017-06-01 2018-12-06 Compugen Ltd. Triple combination antibody therapies
WO2018226714A1 (en) 2017-06-05 2018-12-13 Iovance Biotherapeutics, Inc. Methods of using tumor infiltrating lymphocytes in double-refractory melanoma
WO2019006283A1 (en) 2017-06-30 2019-01-03 Bristol-Myers Squibb Company AMORPHOUS AND CRYSTALLINE FORMS OF IDO INHIBITORS
WO2019023459A1 (en) 2017-07-28 2019-01-31 Bristol-Myers Squibb Company CYCLIC DINUCLEOTIDES AS ANTICANCER AGENTS
WO2019014328A3 (en) * 2017-07-11 2019-02-21 Compass Therapeutics Llc Agonist antibodies that bind human cd137 and uses thereof
WO2019046500A1 (en) 2017-08-31 2019-03-07 Bristol-Myers Squibb Company CYCLIC DINUCLEOTIDES AS ANTICANCER AGENTS
WO2019046496A1 (en) 2017-08-31 2019-03-07 Bristol-Myers Squibb Company CYCLIC DINUCLEOTIDES AS ANTICANCER AGENTS
WO2019046498A1 (en) 2017-08-31 2019-03-07 Bristol-Myers Squibb Company CYCLIC DINUCLEOTIDES AS ANTICANCER AGENTS
EP3470426A1 (en) 2017-10-10 2019-04-17 Numab Therapeutics AG Multispecific antibody
EP3470428A1 (en) 2017-10-10 2019-04-17 Numab Innovation AG Antibodies targeting cd137 and methods of use thereof
WO2019074822A1 (en) 2017-10-09 2019-04-18 Bristol-Myers Squibb Company INDOLEAMINE 2,3-DIOXYGENASE INHIBITORS AND METHODS OF USE
WO2019074824A1 (en) 2017-10-09 2019-04-18 Bristol-Myers Squibb Company INDOLEAMINE 2,3-DIOXYGENASE INHIBITORS AND METHODS OF USE
WO2019072870A1 (en) 2017-10-10 2019-04-18 Numab Innovation Ag ANTIBODIES TARGETING CD137 AND METHODS OF USE
WO2019072868A1 (en) 2017-10-10 2019-04-18 Numab Therapeutics AG MULTISPECIFIC ANTIBODIES
WO2019075090A1 (en) 2017-10-10 2019-04-18 Tilos Therapeutics, Inc. ANTI-LAP ANTIBODIES AND USES THEREOF
WO2019074887A1 (en) 2017-10-10 2019-04-18 Bristol-Myers Squibb Company CYCLIC DINUCLEOTIDES AS ANTICANCER AGENTS
WO2019079261A1 (en) 2017-10-16 2019-04-25 Bristol-Myers Squibb Company CYCLIC DINUCLEOTIDES AS ANTICANCER AGENTS
WO2019090198A1 (en) 2017-11-06 2019-05-09 Bristol-Myers Squibb Company Isofuranone compounds useful as hpk1 inhibitors
WO2019089921A1 (en) 2017-11-01 2019-05-09 Bristol-Myers Squibb Company Immunostimulatory agonistic antibodies for use in treating cancer
WO2019100023A1 (en) 2017-11-17 2019-05-23 Iovance Biotherapeutics, Inc. Til expansion from fine needle aspirates and small biopsies
US10323004B2 (en) 2016-05-04 2019-06-18 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2019136456A1 (en) 2018-01-08 2019-07-11 Iovance Biotherapeutics, Inc. Processes for generating til products enriched for tumor antigen-specific t-cells
WO2019136459A1 (en) 2018-01-08 2019-07-11 Iovance Biotherapeutics, Inc. Processes for generating til products enriched for tumor antigen-specific t-cells
WO2019136112A1 (en) 2018-01-05 2019-07-11 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2019089753A3 (en) * 2017-10-31 2019-07-18 Compass Therapeutics Llc Cd137 antibodies and pd-1 antagonists and uses thereof
WO2019140229A1 (en) 2018-01-12 2019-07-18 Bristol-Myers Squibb Company Antibodies against tim3 and uses thereof
WO2019141268A1 (zh) 2018-01-22 2019-07-25 江苏恒瑞医药股份有限公司 抗4-1bb抗体、其抗原结合片段及其医药用途
WO2019148132A1 (en) 2018-01-29 2019-08-01 Merck Patent Gmbh Gcn2 inhibitors and uses thereof
WO2019160884A1 (en) 2018-02-13 2019-08-22 Bristol-Myers Squibb Company Cyclic dinucleotides as anticancer agents
WO2019160829A1 (en) 2018-02-13 2019-08-22 Iovance Biotherapeutics, Inc. Expansion of tumor infiltrating lymphocytes (tils) with adenosine a2a receptor antagonists and therapeutic combinations of tils and adenosine a2a receptor antagonists
WO2019165315A1 (en) 2018-02-23 2019-08-29 Syntrix Biosystems Inc. Method for treating cancer using chemokine antagonists alone or in combination
WO2019173798A1 (en) 2018-03-08 2019-09-12 Rubius Therapeutics, Inc. Therapeutic cell systems and methods for treating cancer and infectious diseases
WO2019173587A1 (en) 2018-03-08 2019-09-12 Bristol-Myers Squibb Company Cyclic dinucleotides as anticancer agents
WO2019173188A1 (en) 2018-03-05 2019-09-12 Arcus Biosciences, Inc. Arginase inhibitors
US10415015B2 (en) 2016-10-31 2019-09-17 Iovance Biotherapeutics, Inc. Engineered artificial antigen presenting cells for tumor infiltrating lymphocyte expansion
WO2019183040A1 (en) 2018-03-21 2019-09-26 Five Prime Therapeutics, Inc. ANTIBODIES BINDING TO VISTA AT ACIDIC pH
WO2019190579A1 (en) 2018-03-29 2019-10-03 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes and uses of same in immunotherapy
EP3523332A4 (en) * 2017-01-06 2019-10-09 Eutilex Co., Ltd. ANTI-HUMAN 4-1 BB ANTIBODY AND ITS USE
WO2019200256A1 (en) 2018-04-12 2019-10-17 Bristol-Myers Squibb Company Anticancer combination therapy with cd73 antagonist antibody and pd-1/pd-l1 axis antagonist antibody
WO2019197600A1 (en) 2018-04-13 2019-10-17 F. Hoffmann-La Roche Ag Her2-targeting antigen binding molecules comprising 4-1bbl
WO2019204257A1 (en) 2018-04-16 2019-10-24 Arrys Therapeutics, Inc. Ep4 inhibitors and use thereof
WO2019210131A1 (en) 2018-04-27 2019-10-31 Iovance Biotherapeutics, Inc. Closed process for expansion and gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy
WO2019213340A1 (en) 2018-05-03 2019-11-07 Bristol-Myers Squibb Company Uracil derivatives as mer-axl inhibitors
WO2019217753A1 (en) 2018-05-10 2019-11-14 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes and uses of same in immunotherapy
WO2019241730A2 (en) 2018-06-15 2019-12-19 Flagship Pioneering Innovations V, Inc. Increasing immune activity through modulation of postcellular signaling factors
WO2019243832A1 (en) 2018-06-22 2019-12-26 Bicycletx Limited Bicyclic peptide ligands specific for nectin-4
WO2020006016A1 (en) 2018-06-27 2020-01-02 Bristol-Myers Squibb Company Naphthyridinone compounds useful as t cell activators
WO2020006018A1 (en) 2018-06-27 2020-01-02 Bristol-Myers Squibb Company Substituted naphthyridinone compounds useful as t cell activators
WO2020010177A1 (en) 2018-07-06 2020-01-09 Kymera Therapeutics, Inc. Tricyclic crbn ligands and uses thereof
WO2020014132A2 (en) 2018-07-09 2020-01-16 Five Prime Therapeutics, Inc. Antibodies binding to ilt4
WO2020014327A2 (en) 2018-07-11 2020-01-16 Five Prime Therapeutics, Inc. Antibodies binding to vista at acidic ph
WO2020018680A1 (en) 2018-07-18 2020-01-23 Arcus Biosciences, Inc. Solid forms of an azolopyrimidine compound
US10544099B2 (en) 2016-05-04 2020-01-28 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2020023355A1 (en) 2018-07-23 2020-01-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2020023846A1 (en) 2018-07-27 2020-01-30 Arcus Biosciences, Inc. Pyridone a2r antagonists
WO2020023356A1 (en) 2018-07-23 2020-01-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US10570371B2 (en) 2014-03-12 2020-02-25 Eutilex Co., Ltd. Methods for isolating and proliferating autologous cancer antigen-specific CD8+T cells
WO2020051424A1 (en) 2018-09-07 2020-03-12 Pic Therapeutics Eif4e inhibitors and uses thereof
WO2020061429A1 (en) 2018-09-20 2020-03-26 Iovance Biotherapeutics, Inc. Expansion of tils from cryopreserved tumor samples
EP3636320A1 (en) 2018-10-09 2020-04-15 Numab Therapeutics AG Antibodies targeting cd137 and methods of use thereof
WO2020076969A2 (en) 2018-10-10 2020-04-16 Tilos Therapeutics, Inc. Anti-lap antibody variants and uses thereof
WO2020074584A1 (en) 2018-10-09 2020-04-16 Numab Therapeutics AG Antibodies targeting cd137 and methods of use thereof
US10633342B2 (en) 2016-05-04 2020-04-28 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US10640568B2 (en) 2010-09-09 2020-05-05 Pfizer Inc. 4-1BB binding molecules
WO2020096682A2 (en) 2018-08-31 2020-05-14 Iovance Biotherapeutics, Inc. Treatment of nsclc patients refractory for anti-pd-1 antibody
WO2020096986A2 (en) 2018-11-05 2020-05-14 Iovance Biotherapeutics, Inc. Selection of improved tumor reactive t-cells
WO2020096927A1 (en) 2018-11-05 2020-05-14 Iovance Biotherapeutics, Inc. Expansion of tils utilizing akt pathway inhibitors
WO2020096988A2 (en) 2018-11-05 2020-05-14 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes and uses of the same in immunotherapy
WO2020096989A1 (en) 2018-11-05 2020-05-14 Iovance Biotherapeutics, Inc. Treatment of nsclc patients refractory for anti-pd-1 antibody
WO2020102646A2 (en) 2018-11-16 2020-05-22 Arcus Biosciences, Inc. Inhibitors of arg1 and/or arg2
US10660909B2 (en) 2016-11-17 2020-05-26 Syntrix Biosystems Inc. Method for treating cancer using chemokine antagonists
EP3670659A1 (en) 2018-12-20 2020-06-24 Abivax Biomarkers, and uses in treatment of viral infections, inflammations, or cancer
WO2020128893A1 (en) 2018-12-21 2020-06-25 Pfizer Inc. Combination treatments of cancer comprising a tlr agonist
WO2020131547A1 (en) 2018-12-19 2020-06-25 Iovance Biotherapeutics, Inc. Methods of expanding tumor infiltrating lymphocytes using engineered cytokine receptor pairs and uses thereof
US10696650B2 (en) 2017-08-17 2020-06-30 Ikena Oncology, Inc. AHR inhibitors and uses thereof
US10695426B2 (en) 2014-08-25 2020-06-30 Pfizer Inc. Combination of a PD-1 antagonist and an ALK inhibitor for treating cancer
US10696648B2 (en) 2016-05-04 2020-06-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2020185859A1 (en) 2019-03-12 2020-09-17 Arcus Biosciences, Inc. Treatment of oncogene-driven cancers
WO2020187998A1 (en) 2019-03-19 2020-09-24 Fundació Privada Institut D'investigació Oncològica De Vall Hebron Combination therapy with omomyc and an antibody binding pd-1 or ctla-4 for the treatment of cancer
US10793563B2 (en) 2018-01-29 2020-10-06 Merck Patent Gmbh GCN2 inhibitors and uses thereof
WO2020205527A1 (en) 2019-03-29 2020-10-08 Arcus Biosciences, Inc. Treatment of cancer utilizing an identified adenosine fingerprint
WO2020201753A1 (en) 2019-04-02 2020-10-08 Bicycletx Limited Bicycle toxin conjugates and uses thereof
WO2020205662A1 (en) 2019-03-29 2020-10-08 Myst Therapeutics, Inc. Ex vivo methods for producing a t cell therapeutic and related compositions and methods
WO2020216947A1 (en) 2019-04-24 2020-10-29 Heidelberg Pharma Research Gmbh Amatoxin antibody-drug conjugates and uses thereof
WO2020227159A2 (en) 2019-05-03 2020-11-12 Flagship Pioneering Innovations V, Inc. Methods of modulating immune activity
EP3544628A4 (en) * 2016-11-23 2020-11-18 Immunoah Therapeutics, Inc. 4-1BB BINDING PROTEINS AND THEIR USES
WO2020231766A1 (en) 2019-05-13 2020-11-19 Bristol-Myers Squibb Company AGONISTS OF ROR GAMMAt
WO2020232029A1 (en) 2019-05-13 2020-11-19 Iovance Biotherapeutics, Inc. Methods and compositions for selecting tumor infiltrating lymphocytes and uses of the same in immunotherapy
WO2020231713A1 (en) 2019-05-13 2020-11-19 Bristol-Myers Squibb Company AGONISTS OF ROR GAMMAt
WO2020243423A1 (en) 2019-05-31 2020-12-03 Ikena Oncology, Inc. Tead inhibitors and uses thereof
WO2020245746A1 (en) 2019-06-04 2020-12-10 Molecular Partners Ag Multispecific proteins
US10874743B2 (en) 2017-12-26 2020-12-29 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
EP3755333A1 (en) 2018-02-16 2020-12-30 Arcus Biosciences, Inc. Dosing with an azolopyrimidine compound
US10899840B2 (en) 2014-02-04 2021-01-26 Pfizer Inc. Combination of a PD-1 antagonist and a 4-1BB agonist for treating cancer
US20210023134A1 (en) * 2018-01-15 2021-01-28 Pfizer Inc. Methods of administering chimeric antigen receptor immunotherapy in combination with 4-1bb agonist
WO2021026179A1 (en) 2019-08-06 2021-02-11 Bristol-Myers Squibb Company AGONISTS OF ROR GAMMAt
WO2021041588A1 (en) 2019-08-28 2021-03-04 Bristol-Myers Squibb Company Substituted pyridopyrimidinonyl compounds useful as t cell activators
WO2021050964A1 (en) 2019-09-13 2021-03-18 Nimbus Saturn, Inc. Hpk1 antagonists and uses thereof
WO2021055698A1 (en) 2019-09-19 2021-03-25 Bristol-Myers Squibb Company Antibodies binding to vista at acidic ph
US10959986B2 (en) 2018-08-29 2021-03-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US10987322B2 (en) 2014-06-06 2021-04-27 Flexus Biosciences, Inc. Immunoregulatory agents
WO2021081378A1 (en) 2019-10-25 2021-04-29 Iovance Biotherapeutics, Inc. Gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy
WO2021101919A1 (en) 2019-11-19 2021-05-27 Bristol-Myers Squibb Company Compounds useful as inhibitors of helios protein
WO2021108727A1 (en) 2019-11-27 2021-06-03 Myst Therapeutics, Inc. Method of producing tumor-reactive t cell composition using modulatory agents
WO2021108528A1 (en) 2019-11-26 2021-06-03 Ikena Oncology, Inc. Polymorphic carbazole derivatives and uses thereof
WO2021108288A1 (en) 2019-11-26 2021-06-03 Bristol-Myers Squibb Company Salts/cocrystals of (r)-n-(4-chlorophenyl)-2-((1s,4s)-4-(6-fluoroquinolin-4-yl)cyclohexyl)propanamide
WO2021118990A1 (en) 2019-12-11 2021-06-17 Iovance Biotherapeutics, Inc. Processes for the production of tumor infiltrating lymphocytes (tils) and methods of using the same
WO2021124096A1 (en) 2019-12-18 2021-06-24 Pfizer Inc. Once daily cancer treatment regimen with a prmt5 inhibitor
WO2021127217A1 (en) 2019-12-17 2021-06-24 Flagship Pioneering Innovations V, Inc. Combination anti-cancer therapies with inducers of iron-dependent cellular disassembly
WO2021133749A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted piperazine derivatives useful as t cell activators
WO2021133752A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted heteroaryl compounds useful as t cell activators
WO2021133750A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted bicyclic piperidine derivatives useful as t cell activators
WO2021133751A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted quinazolinyl compounds useful as t cell activators
WO2021133748A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted quinolinonyl piperazine compounds useful as t cell activators
WO2021133920A1 (en) 2019-12-23 2021-07-01 Kymera Therapeutics, Inc. Smarca degraders and uses thereof
WO2021139682A1 (en) 2020-01-07 2021-07-15 Hifibio (Hk) Limited Anti-galectin-9 antibody and uses thereof
WO2021141907A1 (en) 2020-01-06 2021-07-15 Hifibio (Hong Kong) Limited Anti-tnfr2 antibody and uses thereof
US11066383B2 (en) 2016-05-04 2021-07-20 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2021146370A1 (en) 2020-01-15 2021-07-22 Blueprint Medicines Corporation Map4k1 inhibitors
CN113166250A (zh) * 2018-11-30 2021-07-23 Abl生物公司 抗4-1bb抗体及其用途
WO2021174208A1 (en) 2020-02-27 2021-09-02 Myst Therapeutics, Llc Methods for ex vivo enrichment and expansion of tumor reactive t cells and related compositions thereof
WO2021170067A1 (zh) 2020-02-28 2021-09-02 上海复宏汉霖生物技术股份有限公司 抗cd137构建体及其用途
WO2021170071A1 (en) 2020-02-28 2021-09-02 Shanghai Henlius Biotech, Inc. Anti-cd137 constructs, multispecific antibody and uses thereof
WO2021178488A1 (en) 2020-03-03 2021-09-10 PIC Therapeutics, Inc. Eif4e inhibitors and uses thereof
US11117889B1 (en) 2018-11-30 2021-09-14 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
WO2021181233A2 (en) 2020-03-09 2021-09-16 Pfizer Inc. Fusion proteins and uses thereof
WO2021188769A1 (en) 2020-03-19 2021-09-23 Arcus Biosciences, Inc. Tetralin and tetrahydroquinoline compounds as inhibitors of hif-2alpha
WO2021188948A1 (en) 2020-03-19 2021-09-23 Kymera Therapeutics, Inc. Mdm2 degraders and uses thereof
WO2021194914A1 (en) 2020-03-23 2021-09-30 Bristol-Myers Squibb Company Substituted oxoisoindoline compounds for the treatment of cancer
WO2021207449A1 (en) 2020-04-09 2021-10-14 Merck Sharp & Dohme Corp. Affinity matured anti-lap antibodies and uses thereof
WO2021226085A1 (en) 2020-05-04 2021-11-11 Iovance Biotherapeutics, Inc. Selection of improved tumor reactive t-cells
WO2021226061A1 (en) 2020-05-04 2021-11-11 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes and uses of the same in immunotherapy
WO2021229507A2 (en) 2020-05-13 2021-11-18 Pfizer Inc. Methods, therapies and uses for treating cancer
EP3708582A4 (en) * 2017-11-09 2021-12-01 Shanghai Hyamab Biotech Co., Ltd. 4-1BB ANTIBODIES AND THE MANUFACTURING METHOD AND USES THEREOF
WO2021247897A1 (en) 2020-06-03 2021-12-09 Kymera Therapeutics, Inc. Deuterated irak degraders and uses thereof
WO2021247591A1 (en) 2020-06-02 2021-12-09 Arcus Biosciences, Inc. Antibodies to tigit
US11203643B2 (en) 2019-05-10 2021-12-21 Lyvgen Biopharma Holdings Limited Humanized anti-CD137 antibodies and uses thereof
WO2021258010A1 (en) 2020-06-19 2021-12-23 Gossamer Bio Services, Inc. Oxime compounds useful as t cell activators
WO2022006179A1 (en) 2020-06-29 2022-01-06 Flagship Pioneering Innovations V, Inc. Viruses engineered to promote thanotransmission and their use in treating cancer
US11242319B2 (en) 2014-11-05 2022-02-08 Flexus Biosciences, Inc. Immunoregulatory agents
WO2022033419A2 (en) 2020-08-10 2022-02-17 Shanghai Xbh Biotechnology Co., Ltd. Compositions and methods for treating autoimmune diseases and cancers by targeting igsf8
US11253525B2 (en) 2018-08-29 2022-02-22 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2022038158A1 (en) 2020-08-17 2022-02-24 Bicycletx Limited Bicycle conjugates specific for nectin-4 and uses thereof
WO2022053990A1 (en) 2020-09-14 2022-03-17 Pfizer Inc. Methods, therapies and uses for treating cancer
WO2022076606A1 (en) 2020-10-06 2022-04-14 Iovance Biotherapeutics, Inc. Treatment of nsclc patients with tumor infiltrating lymphocyte therapies
WO2022076952A1 (en) 2020-10-06 2022-04-14 Iovance Biotherapeutics, Inc. Treatment of nsclc patients with tumor infiltrating lymphocyte therapies
WO2022081718A1 (en) 2020-10-14 2022-04-21 Five Prime Therapeutics, Inc. Anti-c-c chemokine receptor 8 (ccr8) antibodies and methods of use thereof
EP3988568A1 (en) 2020-10-21 2022-04-27 Numab Therapeutics AG Combination treatment
US11351164B2 (en) 2016-08-26 2022-06-07 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2022120354A1 (en) 2020-12-02 2022-06-09 Ikena Oncology, Inc. Tead inhibitors and uses thereof
WO2022120353A1 (en) 2020-12-02 2022-06-09 Ikena Oncology, Inc. Tead inhibitors and uses thereof
US11358948B2 (en) 2017-09-22 2022-06-14 Kymera Therapeutics, Inc. CRBN ligands and uses thereof
WO2022125941A1 (en) 2020-12-11 2022-06-16 Iovance Biotherapeutics, Inc. Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with braf inhibitors and/or mek inhibitors
WO2022133083A1 (en) 2020-12-16 2022-06-23 Gossamer Bio Services, Inc. Compounds useful as t cell activators
WO2022133140A1 (en) 2020-12-17 2022-06-23 Iovance Biotherapeutics, Inc. Treatment with tumor infiltrating lymphocyte therapies in combination with ctla-4 and pd-1 inhibitors
WO2022133149A1 (en) 2020-12-17 2022-06-23 Iovance Biotherapeutics, Inc. Treatment of cancers with tumor infiltrating lymphocytes
US11384131B2 (en) 2014-04-24 2022-07-12 The Board Of Trustees Of The Leland Stanford Junior University Superagonists, partial agonists and antagonists of interleukin-2
WO2022148979A1 (en) 2021-01-11 2022-07-14 Bicycletx Limited Methods for treating cancer
WO2022153161A1 (en) 2021-01-14 2022-07-21 Pfizer Inc. Treatment of cancer using a prmt5 inhibitor
US11396647B2 (en) 2020-01-07 2022-07-26 Board Of Regents, The University Of Texas System Human methylthioadenosine/adenosine depleting enzyme variants for cancer therapy
WO2022169921A1 (en) 2021-02-04 2022-08-11 Bristol-Myers Squibb Company Benzofuran compounds as sting agonists
WO2022167457A1 (en) 2021-02-02 2022-08-11 Liminal Biosciences Limited Gpr84 antagonists and uses thereof
WO2022170219A1 (en) 2021-02-05 2022-08-11 Iovance Biotherapeutics, Inc. Adjuvant therapy for cancer
WO2022167445A1 (en) 2021-02-02 2022-08-11 Liminal Biosciences Limited Gpr84 antagonists and uses thereof
WO2022171745A1 (en) 2021-02-12 2022-08-18 F. Hoffmann-La Roche Ag Bicyclic tetrahydroazepine derivatives for the treatment of cancer
WO2022187741A2 (en) 2021-03-05 2022-09-09 Iovance Biotherapeutics, Inc. Tumor storage and cell culture compositions
WO2022192145A1 (en) 2021-03-08 2022-09-15 Blueprint Medicines Corporation Map4k1 inhibitors
WO2022197641A1 (en) 2021-03-15 2022-09-22 Rapt Therapeutics, Inc. 1h-pyrazolo[3,4-d]pyrimidin-6-yl-amine derivatives as hematopoietic progenitor kinase 1 (hpk1) modulators and/or inhibitors for the treatment of cancer and other diseases
US11459394B2 (en) 2017-02-24 2022-10-04 Macrogenics, Inc. Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof
WO2022212784A1 (en) 2021-03-31 2022-10-06 Flagship Pioneering Innovations V, Inc. Thanotransmission polypeptides and their use in treating cancer
WO2022216573A1 (en) 2021-04-05 2022-10-13 Bristol-Myers Squibb Company Pyridinyl substituted oxoisoindoline compounds for the treatment of cancer
WO2022216644A1 (en) 2021-04-06 2022-10-13 Bristol-Myers Squibb Company Pyridinyl substituted oxoisoindoline compounds
WO2022221866A1 (en) 2021-04-16 2022-10-20 Ikena Oncology, Inc. Mek inhibitors and uses thereof
WO2022225981A2 (en) 2021-04-19 2022-10-27 Iovance Biotherapeutics, Inc. Chimeric costimulatory receptors, chemokine receptors, and the use of same in cellular immunotherapies
US11485750B1 (en) 2019-04-05 2022-11-01 Kymera Therapeutics, Inc. STAT degraders and uses thereof
US11485743B2 (en) 2018-01-12 2022-11-01 Kymera Therapeutics, Inc. Protein degraders and uses thereof
US11505615B2 (en) 2017-12-05 2022-11-22 Lyvgen Biopharma Holdings Limited Anti-CD137 antibodies and uses thereof
WO2022246177A1 (en) 2021-05-21 2022-11-24 Arcus Biosciences, Inc. Axl compounds
WO2022245754A1 (en) 2021-05-17 2022-11-24 Iovance Biotherapeutics, Inc. Pd-1 gene-edited tumor infiltrating lymphocytes and uses of same in immunotherapy
WO2022246179A1 (en) 2021-05-21 2022-11-24 Arcus Biosciences, Inc. Axl inhibitor compounds
US11512080B2 (en) 2018-01-12 2022-11-29 Kymera Therapeutics, Inc. CRBN ligands and uses thereof
US11534440B2 (en) 2015-05-29 2022-12-27 Bergenbio Asa Combination therapy with Axl inhibitor and immune checkpoint modulator or oncolytic virus
US11542312B2 (en) 2017-06-19 2023-01-03 Medicenna Therapeutics, Inc. IL-2 superagonists in combination with anti-PD-1 antibodies
WO2023278641A1 (en) 2021-06-29 2023-01-05 Flagship Pioneering Innovations V, Inc. Immune cells engineered to promote thanotransmission and uses thereof
WO2023288254A1 (en) 2021-07-14 2023-01-19 Blueprint Medicines Corporation Heterocyclic compounds as map4k1 inhibitors
WO2023288264A1 (en) 2021-07-15 2023-01-19 Blueprint Medicines Corporation Map4k1 inhibitors
US11566078B2 (en) 2016-01-11 2023-01-31 Inhibrx, Inc. PDL1-binding proteins
WO2023009716A1 (en) 2021-07-28 2023-02-02 Iovance Biotherapeutics, Inc. Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with kras inhibitors
US11591332B2 (en) 2019-12-17 2023-02-28 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
WO2023028238A1 (en) 2021-08-25 2023-03-02 PIC Therapeutics, Inc. Eif4e inhibitors and uses thereof
WO2023028235A1 (en) 2021-08-25 2023-03-02 PIC Therapeutics, Inc. Eif4e inhibitors and uses thereof
WO2023049862A1 (en) 2021-09-24 2023-03-30 Iovance Biotherapeutics, Inc. Expansion processes and agents for tumor infiltrating lymphocytes
US11623932B2 (en) 2017-09-22 2023-04-11 Kymera Therapeutics, Inc. Protein degraders and uses thereof
WO2023064958A1 (en) 2021-10-15 2023-04-20 Compugen Ltd. Combination therapy with anti-pvrig antibodies formulations, anti-tigit antibodies, and anti-pd-1 antibodies
WO2023077046A1 (en) 2021-10-29 2023-05-04 Arcus Biosciences, Inc. Inhibitors of hif-2alpha and methods of use thereof
WO2023077015A2 (en) 2021-10-27 2023-05-04 Iovance Biotherapeutics, Inc. Systems and methods for coordinating manufacturing of cells for patient-specific immunotherapy
WO2023086803A1 (en) 2021-11-10 2023-05-19 Iovance Biotherapeutics, Inc. Methods of expansion treatment utilizing cd8 tumor infiltrating lymphocytes
US11680090B2 (en) 2013-09-24 2023-06-20 Medicenna Therapeutics, Inc. Interleukin-2 fusion proteins and uses thereof
WO2023114984A1 (en) 2021-12-17 2023-06-22 Ikena Oncology, Inc. Tead inhibitors and uses thereof
US11685750B2 (en) 2020-06-03 2023-06-27 Kymera Therapeutics, Inc. Crystalline forms of IRAK degraders
WO2023122778A1 (en) 2021-12-22 2023-06-29 Gossamer Bio Services, Inc. Pyridazinone derivatives useful as t cell activators
WO2023122777A1 (en) 2021-12-22 2023-06-29 Gossamer Bio Services, Inc. Oxime derivatives useful as t cell activators
WO2023122772A1 (en) 2021-12-22 2023-06-29 Gossamer Bio Services, Inc. Oxime derivatives useful as t cell activators
US11707457B2 (en) 2019-12-17 2023-07-25 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11713446B2 (en) 2018-01-08 2023-08-01 Iovance Biotherapeutics, Inc. Processes for generating TIL products enriched for tumor antigen-specific T-cells
WO2023147486A1 (en) 2022-01-28 2023-08-03 Iovance Biotherapeutics, Inc. Tumor infiltrating lymphocytes engineered to express payloads
WO2023150186A1 (en) 2022-02-01 2023-08-10 Arvinas Operations, Inc. Dgk targeting compounds and uses thereof
WO2023173053A1 (en) 2022-03-10 2023-09-14 Ikena Oncology, Inc. Mek inhibitors and uses thereof
WO2023173057A1 (en) 2022-03-10 2023-09-14 Ikena Oncology, Inc. Mek inhibitors and uses thereof
US11773103B2 (en) 2021-02-15 2023-10-03 Kymera Therapeutics, Inc. IRAK4 degraders and uses thereof
WO2023211889A1 (en) 2022-04-25 2023-11-02 Ikena Oncology, Inc. Polymorphic compounds and uses thereof
WO2023215719A1 (en) 2022-05-02 2023-11-09 Arcus Biosciences, Inc. Anti-tigit antibodies and uses of the same
WO2023230205A1 (en) 2022-05-25 2023-11-30 Ikena Oncology, Inc. Mek inhibitors and uses thereof
US11851497B2 (en) 2017-11-20 2023-12-26 Compass Therapeutics Llc CD137 antibodies and tumor antigen-targeting antibodies and uses thereof
US11857535B2 (en) 2020-07-30 2024-01-02 Kymera Therapeutics, Inc. Methods of treating mutant lymphomas
EP4063388A4 (en) * 2019-11-19 2024-01-17 Sound Biopharmaceuticals Co. Ltd. HUMANIZED MONOCLONAL ANTIBODY 4-1BB AND ASSOCIATED PHARMACEUTICAL COMPOSITION
WO2024015251A1 (en) 2022-07-15 2024-01-18 Arcus Biosciences, Inc. Inhibitors of hpk1 and methods of use thereof
WO2024020034A1 (en) 2022-07-20 2024-01-25 Arcus Biosciences, Inc. Cbl-b inhibitors and methods of use thereof
WO2024030758A1 (en) 2022-08-01 2024-02-08 Iovance Biotherapeutics, Inc. Chimeric costimulatory receptors, chemokine receptors, and the use of same in cellular immunotherapies
WO2024028364A1 (en) 2022-08-02 2024-02-08 Liminal Biosciences Limited Aryl-triazolyl and related gpr84 antagonists and uses thereof
WO2024028363A1 (en) 2022-08-02 2024-02-08 Liminal Biosciences Limited Heteroaryl carboxamide and related gpr84 antagonists and uses thereof
WO2024028365A1 (en) 2022-08-02 2024-02-08 Liminal Biosciences Limited Substituted pyridone gpr84 antagonists and uses thereof
WO2024033458A1 (en) 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydroazepine derivatives
WO2024033457A1 (en) 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives
WO2024036101A1 (en) 2022-08-09 2024-02-15 Bristol-Myers Squibb Company Tertiary amine substituted bicyclic compounds useful as t cell activators
WO2024033389A1 (en) 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives
WO2024033388A1 (en) 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives
WO2024036100A1 (en) 2022-08-08 2024-02-15 Bristol-Myers Squibb Company Substituted tetrazolyl compounds useful as t cell activators
WO2024040194A1 (en) 2022-08-17 2024-02-22 Capstan Therapeutics, Inc. Conditioning for in vivo immune cell engineering
US11926625B2 (en) 2021-03-05 2024-03-12 Nimbus Saturn, Inc. HPK1 antagonists and uses thereof
US11939388B2 (en) 2016-07-14 2024-03-26 Genmab A/S Multispecific antibodies against CD40 and CD137
WO2024077191A1 (en) 2022-10-05 2024-04-11 Flagship Pioneering Innovations V, Inc. Nucleic acid molecules encoding trif and additionalpolypeptides and their use in treating cancer
WO2024081385A1 (en) 2022-10-14 2024-04-18 Arcus Biosciences, Inc. Hpk1 inhibitors and methods of use thereof
WO2024086718A1 (en) 2022-10-20 2024-04-25 Arcus Biosciences, Inc. Lyophilized formulations of cd73 compounds
US11981921B2 (en) 2022-04-15 2024-05-14 Iovance Biotherapeutics, Inc. TIL expansion processes using specific cytokine combinations and/or AKTi treatment
WO2024112894A1 (en) 2022-11-22 2024-05-30 PIC Therapeutics, Inc. Eif4e inhibitors and uses thereof
US12006347B2 (en) 2010-12-22 2024-06-11 The Board Of Trustees Of The Leland Stanford Junior University Superagonists and antagonists of interleukin-2
WO2024137865A1 (en) 2022-12-22 2024-06-27 Gossamer Bio Services, Inc. Compounds useful as t cell activators
WO2024151885A1 (en) 2023-01-13 2024-07-18 Iovance Biotherapeutics, Inc. Use of til as maintenance therapy for nsclc patients who achieved pr/cr after prior therapy
WO2024151687A1 (en) 2023-01-09 2024-07-18 Flagship Pioneering Innovations V, Inc. Genetic switches and their use in treating cancer
US12049520B2 (en) 2017-08-04 2024-07-30 Bicycletx Limited Bicyclic peptide ligands specific for CD137
EP4110827A4 (en) * 2020-02-28 2024-08-14 Shanghai Henlius Biotech, Inc. ANTI-CD137 CONSTRUCTS, MULTISPECIFIC ANTIBODIES AND THEIR USES
US12071442B2 (en) 2021-03-29 2024-08-27 Nimbus Saturn, Inc. Substituted pyrrolo[3,4-c]pyridines as HPK1 antagonists
US12091411B2 (en) 2022-01-31 2024-09-17 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US12097261B2 (en) 2021-05-07 2024-09-24 Kymera Therapeutics, Inc. CDK2 degraders and uses thereof
WO2024233514A1 (en) 2023-05-08 2024-11-14 Bristol-Myers Squibb Company Substituted phenyl oxazolone compounds
WO2024233900A1 (en) 2023-05-10 2024-11-14 Blueprint Medicines Corporation Gsk3a inhibitors and methods of use thereof
WO2024233360A1 (en) 2023-05-05 2024-11-14 Arcus Biosciences, Inc. Cbl-b inhibitors and methods of use thereof
US12146000B2 (en) 2020-05-19 2024-11-19 Boehringer Ingelheim International Gmbh Bispecific and tetravalent CD137 and FAP molecules for the treatment of cancer
US12150995B2 (en) 2020-12-30 2024-11-26 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
WO2024243502A1 (en) 2023-05-25 2024-11-28 Arcus Biosciences, Inc. Cbl-b inhibitors and methods of use thereof
WO2024249540A1 (en) 2023-05-31 2024-12-05 Bristol-Myers Squibb Company Substituted oxazolone compound for decreasing levels of ikzf1-4 proteins
WO2024249954A1 (en) 2023-05-31 2024-12-05 Capstan Therapeutics, Inc. Lipid nanoparticle formulations and compositions
WO2024254227A1 (en) 2023-06-07 2024-12-12 Bristol-Myers Squibb Company Spirocyclic substituted oxoisoindolinyl piperidine-2,6-dione compound
US12171768B2 (en) 2021-02-15 2024-12-24 Kymera Therapeutics, Inc. IRAK4 degraders and uses thereof
WO2024263853A1 (en) 2023-06-23 2024-12-26 Bristol-Myers Squibb Company Substituted oxoisoindolinyl piperidine-2,6-dione compound as anticancer agent
US12187744B2 (en) 2021-10-29 2025-01-07 Kymera Therapeutics, Inc. IRAK4 degraders and synthesis thereof
US12202870B2 (en) 2015-03-31 2025-01-21 Hoffmann-La Roche Inc. Antigen binding molecules comprising a trimeric TNF family ligand and encoding polynucleotides thereof
WO2025030002A2 (en) 2023-08-02 2025-02-06 Arvinas Operations, Inc. Dgk targeting compounds and uses thereof
WO2025032521A1 (en) 2023-08-10 2025-02-13 Pfizer Inc. Methods, therapies and uses for treating cancer
WO2025049840A1 (en) 2023-09-02 2025-03-06 Bristol-Myers Squibb Company Substituted phenyl oxooxazolyl piperidine dione compounds
WO2025054339A1 (en) 2023-09-08 2025-03-13 Arcus Biosciences, Inc. Triazolopyridine compounds as inhibitors of kit
US12252488B2 (en) 2021-02-12 2025-03-18 Nimbus Saturn, Inc. HPK1 antagonists and uses thereof
WO2025059245A1 (en) 2023-09-13 2025-03-20 Bristol-Myers Squibb Company Substituted oxoisoindolinyl piperidine-2,6-dione compounds
WO2025064197A1 (en) 2023-09-02 2025-03-27 Bristol-Myers Squibb Company Substituted azetidinyl oxoisoindolinyl piperidine-2,6-dione compounds
WO2025072330A1 (en) 2023-09-26 2025-04-03 Arcus Biosciences, Inc. Kit inhibitor compounds and methods of use thereof
WO2025076127A1 (en) 2023-10-05 2025-04-10 Capstan Therapeutics, Inc. Constrained ionizable cationic lipids and lipid nanoparticles
WO2025076113A1 (en) 2023-10-05 2025-04-10 Capstan Therapeutics, Inc. Ionizable cationic lipids with conserved spacing and lipid nanoparticles
WO2025076299A1 (en) 2023-10-06 2025-04-10 Arcus Biosciences, Inc. Cbl-b inhibitors and methods of use thereof
WO2025096539A1 (en) 2023-10-31 2025-05-08 Bristol-Myers Squibb Company Ubiquitin specific processing protease 1 (usp1) compounds
WO2025096494A1 (en) 2023-10-31 2025-05-08 Bristol-Myers Squibb Company Ubiquitin specific processing protease 1 (usp1) compounds
WO2025096488A1 (en) 2023-10-31 2025-05-08 Bristol-Myers Squibb Company Ubiquitin specific processing protease 1 (usp1) compounds
WO2025096505A1 (en) 2023-10-31 2025-05-08 Bristol-Myers Squibb Company Ubiquitin specific processing protease 1 (usp1) compounds
WO2025096489A1 (en) 2023-10-31 2025-05-08 Bristol-Myers Squibb Company Ubiquitin specific processing protease 1 (usp1) compounds
WO2025096979A1 (en) 2023-11-02 2025-05-08 Arcus Biosciences, Inc. Thiazole compounds as kit inhibitors and methods of use thereof
WO2025096487A1 (en) 2023-10-31 2025-05-08 Bristol-Myers Squibb Company Ubiquitin specific processing protease 1 (usp1) compounds
WO2025101484A1 (en) 2023-11-06 2025-05-15 Iovance Biotherapeutics, Inc. Treatment of endometrial cancers with tumor infiltrating lymphocyte therapies
US12318454B2 (en) 2014-10-29 2025-06-03 Bicyclerd Limited Bicyclic peptide ligands specific for MT1-MMP
US12325697B2 (en) 2021-04-09 2025-06-10 Nimbus Clio, Inc. CBL-B modulators and uses thereof
WO2025137370A1 (en) 2023-12-20 2025-06-26 Arcus Biosciences, Inc. Salt forms of an axl inhibitor
US12350343B2 (en) 2018-12-13 2025-07-08 Bicycletx Limited Bicyclic peptide ligands specific for MT1-MMP
US12378288B2 (en) 2018-02-23 2025-08-05 Bicycletx Limited Multimeric bicyclic peptide ligands
US12377155B2 (en) 2018-12-13 2025-08-05 Bicyclerd Limited Bicyclic peptide ligands specific for PSMA
WO2025179294A2 (en) 2024-02-22 2025-08-28 Capstan Therapeutics, Inc. Immune engineering amplification
US12403185B2 (en) 2018-07-23 2025-09-02 Heidelberg Pharma Research Gmbh Use of anti-CD137 antibody drug conjugate (ADC) in allogeneic cell therapy
EP4620470A2 (en) 2023-06-23 2025-09-24 Kymera Therapeutics, Inc. Irak degraders and uses thereof
WO2025217454A2 (en) 2024-04-11 2025-10-16 Capstan Therapeutics, Inc. Ionizable cationic lipids and lipid nanoparticles
WO2025217452A1 (en) 2024-04-11 2025-10-16 Capstan Therapeutics, Inc. Constrained ionizable cationic lipids and lipid nanoparticles
US12454520B2 (en) 2018-07-06 2025-10-28 Kymera Therapeutics, Inc. Protein degraders and uses thereof
WO2025226767A1 (en) 2024-04-24 2025-10-30 Bristol-Myers Squibb Company Substituted 3-(5-(6-aminopyridin-2-yl)-4-fluoro-1-oxoisoindolin-2-yl)piperidine-2,6-dione compounds for use in the treatment of cancer
US12479921B2 (en) 2018-04-09 2025-11-25 Oricell Therapeutics Co., Ltd. Anti-PD-L1 antibody and use thereof
US12486330B2 (en) 2019-02-26 2025-12-02 Pieris Pharmaceuticals Gmbh Fusion proteins specific for CD137 and GPC3
US12492224B2 (en) 2018-12-21 2025-12-09 Bicycletx Limited Bicyclic peptide ligands specific for PD-L1
US12491253B2 (en) 2018-12-13 2025-12-09 Bicyclerd Limited Bicyclic peptide ligands specific for MT1-MMP
WO2026006759A1 (en) 2024-06-28 2026-01-02 Arcus Biosciences, Inc. Pharmaceutical compositions, dosage forms, and methods of making and using same
US12521438B2 (en) 2019-06-10 2026-01-13 Kymera Therapeutics, Inc. SMARCA degraders and uses thereof
US12540161B2 (en) 2020-08-03 2026-02-03 Bicycletx Limited Linkers
US12545659B2 (en) 2019-06-28 2026-02-10 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
WO2026035787A1 (en) 2024-08-07 2026-02-12 Bristol-Myers Squibb Company Ubiquitin specific processing protease 1 (usp1) macrocyles
US12552837B2 (en) 2017-06-26 2026-02-17 Bicyclerd Limited Bicyclic peptide ligands with detectable moieties and uses thereof
US12551567B2 (en) 2018-12-21 2026-02-17 Bicyclerd Limited Bicyclic peptide ligands specific for PD-L1
US12553031B2 (en) 2021-03-25 2026-02-17 Iovance Biotherapeutics, Inc. Methods and compositions for T-cell coculture potency assays and use with cell therapy products
US12551564B2 (en) 2019-12-10 2026-02-17 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US12558427B2 (en) 2019-07-17 2026-02-24 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US12570695B2 (en) 2019-07-30 2026-03-10 Bicycletx Limited Bicyclic peptide ligands specific for EphA2
US12570751B2 (en) 2017-08-04 2026-03-10 Genmab A/S Binding agents binding to PD-L1 and CD137 and use thereof
US12569485B2 (en) 2019-12-23 2026-03-10 Kymera Therapeutics, Inc. SMARCA inhibitors and uses thereof
US12606568B2 (en) 2020-12-09 2026-04-21 Kymera Therapeutics, Inc. SMARCA degraders and uses thereof

Families Citing this family (73)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013180200A1 (ja) 2012-05-30 2013-12-05 中外製薬株式会社 標的組織特異的抗原結合分子
EP2951199A4 (en) * 2013-01-31 2016-07-20 Univ Jefferson Fusion proteins for the modulation of regulatory and effector T cells
US9944992B2 (en) 2013-03-15 2018-04-17 The University Of Chicago Methods and compositions related to T-cell activity
CN105246914B (zh) 2013-04-02 2021-08-27 中外制药株式会社 Fc区变体
DK3078744T3 (da) 2013-12-04 2020-09-28 Chugai Pharmaceutical Co Ltd Antigen-bindende molekyler, antigen-bindingsaktiviteten af hvilke varierer i henhold til koncentrationen af forbindelser, og biblioteker af molekylerne
CN106413751A (zh) * 2014-05-21 2017-02-15 辉瑞大药厂 用于治疗癌症的抗ccr4抗体和4‑1bb激动剂的组合
IL308212A (en) 2015-01-20 2024-01-01 Igm Biosciences Inc Tumor necrosis factor-α receptor binding molecules and their uses
RU2714233C2 (ru) 2015-02-26 2020-02-13 Мерк Патент Гмбх Ингибиторы pd-1 / pd-l1 для лечения рака
CN114181309B (zh) * 2015-05-21 2024-07-30 鳄鱼生物科学公司 新型多肽
MY193229A (en) 2015-06-16 2022-09-26 Merck Patent GmbH Pd-l1 antagonist combination treatments
US10786547B2 (en) 2015-07-16 2020-09-29 Biokine Therapeutics Ltd. Compositions, articles of manufacture and methods for treating cancer
US20180230431A1 (en) 2015-08-07 2018-08-16 Glaxosmithkline Intellectual Property Development Limited Combination Therapy
JP6845846B6 (ja) * 2015-09-22 2021-04-21 ディンフー バイオターゲット カンパニー リミテッド 抗ヒトcd137の完全ヒト抗体及びその用途
PE20181326A1 (es) 2015-11-03 2018-08-20 Janssen Biotech Inc Anticuerpos que se unen especificamente a pd-1 y sus usos
CA2955184A1 (en) * 2016-01-25 2017-07-25 Pfizer Inc. Combination of an ox40 agonist and a 4-1bb agonist for treating cancer
BR112018074453A2 (pt) 2016-05-27 2019-03-19 Abbvie Biotherapeutics Inc. proteínas de ligação biespecíficas ligando uma protéina imunomoduladora e um antígeno tumoral
IL263744B2 (en) 2016-06-17 2023-11-01 Magenta Therapeutics Inc Compositions and methods for the depletion of cd117 plus cells
SG11201811184UA (en) 2016-06-20 2019-01-30 F Star Beta Ltd Lag -3 binding members
GB201612520D0 (en) 2016-07-19 2016-08-31 F-Star Beta Ltd Binding molecules
WO2018031258A1 (en) 2016-08-12 2018-02-15 Janssen Biotech, Inc. Engineered antibodies and other fc-domain containing molecules with enhanced agonism and effector functions
WO2018031400A1 (en) 2016-08-12 2018-02-15 Janssen Biotech, Inc. Fc engineered anti-tnfr superfamily member antibodies having enhanced agonistic activity and methods of using them
US11246905B2 (en) 2016-08-15 2022-02-15 President And Fellows Of Harvard College Treating infections using IdsD from Proteus mirabilis
CN106244611B (zh) * 2016-08-23 2019-05-17 浙江普康生物技术股份有限公司 一种细胞免疫佐剂tsa-41的制备方法及应用
ES2981272T3 (es) 2016-09-23 2024-10-08 Merus Nv Moléculas de unión que modulan una actividad biológica expresada por una célula
KR20190062515A (ko) 2016-10-06 2019-06-05 화이자 인코포레이티드 암의 치료를 위한 아벨루맙의 투약 용법
EP3571230A4 (en) 2017-01-20 2020-12-16 Magenta Therapeutics, Inc. COMPOSITIONS AND METHODS FOR DELETION OF CD137 + CELLS
KR20240017409A (ko) 2017-04-13 2024-02-07 아게누스 인코포레이티드 항-cd137 항체 및 이의 사용 방법
ES3000510T3 (en) 2017-06-09 2025-02-28 Providence Health & Services Oregon Tumor-infiltrating t-cells for use in the treatment of cancer
US11987635B2 (en) * 2017-06-25 2024-05-21 Baili-Bio (Chengdu) Pharmaceutical Co., Ltd. Anti-4-1BB antibodies and methods of making and using thereof
EP3655439A1 (en) 2017-07-20 2020-05-27 Aptevo Research and Development LLC Antigen binding proteins binding to 5t4 and 4-1bb and related compositions and methods
CA3071383C (en) * 2017-08-01 2022-04-12 Eli Lilly And Company Anti-cd137 antibodies
US11512134B2 (en) 2017-08-01 2022-11-29 Eli Lilly And Company Anti-CD137 antibodies
WO2019036855A1 (en) * 2017-08-21 2019-02-28 Adagene Inc. Anti-cd137 molecules and use thereof
CN109651507B (zh) * 2017-10-12 2021-11-26 瑞阳(苏州)生物科技有限公司 一种激动型4-1bb单克隆抗体
JP7404252B2 (ja) 2017-11-08 2023-12-25 ヤフェイ シャンハイ バイオロジー メディスン サイエンス アンド テクノロジー カンパニー リミテッド 生体分子のコンジュゲートおよびその使用
CN110003332B (zh) * 2018-01-05 2021-05-11 上海原能细胞医学技术有限公司 Cd137抗体及其应用
US12398209B2 (en) 2018-01-22 2025-08-26 Janssen Biotech, Inc. Methods of treating cancers with antagonistic anti-PD-1 antibodies
WO2019148445A1 (en) 2018-02-02 2019-08-08 Adagene Inc. Precision/context-dependent activatable antibodies, and methods of making and using the same
JP7059388B2 (ja) 2018-03-23 2022-04-25 イーライ リリー アンド カンパニー 抗pd-l1抗体との組み合わせのための抗cd137抗体
US20210054089A1 (en) * 2018-03-23 2021-02-25 Eli Lilly And Company Anti-cd137 antibodies for combination with anti-pd-1 antibodies
US12054554B2 (en) 2018-04-10 2024-08-06 Wuxi Biologics (Shanghai) Co., Ltd. Monoclonal antibody against human 4-1BB, method for preparing the same, and use thereof
GB201811404D0 (en) 2018-07-12 2018-08-29 F Star Beta Ltd Anti-CD137 Antibodies
GB201811403D0 (en) 2018-07-12 2018-08-29 F Star Beta Ltd Antibody molecules
GB201811408D0 (en) 2018-07-12 2018-08-29 F Star Beta Ltd CD137 Binding Molecules
PT3820569T (pt) 2018-07-12 2025-01-14 Invox Pharma Ltd Moléculas de anticorpo que se ligam a pd-l1 e cd137
GB201811450D0 (en) 2018-07-12 2018-08-29 F Star Delta Ltd Mesothelin and CD137 binding molecules
ES3044118T3 (en) 2018-07-12 2025-11-26 Invox Pharma Ltd Antibody molecules that bind cd137 and ox40
GB201811410D0 (en) 2018-07-12 2018-08-29 F Star Beta Ltd OX40 Binding molecules
GB201811415D0 (en) 2018-07-12 2018-08-29 F Star Beta Ltd Anti-Mesothelin Anti bodies
JP7090204B2 (ja) 2018-07-19 2022-06-23 イーライ リリー アンド カンパニー 免疫チェックポイントを標的とする二重特異性抗体
EP3827019A1 (en) 2018-07-24 2021-06-02 Inhibrx, Inc. Multispecific polypeptide constructs containing a constrained cd3 binding domain and a receptor binding region and methods of using the same
KR102259473B1 (ko) 2018-08-10 2021-06-02 추가이 세이야쿠 가부시키가이샤 항cd137 항원 결합 분자 및 그의 사용
JP7611820B2 (ja) 2018-10-11 2025-01-10 インヒブルクス バイオサイエンシズ インコーポレイテッド Dll3シングルドメイン抗体およびその治療用組成物
CN120623346A (zh) 2018-10-11 2025-09-12 因荷布瑞克斯生物科学公司 Pd-1单结构域抗体及其治疗组合物
JP2022504802A (ja) 2018-10-11 2022-01-13 インヒブルクス インコーポレイテッド 5t4シングルドメイン抗体およびその治療組成物
CN120098128A (zh) * 2019-01-02 2025-06-06 Qlsf生物治疗药物公司 Cd137激动剂抗体及其用途
BR112021013571A2 (pt) * 2019-01-16 2021-09-21 Compass Therapeutics Llc Formulações de anticorpos que se ligam a cd137 humano e usos das mesmas
CA3141452A1 (en) 2019-05-24 2020-12-03 Pfizer Inc. Combination therapies using cdk inhibitors
WO2020239558A1 (en) 2019-05-24 2020-12-03 Pfizer Inc. Combination therapies using cdk inhibitors
KR20220070254A (ko) 2019-09-25 2022-05-30 화이자 인코포레이티드 Sting (인터페론 유전자의 자극인자)의 폴리헤테로시클릭 조정제
KR20220087479A (ko) 2019-11-13 2022-06-24 허페이 한커맵 바이오테크놀로지 컴퍼니 리미티드 인간 4-1bb와 결합할 수 있는 분자 및 이의 응용
TWI895351B (zh) * 2020-02-12 2025-09-01 日商中外製藥股份有限公司 用於癌症之治療的抗cd137抗原結合分子
CA3168337A1 (en) 2020-02-17 2021-08-26 Marie-Andree Forget Methods for expansion of tumor infiltrating lymphocytes and use thereof
IL295434A (en) 2020-02-21 2022-10-01 Macrogenics Inc cd137 binding molecules and their uses
CN114195894B (zh) * 2020-09-17 2025-02-25 普米斯生物技术(珠海)有限公司 一种靶向4-1bb的抗体及其应用
CN114195900B (zh) 2020-09-17 2024-02-23 普米斯生物技术(珠海)有限公司 一种抗4-1bb/pd-l1双特异性抗体及其用途
CN114457026A (zh) * 2020-10-30 2022-05-10 未来智人再生医学研究院(广州)有限公司 一种表达4-1bb激活型抗体的多能干细胞及其衍生物与应用
WO2022130206A1 (en) 2020-12-16 2022-06-23 Pfizer Inc. TGFβr1 INHIBITOR COMBINATION THERAPIES
US11964978B2 (en) 2021-03-18 2024-04-23 Pfizer Inc. Modulators of STING (stimulator of interferon genes)
US20240277842A1 (en) 2021-06-07 2024-08-22 Providence Health & Services - Oregon Cxcr5, pd-1, and icos expressing tumor reactive cd4 t cells and their use
EP4416183A4 (en) * 2021-10-12 2025-10-29 Lepu Biopharma Co Ltd SINGLE-DOMAIN ANTI-4-1BB ANTIBODY
EP4644417A4 (en) 2022-12-30 2026-02-11 Abclon Inc AFFICORPS SPECIFICALLY BINDING TO CD137 AND ITS USE
CN121666401A (zh) 2023-07-10 2026-03-13 瑞泽恩制药公司 双特异性PD-L1x4-1BB抗体及其使用方法

Citations (39)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4634665A (en) 1980-02-25 1987-01-06 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
WO1987004462A1 (en) 1986-01-23 1987-07-30 Celltech Limited Recombinant dna sequences, vectors containing them and method for the use thereof
WO1989001036A1 (en) 1987-07-23 1989-02-09 Celltech Limited Recombinant dna expression vectors
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
EP0338841A1 (en) 1988-04-18 1989-10-25 Celltech Limited Recombinant DNA methods, vectors and host cells
EP0368684A1 (en) 1988-11-11 1990-05-16 Medical Research Council Cloning immunoglobulin variable domain sequences.
US5179017A (en) 1980-02-25 1993-01-12 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
EP0616640A1 (en) 1991-12-02 1994-09-28 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
US5994619A (en) 1996-04-01 1999-11-30 University Of Massachusetts, A Public Institution Of Higher Education Of The Commonwealth Of Massachusetts, As Represented By Its Amherst Campus Production of chimeric bovine or porcine animals using cultured inner cell mass cells
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
WO2001005950A2 (en) 1999-07-20 2001-01-25 Morphosys Ag Methods for displaying (poly)peptides/proteins on bacteriophage particles via disulfide bonds
US6291158B1 (en) 1989-05-16 2001-09-18 Scripps Research Institute Method for tapping the immunological repertoire
WO2002053596A2 (en) 2001-01-05 2002-07-11 Pfizer Inc. Antibodies to insulin-like growth factor i receptor
WO2002055106A2 (en) 2001-01-09 2002-07-18 Merck Patent Gmbh Combination therapy using receptor tyrosine kinase inhibitors and angiogenesis inhibitors
WO2003002609A2 (en) 2001-06-28 2003-01-09 Domantis Limited Dual-specific ligand and its use
WO2003015711A2 (en) 2001-08-17 2003-02-27 Coley Pharmaceutical Group, Inc. Combination motif immune stimulatory oligonucleotides with improved activity
WO2003040170A2 (en) 2001-11-09 2003-05-15 Pfizer Products Inc. Antibodies to cd40
WO2003048731A2 (en) 2001-12-03 2003-06-12 Abgenix, Inc. Antibody categorization based on binding characteristics
US6582915B1 (en) 1991-12-02 2003-06-24 Medical Research Council Production of anti-self bodies from antibody segment repertories and displayed on phage
WO2004003019A2 (en) 2002-06-28 2004-01-08 Domantis Limited Immunoglobin single variant antigen-binding domains and dual-specific constructs
US6696245B2 (en) 1997-10-20 2004-02-24 Domantis Limited Methods for selecting functional polypeptides
WO2004016805A2 (en) 2002-08-19 2004-02-26 Coley Pharmaceutical Group, Inc. Immunostimulatory nucleic acids
WO2004058821A2 (en) 2002-12-27 2004-07-15 Domantis Limited Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand
US6765087B1 (en) 1992-08-21 2004-07-20 Vrije Universiteit Brussel Immunoglobulins devoid of light chains
WO2004081026A2 (en) 2003-06-30 2004-09-23 Domantis Limited Polypeptides
WO2004101790A1 (en) 2003-05-14 2004-11-25 Domantis Limited A process for recovering polypeptides that unfold reversibly from a polypeptide repertoire
US6838254B1 (en) 1993-04-29 2005-01-04 Conopco, Inc. Production of antibodies or (functionalized) fragments thereof derived from heavy chain immunoglobulins of camelidae
WO2005035584A1 (en) * 2003-10-10 2005-04-21 Bristol-Myers Squibb Company Fully human antibodies against human 4-1bb (cd137)
US6933368B2 (en) 1992-03-09 2005-08-23 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation of immunoglobulin variable region
US20060153808A1 (en) 2004-11-17 2006-07-13 Board Of Regents, The Universtiy Of Texas System Cancer immunotherapy incorporating p53
WO2006079372A1 (en) 2005-01-31 2006-08-03 Ablynx N.V. Method for generating variable domain sequences of heavy chain antibodies
WO2006088639A1 (en) 2005-02-11 2006-08-24 Winchester Electronics Corporation Snap lock connector
WO2006129163A1 (en) 2005-06-03 2006-12-07 Pfizer Products Inc. Combinations of erbb2 inhibitors with other therapeutic agents in the treatment of cancer
US20070117809A1 (en) 2005-11-22 2007-05-24 Fridman Jordan S Combination therapy for the treatment of cancer
WO2007059782A1 (en) 2005-11-28 2007-05-31 Genmab A/S Recombinant monovalent antibodies and methods for production thereof
WO2009022215A1 (en) 2007-08-13 2009-02-19 Pfizer Inc. Combination motif immune stimulatory oligonucleotides with improved activity
WO2009079335A1 (en) 2007-12-14 2009-06-25 Medarex, Inc. Binding molecules to the human ox40 receptor

Family Cites Families (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
GB9207479D0 (en) 1992-04-06 1992-05-20 Scotgen Ltd Novel antibodies for treatment and prevention of respiratory syncytial virus infection in animals and man
AU5369996A (en) 1995-03-23 1996-10-08 Indiana University Foundation Monoclonal antibody against human receptor protein 4-1bb and methods of its use for treatment of diseases
RU2192281C2 (ru) 1996-10-11 2002-11-10 Бристол-Маерс Сквибб Компани Способы и композиции для иммуномодуляции
EP0953639A1 (en) 1998-04-30 1999-11-03 Boehringer Ingelheim International GmbH FAPalpha-specific antibody with improved producibility
US7504490B1 (en) * 1998-10-16 2009-03-17 Oscient Pharmaceuticals Corporation Nucleic acid and amino acid sequences relating to Apergillus fumigatus for diagnostics and therapeutics
US20030118588A1 (en) 1999-05-22 2003-06-26 Linda Diehl Induction of anti-tumor CTL immunity through in vivo triggering of 4-1BB and/or CD40
US7651686B2 (en) * 2001-10-09 2010-01-26 Mayo Foundation For Medical Education And Research Enhancement of immune responses by 4-1bb-binding agents
JP2006500921A (ja) * 2002-07-30 2006-01-12 ブリストル−マイヤーズ スクイブ カンパニー ヒト4−1bbに対するヒト化抗体
AU2003295600A1 (en) 2002-11-14 2004-06-15 Dharmacon, Inc. Functional and hyperfunctional sirna
EP1575672A2 (en) 2002-12-16 2005-09-21 Herbert Schwarz Use of cd137 antagonists for the treatment of tumors
AR046094A1 (es) * 2003-10-10 2005-11-23 Bristol Myers Squibb Co Anticuerpos completamente humanos contra 4-1bb humano
EP2399935A3 (en) 2005-02-15 2012-02-22 GTC Biotherapeutics, Inc. An anti-CD137 antibody as an agent in the treatment of cancer and glycosylation variants thereof
KR100694508B1 (ko) * 2005-05-24 2007-03-13 울산대학교 산학협력단 Hbbk4항체를 포함하는 암 질환 치료용 약학조성물및 이를 이용한 암의 면역치료 방법
NZ612578A (en) 2005-08-19 2014-11-28 Abbvie Inc Dual variable domain immunoglobin and uses thereof
KR100745488B1 (ko) 2006-07-04 2007-08-02 학교법인 울산공업학원 항-4-1bb 항체 및 화학 항암제를 포함하는 암 질환 예방및 치료용 약학 조성물
WO2008057458A2 (en) 2006-11-07 2008-05-15 Merck & Co., Inc. Antagonists of pcsk9
WO2009130296A2 (en) 2008-04-25 2009-10-29 Morphosys Ag Anti-alk1 antibodies and uses thereof
US8745699B2 (en) * 2010-05-14 2014-06-03 Authentify Inc. Flexible quasi out of band authentication architecture
SG181533A1 (en) 2009-12-07 2012-07-30 Univ Leland Stanford Junior Methods for enhancing anti-tumor antibody therapy
MX337040B (es) * 2010-09-09 2016-02-09 Pfizer Moleculas de union a 4-1bb.
DK2699598T3 (en) * 2011-04-19 2019-04-23 Pfizer COMBINATIONS OF ANTI-4-1BB ANTIBODIES AND ADCC-INducing ANTIBODIES FOR TREATMENT OF CANCER

Patent Citations (41)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4634665A (en) 1980-02-25 1987-01-06 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US5179017A (en) 1980-02-25 1993-01-12 The Trustees Of Columbia University In The City Of New York Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
WO1987004462A1 (en) 1986-01-23 1987-07-30 Celltech Limited Recombinant dna sequences, vectors containing them and method for the use thereof
WO1989001036A1 (en) 1987-07-23 1989-02-09 Celltech Limited Recombinant dna expression vectors
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
EP0338841A1 (en) 1988-04-18 1989-10-25 Celltech Limited Recombinant DNA methods, vectors and host cells
EP0368684A1 (en) 1988-11-11 1990-05-16 Medical Research Council Cloning immunoglobulin variable domain sequences.
US6291158B1 (en) 1989-05-16 2001-09-18 Scripps Research Institute Method for tapping the immunological repertoire
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
EP0616640A1 (en) 1991-12-02 1994-09-28 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US6582915B1 (en) 1991-12-02 2003-06-24 Medical Research Council Production of anti-self bodies from antibody segment repertories and displayed on phage
US6593081B1 (en) 1991-12-02 2003-07-15 Medical Research Council Production of anti-self antibodies from antibody segment repertoires and displayed on phage
US6933368B2 (en) 1992-03-09 2005-08-23 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation of immunoglobulin variable region
US6765087B1 (en) 1992-08-21 2004-07-20 Vrije Universiteit Brussel Immunoglobulins devoid of light chains
US6838254B1 (en) 1993-04-29 2005-01-04 Conopco, Inc. Production of antibodies or (functionalized) fragments thereof derived from heavy chain immunoglobulins of camelidae
US5994619A (en) 1996-04-01 1999-11-30 University Of Massachusetts, A Public Institution Of Higher Education Of The Commonwealth Of Massachusetts, As Represented By Its Amherst Campus Production of chimeric bovine or porcine animals using cultured inner cell mass cells
US6696245B2 (en) 1997-10-20 2004-02-24 Domantis Limited Methods for selecting functional polypeptides
WO2001005950A2 (en) 1999-07-20 2001-01-25 Morphosys Ag Methods for displaying (poly)peptides/proteins on bacteriophage particles via disulfide bonds
WO2002053596A2 (en) 2001-01-05 2002-07-11 Pfizer Inc. Antibodies to insulin-like growth factor i receptor
WO2002055106A2 (en) 2001-01-09 2002-07-18 Merck Patent Gmbh Combination therapy using receptor tyrosine kinase inhibitors and angiogenesis inhibitors
WO2003002609A2 (en) 2001-06-28 2003-01-09 Domantis Limited Dual-specific ligand and its use
WO2003015711A2 (en) 2001-08-17 2003-02-27 Coley Pharmaceutical Group, Inc. Combination motif immune stimulatory oligonucleotides with improved activity
WO2003040170A2 (en) 2001-11-09 2003-05-15 Pfizer Products Inc. Antibodies to cd40
WO2003048731A2 (en) 2001-12-03 2003-06-12 Abgenix, Inc. Antibody categorization based on binding characteristics
WO2004003019A2 (en) 2002-06-28 2004-01-08 Domantis Limited Immunoglobin single variant antigen-binding domains and dual-specific constructs
WO2004016805A2 (en) 2002-08-19 2004-02-26 Coley Pharmaceutical Group, Inc. Immunostimulatory nucleic acids
WO2004058821A2 (en) 2002-12-27 2004-07-15 Domantis Limited Dual specific single domain antibodies specific for a ligand and for the receptor of the ligand
WO2004101790A1 (en) 2003-05-14 2004-11-25 Domantis Limited A process for recovering polypeptides that unfold reversibly from a polypeptide repertoire
WO2004081026A2 (en) 2003-06-30 2004-09-23 Domantis Limited Polypeptides
WO2005035572A2 (en) 2003-10-08 2005-04-21 Domantis Limited Antibody compositions and methods
WO2005035584A1 (en) * 2003-10-10 2005-04-21 Bristol-Myers Squibb Company Fully human antibodies against human 4-1bb (cd137)
US20060153808A1 (en) 2004-11-17 2006-07-13 Board Of Regents, The Universtiy Of Texas System Cancer immunotherapy incorporating p53
WO2006079372A1 (en) 2005-01-31 2006-08-03 Ablynx N.V. Method for generating variable domain sequences of heavy chain antibodies
WO2006088639A1 (en) 2005-02-11 2006-08-24 Winchester Electronics Corporation Snap lock connector
WO2006129163A1 (en) 2005-06-03 2006-12-07 Pfizer Products Inc. Combinations of erbb2 inhibitors with other therapeutic agents in the treatment of cancer
US20070117809A1 (en) 2005-11-22 2007-05-24 Fridman Jordan S Combination therapy for the treatment of cancer
WO2007059782A1 (en) 2005-11-28 2007-05-31 Genmab A/S Recombinant monovalent antibodies and methods for production thereof
WO2009022215A1 (en) 2007-08-13 2009-02-19 Pfizer Inc. Combination motif immune stimulatory oligonucleotides with improved activity
WO2009079335A1 (en) 2007-12-14 2009-06-25 Medarex, Inc. Binding molecules to the human ox40 receptor

Non-Patent Citations (52)

* Cited by examiner, † Cited by third party
Title
"Fundamental Immunology", 1989, RAVEN PRESS, NEW YORK
"Immunology--A Synthesis", 1991, SINAUER ASSOCIATES
ABRAHAM ET AL., J. MOLEC. RECOG., vol. 9, no. 5-6, 1996, pages 456 - 461
ACHIM KNAPPIK ET AL.: "Fully Synthetic Human Combinatorial Antibody Libraries (HuCAL) Based on Modular Consensus Frameworks and CDRs Randomized with Trinucleotides", J. MOL. BIOL., vol. 296, 2000, pages 57 - 86, XP085067323, DOI: doi:10.1006/jmbi.1999.3444
ALLEN, NAT. REV. CANCER, vol. 2, 2002, pages 750 - 763
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410
ALTSCHUL ET AL., NUCELIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 2002, JOHN WILEY & SONS
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BROLL, AMER. J CLIN. PATHOL., vol. 115, no. 4, 2001, pages 543 - 549
CHEUK ATC ET AL., CANCER GENE THERAPY, vol. 11, 2004, pages 215 - 226
CHOTHIA, LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
CHRISTINE ROTHE, J. MOL. BIOL., vol. 376, 2008, pages 1182 - 1200
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628
COX, J. P. L. ET AL., EUR. J. IMMUNOL., vol. 24, 1994, pages 827 - 836
CROFT, NAT REV IMMUNOL, vol. 9, 2009, pages 271 - 285
DRENKARD, FASEB J., vol. 21, 2007, pages 456 - 463
G.E. MORRIS: "Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996
GOEDDEL: "Gene Expression Technology. Methods in Enzymology", vol. 185, 1990, ACADEMIC PRESS
GREEN ET AL., NATURE GENETICS, vol. 7, 1994, pages 13 - 21
HARLOW, LANE: "Antibodies: A Laboratory Manual", 1990, COLD SPRING HARBOR LABORATORY PRESS
HARLOW, LANE: "Antibodies: A Laboratory Manual", 1990, COLD SPRING HARBOR PRESS
HOLLIGER P. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
KABAT ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242
KABAT, E. A. ET AL.: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242
KABAT: "Sequences of Proteins of Immunological Interest", 1991, NIH PUBLICATION NO. 91-3242
KAUFMAN, SHARP, J. MOL. BIOL., vol. 159, 1982, pages 601 - 621
KING, CLIN. IMMUNOL., vol. 126, 2008, pages 303 - 314
KNAPPIK ET AL., J. MOL. BIOL., vol. 296, no. 1, 2000, pages 57 - 86
KOHLER, MILSTEIN, NATURE, vol. 256, 1975, pages 495
LYNCH, IMMUNOL REV., vol. 22, 2008, pages 277 - 286
MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597
MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554
OLOFSSON, CIRCULATION, vol. 117, 2008, pages 1292 - 1301
PASTAN, I., KREITMAN, CURR. OPIN. INVESTIG. DRUGS, vol. 3, 2002, pages 1089 - 1091
PAYNE, CANCER CELL, vol. 3, 2003, pages 207 - 212
PEARSON, METHODS ENZYMOL., vol. 183, 1990, pages 63 - 98
PEARSON, METHODS MOL. BIOL., vol. 132, 2000, pages 185 - 219
POLJAK R. J. ET AL., STRUCTURE, vol. 2, 1994, pages 1121 - 1123
SAITO ET AL., ADV. DRUG DELIV. REV., vol. 55, 2003, pages 199 - 215
SAMBROOK, RUSSELL: "Molecular Cloning, A Laboratory Approach", 2001, COLD SPRING HARBOR PRESS
SEAMAN, CANCER CELL, vol. 11, 2007, pages 539 - 554
SENTER, P.D., SPRINGER, C.J., ADV. DRUG DELIV. REV., vol. 53, 2001, pages 247 - 264
T. LOGAN ET AL.: "Phase I study of BMS-663513, a fully human anti-CD137 agonist monoclonal antibody, in patients (Pts) with advanced cancer (CA).", JOURNAL OF IMMUNOTHERAPY, vol. 31, no. 9, November 2008 (2008-11-01), pages 956, XP008144757 *
TAKEBE, Y. ET AL., MOL. CELL. BIOL., vol. 8, 1988, pages 466 - 472
TOMLINSON, I. M. ET AL., J. MOL. BIOL., vol. 227, 1992, pages 776 - 798
TRAIL ET AL., CANCER IMMUNOL. IMMUNOTHER., vol. 52, 2003, pages 328 - 337
URLAUB, CHASIN, PROC. NATL. ACAD. SCI. USA, vol. 77, 1980, pages 4216 - 4220
VINAY, J MOL MED, vol. 84, 2006, pages 726 - 736
WANG, IMMUNOLOGICAL REVIEWS, vol. 229, 2009, pages 192 - 215
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546

Cited By (516)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10640568B2 (en) 2010-09-09 2020-05-05 Pfizer Inc. 4-1BB binding molecules
US12006347B2 (en) 2010-12-22 2024-06-11 The Board Of Trustees Of The Leland Stanford Junior University Superagonists and antagonists of interleukin-2
WO2012145183A3 (en) * 2011-04-19 2013-03-14 Pfizer Inc. Combinations of anti-4-1bb antibodies and adcc-inducing antibodies for the treatment of cancer
US11680090B2 (en) 2013-09-24 2023-06-20 Medicenna Therapeutics, Inc. Interleukin-2 fusion proteins and uses thereof
WO2015069703A1 (en) * 2013-11-06 2015-05-14 Bristol-Myers Squibb Company Immunotherapeutic dosing regimens and combinations thereof
EP3466949A1 (en) 2013-12-24 2019-04-10 Bristol-Myers Squibb Company Tricyclic compound as anticancer agents
WO2015100282A1 (en) 2013-12-24 2015-07-02 Bristol-Myers Squibb Company Tricyclic compounds as anticancer agents
US10899840B2 (en) 2014-02-04 2021-01-26 Pfizer Inc. Combination of a PD-1 antagonist and a 4-1BB agonist for treating cancer
US10570371B2 (en) 2014-03-12 2020-02-25 Eutilex Co., Ltd. Methods for isolating and proliferating autologous cancer antigen-specific CD8+T cells
US10801011B2 (en) 2014-03-12 2020-10-13 National Cancer Center Methods for isolating and proliferating autologous cancer antigen-specific CD8+ T cells
US12202873B2 (en) 2014-04-24 2025-01-21 The Board Of Trustees Of The Leland Stanford Junior University Superagonists, partial agonists and antagonists of interleukin-2
US11384131B2 (en) 2014-04-24 2022-07-12 The Board Of Trustees Of The Leland Stanford Junior University Superagonists, partial agonists and antagonists of interleukin-2
WO2015187835A2 (en) 2014-06-06 2015-12-10 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
EP3610924A1 (en) 2014-06-06 2020-02-19 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
US10987322B2 (en) 2014-06-06 2021-04-27 Flexus Biosciences, Inc. Immunoregulatory agents
EP3998079A1 (en) 2014-06-06 2022-05-18 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
US10695426B2 (en) 2014-08-25 2020-06-30 Pfizer Inc. Combination of a PD-1 antagonist and an ALK inhibitor for treating cancer
US12318454B2 (en) 2014-10-29 2025-06-03 Bicyclerd Limited Bicyclic peptide ligands specific for MT1-MMP
US11242319B2 (en) 2014-11-05 2022-02-08 Flexus Biosciences, Inc. Immunoregulatory agents
US9598422B2 (en) 2014-11-05 2017-03-21 Flexus Biosciences, Inc. Immunoregulatory agents
EP3854394A1 (en) 2014-11-05 2021-07-28 Flexus Biosciences, Inc. Immunoregulatory agents
US9643972B2 (en) 2014-11-05 2017-05-09 Flexus Biosciences, Inc. Immunoregulatory agents
US10106546B2 (en) 2014-11-05 2018-10-23 Flexus Biosciences, Inc. Immunoregulatory agents
US10206893B2 (en) 2014-11-05 2019-02-19 Flexus Biosciences, Inc. Immunoregulatory agents
US11932601B2 (en) 2014-11-05 2024-03-19 Flexus Biosciences, Inc. Immunoregulatory agents
US10533014B2 (en) 2014-11-05 2020-01-14 Flexus Biosciences, Inc. Immunoregulatory agents
WO2016081748A2 (en) 2014-11-21 2016-05-26 Bristol-Myers Squibb Company Antibodies against cd73 and uses thereof
EP3725808A1 (en) 2014-11-21 2020-10-21 Bristol-Myers Squibb Company Antibodies against cd73 and uses thereof
WO2016106266A1 (en) 2014-12-22 2016-06-30 Bristol-Myers Squibb Company TGFβ RECEPTOR ANTAGONISTS
WO2016127052A1 (en) 2015-02-05 2016-08-11 Bristol-Myers Squibb Company Cxcl11 and smica as predictive biomarkers for efficacy of anti-ctla4 immunotherapy
US10233251B2 (en) 2015-02-22 2019-03-19 Sorrento Therapeutics, Inc. Antibody therapeutics that bind CD137
EP3258959A4 (en) * 2015-02-22 2018-10-17 Sorrento Therapeutics, Inc. Antibody therapeutics that bind cd137
US11180568B2 (en) 2015-02-22 2021-11-23 Sorrento Therapeutics, Inc. Antibody therapeutics that bind CD137
US10259881B2 (en) 2015-02-22 2019-04-16 Sorrento Therapeutics, Inc. Antibody therapeutics that bind CD137
WO2016140884A1 (en) 2015-03-02 2016-09-09 Rigel Pharmaceuticals, Inc. TGF-β INHIBITORS
US12202870B2 (en) 2015-03-31 2025-01-21 Hoffmann-La Roche Inc. Antigen binding molecules comprising a trimeric TNF family ligand and encoding polynucleotides thereof
US10399933B2 (en) 2015-04-03 2019-09-03 Bristol-Myers Squibb Company Inhibitors of indoleamine-2,3-dioxygenase for the treatment of cancer
WO2016161279A1 (en) 2015-04-03 2016-10-06 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase for the treatment of cancer
US9790169B2 (en) 2015-04-03 2017-10-17 Bristol-Myers Squibb Company IDO inhibitors
US10399932B2 (en) 2015-04-03 2019-09-03 Bristol-Myers Squibb Company Inhibitors of indoleamine-2,3-dioxygenase for the treatment of cancer
WO2016161269A1 (en) 2015-04-03 2016-10-06 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase for the treatment of cancer
US10167254B2 (en) 2015-04-03 2019-01-01 Bristol-Myers Squibb Company IDO inhibitors
WO2016162505A1 (en) 2015-04-08 2016-10-13 F-Star Biotechnology Limited Her2 binding agent therapies
EP3964527A2 (en) 2015-04-13 2022-03-09 Five Prime Therapeutics, Inc. Combination therapy for cancer
WO2016168149A1 (en) 2015-04-13 2016-10-20 Five Prime Therapeutics, Inc. Combination therapy for cancer
WO2016183114A1 (en) 2015-05-11 2016-11-17 Bristol-Myers Squibb Company Tricyclic compounds as anticancer agents
WO2016183118A1 (en) 2015-05-12 2016-11-17 Bristol-Myers Squibb Company Tricyclic compounds as anticancer agents
WO2016183115A1 (en) 2015-05-12 2016-11-17 Bristol-Myers Squibb Company 5h-pyrido[3,2-b]indole compounds as anticancer agents
EP4219535A1 (en) * 2015-05-18 2023-08-02 Pieris Pharmaceuticals GmbH Anti-cancer fusion polypeptide
WO2016184882A1 (en) * 2015-05-18 2016-11-24 Pieris Pharmaceuticals Gmbh Anti-cancer fusion polypeptide
US10913778B2 (en) 2015-05-18 2021-02-09 Pieris Pharmaceuticals Gmbh Anti-cancer fusion polypeptides, encoding nucleic acids and methods of using polypeptides
CN108112253A (zh) * 2015-05-18 2018-06-01 皮里斯制药有限公司 抗癌融合多肽
WO2016196228A1 (en) 2015-05-29 2016-12-08 Bristol-Myers Squibb Company Antibodies against ox40 and uses thereof
US11534440B2 (en) 2015-05-29 2022-12-27 Bergenbio Asa Combination therapy with Axl inhibitor and immune checkpoint modulator or oncolytic virus
WO2017019757A1 (en) 2015-07-28 2017-02-02 Bristol-Myers Squibb Company Tgf beta receptor antagonists
WO2017035118A1 (en) 2015-08-25 2017-03-02 Bristol-Myers Squibb Company Tgf beta receptor antagonists
WO2017069291A1 (en) 2015-10-23 2017-04-27 Canbas Co., Ltd. Peptides and peptidomimetics in combination with t cell activating and/or checkpoint inhibiting agents for cancer treatment
WO2017079117A1 (en) 2015-11-02 2017-05-11 Five Prime Therapeutics, Inc. Cd80 extracellular domain polypeptides and their use in cancer treatment
US11001638B2 (en) 2015-11-04 2021-05-11 Cancer Research Technology Limited Immunomodulatory antibodies
US11780929B2 (en) 2015-11-04 2023-10-10 Cancer Research Technology Limited Immunomodulatory antibodies
EP4541424A3 (en) * 2015-11-04 2025-07-02 Cancer Research Technology Limited Immunomodulatory antibodies
WO2017077085A3 (en) * 2015-11-04 2017-06-22 Cancer Research Technology Immunomodulatory antibodies
WO2017087678A2 (en) 2015-11-19 2017-05-26 Bristol-Myers Squibb Company Antibodies against glucocorticoid-induced tumor necrosis factor receptor (gitr) and uses thereof
WO2017091577A1 (en) 2015-11-23 2017-06-01 Five Prime Therapeutics, Inc. Fgfr2 inhibitors alone or in combination with immune stimulating agents in cancer treatment
WO2017091580A1 (en) 2015-11-23 2017-06-01 Five Prime Therapeutics, Inc. Predicting response to cancer treatment with fgfr2 inhibitors
WO2017106291A1 (en) 2015-12-15 2017-06-22 Bristol-Myers Squibb Company Cxcr4 receptor antagonists
US11566078B2 (en) 2016-01-11 2023-01-31 Inhibrx, Inc. PDL1-binding proteins
US12187804B2 (en) 2016-01-11 2025-01-07 Inhibrx Biosciences, Inc. Multivalent and multispecific 41BB-binding proteins
WO2017152085A1 (en) 2016-03-04 2017-09-08 Bristol-Myers Squibb Company Combination therapy with anti-cd73 antibodies
WO2017184619A2 (en) 2016-04-18 2017-10-26 Celldex Therapeutics, Inc. Agonistic antibodies that bind human cd40 and uses thereof
US10323004B2 (en) 2016-05-04 2019-06-18 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US10696648B2 (en) 2016-05-04 2020-06-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US11066383B2 (en) 2016-05-04 2021-07-20 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US10544099B2 (en) 2016-05-04 2020-01-28 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US10633342B2 (en) 2016-05-04 2020-04-28 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2017205745A1 (en) * 2016-05-27 2017-11-30 Abbvie Biotherapeutics Inc. Anti-4-1bb antibodies and their uses
US10875921B2 (en) 2016-05-27 2020-12-29 Abbvie Biotherapeutics Inc. Anti-4-1BB antibodies and their uses
WO2017220989A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
WO2017220988A1 (en) 2016-06-20 2017-12-28 Kymab Limited Multispecific antibodies for immuno-oncology
WO2017220990A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 antibodies
US10077306B2 (en) 2016-07-14 2018-09-18 Bristol-Myers Squibb Company Antibodies against TIM3 and uses thereof
EP4512829A2 (en) 2016-07-14 2025-02-26 Bristol-Myers Squibb Company Antibodies against tim3 and uses thereof
WO2018013818A2 (en) 2016-07-14 2018-01-18 Bristol-Myers Squibb Company Antibodies against tim3 and uses thereof
US12077596B2 (en) 2016-07-14 2024-09-03 Genmab A/S Multispecific antibodies against CD40 and CD137
US11591392B2 (en) 2016-07-14 2023-02-28 Bristol-Myers Squibb Company Antibodies against TIM3 and uses thereof
US12312403B2 (en) 2016-07-14 2025-05-27 Bristol-Myers Squibb Company Antibodies against TIM3 and uses thereof
US10533052B2 (en) 2016-07-14 2020-01-14 Bristol-Myers Squibb Company Antibodies against TIM3 and uses thereof
US11939388B2 (en) 2016-07-14 2024-03-26 Genmab A/S Multispecific antibodies against CD40 and CD137
WO2018017633A1 (en) 2016-07-21 2018-01-25 Bristol-Myers Squibb Company TGF Beta RECEPTOR ANTAGONISTS
EP3617232A1 (en) 2016-08-17 2020-03-04 Compugen Ltd. Anti-tigit antibodies, anti-pvrig antibodies and combinations thereof
WO2018033798A1 (en) 2016-08-17 2018-02-22 Compugen Ltd. Anti-tigit antibodies, anti-pvrig antibodies and combinations thereof
US11351164B2 (en) 2016-08-26 2022-06-07 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US11667890B2 (en) 2016-10-31 2023-06-06 Iovance Biotherapeutics, Inc. Engineered artificial antigen presenting cells for tumor infiltrating lymphocyte expansion
US10415015B2 (en) 2016-10-31 2019-09-17 Iovance Biotherapeutics, Inc. Engineered artificial antigen presenting cells for tumor infiltrating lymphocyte expansion
US10660909B2 (en) 2016-11-17 2020-05-26 Syntrix Biosystems Inc. Method for treating cancer using chemokine antagonists
EP3544628A4 (en) * 2016-11-23 2020-11-18 Immunoah Therapeutics, Inc. 4-1BB BINDING PROTEINS AND THEIR USES
US10899842B2 (en) 2016-11-23 2021-01-26 Immunoah Therapeutics, Inc. 4-1BB binding proteins and uses thereof
WO2018132279A1 (en) 2017-01-05 2018-07-19 Bristol-Myers Squibb Company Tgf beta receptor antagonists
WO2018129332A1 (en) 2017-01-06 2018-07-12 Iovance Biotherapeutics, Inc. Expansion of tumor infiltrating lymphocytes (tils) with tumor necrosis factor receptor superfamily (tnfrsf) agonists and therapeutic combinations of tils and tnfrsf agonists
CN112210010A (zh) * 2017-01-06 2021-01-12 优特力克斯有限公司 抗-人4-1bb抗体及其应用
EP3523332A4 (en) * 2017-01-06 2019-10-09 Eutilex Co., Ltd. ANTI-HUMAN 4-1 BB ANTIBODY AND ITS USE
EP4032911A1 (en) * 2017-01-06 2022-07-27 Eutilex Co., Ltd. Anti-human 4-1bb antibodies and use thereof
CN112210010B (zh) * 2017-01-06 2023-12-05 优特力克斯有限公司 抗-人4-1bb抗体及其应用
US11859004B2 (en) 2017-01-06 2024-01-02 Eutilex Co., Ltd. Anti-human 4-1BB antibodies and uses thereof
US10774151B2 (en) 2017-01-06 2020-09-15 Eutilex Co., Ltd. Anti-human 4-1BB antibodies and uses thereof
US10919972B2 (en) 2017-01-06 2021-02-16 Eutilex Co., Ltd. Anti-human 4-1BB antibodies and uses thereof
WO2018186924A1 (en) 2017-01-17 2018-10-11 The University Of Chicago Dysfunctional antigen-specific cd8+ t cells in the tumor microenvironment
EP3570887A4 (en) * 2017-01-17 2020-11-25 The University of Chicago DYSFUNCTIONAL ANTIGEN-SPECIFIC CD8 + T CELLS IN THE TUMOR MICROENVIRONMENT
EP4310082A2 (en) 2017-01-20 2024-01-24 Arcus Biosciences, Inc. Azolopyrimidine for the treatment of cancer-related disorders
WO2018136700A1 (en) 2017-01-20 2018-07-26 Arcus Biosciences, Inc. Azolopyrimidine for the treatment of cancer-related disorders
WO2018146317A1 (en) 2017-02-10 2018-08-16 Genmab B.V. Polypeptide variants and uses thereof
US11942149B2 (en) 2017-02-24 2024-03-26 Macrogenics, Inc. Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof
US11459394B2 (en) 2017-02-24 2022-10-04 Macrogenics, Inc. Bispecific binding molecules that are capable of binding CD137 and tumor antigens, and uses thereof
WO2018183608A1 (en) 2017-03-31 2018-10-04 Five Prime Therapeutics, Inc. Combination therapy for cancer using anti-gitr antibodies
US11358969B2 (en) 2017-04-21 2022-06-14 Ikena Oncology, Inc. Indole AHR inhibitors and uses thereof
US10570138B2 (en) 2017-04-21 2020-02-25 Kyn Therapeutics Indole AHR inhibitors and uses thereof
US12077542B2 (en) 2017-04-21 2024-09-03 Ikena Oncology, Inc. Indole AHR inhibitors and uses thereof
US10689388B1 (en) 2017-04-21 2020-06-23 Ikena Oncology, Inc. Indole AHR inhibitors and uses thereof
EP4710923A2 (en) 2017-04-21 2026-03-18 Ikena Oncology, Inc. Indole ahr inhibitors and uses thereof
WO2018195397A2 (en) 2017-04-21 2018-10-25 Kyn Therapeutics Indole ahr inhibitors and uses thereof
WO2018201014A1 (en) 2017-04-28 2018-11-01 Five Prime Therapeutics, Inc. Methods of treatment with cd80 extracellular domain polypeptides
WO2018209049A1 (en) 2017-05-12 2018-11-15 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US11066392B2 (en) 2017-05-12 2021-07-20 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2018213377A1 (en) 2017-05-17 2018-11-22 Arcus Biosciences, Inc. Quinazoline-pyrazole derivatives for the treatment of cancer-related disorders
WO2018220446A1 (en) 2017-06-01 2018-12-06 Compugen Ltd. Triple combination antibody therapies
WO2020117233A1 (en) 2017-06-05 2020-06-11 Iovance Biotherapeutics, Inc. Methods of using tumor infiltrating lymphocytes in double-refractory melanoma
WO2018226714A1 (en) 2017-06-05 2018-12-13 Iovance Biotherapeutics, Inc. Methods of using tumor infiltrating lymphocytes in double-refractory melanoma
US11433097B2 (en) 2017-06-05 2022-09-06 Iovance Biotherapeutics, Inc. Methods of using tumor infiltrating lymphocytes in double-refractory melanoma
US11819517B2 (en) 2017-06-05 2023-11-21 Iovance Biotherapeutics, Inc. Methods of using tumor infiltrating lymphocytes in double-refractory melanoma
US11542312B2 (en) 2017-06-19 2023-01-03 Medicenna Therapeutics, Inc. IL-2 superagonists in combination with anti-PD-1 antibodies
US12338269B2 (en) 2017-06-19 2025-06-24 Medicenna Therapeutics Inc. IL-2 superagonists in combination with anti-PD-1 antibodies
US12552837B2 (en) 2017-06-26 2026-02-17 Bicyclerd Limited Bicyclic peptide ligands with detectable moieties and uses thereof
WO2019006283A1 (en) 2017-06-30 2019-01-03 Bristol-Myers Squibb Company AMORPHOUS AND CRYSTALLINE FORMS OF IDO INHIBITORS
US12421195B2 (en) 2017-06-30 2025-09-23 Bristol-Myers Squibb Company Amorphous and crystalline forms of IDO inhibitors
US11236049B2 (en) 2017-06-30 2022-02-01 Bristol-Myers Squibb Company Amorphous and crystalline forms of IDO inhibitors
US10716851B2 (en) 2017-07-11 2020-07-21 Compass Therapeutics Llc Agonist antibodies that bind human CD137 and uses thereof
US10279038B2 (en) 2017-07-11 2019-05-07 Compass Therapeutics Llc Agonist antibodies that bind human CD137 and uses thereof
IL271696B2 (en) * 2017-07-11 2026-02-01 Compass Therapeutics Llc Agonist antibodies that bind human CD137 and their use
US10434175B2 (en) 2017-07-11 2019-10-08 Compass Therapeutics Llc Agonist antibodies that bind human CD137 and uses thereof
AU2018301393B2 (en) * 2017-07-11 2025-02-27 Compass Therapeutics Llc Agonist antibodies that bind human CD137 and uses thereof
US11752207B2 (en) 2017-07-11 2023-09-12 Compass Therapeutics Llc Agonist antibodies that bind human CD137 and uses thereof
WO2019014328A3 (en) * 2017-07-11 2019-02-21 Compass Therapeutics Llc Agonist antibodies that bind human cd137 and uses thereof
US10350292B1 (en) 2017-07-11 2019-07-16 Compass Therapeutics Llc Agonist antibodies that bind human CD137 and uses thereof
US20200046833A1 (en) * 2017-07-11 2020-02-13 Compass Therapeutics Llc Agonist antibodies that bind human cd137 and uses thereof
IL271696B1 (en) * 2017-07-11 2025-10-01 Compass Therapeutics Llc Agonist antibodies that bind human CD137 and their use
CN111278858A (zh) * 2017-07-11 2020-06-12 指南针制药有限责任公司 结合人cd137的激动剂抗体及其用途
US10279040B1 (en) 2017-07-11 2019-05-07 Compass Therapeutics Llc Agonist antibodies that bind human CD137 and uses thereof
US10279039B2 (en) 2017-07-11 2019-05-07 Compass Therapeutics Llc Agonist antibodies that bind human CD137 and uses thereof
WO2019023459A1 (en) 2017-07-28 2019-01-31 Bristol-Myers Squibb Company CYCLIC DINUCLEOTIDES AS ANTICANCER AGENTS
US12570751B2 (en) 2017-08-04 2026-03-10 Genmab A/S Binding agents binding to PD-L1 and CD137 and use thereof
US12049520B2 (en) 2017-08-04 2024-07-30 Bicycletx Limited Bicyclic peptide ligands specific for CD137
US11555026B2 (en) 2017-08-17 2023-01-17 Ikena Oncology, Inc. AHR inhibitors and uses thereof
US10696650B2 (en) 2017-08-17 2020-06-30 Ikena Oncology, Inc. AHR inhibitors and uses thereof
WO2019046498A1 (en) 2017-08-31 2019-03-07 Bristol-Myers Squibb Company CYCLIC DINUCLEOTIDES AS ANTICANCER AGENTS
WO2019046500A1 (en) 2017-08-31 2019-03-07 Bristol-Myers Squibb Company CYCLIC DINUCLEOTIDES AS ANTICANCER AGENTS
WO2019046496A1 (en) 2017-08-31 2019-03-07 Bristol-Myers Squibb Company CYCLIC DINUCLEOTIDES AS ANTICANCER AGENTS
US12540127B2 (en) 2017-09-22 2026-02-03 Kymera Therapeutics, Inc. CRBN ligands and uses thereof
US11623932B2 (en) 2017-09-22 2023-04-11 Kymera Therapeutics, Inc. Protein degraders and uses thereof
US11358948B2 (en) 2017-09-22 2022-06-14 Kymera Therapeutics, Inc. CRBN ligands and uses thereof
WO2019074824A1 (en) 2017-10-09 2019-04-18 Bristol-Myers Squibb Company INDOLEAMINE 2,3-DIOXYGENASE INHIBITORS AND METHODS OF USE
US11649212B2 (en) 2017-10-09 2023-05-16 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US11203592B2 (en) 2017-10-09 2021-12-21 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2019074822A1 (en) 2017-10-09 2019-04-18 Bristol-Myers Squibb Company INDOLEAMINE 2,3-DIOXYGENASE INHIBITORS AND METHODS OF USE
EP3470426A1 (en) 2017-10-10 2019-04-17 Numab Therapeutics AG Multispecific antibody
US11230601B2 (en) 2017-10-10 2022-01-25 Tilos Therapeutics, Inc. Methods of using anti-lap antibodies
EP3470428A1 (en) 2017-10-10 2019-04-17 Numab Innovation AG Antibodies targeting cd137 and methods of use thereof
JP7438939B2 (ja) 2017-10-10 2024-02-27 ヌマブ セラピューティクス アクチェンゲゼルシャフト Cd137を標的とする抗体とその利用方法
US11578133B2 (en) 2017-10-10 2023-02-14 Namab Therapeutics AG Antibodies targeting CD137 and methods of use thereof
WO2019074887A1 (en) 2017-10-10 2019-04-18 Bristol-Myers Squibb Company CYCLIC DINUCLEOTIDES AS ANTICANCER AGENTS
AU2018348431B2 (en) * 2017-10-10 2025-10-02 Numab Therapeutics AG Antibodies targeting CD137 and methods of use thereof
WO2019072870A1 (en) 2017-10-10 2019-04-18 Numab Innovation Ag ANTIBODIES TARGETING CD137 AND METHODS OF USE
WO2019075090A1 (en) 2017-10-10 2019-04-18 Tilos Therapeutics, Inc. ANTI-LAP ANTIBODIES AND USES THEREOF
KR102907326B1 (ko) 2017-10-10 2025-12-31 누맙 세러퓨틱스 아게 Cd137을 표적화하는 항체 및 이의 사용 방법
JP2020537520A (ja) * 2017-10-10 2020-12-24 ヌマブ セラピューティクス アクチェンゲゼルシャフト Cd137を標的とする抗体とその利用方法
WO2019072868A1 (en) 2017-10-10 2019-04-18 Numab Therapeutics AG MULTISPECIFIC ANTIBODIES
CN111183159A (zh) * 2017-10-10 2020-05-19 努玛治疗有限公司 靶向cd137的抗体及其使用方法
KR20200063153A (ko) * 2017-10-10 2020-06-04 누맙 세러퓨틱스 아게 Cd137을 표적화하는 항체 및 이의 사용 방법
WO2019079261A1 (en) 2017-10-16 2019-04-25 Bristol-Myers Squibb Company CYCLIC DINUCLEOTIDES AS ANTICANCER AGENTS
US11718679B2 (en) 2017-10-31 2023-08-08 Compass Therapeutics Llc CD137 antibodies and PD-1 antagonists and uses thereof
WO2019089753A3 (en) * 2017-10-31 2019-07-18 Compass Therapeutics Llc Cd137 antibodies and pd-1 antagonists and uses thereof
US12286483B2 (en) 2017-10-31 2025-04-29 Compass Therapeutics Llc Method of treating cancer using CD137 antibodies and PD-1 antagonists
WO2019089921A1 (en) 2017-11-01 2019-05-09 Bristol-Myers Squibb Company Immunostimulatory agonistic antibodies for use in treating cancer
WO2019090198A1 (en) 2017-11-06 2019-05-09 Bristol-Myers Squibb Company Isofuranone compounds useful as hpk1 inhibitors
EP3708582A4 (en) * 2017-11-09 2021-12-01 Shanghai Hyamab Biotech Co., Ltd. 4-1BB ANTIBODIES AND THE MANUFACTURING METHOD AND USES THEREOF
US11555077B2 (en) 2017-11-09 2023-01-17 Shanghai Hyamab Biotech Co., Ltd. 4-1BB antibody and preparation method and use thereof
WO2019100023A1 (en) 2017-11-17 2019-05-23 Iovance Biotherapeutics, Inc. Til expansion from fine needle aspirates and small biopsies
EP4501408A2 (en) 2017-11-17 2025-02-05 Iovance Biotherapeutics, Inc. Til expansion from fine needle aspirates and small biopsies
US11851497B2 (en) 2017-11-20 2023-12-26 Compass Therapeutics Llc CD137 antibodies and tumor antigen-targeting antibodies and uses thereof
US11505615B2 (en) 2017-12-05 2022-11-22 Lyvgen Biopharma Holdings Limited Anti-CD137 antibodies and uses thereof
US10874743B2 (en) 2017-12-26 2020-12-29 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11723980B2 (en) 2017-12-26 2023-08-15 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US12168057B2 (en) 2017-12-26 2024-12-17 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11318205B1 (en) 2017-12-26 2022-05-03 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11447449B2 (en) 2018-01-05 2022-09-20 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2019136112A1 (en) 2018-01-05 2019-07-11 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2019136456A1 (en) 2018-01-08 2019-07-11 Iovance Biotherapeutics, Inc. Processes for generating til products enriched for tumor antigen-specific t-cells
US12104172B2 (en) 2018-01-08 2024-10-01 Iovance Biotherapeutics, Inc. Processes for generating TIL products enriched for tumor antigen-specific t-cells
WO2019136459A1 (en) 2018-01-08 2019-07-11 Iovance Biotherapeutics, Inc. Processes for generating til products enriched for tumor antigen-specific t-cells
US11713446B2 (en) 2018-01-08 2023-08-01 Iovance Biotherapeutics, Inc. Processes for generating TIL products enriched for tumor antigen-specific T-cells
US12516068B2 (en) 2018-01-12 2026-01-06 Kymera Therapeutics, Inc. Protein degraders and uses thereof
US12129297B2 (en) 2018-01-12 2024-10-29 Bristol-Myers Squibb Company Antibodies against TIM3 and uses thereof
US11932635B2 (en) 2018-01-12 2024-03-19 Kymera Therapeutics, Inc. CRBN ligands and uses thereof
US11512080B2 (en) 2018-01-12 2022-11-29 Kymera Therapeutics, Inc. CRBN ligands and uses thereof
US11485743B2 (en) 2018-01-12 2022-11-01 Kymera Therapeutics, Inc. Protein degraders and uses thereof
WO2019140229A1 (en) 2018-01-12 2019-07-18 Bristol-Myers Squibb Company Antibodies against tim3 and uses thereof
US12006329B2 (en) 2018-01-12 2024-06-11 Kymera Therapeutics, Inc. Protein degraders and uses thereof
US20210023134A1 (en) * 2018-01-15 2021-01-28 Pfizer Inc. Methods of administering chimeric antigen receptor immunotherapy in combination with 4-1bb agonist
WO2019141268A1 (zh) 2018-01-22 2019-07-25 江苏恒瑞医药股份有限公司 抗4-1bb抗体、其抗原结合片段及其医药用途
WO2019148132A1 (en) 2018-01-29 2019-08-01 Merck Patent Gmbh Gcn2 inhibitors and uses thereof
US10793563B2 (en) 2018-01-29 2020-10-06 Merck Patent Gmbh GCN2 inhibitors and uses thereof
EP4616913A2 (en) 2018-01-29 2025-09-17 Merck Patent GmbH Gcn2 inhibitors and uses thereof
US10988477B2 (en) 2018-01-29 2021-04-27 Merck Patent Gmbh GCN2 inhibitors and uses thereof
US12084438B2 (en) 2018-01-29 2024-09-10 Merck Patent Gmbh GCN2 inhibitors and uses thereof
WO2019160829A1 (en) 2018-02-13 2019-08-22 Iovance Biotherapeutics, Inc. Expansion of tumor infiltrating lymphocytes (tils) with adenosine a2a receptor antagonists and therapeutic combinations of tils and adenosine a2a receptor antagonists
WO2019160884A1 (en) 2018-02-13 2019-08-22 Bristol-Myers Squibb Company Cyclic dinucleotides as anticancer agents
EP3755333A1 (en) 2018-02-16 2020-12-30 Arcus Biosciences, Inc. Dosing with an azolopyrimidine compound
US12378288B2 (en) 2018-02-23 2025-08-05 Bicycletx Limited Multimeric bicyclic peptide ligands
WO2019165315A1 (en) 2018-02-23 2019-08-29 Syntrix Biosystems Inc. Method for treating cancer using chemokine antagonists alone or in combination
WO2019173188A1 (en) 2018-03-05 2019-09-12 Arcus Biosciences, Inc. Arginase inhibitors
WO2019173587A1 (en) 2018-03-08 2019-09-12 Bristol-Myers Squibb Company Cyclic dinucleotides as anticancer agents
WO2019173798A1 (en) 2018-03-08 2019-09-12 Rubius Therapeutics, Inc. Therapeutic cell systems and methods for treating cancer and infectious diseases
US11141433B2 (en) 2018-03-08 2021-10-12 Rubius Therapeutics, Inc. Therapeutic cell systems and methods for treating cancer and infectious diseases
WO2019183040A1 (en) 2018-03-21 2019-09-26 Five Prime Therapeutics, Inc. ANTIBODIES BINDING TO VISTA AT ACIDIC pH
EP4386080A2 (en) 2018-03-29 2024-06-19 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes and uses of same in immunotherapy
WO2019190579A1 (en) 2018-03-29 2019-10-03 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes and uses of same in immunotherapy
US12479921B2 (en) 2018-04-09 2025-11-25 Oricell Therapeutics Co., Ltd. Anti-PD-L1 antibody and use thereof
WO2019200256A1 (en) 2018-04-12 2019-10-17 Bristol-Myers Squibb Company Anticancer combination therapy with cd73 antagonist antibody and pd-1/pd-l1 axis antagonist antibody
WO2019197600A1 (en) 2018-04-13 2019-10-17 F. Hoffmann-La Roche Ag Her2-targeting antigen binding molecules comprising 4-1bbl
US12065478B2 (en) 2018-04-13 2024-08-20 Hoffmann-La Roche Inc. HER2-targeting antigen binding molecules comprising 4-1BBL
WO2019204257A1 (en) 2018-04-16 2019-10-24 Arrys Therapeutics, Inc. Ep4 inhibitors and use thereof
US11866688B2 (en) 2018-04-27 2024-01-09 Iovance Biotherapeutics, Inc. Closed process for expansion and gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy
WO2019210131A1 (en) 2018-04-27 2019-10-31 Iovance Biotherapeutics, Inc. Closed process for expansion and gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy
US11384337B2 (en) 2018-04-27 2022-07-12 Iovance Biotherapeutics, Inc. Closed process for expansion and gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy
US12024718B2 (en) 2018-04-27 2024-07-02 Iovance Biotherapeutics, Inc. Closed process for expansion and gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy
US12031157B2 (en) 2018-04-27 2024-07-09 Iovance Biotherapeutics, Inc. Closed process for expansion and gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy
US12495791B2 (en) 2018-04-27 2025-12-16 Ióvance Biotherapeutics, Inc. Closed process for expansion and gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy
WO2019213340A1 (en) 2018-05-03 2019-11-07 Bristol-Myers Squibb Company Uracil derivatives as mer-axl inhibitors
WO2019217753A1 (en) 2018-05-10 2019-11-14 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes and uses of same in immunotherapy
WO2019241730A2 (en) 2018-06-15 2019-12-19 Flagship Pioneering Innovations V, Inc. Increasing immune activity through modulation of postcellular signaling factors
EP4461739A2 (en) 2018-06-22 2024-11-13 BicycleTx Limited Bicyclic peptide ligands specific for nectin-4
WO2019243832A1 (en) 2018-06-22 2019-12-26 Bicycletx Limited Bicyclic peptide ligands specific for nectin-4
EP4588934A2 (en) 2018-06-22 2025-07-23 BicycleTX Limited Bicyclic peptide ligands specific for nectin-4
WO2019243833A1 (en) 2018-06-22 2019-12-26 Bicycletx Limited Bicyclic peptide ligands specific for nectin-4
US12459974B2 (en) 2018-06-22 2025-11-04 Bicycletx Limited Bicyclic peptide ligands specific for Nectin-4
EP4464715A2 (en) 2018-06-22 2024-11-20 BicycleTx Limited Bicyclic peptide ligands specific for nectin-4
WO2020006016A1 (en) 2018-06-27 2020-01-02 Bristol-Myers Squibb Company Naphthyridinone compounds useful as t cell activators
WO2020006018A1 (en) 2018-06-27 2020-01-02 Bristol-Myers Squibb Company Substituted naphthyridinone compounds useful as t cell activators
WO2020010177A1 (en) 2018-07-06 2020-01-09 Kymera Therapeutics, Inc. Tricyclic crbn ligands and uses thereof
US11292792B2 (en) 2018-07-06 2022-04-05 Kymera Therapeutics, Inc. Tricyclic CRBN ligands and uses thereof
US11897882B2 (en) 2018-07-06 2024-02-13 Kymera Therapeutics, Inc. Tricyclic crbn ligands and uses thereof
US12454520B2 (en) 2018-07-06 2025-10-28 Kymera Therapeutics, Inc. Protein degraders and uses thereof
US11401328B2 (en) 2018-07-09 2022-08-02 Five Prime Therapeutics, Inc. Antibodies binding to ILT4
WO2020014132A2 (en) 2018-07-09 2020-01-16 Five Prime Therapeutics, Inc. Antibodies binding to ilt4
US12435136B2 (en) 2018-07-09 2025-10-07 Five Prime Therapeutics, Inc. Antibodies binding to ILT4
WO2020014327A2 (en) 2018-07-11 2020-01-16 Five Prime Therapeutics, Inc. Antibodies binding to vista at acidic ph
WO2020018680A1 (en) 2018-07-18 2020-01-23 Arcus Biosciences, Inc. Solid forms of an azolopyrimidine compound
US12059420B2 (en) 2018-07-23 2024-08-13 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2020023356A1 (en) 2018-07-23 2020-01-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US12403185B2 (en) 2018-07-23 2025-09-02 Heidelberg Pharma Research Gmbh Use of anti-CD137 antibody drug conjugate (ADC) in allogeneic cell therapy
WO2020023355A1 (en) 2018-07-23 2020-01-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US12145927B2 (en) 2018-07-23 2024-11-19 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2020023846A1 (en) 2018-07-27 2020-01-30 Arcus Biosciences, Inc. Pyridone a2r antagonists
US11253525B2 (en) 2018-08-29 2022-02-22 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
US10959986B2 (en) 2018-08-29 2021-03-30 Bristol-Myers Squibb Company Inhibitors of indoleamine 2,3-dioxygenase and methods of their use
WO2020096682A2 (en) 2018-08-31 2020-05-14 Iovance Biotherapeutics, Inc. Treatment of nsclc patients refractory for anti-pd-1 antibody
EP4378530A2 (en) 2018-08-31 2024-06-05 Iovance Biotherapeutics, Inc. Use of tumor infiltrating lymphocytes for treating nsclc patients refractory for anti-pd-1 antibody
WO2020051424A1 (en) 2018-09-07 2020-03-12 Pic Therapeutics Eif4e inhibitors and uses thereof
WO2020061429A1 (en) 2018-09-20 2020-03-26 Iovance Biotherapeutics, Inc. Expansion of tils from cryopreserved tumor samples
EP3636320A1 (en) 2018-10-09 2020-04-15 Numab Therapeutics AG Antibodies targeting cd137 and methods of use thereof
WO2020074584A1 (en) 2018-10-09 2020-04-16 Numab Therapeutics AG Antibodies targeting cd137 and methods of use thereof
WO2020076969A2 (en) 2018-10-10 2020-04-16 Tilos Therapeutics, Inc. Anti-lap antibody variants and uses thereof
US11130802B2 (en) 2018-10-10 2021-09-28 Tilos Therapeutics, Inc. Anti-lap antibody variants
US12453697B2 (en) 2018-11-05 2025-10-28 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes and uses of the same in immunotherapy
US12611427B2 (en) 2018-11-05 2026-04-28 Iovance Biotherapeutics, Inc. Treatment of NSCLC patients refractory for anti-PD-1 antibody
US12280140B2 (en) 2018-11-05 2025-04-22 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes and uses of the same in immunotherapy
WO2020096989A1 (en) 2018-11-05 2020-05-14 Iovance Biotherapeutics, Inc. Treatment of nsclc patients refractory for anti-pd-1 antibody
WO2020096927A1 (en) 2018-11-05 2020-05-14 Iovance Biotherapeutics, Inc. Expansion of tils utilizing akt pathway inhibitors
WO2020096988A2 (en) 2018-11-05 2020-05-14 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes and uses of the same in immunotherapy
US12226522B2 (en) 2018-11-05 2025-02-18 lovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes and uses of the same in immunotherapy
WO2020096986A2 (en) 2018-11-05 2020-05-14 Iovance Biotherapeutics, Inc. Selection of improved tumor reactive t-cells
WO2020102646A2 (en) 2018-11-16 2020-05-22 Arcus Biosciences, Inc. Inhibitors of arg1 and/or arg2
EP3887403A4 (en) * 2018-11-30 2022-08-31 ABL Bio Inc. ANTI-4-1BB ANTIBODIES AND USE THEREOF
US11807636B2 (en) 2018-11-30 2023-11-07 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US12258341B2 (en) 2018-11-30 2025-03-25 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
CN113166250A (zh) * 2018-11-30 2021-07-23 Abl生物公司 抗4-1bb抗体及其用途
US11352350B2 (en) 2018-11-30 2022-06-07 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11117889B1 (en) 2018-11-30 2021-09-14 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US12195537B2 (en) 2018-11-30 2025-01-14 Abl Bio, Inc. Anti-4-1BB antibody and use thereof
CN113166250B (zh) * 2018-11-30 2023-10-03 Abl生物公司 抗4-1bb抗体及其用途
US12377155B2 (en) 2018-12-13 2025-08-05 Bicyclerd Limited Bicyclic peptide ligands specific for PSMA
US12350343B2 (en) 2018-12-13 2025-07-08 Bicycletx Limited Bicyclic peptide ligands specific for MT1-MMP
US12491253B2 (en) 2018-12-13 2025-12-09 Bicyclerd Limited Bicyclic peptide ligands specific for MT1-MMP
WO2020131547A1 (en) 2018-12-19 2020-06-25 Iovance Biotherapeutics, Inc. Methods of expanding tumor infiltrating lymphocytes using engineered cytokine receptor pairs and uses thereof
WO2020127853A1 (en) 2018-12-20 2020-06-25 Abivax Biomarkers, and uses in treatment of viral infections, inflammations, or cancer
EP3670659A1 (en) 2018-12-20 2020-06-24 Abivax Biomarkers, and uses in treatment of viral infections, inflammations, or cancer
US12492224B2 (en) 2018-12-21 2025-12-09 Bicycletx Limited Bicyclic peptide ligands specific for PD-L1
US12551567B2 (en) 2018-12-21 2026-02-17 Bicyclerd Limited Bicyclic peptide ligands specific for PD-L1
WO2020128893A1 (en) 2018-12-21 2020-06-25 Pfizer Inc. Combination treatments of cancer comprising a tlr agonist
US12486330B2 (en) 2019-02-26 2025-12-02 Pieris Pharmaceuticals Gmbh Fusion proteins specific for CD137 and GPC3
WO2020185859A1 (en) 2019-03-12 2020-09-17 Arcus Biosciences, Inc. Treatment of oncogene-driven cancers
EP4660628A2 (en) 2019-03-12 2025-12-10 Arcus Biosciences, Inc. Treatment of oncogene-driven cancers
WO2020187998A1 (en) 2019-03-19 2020-09-24 Fundació Privada Institut D'investigació Oncològica De Vall Hebron Combination therapy with omomyc and an antibody binding pd-1 or ctla-4 for the treatment of cancer
WO2020205662A1 (en) 2019-03-29 2020-10-08 Myst Therapeutics, Inc. Ex vivo methods for producing a t cell therapeutic and related compositions and methods
WO2020205527A1 (en) 2019-03-29 2020-10-08 Arcus Biosciences, Inc. Treatment of cancer utilizing an identified adenosine fingerprint
WO2020201753A1 (en) 2019-04-02 2020-10-08 Bicycletx Limited Bicycle toxin conjugates and uses thereof
US11746120B2 (en) 2019-04-05 2023-09-05 Kymera Therapeutics, Inc. Stat degraders and uses thereof
US11485750B1 (en) 2019-04-05 2022-11-01 Kymera Therapeutics, Inc. STAT degraders and uses thereof
US12077555B2 (en) 2019-04-05 2024-09-03 Kymera Therapeutics, Inc. STAT degraders and uses thereof
WO2020216947A1 (en) 2019-04-24 2020-10-29 Heidelberg Pharma Research Gmbh Amatoxin antibody-drug conjugates and uses thereof
WO2020227159A2 (en) 2019-05-03 2020-11-12 Flagship Pioneering Innovations V, Inc. Methods of modulating immune activity
US11203643B2 (en) 2019-05-10 2021-12-21 Lyvgen Biopharma Holdings Limited Humanized anti-CD137 antibodies and uses thereof
WO2020231713A1 (en) 2019-05-13 2020-11-19 Bristol-Myers Squibb Company AGONISTS OF ROR GAMMAt
WO2020232029A1 (en) 2019-05-13 2020-11-19 Iovance Biotherapeutics, Inc. Methods and compositions for selecting tumor infiltrating lymphocytes and uses of the same in immunotherapy
WO2020231766A1 (en) 2019-05-13 2020-11-19 Bristol-Myers Squibb Company AGONISTS OF ROR GAMMAt
WO2020243423A1 (en) 2019-05-31 2020-12-03 Ikena Oncology, Inc. Tead inhibitors and uses thereof
WO2020245746A1 (en) 2019-06-04 2020-12-10 Molecular Partners Ag Multispecific proteins
US12521438B2 (en) 2019-06-10 2026-01-13 Kymera Therapeutics, Inc. SMARCA degraders and uses thereof
US12545659B2 (en) 2019-06-28 2026-02-10 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US12558427B2 (en) 2019-07-17 2026-02-24 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US12570695B2 (en) 2019-07-30 2026-03-10 Bicycletx Limited Bicyclic peptide ligands specific for EphA2
US12606594B2 (en) 2019-07-30 2026-04-21 Bicycletx Limited Heterotandem bicyclic peptide complexes
WO2021026179A1 (en) 2019-08-06 2021-02-11 Bristol-Myers Squibb Company AGONISTS OF ROR GAMMAt
WO2021041588A1 (en) 2019-08-28 2021-03-04 Bristol-Myers Squibb Company Substituted pyridopyrimidinonyl compounds useful as t cell activators
US11028085B2 (en) 2019-09-13 2021-06-08 Nimbus Saturn, Inc. Substituted isoindolin-1-ones and 2,3-dihydro-1h-pyrrolo[3,4-c]pyridin-1-ones as hpk1 antagonists
US11034694B2 (en) 2019-09-13 2021-06-15 Nimbus Saturn, Inc. Substituted isoindolin-1-ones and 2,3-dihydro-1H-pyrrolo[3,4-c]pyridin-1-ones as HPK1 antagonists
US12215105B2 (en) 2019-09-13 2025-02-04 Nimbus Saturn, Inc. HPK1 antagonists and uses thereof
US11021481B2 (en) 2019-09-13 2021-06-01 Nimbus Saturn, Inc. Substituted isoindolin-1-ones and 2,3-dihydro-1h-pyrrolo[3,4-c]pyridin-1-ones as HPK1 antagonists
US11078201B2 (en) 2019-09-13 2021-08-03 Nimbus Saturn, Inc. Substituted isoindolin-1-ones and 2,3-dihydro-1H-pyrrol[3,4-c]pyridin-1-ones as HPK1 antagonists
WO2021050964A1 (en) 2019-09-13 2021-03-18 Nimbus Saturn, Inc. Hpk1 antagonists and uses thereof
US11548890B1 (en) 2019-09-13 2023-01-10 Nimbus Saturn, Inc. HPK1 antagonists and uses thereof
WO2021055698A1 (en) 2019-09-19 2021-03-25 Bristol-Myers Squibb Company Antibodies binding to vista at acidic ph
WO2021081378A1 (en) 2019-10-25 2021-04-29 Iovance Biotherapeutics, Inc. Gene editing of tumor infiltrating lymphocytes and uses of same in immunotherapy
WO2021101919A1 (en) 2019-11-19 2021-05-27 Bristol-Myers Squibb Company Compounds useful as inhibitors of helios protein
US12503515B2 (en) 2019-11-19 2025-12-23 Sound Biopharmaceuticals Co. Ltd. Humanized 4-1BB monoclonal antibody and pharmaceutical composition thereof
EP4063388A4 (en) * 2019-11-19 2024-01-17 Sound Biopharmaceuticals Co. Ltd. HUMANIZED MONOCLONAL ANTIBODY 4-1BB AND ASSOCIATED PHARMACEUTICAL COMPOSITION
AU2020387891B2 (en) * 2019-11-19 2024-11-07 Sound Biopharmaceuticals Co. Ltd. Humanized 4-1BB monoclonal antibody and pharmaceutical composition thereof
EP4529955A2 (en) 2019-11-26 2025-04-02 Ikena Oncology, Inc. Polymorphic carbazole derivatives and uses thereof
WO2021108288A1 (en) 2019-11-26 2021-06-03 Bristol-Myers Squibb Company Salts/cocrystals of (r)-n-(4-chlorophenyl)-2-((1s,4s)-4-(6-fluoroquinolin-4-yl)cyclohexyl)propanamide
WO2021108528A1 (en) 2019-11-26 2021-06-03 Ikena Oncology, Inc. Polymorphic carbazole derivatives and uses thereof
US11591339B2 (en) 2019-11-26 2023-02-28 Ikena Oncology, Inc. Solid forms of (R)-N-(2-(5-fluoropyridin-3-yl)-8-isopropylpyrazolo[ 1,5-a][1,3,5]triazin-4-yl)-2,3,4,9-tetrahydro-1H-carbazol-3-amine maleate as aryl hydrocarbon receptor (AHR) inhibitors
US12162884B2 (en) 2019-11-26 2024-12-10 Ikena Oncology, Inc. Solid forms of (R)-N-(2-(5-fluoropyridin-3-yl)-8-isopropylpyrazolo[1,5-a] [1,3,5]triazin-4-yl)-2,3,4,9-tetrahydro-1H-carbazol-3-amine as aryl hydrocarbon receptor (AHR) inhibitors
US12527783B2 (en) 2019-11-26 2026-01-20 Bristol-Myers Squibb Company Salts/cocrystals of (R)-N-(4-chlorophenyl-2-((1S,4S)-4-(6-fluoroquinolin-4-yl)cyclohexyl)propanamide
WO2021108727A1 (en) 2019-11-27 2021-06-03 Myst Therapeutics, Inc. Method of producing tumor-reactive t cell composition using modulatory agents
US12551564B2 (en) 2019-12-10 2026-02-17 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
WO2021118990A1 (en) 2019-12-11 2021-06-17 Iovance Biotherapeutics, Inc. Processes for the production of tumor infiltrating lymphocytes (tils) and methods of using the same
US12539295B2 (en) 2019-12-17 2026-02-03 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11779578B2 (en) 2019-12-17 2023-10-10 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11707457B2 (en) 2019-12-17 2023-07-25 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
US11591332B2 (en) 2019-12-17 2023-02-28 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
WO2021127217A1 (en) 2019-12-17 2021-06-24 Flagship Pioneering Innovations V, Inc. Combination anti-cancer therapies with inducers of iron-dependent cellular disassembly
WO2021124096A1 (en) 2019-12-18 2021-06-24 Pfizer Inc. Once daily cancer treatment regimen with a prmt5 inhibitor
WO2021133752A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted heteroaryl compounds useful as t cell activators
WO2021133748A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted quinolinonyl piperazine compounds useful as t cell activators
WO2021133751A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted quinazolinyl compounds useful as t cell activators
WO2021133920A1 (en) 2019-12-23 2021-07-01 Kymera Therapeutics, Inc. Smarca degraders and uses thereof
WO2021133750A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted bicyclic piperidine derivatives useful as t cell activators
WO2021133749A1 (en) 2019-12-23 2021-07-01 Bristol-Myers Squibb Company Substituted piperazine derivatives useful as t cell activators
US12569485B2 (en) 2019-12-23 2026-03-10 Kymera Therapeutics, Inc. SMARCA inhibitors and uses thereof
US11679109B2 (en) 2019-12-23 2023-06-20 Kymera Therapeutics, Inc. SMARCA degraders and uses thereof
WO2021141907A1 (en) 2020-01-06 2021-07-15 Hifibio (Hong Kong) Limited Anti-tnfr2 antibody and uses thereof
US11396647B2 (en) 2020-01-07 2022-07-26 Board Of Regents, The University Of Texas System Human methylthioadenosine/adenosine depleting enzyme variants for cancer therapy
WO2021139682A1 (en) 2020-01-07 2021-07-15 Hifibio (Hk) Limited Anti-galectin-9 antibody and uses thereof
US11591579B2 (en) 2020-01-07 2023-02-28 Board Of Regents, The University Of Texas System Human methylthioadenosine/adenosine depleting enzyme variants for cancer therapy
WO2021146370A1 (en) 2020-01-15 2021-07-22 Blueprint Medicines Corporation Map4k1 inhibitors
WO2021174208A1 (en) 2020-02-27 2021-09-02 Myst Therapeutics, Llc Methods for ex vivo enrichment and expansion of tumor reactive t cells and related compositions thereof
EP4512828A2 (en) 2020-02-27 2025-02-26 Turnstone Biologics Corp. Methods for ex vivo enrichment and expansion of tumor reactive t cells and related compositions thereof
WO2021170067A1 (zh) 2020-02-28 2021-09-02 上海复宏汉霖生物技术股份有限公司 抗cd137构建体及其用途
EP4110826A4 (en) * 2020-02-28 2024-08-14 Shanghai Henlius Biotech, Inc. ANTI-CD137 CONSTRUCTS, MULTI-SPECIFIC ANTIBODY AND ITS USES
EP4110827A4 (en) * 2020-02-28 2024-08-14 Shanghai Henlius Biotech, Inc. ANTI-CD137 CONSTRUCTS, MULTISPECIFIC ANTIBODIES AND THEIR USES
WO2021170071A1 (en) 2020-02-28 2021-09-02 Shanghai Henlius Biotech, Inc. Anti-cd137 constructs, multispecific antibody and uses thereof
WO2021178488A1 (en) 2020-03-03 2021-09-10 PIC Therapeutics, Inc. Eif4e inhibitors and uses thereof
WO2021181233A2 (en) 2020-03-09 2021-09-16 Pfizer Inc. Fusion proteins and uses thereof
US12528785B2 (en) 2020-03-19 2026-01-20 Kymera Therapeutics, Inc. MDM2 degraders and uses thereof
US11932624B2 (en) 2020-03-19 2024-03-19 Kymera Therapeutics, Inc. MDM2 degraders and uses thereof
WO2021188769A1 (en) 2020-03-19 2021-09-23 Arcus Biosciences, Inc. Tetralin and tetrahydroquinoline compounds as inhibitors of hif-2alpha
WO2021188948A1 (en) 2020-03-19 2021-09-23 Kymera Therapeutics, Inc. Mdm2 degraders and uses thereof
WO2021194914A1 (en) 2020-03-23 2021-09-30 Bristol-Myers Squibb Company Substituted oxoisoindoline compounds for the treatment of cancer
WO2021207449A1 (en) 2020-04-09 2021-10-14 Merck Sharp & Dohme Corp. Affinity matured anti-lap antibodies and uses thereof
WO2021226085A1 (en) 2020-05-04 2021-11-11 Iovance Biotherapeutics, Inc. Selection of improved tumor reactive t-cells
WO2021226061A1 (en) 2020-05-04 2021-11-11 Iovance Biotherapeutics, Inc. Processes for production of tumor infiltrating lymphocytes and uses of the same in immunotherapy
WO2021229507A2 (en) 2020-05-13 2021-11-18 Pfizer Inc. Methods, therapies and uses for treating cancer
US12146000B2 (en) 2020-05-19 2024-11-19 Boehringer Ingelheim International Gmbh Bispecific and tetravalent CD137 and FAP molecules for the treatment of cancer
WO2021247591A1 (en) 2020-06-02 2021-12-09 Arcus Biosciences, Inc. Antibodies to tigit
WO2021247897A1 (en) 2020-06-03 2021-12-09 Kymera Therapeutics, Inc. Deuterated irak degraders and uses thereof
US11685750B2 (en) 2020-06-03 2023-06-27 Kymera Therapeutics, Inc. Crystalline forms of IRAK degraders
WO2021258010A1 (en) 2020-06-19 2021-12-23 Gossamer Bio Services, Inc. Oxime compounds useful as t cell activators
WO2022006179A1 (en) 2020-06-29 2022-01-06 Flagship Pioneering Innovations V, Inc. Viruses engineered to promote thanotransmission and their use in treating cancer
US11857535B2 (en) 2020-07-30 2024-01-02 Kymera Therapeutics, Inc. Methods of treating mutant lymphomas
US12540161B2 (en) 2020-08-03 2026-02-03 Bicycletx Limited Linkers
WO2022033419A2 (en) 2020-08-10 2022-02-17 Shanghai Xbh Biotechnology Co., Ltd. Compositions and methods for treating autoimmune diseases and cancers by targeting igsf8
WO2022038158A1 (en) 2020-08-17 2022-02-24 Bicycletx Limited Bicycle conjugates specific for nectin-4 and uses thereof
WO2022053990A1 (en) 2020-09-14 2022-03-17 Pfizer Inc. Methods, therapies and uses for treating cancer
WO2022076606A1 (en) 2020-10-06 2022-04-14 Iovance Biotherapeutics, Inc. Treatment of nsclc patients with tumor infiltrating lymphocyte therapies
WO2022076952A1 (en) 2020-10-06 2022-04-14 Iovance Biotherapeutics, Inc. Treatment of nsclc patients with tumor infiltrating lymphocyte therapies
US12553029B2 (en) 2020-10-06 2026-02-17 Iovance Biotherapeutics, Inc. Treatment of NSCLC patients with tumor infiltrating lymphocyte therapies
WO2022081718A1 (en) 2020-10-14 2022-04-21 Five Prime Therapeutics, Inc. Anti-c-c chemokine receptor 8 (ccr8) antibodies and methods of use thereof
WO2022084440A2 (en) 2020-10-21 2022-04-28 Numab Therapeutics AG Combination treatment
EP3988568A1 (en) 2020-10-21 2022-04-27 Numab Therapeutics AG Combination treatment
WO2022120353A1 (en) 2020-12-02 2022-06-09 Ikena Oncology, Inc. Tead inhibitors and uses thereof
WO2022120354A1 (en) 2020-12-02 2022-06-09 Ikena Oncology, Inc. Tead inhibitors and uses thereof
US12606568B2 (en) 2020-12-09 2026-04-21 Kymera Therapeutics, Inc. SMARCA degraders and uses thereof
WO2022125941A1 (en) 2020-12-11 2022-06-16 Iovance Biotherapeutics, Inc. Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with braf inhibitors and/or mek inhibitors
WO2022133083A1 (en) 2020-12-16 2022-06-23 Gossamer Bio Services, Inc. Compounds useful as t cell activators
WO2022133149A1 (en) 2020-12-17 2022-06-23 Iovance Biotherapeutics, Inc. Treatment of cancers with tumor infiltrating lymphocytes
WO2022133140A1 (en) 2020-12-17 2022-06-23 Iovance Biotherapeutics, Inc. Treatment with tumor infiltrating lymphocyte therapies in combination with ctla-4 and pd-1 inhibitors
US12150995B2 (en) 2020-12-30 2024-11-26 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
WO2022148979A1 (en) 2021-01-11 2022-07-14 Bicycletx Limited Methods for treating cancer
WO2022153161A1 (en) 2021-01-14 2022-07-21 Pfizer Inc. Treatment of cancer using a prmt5 inhibitor
WO2022167457A1 (en) 2021-02-02 2022-08-11 Liminal Biosciences Limited Gpr84 antagonists and uses thereof
WO2022167445A1 (en) 2021-02-02 2022-08-11 Liminal Biosciences Limited Gpr84 antagonists and uses thereof
WO2022169921A1 (en) 2021-02-04 2022-08-11 Bristol-Myers Squibb Company Benzofuran compounds as sting agonists
WO2022170219A1 (en) 2021-02-05 2022-08-11 Iovance Biotherapeutics, Inc. Adjuvant therapy for cancer
WO2022171745A1 (en) 2021-02-12 2022-08-18 F. Hoffmann-La Roche Ag Bicyclic tetrahydroazepine derivatives for the treatment of cancer
US12252488B2 (en) 2021-02-12 2025-03-18 Nimbus Saturn, Inc. HPK1 antagonists and uses thereof
US12171768B2 (en) 2021-02-15 2024-12-24 Kymera Therapeutics, Inc. IRAK4 degraders and uses thereof
US12497402B2 (en) 2021-02-15 2025-12-16 Kymera Therapeutics, Inc. IRAK4 degraders and uses thereof
US11773103B2 (en) 2021-02-15 2023-10-03 Kymera Therapeutics, Inc. IRAK4 degraders and uses thereof
WO2022187741A2 (en) 2021-03-05 2022-09-09 Iovance Biotherapeutics, Inc. Tumor storage and cell culture compositions
US11926625B2 (en) 2021-03-05 2024-03-12 Nimbus Saturn, Inc. HPK1 antagonists and uses thereof
WO2022192145A1 (en) 2021-03-08 2022-09-15 Blueprint Medicines Corporation Map4k1 inhibitors
WO2022197641A1 (en) 2021-03-15 2022-09-22 Rapt Therapeutics, Inc. 1h-pyrazolo[3,4-d]pyrimidin-6-yl-amine derivatives as hematopoietic progenitor kinase 1 (hpk1) modulators and/or inhibitors for the treatment of cancer and other diseases
US12570961B2 (en) 2021-03-25 2026-03-10 Iovance Biotherapeutics, Inc. Methods and compositions for T-cell coculture potency assays and use with cell therapy products
US12553031B2 (en) 2021-03-25 2026-02-17 Iovance Biotherapeutics, Inc. Methods and compositions for T-cell coculture potency assays and use with cell therapy products
US12071442B2 (en) 2021-03-29 2024-08-27 Nimbus Saturn, Inc. Substituted pyrrolo[3,4-c]pyridines as HPK1 antagonists
US12466841B2 (en) 2021-03-29 2025-11-11 Nimbus Saturn, Inc. Substituted pyrrolo[3,4-c]pyridines as HPK1 antagonists
WO2022212784A1 (en) 2021-03-31 2022-10-06 Flagship Pioneering Innovations V, Inc. Thanotransmission polypeptides and their use in treating cancer
WO2022216573A1 (en) 2021-04-05 2022-10-13 Bristol-Myers Squibb Company Pyridinyl substituted oxoisoindoline compounds for the treatment of cancer
WO2022216644A1 (en) 2021-04-06 2022-10-13 Bristol-Myers Squibb Company Pyridinyl substituted oxoisoindoline compounds
US12325697B2 (en) 2021-04-09 2025-06-10 Nimbus Clio, Inc. CBL-B modulators and uses thereof
WO2022221866A1 (en) 2021-04-16 2022-10-20 Ikena Oncology, Inc. Mek inhibitors and uses thereof
WO2022225981A2 (en) 2021-04-19 2022-10-27 Iovance Biotherapeutics, Inc. Chimeric costimulatory receptors, chemokine receptors, and the use of same in cellular immunotherapies
US12097261B2 (en) 2021-05-07 2024-09-24 Kymera Therapeutics, Inc. CDK2 degraders and uses thereof
WO2022245754A1 (en) 2021-05-17 2022-11-24 Iovance Biotherapeutics, Inc. Pd-1 gene-edited tumor infiltrating lymphocytes and uses of same in immunotherapy
WO2022246179A1 (en) 2021-05-21 2022-11-24 Arcus Biosciences, Inc. Axl inhibitor compounds
WO2022246177A1 (en) 2021-05-21 2022-11-24 Arcus Biosciences, Inc. Axl compounds
WO2023278641A1 (en) 2021-06-29 2023-01-05 Flagship Pioneering Innovations V, Inc. Immune cells engineered to promote thanotransmission and uses thereof
WO2023288254A1 (en) 2021-07-14 2023-01-19 Blueprint Medicines Corporation Heterocyclic compounds as map4k1 inhibitors
US12202844B2 (en) 2021-07-14 2025-01-21 Blueprint Medicines Corporation MAP4K1 inhibitors
WO2023288264A1 (en) 2021-07-15 2023-01-19 Blueprint Medicines Corporation Map4k1 inhibitors
WO2023009716A1 (en) 2021-07-28 2023-02-02 Iovance Biotherapeutics, Inc. Treatment of cancer patients with tumor infiltrating lymphocyte therapies in combination with kras inhibitors
WO2023028238A1 (en) 2021-08-25 2023-03-02 PIC Therapeutics, Inc. Eif4e inhibitors and uses thereof
WO2023028235A1 (en) 2021-08-25 2023-03-02 PIC Therapeutics, Inc. Eif4e inhibitors and uses thereof
WO2023049862A1 (en) 2021-09-24 2023-03-30 Iovance Biotherapeutics, Inc. Expansion processes and agents for tumor infiltrating lymphocytes
WO2023064958A1 (en) 2021-10-15 2023-04-20 Compugen Ltd. Combination therapy with anti-pvrig antibodies formulations, anti-tigit antibodies, and anti-pd-1 antibodies
WO2023077015A2 (en) 2021-10-27 2023-05-04 Iovance Biotherapeutics, Inc. Systems and methods for coordinating manufacturing of cells for patient-specific immunotherapy
US12187744B2 (en) 2021-10-29 2025-01-07 Kymera Therapeutics, Inc. IRAK4 degraders and synthesis thereof
WO2023077046A1 (en) 2021-10-29 2023-05-04 Arcus Biosciences, Inc. Inhibitors of hif-2alpha and methods of use thereof
WO2023086803A1 (en) 2021-11-10 2023-05-19 Iovance Biotherapeutics, Inc. Methods of expansion treatment utilizing cd8 tumor infiltrating lymphocytes
WO2023114984A1 (en) 2021-12-17 2023-06-22 Ikena Oncology, Inc. Tead inhibitors and uses thereof
WO2023122772A1 (en) 2021-12-22 2023-06-29 Gossamer Bio Services, Inc. Oxime derivatives useful as t cell activators
WO2023122778A1 (en) 2021-12-22 2023-06-29 Gossamer Bio Services, Inc. Pyridazinone derivatives useful as t cell activators
WO2023122777A1 (en) 2021-12-22 2023-06-29 Gossamer Bio Services, Inc. Oxime derivatives useful as t cell activators
WO2023147486A1 (en) 2022-01-28 2023-08-03 Iovance Biotherapeutics, Inc. Tumor infiltrating lymphocytes engineered to express payloads
US12091411B2 (en) 2022-01-31 2024-09-17 Kymera Therapeutics, Inc. IRAK degraders and uses thereof
WO2023150186A1 (en) 2022-02-01 2023-08-10 Arvinas Operations, Inc. Dgk targeting compounds and uses thereof
WO2023173057A1 (en) 2022-03-10 2023-09-14 Ikena Oncology, Inc. Mek inhibitors and uses thereof
WO2023173053A1 (en) 2022-03-10 2023-09-14 Ikena Oncology, Inc. Mek inhibitors and uses thereof
US11981921B2 (en) 2022-04-15 2024-05-14 Iovance Biotherapeutics, Inc. TIL expansion processes using specific cytokine combinations and/or AKTi treatment
WO2023211889A1 (en) 2022-04-25 2023-11-02 Ikena Oncology, Inc. Polymorphic compounds and uses thereof
WO2023215719A1 (en) 2022-05-02 2023-11-09 Arcus Biosciences, Inc. Anti-tigit antibodies and uses of the same
WO2023230205A1 (en) 2022-05-25 2023-11-30 Ikena Oncology, Inc. Mek inhibitors and uses thereof
WO2024015251A1 (en) 2022-07-15 2024-01-18 Arcus Biosciences, Inc. Inhibitors of hpk1 and methods of use thereof
WO2024020034A1 (en) 2022-07-20 2024-01-25 Arcus Biosciences, Inc. Cbl-b inhibitors and methods of use thereof
WO2024030758A1 (en) 2022-08-01 2024-02-08 Iovance Biotherapeutics, Inc. Chimeric costimulatory receptors, chemokine receptors, and the use of same in cellular immunotherapies
WO2024028364A1 (en) 2022-08-02 2024-02-08 Liminal Biosciences Limited Aryl-triazolyl and related gpr84 antagonists and uses thereof
WO2024028365A1 (en) 2022-08-02 2024-02-08 Liminal Biosciences Limited Substituted pyridone gpr84 antagonists and uses thereof
WO2024028363A1 (en) 2022-08-02 2024-02-08 Liminal Biosciences Limited Heteroaryl carboxamide and related gpr84 antagonists and uses thereof
WO2024036100A1 (en) 2022-08-08 2024-02-15 Bristol-Myers Squibb Company Substituted tetrazolyl compounds useful as t cell activators
WO2024036101A1 (en) 2022-08-09 2024-02-15 Bristol-Myers Squibb Company Tertiary amine substituted bicyclic compounds useful as t cell activators
WO2024033389A1 (en) 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives
WO2024033388A1 (en) 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives
WO2024033458A1 (en) 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydroazepine derivatives
WO2024033457A1 (en) 2022-08-11 2024-02-15 F. Hoffmann-La Roche Ag Bicyclic tetrahydrothiazepine derivatives
WO2024040194A1 (en) 2022-08-17 2024-02-22 Capstan Therapeutics, Inc. Conditioning for in vivo immune cell engineering
WO2024040195A1 (en) 2022-08-17 2024-02-22 Capstan Therapeutics, Inc. Conditioning for in vivo immune cell engineering
WO2024077191A1 (en) 2022-10-05 2024-04-11 Flagship Pioneering Innovations V, Inc. Nucleic acid molecules encoding trif and additionalpolypeptides and their use in treating cancer
WO2024081385A1 (en) 2022-10-14 2024-04-18 Arcus Biosciences, Inc. Hpk1 inhibitors and methods of use thereof
WO2024086718A1 (en) 2022-10-20 2024-04-25 Arcus Biosciences, Inc. Lyophilized formulations of cd73 compounds
WO2024112894A1 (en) 2022-11-22 2024-05-30 PIC Therapeutics, Inc. Eif4e inhibitors and uses thereof
WO2024137865A1 (en) 2022-12-22 2024-06-27 Gossamer Bio Services, Inc. Compounds useful as t cell activators
WO2024151687A1 (en) 2023-01-09 2024-07-18 Flagship Pioneering Innovations V, Inc. Genetic switches and their use in treating cancer
WO2024151885A1 (en) 2023-01-13 2024-07-18 Iovance Biotherapeutics, Inc. Use of til as maintenance therapy for nsclc patients who achieved pr/cr after prior therapy
WO2024233360A1 (en) 2023-05-05 2024-11-14 Arcus Biosciences, Inc. Cbl-b inhibitors and methods of use thereof
WO2024233514A1 (en) 2023-05-08 2024-11-14 Bristol-Myers Squibb Company Substituted phenyl oxazolone compounds
WO2024233900A1 (en) 2023-05-10 2024-11-14 Blueprint Medicines Corporation Gsk3a inhibitors and methods of use thereof
WO2024243502A1 (en) 2023-05-25 2024-11-28 Arcus Biosciences, Inc. Cbl-b inhibitors and methods of use thereof
WO2024249954A1 (en) 2023-05-31 2024-12-05 Capstan Therapeutics, Inc. Lipid nanoparticle formulations and compositions
WO2024249540A1 (en) 2023-05-31 2024-12-05 Bristol-Myers Squibb Company Substituted oxazolone compound for decreasing levels of ikzf1-4 proteins
WO2024254227A1 (en) 2023-06-07 2024-12-12 Bristol-Myers Squibb Company Spirocyclic substituted oxoisoindolinyl piperidine-2,6-dione compound
EP4620470A2 (en) 2023-06-23 2025-09-24 Kymera Therapeutics, Inc. Irak degraders and uses thereof
WO2024263853A1 (en) 2023-06-23 2024-12-26 Bristol-Myers Squibb Company Substituted oxoisoindolinyl piperidine-2,6-dione compound as anticancer agent
WO2025030002A2 (en) 2023-08-02 2025-02-06 Arvinas Operations, Inc. Dgk targeting compounds and uses thereof
WO2025032521A1 (en) 2023-08-10 2025-02-13 Pfizer Inc. Methods, therapies and uses for treating cancer
WO2025049840A1 (en) 2023-09-02 2025-03-06 Bristol-Myers Squibb Company Substituted phenyl oxooxazolyl piperidine dione compounds
WO2025064197A1 (en) 2023-09-02 2025-03-27 Bristol-Myers Squibb Company Substituted azetidinyl oxoisoindolinyl piperidine-2,6-dione compounds
WO2025054339A1 (en) 2023-09-08 2025-03-13 Arcus Biosciences, Inc. Triazolopyridine compounds as inhibitors of kit
WO2025059245A1 (en) 2023-09-13 2025-03-20 Bristol-Myers Squibb Company Substituted oxoisoindolinyl piperidine-2,6-dione compounds
WO2025072330A1 (en) 2023-09-26 2025-04-03 Arcus Biosciences, Inc. Kit inhibitor compounds and methods of use thereof
WO2025076127A1 (en) 2023-10-05 2025-04-10 Capstan Therapeutics, Inc. Constrained ionizable cationic lipids and lipid nanoparticles
WO2025076113A1 (en) 2023-10-05 2025-04-10 Capstan Therapeutics, Inc. Ionizable cationic lipids with conserved spacing and lipid nanoparticles
WO2025076299A1 (en) 2023-10-06 2025-04-10 Arcus Biosciences, Inc. Cbl-b inhibitors and methods of use thereof
WO2025096489A1 (en) 2023-10-31 2025-05-08 Bristol-Myers Squibb Company Ubiquitin specific processing protease 1 (usp1) compounds
WO2025096539A1 (en) 2023-10-31 2025-05-08 Bristol-Myers Squibb Company Ubiquitin specific processing protease 1 (usp1) compounds
WO2025096494A1 (en) 2023-10-31 2025-05-08 Bristol-Myers Squibb Company Ubiquitin specific processing protease 1 (usp1) compounds
WO2025096488A1 (en) 2023-10-31 2025-05-08 Bristol-Myers Squibb Company Ubiquitin specific processing protease 1 (usp1) compounds
WO2025096505A1 (en) 2023-10-31 2025-05-08 Bristol-Myers Squibb Company Ubiquitin specific processing protease 1 (usp1) compounds
WO2025096487A1 (en) 2023-10-31 2025-05-08 Bristol-Myers Squibb Company Ubiquitin specific processing protease 1 (usp1) compounds
WO2025096979A1 (en) 2023-11-02 2025-05-08 Arcus Biosciences, Inc. Thiazole compounds as kit inhibitors and methods of use thereof
WO2025101484A1 (en) 2023-11-06 2025-05-15 Iovance Biotherapeutics, Inc. Treatment of endometrial cancers with tumor infiltrating lymphocyte therapies
WO2025137370A1 (en) 2023-12-20 2025-06-26 Arcus Biosciences, Inc. Salt forms of an axl inhibitor
WO2025179294A2 (en) 2024-02-22 2025-08-28 Capstan Therapeutics, Inc. Immune engineering amplification
WO2025217454A2 (en) 2024-04-11 2025-10-16 Capstan Therapeutics, Inc. Ionizable cationic lipids and lipid nanoparticles
WO2025217452A1 (en) 2024-04-11 2025-10-16 Capstan Therapeutics, Inc. Constrained ionizable cationic lipids and lipid nanoparticles
WO2025226767A1 (en) 2024-04-24 2025-10-30 Bristol-Myers Squibb Company Substituted 3-(5-(6-aminopyridin-2-yl)-4-fluoro-1-oxoisoindolin-2-yl)piperidine-2,6-dione compounds for use in the treatment of cancer
WO2026006759A1 (en) 2024-06-28 2026-01-02 Arcus Biosciences, Inc. Pharmaceutical compositions, dosage forms, and methods of making and using same
WO2026035787A1 (en) 2024-08-07 2026-02-12 Bristol-Myers Squibb Company Ubiquitin specific processing protease 1 (usp1) macrocyles

Also Published As

Publication number Publication date
JP2017075164A (ja) 2017-04-20
CN103221428B (zh) 2016-02-10
CN103221428A (zh) 2013-07-24
PH12020550156A1 (en) 2024-01-15
AU2011300445A1 (en) 2013-03-14
SI2614082T1 (sl) 2018-12-31
TW201414748A (zh) 2014-04-16
IL250386A0 (en) 2017-03-30
SG10201506906VA (en) 2015-10-29
DK2614082T3 (en) 2018-11-26
US20160369000A1 (en) 2016-12-22
CA2810359C (en) 2021-06-22
PL2614082T3 (pl) 2019-02-28
AU2011300445B2 (en) 2014-10-09
US10640568B2 (en) 2020-05-05
EP2614082B1 (en) 2018-10-03
AU2014227437A1 (en) 2014-10-02
AR114031A2 (es) 2020-07-15
CA2810359A1 (en) 2012-03-15
ZA201502914B (en) 2017-08-30
MX337040B (es) 2016-02-09
PH12013500395A1 (en) 2013-04-22
AU2018201703A1 (en) 2018-04-05
US20140377255A1 (en) 2014-12-25
TWI520969B (zh) 2016-02-11
HUE041958T2 (hu) 2019-06-28
JP2022046651A (ja) 2022-03-23
RU2015110632A (ru) 2015-08-10
US8337850B2 (en) 2012-12-25
ES2699648T3 (es) 2019-02-12
AU2016204960A1 (en) 2016-08-04
EP3441404A1 (en) 2019-02-13
NZ700891A (en) 2017-05-26
PT2614082T (pt) 2018-12-03
RU2551963C2 (ru) 2015-06-10
BR112013005699A2 (pt) 2017-11-21
MX374682B (es) 2025-03-06
NZ729044A (en) 2020-07-31
RU2015110632A3 (https=) 2018-11-30
CO6690759A2 (es) 2013-06-17
KR101527297B1 (ko) 2015-06-26
US20120237498A1 (en) 2012-09-20
KR20130080866A (ko) 2013-07-15
US8821867B2 (en) 2014-09-02
MX2013002709A (es) 2013-05-22
EP2614082A1 (en) 2013-07-17
TW201812011A (zh) 2018-04-01
NZ607710A (en) 2014-11-28
HK1222872A1 (zh) 2017-07-14
PH12013500395B1 (en) 2020-10-16
IL247054B (en) 2020-06-30
TWI652345B (zh) 2019-03-01
JP6557648B2 (ja) 2019-08-07
JP6105470B2 (ja) 2017-03-29
SG10201912092VA (en) 2020-02-27
MY177065A (en) 2020-09-03
CN105481983B (zh) 2021-09-03
NZ714128A (en) 2017-10-27
KR20130079533A (ko) 2013-07-10
TW201625694A (zh) 2016-07-16
US9468678B2 (en) 2016-10-18
TW201300413A (zh) 2013-01-01
TWI641621B (zh) 2018-11-21
BR112013005699B1 (pt) 2021-08-17
RU2013110576A (ru) 2014-10-20
JP2013544756A (ja) 2013-12-19
HK1187627A1 (zh) 2014-04-11
KR101527300B1 (ko) 2015-06-09
PE20131465A1 (es) 2014-01-04
AR082916A1 (es) 2013-01-16
US20180194851A1 (en) 2018-07-12
CN105481983A (zh) 2016-04-13
TWI425005B (zh) 2014-02-01
IL225001A (en) 2016-08-31
MY162737A (en) 2017-07-14
RU2710717C2 (ru) 2020-01-10
US20130078240A1 (en) 2013-03-28
AU2014227437B2 (en) 2016-07-28
JP2019065038A (ja) 2019-04-25
IL247054A0 (en) 2016-09-29
SG188313A1 (en) 2013-04-30

Similar Documents

Publication Publication Date Title
US10640568B2 (en) 4-1BB binding molecules
IL272700B1 (en) Anti-CD137 molecules and their use
AU2013201617B2 (en) 4-1BB binding molecules
HK1222872B (zh) 4-1bb 结合分子
HK1187627B (en) 4-1bb binding molecules

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11764859

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 12013500395

Country of ref document: PH

ENP Entry into the national phase

Ref document number: 2810359

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 13047147

Country of ref document: CO

Ref document number: 000404-2013

Country of ref document: PE

Ref document number: MX/A/2013/002709

Country of ref document: MX

ENP Entry into the national phase

Ref document number: 2013527708

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2011300445

Country of ref document: AU

Date of ref document: 20110826

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2011764859

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 20137008907

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2013110576

Country of ref document: RU

Kind code of ref document: A

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112013005699

Country of ref document: BR

WWE Wipo information: entry into national phase

Ref document number: 247054

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 250386

Country of ref document: IL

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112013005699

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112013005699

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20130308

WWW Wipo information: withdrawn in national office

Ref document number: 607710

Country of ref document: NZ