WO2011112978A1 - Cd37-binding molecules and immunoconjugates thereof - Google Patents

Cd37-binding molecules and immunoconjugates thereof Download PDF

Info

Publication number
WO2011112978A1
WO2011112978A1 PCT/US2011/028172 US2011028172W WO2011112978A1 WO 2011112978 A1 WO2011112978 A1 WO 2011112978A1 US 2011028172 W US2011028172 W US 2011028172W WO 2011112978 A1 WO2011112978 A1 WO 2011112978A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
polypeptide
nos
cell
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2011/028172
Other languages
English (en)
French (fr)
Inventor
Jutta Deckert
Peter Park
Daniel Tavares
Lingyun Rui
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Immunogen Inc
Original Assignee
Immunogen Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2011226672A priority Critical patent/AU2011226672B2/en
Priority to DK11754195.3T priority patent/DK2544719T3/da
Priority to MX2015008742A priority patent/MX375439B/es
Priority to SM20190549T priority patent/SMT201900549T1/it
Priority to EP19183557.8A priority patent/EP3620467A1/en
Priority to HRP20191688TT priority patent/HRP20191688T1/hr
Priority to CN201180013661.2A priority patent/CN102971012B/zh
Priority to RSP20191291 priority patent/RS59389B1/sr
Application filed by Immunogen Inc filed Critical Immunogen Inc
Priority to LT11754195T priority patent/LT2544719T/lt
Priority to KR1020157000870A priority patent/KR101764572B1/ko
Priority to UAA201210674A priority patent/UA110698C2/uk
Priority to SG2012064168A priority patent/SG183542A1/en
Priority to KR1020127026626A priority patent/KR101644674B1/ko
Priority to ES11754195T priority patent/ES2748347T3/es
Priority to EP11754195.3A priority patent/EP2544719B1/en
Priority to BR112012023010A priority patent/BR112012023010A8/pt
Priority to SI201131793T priority patent/SI2544719T1/sl
Priority to RU2012139045A priority patent/RU2610662C9/ru
Priority to JP2012557290A priority patent/JP5932672B2/ja
Priority to PL11754195T priority patent/PL2544719T3/pl
Priority to MX2012010514A priority patent/MX338932B/es
Priority to CA2792618A priority patent/CA2792618C/en
Priority to NZ602176A priority patent/NZ602176A/en
Publication of WO2011112978A1 publication Critical patent/WO2011112978A1/en
Priority to IL221682A priority patent/IL221682A/en
Anticipated expiration legal-status Critical
Priority to AU2015246118A priority patent/AU2015246118B2/en
Priority to IL252398A priority patent/IL252398B/en
Priority to AU2017248441A priority patent/AU2017248441A1/en
Priority to CY20191101025T priority patent/CY1122091T1/el
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/56Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
    • A61K47/59Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes
    • A61K47/60Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyureas or polyurethanes the organic macromolecular compound being a polyoxyalkylene oligomer, polymer or dendrimer, e.g. PEG, PPG, PEO or polyglycerol
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/68033Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a maytansine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6801Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
    • A61K47/6803Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
    • A61K47/6811Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
    • A61K47/6817Toxins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6851Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
    • A61K47/6867Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from a cell of a blood cancer
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/566Immunoassay; Biospecific binding assay; Materials therefor using specific carrier or receptor proteins as ligand binding reagents where possible specific carrier or receptor proteins are classified with their target compounds
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/54F(ab')2
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/55Fab or Fab'
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/626Diabody or triabody
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/734Complement-dependent cytotoxicity [CDC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/705Assays involving receptors, cell surface antigens or cell surface determinants
    • G01N2333/70596Molecules with a "CD"-designation not provided for elsewhere in G01N2333/705

Definitions

  • the field of the invention generally relates to antibodies, antigen-binding fragments thereof, polypeptides, and immunoconjugates that bind to CD37, as well as to methods of using such CD37- binding molecules for the treatment of diseases, such as B-cell malignancies.
  • CD37 Leukocyte antigen CD37
  • GP52-40 tetraspanin-26
  • TSPAN26 is a transmembrane protein of the tetraspanin superfamily (Maecker et al., 1997 FASEB J. 1 1 :428-442). It is a heavily glycosylated protein with four transmembrane domains that is expressed on B cells during the pre-B to peripheral mature B-cell stages, but is absent on terminal differentiation to plasma cells. (Link et al., 1987, J Pathol. 152: 12-21).
  • CD37 antigen is only weakly expressed on T-cells, myeloid cells and granulocytes (Schwartz-Albiez et al. 1988, J. Immunol., 140(3)905-914). However, CD37 is also expressed on malignant B-cells such as those founding non-Hodgkin's lymphoma (NHL) and chronic lymphoid leukemia (CLL) (Moore et al. 1986, J Immunol. 137(9):3013-8). This expression profile suggests that CD37 represents a promising therapeutic target for B-cell malignancies.
  • NHL non-Hodgkin's lymphoma
  • CLL chronic lymphoid leukemia
  • CD37 While the exact physiological role of CD37 in unclear, studies suggest a potential role in T- cell proliferation (van Spriel et al. 2004, J Immunol., 172(5):2953-61) As part of the tetraspanin family of cell surface glycoproteins, CD37 may also complex with other surface proteins (Angelisova 1994, Immunogenetics., 39(4):249-56). Mice deficient in CD37 expression were developed and revealed no changes in development and cellular composition of lymphoid organs. Only reduced levels of IgGl and alterations of responses to T-cell dependent antigens were observed (Knobeloch et al. 2000, Mol Cell Biol., 20(15):5363-9).
  • Antibodies are emerging as a promising method to treat such cancers.
  • antibodies that are able to induce apoptosis in target cells are desirable.
  • antibodies having complement-dependent cytotoxicity (CDC) activity and antibody-dependent cytotoxicity (ADCC) are also desirable.
  • rituximab an anti-CD20 antibody called rituximab is being used to treat B-cell malignancies (Leget et al., 1998, Curr. Opin. Oncol., 10:548-551).
  • CD37-binding agents are also being tested as potential therapeutics for B-cell malignancies. Trubion Pharmaceuticals developed the CD37-binding agents SMIP-016 and TRU-016 (Zhao et al., 2007, Blood, 1 10:2569-2577).
  • SMIP-016 is a single chain polypeptide that includes variable regions from a hybridoma and engineered human constant regions.
  • TRU-016 is a humanized version of the anti-CD37 SMIP protein. See e.g. U.S. Published Application No. 2007/0009519. TRU-016 is being tested clinically for the treatment of chronic lyphocytic leukemia (CLL). Boehringer Ingelheim has also disclosed a CD37 binding agent in International Published Application No. WO 2009/019312. However, no CDC activity has been described for any of these binding agents and no in vitro pro-apoptotic activity has been described in the absence of cross-linking agents.
  • Radio-immunotherapy has been attempted using a radio-labeled anti-CD37 antibody MB-1 in two separate trials.
  • Therapeutic doses of 131 I-MB-1 were administered to six relapsed NHL patients (Press et al. 1989 J Clin Oncol. 7(8): 1027-38, Press at el. 1993, N Engl J Med. 329(17): 1219-24). All six patients achieved a complete remission (CR) with a duration of four to thirty-one months.
  • 131 I-MB- 1 was administered to ten relapsed NHL patients (Kaminski et al. 1992 J Clin Oncol. 10(1 1): 1696-71 1).
  • ACC antibody-cytotoxic agent conjugates
  • ADC antibody-drug conjugates
  • CD37 is structurally similar to CD20 as both antigens contain four transmembrane domains, although CD20 is not part of the tetraspanin family (Tedder et al. 1989, J. Immun. 142: 2560-2568).
  • Antibodies against several B-cell antigens including CD37 and CD20 have been studied for their ability to undergo endocytosis and degradation (Press et al. 1989, Cancer Res. 49(17):4906-12, and Press et al. 1994, Blood. 83(5): 1390-7).
  • the anti-CD37 antibody MB-1 was retained on the cell surface and internalized slowly in Daudi lymphoma cells in vitro.
  • the MB-1 antibody also had a low rate of endocytosis and intracellular metabolism in NHL patient cells in vitro. Similar results were obtained with the anti-CD20 antibody 1F5, which was also retained mainly on the lymphoma cell surface and internalized poorly.
  • CD37 has not been considered a favorable target for antibody-drug conjugates. [0008] Therefore, there exists a need for CD37 binding agents including antibodies, antigen-binding fragments thereof, and antibody-drug conjugates (immunoconjugates) as a means to treat B-cell malignancies.
  • the present invention addresses that need.
  • Novel antibodies that bind to human CD37, immunoconjugates comprising these antibodies, and methods of their use are described herein.
  • Novel polypeptides such as antibodies that bind human CD37, fragments of such antibodies, and other polypeptides related to such antibodies are also provided.
  • Polynucleotides comprising nucleic acid sequences encoding the polypeptides are also provided, as are vectors comprising the polynucleotides.
  • Cells comprising the polypeptides and/or polynucleotides of the invention are further provided.
  • Compositions e.g., pharmaceutical compositions
  • methods of making and using the novel CD37 antibodies or immunoconjugates are also provided, such as methods of using the novel CD37 antibodies or immunoconjugates to inhibit tumor growth and/or treat cancer.
  • Antibodies or antigen binding fragment thereof that specifically bind to CD37, and are capable of inducing complement dependent cytotoxicity (CDC) are provided.
  • the antibody is also capable of inducing apoptosis and/or antibody dependent cell mediated cytotoxicity (ADCC).
  • the antibody or antigen binding fragment thereof can be one that specifically binds to the same CD37 epitope as an antibody selected from the group consisting of: (a) an antibody comprising the polypeptide of SEQ ID NO:55 and the polypeptide of SEQ ID NO:72; (b) an antibody comprising the polypeptide of SEQ ID NO:59 and the polypeptide of SEQ ID NO:75; (c) an antibody comprising the polypeptide of SEQ ID NO:61 and the polypeptide of SEQ ID NO:77; (d) an antibody comprising the polypeptide of SEQ ID NO:64 and the polypeptide of SEQ ID NO:80; (e) an antibody comprising the polypeptide of SEQ ID NO:66 and the polypeptide of SEQ ID NO:82; (f) an antibody comprising the polypeptide of SEQ ID NO:68 and the polypeptide of SEQ ID NO:84; and (g) an antibody comprising the polypeptide of SEQ ID NO:70 and the polypeptide of SEQ ID NO:
  • the antibody or antigen binding fragment thereof specifically binds to CD37 and specifically binds to the polypeptide of SEQ ID NO: 180. In a certain embodiment, the antibody or antigen binding fragment thereof does not bind to the polypeptide of SEQ ID NO: 184.
  • the antibody or antigen binding fragment thereof specifically binds to CD37, and the antibody or fragment thereof competitively inhibits an antibody selected from the group consisting of: (a) an antibody comprising the polypeptide of SEQ ID NO:55 and the polypeptide of SEQ ID NO:72; (b) an antibody comprising the polypeptide of SEQ ID NO:59 and the polypeptide of SEQ ID NO:75; (c) an antibody comprising the polypeptide of SEQ ID NO:61 and the polypeptide of SEQ ID NO:77; (d) an antibody comprising the polypeptide of SEQ ID NO:64 and the polypeptide of SEQ ID NO:80; (e) an antibody comprising the polypeptide of SEQ ID NO:66 and the polypeptide of SEQ ID NO:82; (f) an antibody comprising the polypeptide of SEQ ID NO:68 and the polypeptide of SEQ ID NO:84; and (g) an antibody comprising the polypeptide of SEQ ID NO:70 and the polypeptide
  • the antibody or antigen binding fragment thereof is produced by hybridoma selected from the group consisting of ATCC Deposit Designation PTA- 10664, deposited with the ATCC on February 18, 2010, ATCC Deposit Designation PTA- 10665, deposited with the ATCC on February 18, 2010, ATCC Deposit Deisgnation PTA- 10666, deposited with the ATCC on February 18, 2010, ATCC Deposit Designation PTA- 10667 deposited with the ATCC on February 18, 2010, ATCC Deposit Designation PTA- 10668, deposited with the ATCC on February 18, 2010, ATCC Deposit Designation PTA- 10669, deposited with the ATCC on February 18, 2010, and ATCC Deposit Designation PTA- 10670, deposited with the ATCC on February 18, 2010.
  • the antibody or antigen binding fragment thereof specifically binds to CD37, and the antibody comprises polypeptide sequences selected from the group consisting of: (a) SEQ ID NOs: 4, 5, and 6 and SEQ ID NOs: 28, 29, and 30; (b) SEQ ID NOs: 7, 8, and 9 and SEQ ID NOs: 31, 32, and 33; (c) SEQ ID NOs: 10, 1 1, and 12 and SEQ ID NOs: 34, 35, and 36; (d) SEQ ID NOs: 13, 14, and 15 and SEQ ID NOs: 37, 38, and 39; (e) SEQ ID NOs: 13, 14, and 15 and SEQ ID NOs: 37, 40, and 39; (f) SEQ ID NOs: 16, 17, and 18 and SEQ ID NOs: 41, 42, and 43; (g) SEQ ID NOs: 19, 20, and 21 and SEQ ID NOs: 44, 45, and 46; (h) SEQ ID NOs: 19, 20, and 21 and SEQ ID NOs: 44, 47, and 46
  • the antibody or antigen binding fragment thereof comprises polypeptide sequences that are at least 90% identical , at least 95% identical, at least 99% identical, or identical to polypeptide sequences selected from the group consisting of: (a) SEQ ID NO:55 and SEQ ID NO:72; (b) SEQ ID NO:56 and SEQ ID NO:73; (c) SEQ ID NO:57 and SEQ ID NO:74; (d) SEQ ID NO:58 and SEQ ID NO:74; (e) SEQ ID NO:59 and SEQ ID NO:75; (f) SEQ ID NO:60 and SEQ ID NO: 76; (g) SEQ ID NO:61 and SEQ ID NO: 77; (h) SEQ ID NO: 62 and SEQ ID NO: 78; (i) SEQ ID NO:63 and SEQ ID NO:79; (j) SEQ ID NO:64 and SEQ ID NO:80; (k) SEQ ID NO:65 and SEQ ID NO:81; (1) SEQ ID NO:
  • the antibody or antigen binding fragment thereof is murine, non- human, humanized, chimeric, resurfaced, or human. [0018] In some embodiments, the antibody or antibody fragment is capable of inducing apoptosis of a cell expressing CD37 in vitro in the absence of cross-linking agents. In some embodiments, the antibody or antigen binding fragment is capable of inducing complement dependent cytotoxicity (CDC). In still further embodiments, the antibody or antigen binding fragment is capable of inducing antibody dependent cell mediated cytotoxicity (ADCC).
  • CDC complement dependent cytotoxicity
  • ADCC antibody dependent cell mediated cytotoxicity
  • the antibody or antigen binding fragment thereof is human or humanized, specifically binds to CD37, and is capable of inducing apoptosis of a cell expressing CD37 in vitro in the absence of cross-linking agents.
  • the human or humanized antibody or antigen binding fragment thereof is also capable of inducing complement dependent cytotoxicity (CDC) and/or capable of inducing antibody dependent cell mediated cytotoxicity (ADCC).
  • the antibody or antigen binding fragment thereof binds to human CD37 and macaque CD37.
  • the antibody or antigen binding fragment thereof is a full length antibody or an antigen binding fragment.
  • the antibody or antigen binding fragment thereof can comprise a Fab, Fab', F(ab')2, Fd, single chain Fv or scFv, disulfide linked Fv, V-NAR domain, IgNar, intrabody, IgGACH2, minibody, F(ab')3, tetrabody, triabody, diabody, single-domain antibody, DVD-Ig, Fcab, mAb2, (scFv)2, or scFv-Fc.
  • the CD37-binding agent is a polypeptide that specifically binds CD37, and the polypeptide comprises sequences selected from the group consisting of: (a) SEQ ID NOs: 4, 5, and 6 and SEQ ID NOs: 28, 29, and 30; (b) SEQ ID NOs: 7, 8, and 9 and SEQ ID NOs: 31, 32, and 33; (c) SEQ ID NOs: 10, 1 1, and 12 and SEQ ID NOs: 34, 35, and 36; (d) SEQ ID NOs: 13, 14, and 15 and SEQ ID NOs: 37, 38, and 39; (e) SEQ ID NOs: 13, 14, and 15 and SEQ ID NOs: 37, 40, and 39; (f) SEQ ID NOs: 16, 17, and 18 and SEQ ID NOs: 41, 42, and 43; (g) SEQ ID NOs: 19, 20, and 21 and SEQ ID NOs: 44, 45, and 46; (h) SEQ ID NOs: 19, 20, and 21 and SEQ ID NOs: 44,
  • the CD37-binding agent is a polypeptide that specifically binds CD37
  • the polypetide comprises sequences that are at least 90% identical, at least 95% identical, at least 99% identical, or identical to sequences selected from the group consisting of: (a) SEQ ID NO:55 and SEQ ID NO:72; (b) SEQ ID NO:56 and SEQ ID NO:73; (c) SEQ ID NO:57 and SEQ ID NO:74; (d) SEQ ID NO:58 and SEQ ID NO:74; (e) SEQ ID NO:59 and SEQ ID NO:75; (f) SEQ ID NO:60 and SEQ ID NO: 76; (g) SEQ ID NO:61 and SEQ ID NO: 77; (h) SEQ ID NO: 62 and SEQ ID NO: 78; (i) SEQ ID NO:63 and SEQ ID NO:79; (j) SEQ ID NO:64 and SEQ ID NO:80; (k) SEQ ID NO:65 and SEQ ID NO:72; (b
  • Cells producing the antibody or antigen binding fragment thereof or the polypeptide can also be made and used according to the methods described herein.
  • the methods provide methods of making an antibody or antigen-binding fragment thereof or a polypeptide comprising (a) culturing a cell producing such a CD37-binding agent; and (b) isolating the antibody, antigen-binding fragment thereof, or polypeptide from the cultured cell.
  • the CD37-binding agent is an immunoconjugate having the formula (A) - (L) - (C), wherein: (A) is a CD37-binding agent; (L) is a linker; and (C) is a cytotoxic agent; and wherein the linker (L) links (A) to (C).
  • the CD37-binding agent is an immunoconjugate having the formula (A) - (L) - (C), wherein: (A) is an antibody or antigen binding fragment that specifically binds to CD37; (L) is a non-cleavable linker; and (C) is a cytotoxic agent; and wherein the linker (L) links (A) to (C).
  • the CD37-binding agent is an immunoconjugate having the formula (A) - (L) - (C), wherein: (A) is an antibody or antigen binding fragment that specifically binds to CD37; (L) is a linker; and (C) is a maytansinoid; and wherein the linker (L) links (A) to (C).
  • the immunoconjugate linker can be a non-cleavable linker.
  • the linker can be selected from a group consisting of a cleavable linker, a non-cleavable linker, a hydrophilic linker, and a dicarboxylic acid based linker.
  • the linker can be selected from the group consisting of: N-succinimidyl 4-(2- pyridyldithio)pentanoate (SPP); N-succinimidyl 4-(2-pyridyldithio)butanoate (SPDB) or N-succinimidyl 4-(2-pyridyldithio)-2-sulfobutanoate (sulfo-SPDB); N-succinimidyl 4-(maleimidomethyl) cyclohexanecarboxylate (SMCC); N-sulfosuccinimidyl 4-(maleimidomethyl) cyclohexanecarboxylate (sulfoSMCC); N-succinimidyl-4-(iodoacetyl)-aminobenzoate (SIAB); and N-succinimidyl- [(N- maleimidopropionamido)-tetraethyleneglycol
  • the cytotoxic agent can be selected from the group consisting of a maytansinoid, maytansinoid analog, doxorubicin, a modified doxorubicin, benzodiazepine, taxoid, CC-1065, CC-1065 analog, duocarmycin, duocarmycin analog, calicheamicin, dolastatin, dolastatin analog, aristatin, tomaymycin derivative, and leptomycin derivative or a prodrug of the agent.
  • the cytotoxic agent can be a maytansinoid.
  • the cytotoxic agent can be N(2')-deacetyl-N(2')-(3-mercapto-l-oxopropyl)-maytansine (DM1) or N(2')-deacetyl-N2-(4-mercapto-4-methyl-l-oxopentyl)-maytansine (DM4).
  • a pharmaceutical composition comprising a CD37-binding agent and a pharmaceutically acceptable carrier.
  • the pharmaceutical composition can comprise a second anticancer agent.
  • a diagnostic reagent comprising a CD37-binding agent which is labeled is also provided herein.
  • the label can be selected from the group consisting of a radiolabel, a fluorophore, a chromophore, an imaging agent and a metal ion.
  • kits comprising a CD37-binding agent.
  • the methods described herein include methods for inhibiting the growth of a cell expressing CD37 comprising contacting the cell with a CD37 binding agent or pharmaceutical composition comprising the same.
  • the methods also provide methods for treating a patient having cancer comprising administering to the patient a therapeutically effective amount of a CD37 binding agent or pharmaceutical composition comprising the same to the subject.
  • the methods can comprise administering a second anti-cancer agent to the subject.
  • the second anti-cancer agent can be a chemotherapeutic agent.
  • the cancer can be a cancer selected from the group consisting of B cell lymphomas, NHL, precursor B cell lymphoblastic leukemia/lymphoma and mature B cell neoplasms, B cell chronic lymphocytic leukemia (CLL)/small lymphocytic lymphoma (SLL), B cell prolymphocyte leukemia, lymphoplasmacytic lymphoma, mantle cell lymphoma (MCL), follicular lymphoma (FL), low grade, intermediate-grade and high-grade (FL), cutaneous follicle center lymphoma, marginal zone B cell lymphoma, MALT type marginal zone B cell lymphoma, nodal marginal zone B cell lymphoma, splenic type marginal zone B cell lymphoma, hairy cell leukemia, diffuse large B cell lymphoma, Burkitt's lymphoma, plasmacytoma, plasma cell myeloma, post-transplant lymphoproliferative disorder, Waldenstrom's macro
  • Isolated polynucleotides comprising a sequence that encodes a polypeptide at least 90% identical, at least 95% identical, at least 99% identical, or identical to a sequence selected from the group consisting of SEQ ID NOs: 55-87 are also provided herein.
  • the polynucleotide can comprise a sequence that is at least 90%, at lesat 95% identical, at least 99% identical, or identical to SEQ ID NOs: 121-151.
  • Vectors and host cells comprising such polynucleotides and vectors are also provided herein.
  • Figure 1 depicts the histograms for antibody binding to non-transfected 300-19 control cells (left panels) and CD37-expressing 300-19 cells (right panels). Histograms are shown for staining with 10 nM of muCD37-3, muCD37- 12, muCD37-38 and the absence of primary antibody.
  • Figure 2 depicts the histograms for antibody binding to non-transfected 300-19 control cells (left panels) and CD37-expressing 300-19 cells (right panels). Histograms are shown for staining with 10 nM muCD37-50, muCD37-51, muCD37-56 and muCD37-57.
  • Figure 3 depicts the binding of (A) muCD37-3 and muCD37-12 and (B) muCD37-8, muCD37-10 and muCD37-14 to WSU-DLCL-2 cells as assayed by flow cytometry. Mean fluorescence intensity (MFI) is plotted for each antibody concentration used. The binding curves were used to determine the EC50 of antibody binding, which corresponds to the apparent Kd of each antibody.
  • MFI Mean fluorescence intensity
  • Figure 4 depicts results from an Annexin-V assay to measure induction of apoptosis using Ramos lymphoma cells incubated with a 10 nM concentration of (A) rituximab, muCD37-3, muCD37-8, muCD37-10, muCD37-12 or muCD37- 14 and (B) rituximab, huCD37-3, muCD37-38, muCD37-50, muCD37-51, muCD37-56 or muCD37-57. Control samples of untreated cells in the absence of antibody (no Ab) are used in comparison.
  • Figure 5 depicts the results from WST-8 proliferation assays on SU-DHL-4 lymphoma cells incubated with varying concentrations of muCD37-3, muCD37-38, muCD37-50, muCD37-51 and muCD37-16 antibodies for 5 days.
  • Figure 6 depicts a list of CD37-3 surface residues and substitutions in resurfaced versions for (A) CD37-3 VL and (B) CD37-3 VH.
  • Figure 7 depicts a list of CD37-50 surface residues and substitutions in the resurfaced version for (A) CD37-50 VL and (B) CD37-50 VH.
  • Figure 8 depicts alignments of resurfaced sequences for the CD37-3 and CD37-50 variable region with their murine counterparts: A) CD37-3 light chain variable domain; B) CD37-3 heavy chain variable domain. C) CD37-50 light chain variable domain; D) CD37-50 heavy chain variable domain. Dashes "-" denote identity with the murine sequence.
  • Figure 9 depicts (A) direct binding assays of muCD37-3, chCD37-3, muCD37-12 and chCD37- 12 to Ramos cells as assayed by flow cytometry and (B) competitive binding assays with muCD37-3, chCD37-3, huCD37-3vl.O and huCD37-3 v 1.01 to BJAB cells in the presence of 2 nM concentration of muCD37-3-PE conjugates.
  • Figure 10 depicts binding of anti-CD37 antibodies to 300-19 cells expressing the macaque CD37 antigen as assayed by flow cytometry: (A) binding of muCD37-3, muCD37-12, muCD37-38, muCD37-50, muCD37-51, muCD37-56, muCD37-57, WR17 and TRU-016 and (B) binding of huCD37- 3, huCD37-38, huCD37-50, huCD37-51, huCD37-56 and huCD37-57. The binding curves were used to determine the EC50 of antibody binding, which corresponds to the apparent Kd of each antibody.
  • Figure 1 1 depicts the results from an Annexin-V assay to measure induction of apoptosis on Ramos lymphoma cells incubated with varying concentration of (A) huCD37-3, huCD37-38, huCD37-50 and (B) huCD37-51, huCD37-56, huCD36-57 and rituximab. Control samples of cells treated with a human IgGl isotype control antibody (hulgG control) are used in comparison.
  • Figure 12 depicts the results from WST-8 proliferation assays on (A) SU-DHL-4 and (B) DOHH-2 lymphoma cells incubated with varying concentrations of muCD37-3, chCD37-3, huCD37- 3vl .O and huCD37-3vl .01 antibodies for 5 days.
  • Figure 13 depicts the results from WST-8 proliferation assays on (A) Granta-519 and (B) SU- DHL-4 lymphoma cells incubated with varying concentrations of huCD37-3, TRU-016 or rituximab antibodies for 5 days.
  • Figure 14 depicts the results from CDC assays on Ramos lymphoma cells incubated with (A) huCD37-3, huCD37-38, chCD37- 12 or a hulgGl isotype control antibody and (B) huCD37-38, huCD37- 50, huCD37-51, huCD37-56, huCD37-57, chCD37-12 or a hulgGl isotype control antibody in the presence of 5% human serum as a source of complement.
  • Figure 15 depicts the results from an ADCC assay on Daudi lymphoma cells incubated with (A) huCD37-3, huCD37-38, huCD37-50, TRU-016 and (B) huCD37-51, huCD37-56, huCD37-57, TRU- 016 or a human IgGl isotype control antibody in the presence of purified human NK cells as effector cells.
  • Figure 16 depicts the alignment of the full length murine, human, and macaca CD37 amino acid sequences. Dashes "-" denote identity with the murine sequence. The small and large extracellular domains are marked with underlines.
  • Figure 17 depicts the alignment of the large extracellular domain of human, recombinant and wild type murine, macaca and the chimeric CD37 sequences. Dashes "-" denote identity with the human sequence. The positions of the engineered restriction sites are given and the affected residues are underlined.
  • Figure 18 depicts binding of a panel of CD37 antibodies to cells transfected with (A) human CD37 wildtype and (B) hCD37-M3 variant as assayed by flow cytometry using 1.5 ⁇ g/mL of each antibody.
  • Figure 19 depicts binding of a panel of CD37 antibodies to cells transfected with (A) the hCD37-Ml variant and (B) the hCD37-M45 variant as assayed by flow cytometry using 1.5 ⁇ g/mL of each antibody.
  • Figure 20 depicts binding of (A) huCD37-3 in comparison with huCD37-3-SMCC-DMl huCD37-3-SPP-DMl and huCD37-3-sulfo-mal-DM4 and (B) huCD37-38 in comparison with huCD37- 38-SMCC-DM1 to BJAB cells as assayed by flow cytometry.
  • the binding curves were used to determine the EC50 of antibody or conjugate binding, which corresponds to the apparent Kd of each.
  • Figure 21 depicts the results of (A) an Annexin-V assay to measure induction of apoptosis and (B) the results from a CDC assay. Assays were performed on Ramos lymphoma cells incubated with varying concentrations of the huCD37-3, huCD37-3-SMCC-DMl, hulgGl control antibody, hulgGl- SMCC-DM1 control conjugate, or rituximab. CDC assays were performed in the presence of 5% human serum as a source of complement.
  • Figure 22 depicts the results from ADCC assays on (A) Daudi lymphoma cells incubated with huCD37-3, huCD37-3-SMCC-DMl, huCD37-3-PEG4-mal-DMl, TRU-016 or a hulgGI isotype control antibody and (B) Ramos lymphoma cells incubated with huCD37-3, huCD37-3-SMCC-DMl, huCD37-3- PEG4-mal-DMl or a hulgGI isotype control antibody in the presence of purified human NK cells as effector cells.
  • Figure 23 depicts the results from a cell cycle analysis using propridium iodide staining on (A) BJAB cells and (B) RL cells incubated with huCD37-3, huCD37-3-SMCC-DMl, or a non-binding hulgGI -SMCC-DM1 control conjugate at a 10 nM concentration for 20 hours.
  • Figure 24 depicts the results from a WST-8 cytotoxicity assay on (A) Daudi cells incubated with huCD37-3-SMCC-DMl, huCD37-38-SMCC-DMl, huCD37-50-SMCC-DMl, huCD37-51-SMCC- DM1, huCD37-56-SMCC-DMl, huCD37-57-SMCC-DMl, and (B) Granta-519 cells incubated with huCD37-3-SMCC-DMl, huCD37-38-SMCC-DMl, huCD37-50-SMCC-DMl, huCD37-51-SMCC-DMl, or a non-binding hulgGI -SMCC-DM1 control conjugate at concentrations ranging from 3 x 10 "8 M to 1 x 10 "u M for 5 days.
  • Figure 25 depicts the results of an established xenograft model using BJAB lymphoma cells implanted subcutaneous into SCID mice. Animals were treated once on day 12 post cell inoculation with either 10 mg/kg of (A) huCD37-3 Ab, huCD37-3-SMCC-DMl, huCD37-50 Ab, huCD37-50-SMCC- DM1 or (B) huCD37-38 Ab, huCD37-38-SMCC-DMl, huCD37-56 Ab, huCD37-56-SMCC-DMl . The mean tumor volume of the different treatment groups is plotted against time post tumor cell inoculation.
  • Figure 26 depicts results from an established xenograft study using BJAB lymphoma cells implanted subcutaneous into SCID mice. Animals were treated once on day 9 post cell inoculation with either 10 mg/kg of huCD37-3 Ab, huCD37-3-SMCC-DMl, huCD37-3-sulfo-mal-DM4 or 5 mg/kg of huCD37-3-SPP-DMl . The mean tumor volume of the different treatment groups is plotted against time post tumor cell inoculation.
  • Figure 27 depicts results from an established xenograft model using SU-DHL-4 diffuse large B-cell lymphoma cells implanted subcutaneous into SCID mice. Animals were treated once on day 17 post cell inoculation with either 10 mg/kg of huCD37-3 Ab, huCD37-3-SMCC-DMl, huCD37-3-sulfo- mal-DM4 or 5 mg/kg of huCD37-3-SPP-DMl . The median tumor volume of the different treatment groups is plotted against time post tumor cell inoculation.
  • Figure 28 depicts the results of an established xenograft model using BJAB lymphoma cells implanted subcutaneous into SCID mice. Animals were treated once on day 9 post cell inoculation with either 10 mg/kg of huCD37-3 Ab, huCD37-3-SMCC-DMl or huCD37-3-PEG4-mal-DMl . The mean tumor volume of the different treatment groups is plotted against time post tumor cell inoculation.
  • Figure 29 depicts the results of an established xenograft model using SU-DHL-4 diffuse large B-cell lymphoma cells implanted subcutaneous into SCID mice.
  • mice were treated once on day 15 post cell inoculation with either 10 mg/kg of huCD37-3 Ab, huCD37-3-SMCC-DMl or huCD37-3-PEG4- mal-DMl .
  • the mean tumor volume of the different treatment groups is plotted against time post tumor cell inoculation.
  • Figure 30 depicts the results of an assay using an established xenograft model with DoHH2 follicular B-cell lymphoma cells implanted subcutaneously into SCID mice.
  • Animals were treated starting on day 12 post inoculation with (i) a single dose of 10 mg/kg of huCD37-3 antibody, (ii) a single dose of 10 mg/kg of huCD37-3-SMCC-DMl conjugate, (iii) six doses of 2 mg/kg of Rituximab twice per week for three weeks, (iv) a regimen of a single 40 mg/kg dose of cyclophosphamide and 0.5 mg/kg of vincristine, along with five daily 0.2 mg/kg doses of prednisone (CVP), or (v) a vehicle control.
  • the median tumor volume of the different treatment groups is plotted against time post tumor cell inoculation.
  • Figure 31 depicts the results of an assay an using established xenograft model with JVM3 CLL cells implanted subcutaneous into SCID mice.
  • Animals were treated starting on day 7 post inoculation with (i) a single dose of 10 mg/kg of huCD37-3 antibody, (ii) a 5 mg/kg dose of huCD37-3- SMCC-DM1 conjugate, (iii) a 10 mg/kg dose of huCD37-3-SMCC-DMl conjugate, (iv) six doses of 5 mg/kg of ofatumumab twice per week for three weeks, (v) a single 50 mg/kg dose of bendamustine, or (vi) a vehicle control.
  • the median tumor volume of the different treatment groups is plotted against time post tumor cell inoculation.
  • Figure 32 depicts the CD37 and CD20 expression levels measured in various NHL and CLL tumor cell lines (A) and the in vitro cytotoxicty of huCD37-3-SMCC-DMl measured in these cell lines (B).
  • the present invention provides a new class of CD37 binding molecules having high potency in the following three cytotoxic activities against CD37 expressing (e.g., positive) cells: induction of apoptosis, ADCC, and CDC. Further, immunoconjugates of anti-CD37 antibodies kill CD37 expressing cells unexpectedly well, as demonstrated using in vivo tumor models.
  • CD37 refers to any native CD37, unless otherwise indicated. CD37 is also referred to as GP52-40, leukocyte antigen CD37, and Tetraspanin-26.
  • CD37 encompasses "full-length,” unprocessed CD37 as well as any form of CD37 that results from processing in the cell.
  • the term also encompasses naturally occurring variants of CD37, e.g., splice variants, allelic variants, and isoforms.
  • the CD37 polypeptides described herein can be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods.
  • antibody means an immunoglobulin molecule that recognizes and specifically binds to a target, such as a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing through at least one antigen recognition site within the variable region of the immunoglobulin molecule.
  • an antibody encompasses intact polyclonal antibodies, intact monoclonal antibodies, antibody fragments (such as Fab, Fab', F(ab')2, and Fv fragments), single chain Fv (scFv) mutants, multispecific antibodies such as bispecific antibodies generated from at least two intact antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen determination portion of an antibody, and any other modified immunoglobulin molecule comprising an antigen recognition site so long as the antibodies exhibit the desired biological activity.
  • An antibody can be of any the five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, or subclasses (isotypes) thereof (e.g.
  • IgGl, IgG2, IgG3, IgG4, IgAl and IgA2) based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively.
  • the different classes of immunoglobulins have different and well known subunit structures and three-dimensional configurations.
  • Antibodies can be naked or conjugated to other molecules such as toxins, radioisotopes, etc.
  • a “blocking" antibody or an “antagonist” antibody is one which inhibits or reduces biological activity of the antigen it binds, such as CD37.
  • blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen.
  • the biological activity can be reduced by 10%, 20%, 30%, 50%, 70%, 80%, 90%, 95%, or even 100%.
  • anti-CD37 antibody or "an antibody that binds to CD37” refers to an antibody that is capable of binding CD37 with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting CD37.
  • the extent of binding of an anti-CD37 antibody to an unrelated, non- CD37 protein can be less than about 10% of the binding of the antibody to CD37 as measured, e.g., by a radioimmunoassay (RIA).
  • RIA radioimmunoassay
  • an antibody that binds to CD37 has a dissociation constant (Kd) of ⁇ 1 ⁇ , ⁇ 100 nM, ⁇ 10 nM, ⁇ 1 nM, or ⁇ 0.1 nM.
  • antibody fragment refers to a portion of an intact antibody and refers to the antigenic determining variable regions of an intact antibody.
  • antibody fragments include, but are not limited to Fab, Fab', F(ab')2, and Fv fragments, linear antibodies, single chain antibodies, and multispecific antibodies formed from antibody fragments.
  • a “monoclonal antibody” refers to a homogeneous antibody population involved in the highly specific recognition and binding of a single antigenic determinant, or epitope. This is in contrast to polyclonal antibodies that typically include different antibodies directed against different antigenic determinants.
  • the term “monoclonal antibody” encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab')2, Fv), single chain (scFv) mutants, fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising an antigen recognition site.
  • “monoclonal antibody” refers to such antibodies made in any number of manners including but not limited to by hybridoma, phage selection, recombinant expression, and transgenic animals.
  • humanized antibody refers to forms of non-human (e.g. murine) antibodies that are specific immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal non-human (e.g., murine) sequences.
  • humanized antibodies are human immunoglobulins in which residues from the complementary determining region (CDR) are replaced by residues from the CDR of a non-human species (e.g.
  • the Fv framework region (FR) residues of a human immunoglobulin are replaced with the corresponding residues in an antibody from a non-human species that has the desired specificity, affinity, and capability.
  • the humanized antibody can be further modified by the substitution of additional residues either in the Fv framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability.
  • the humanized antibody will comprise substantially all of at least one, and typically two or three, variable domains containing all or substantially all of the CDR regions that correspond to the non-human immunoglobulin whereas all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
  • the humanized antibody can also comprise at least a portion of an immunoglobulin constant region or domain (Fc), typically that of a human immunoglobulin. Examples of methods used to generate humanized antibodies are described in U.S. Pat. 5,225,539.
  • variable region of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination.
  • the variable regions of the heavy and light chain each consist of four framework regions (FR) connected by three complementarity determining regions (CDRs) also known as hypervariable regions.
  • the CDRs in each chain are held together in close proximity by the FRs and, with the CDRs from the other chain, contribute to the formation of the antigen-binding site of antibodies.
  • There are at least two techniques for determining CDRs (1) an approach based on cross-species sequence variability (i.e., Kabat et al.
  • the Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1- 107 of the light chain and residues 1-1 13 of the heavy chain) (e.g, Kabat et al., Sequences of Immunological Interest. 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
  • the amino acid position numbering as in Kabat refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991). Using this numbering system, the actual linear amino acid sequence can contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain.
  • a heavy chain variable domain can include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g.
  • residues 82a, 82b, and 82c, etc according to Kabat after heavy chain FR residue 82.
  • the Kabat numbering of residues can be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard” Kabat numbered sequence. Chothia refers instead to the location of the structural loops (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)).
  • the end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop (this is because the Kabat numbering scheme places the insertions at H35A and H35B; if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34).
  • the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software.
  • human antibody means an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art. This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and/or antibodies comprising at least one human heavy and/or light chain polypeptide such as, for example, an antibody comprising murine light chain and human heavy chain polypeptides.
  • chimeric antibodies refers to antibodies wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species.
  • the variable region of both light and heavy chains corresponds to the variable region of antibodies derived from one species of mammals (e.g. mouse, rat, rabbit, etc) with the desired specificity, affinity, and capability while the constant regions are homologous to the sequences in antibodies derived from another (usually human) to avoid eliciting an immune response in that species.
  • epitopes or "antigenic determinant” are used interchangeably herein and refer to that portion of an antigen capable of being recognized and specifically bound by a particular antibody.
  • the antigen is a polypeptide
  • epitopes can be formed both from contiguous amino acids and noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained upon protein denaturing, whereas epitopes formed by tertiary folding are typically lost upon protein denaturing.
  • An epitope typically includes at least 3, and more usually, at least 5 or 8- 10 amino acids in a unique spatial conformation.
  • Binding affinity generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
  • the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein.
  • Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high-affinity antibodies generally bind antigen faster and tend to remain bound longer.
  • a variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present invention. Specific illustrative embodiments are described in the following.
  • binding affinity refers to a stronger binding between a molecule and its binding partner.
  • Or better when used herein refers to a stronger binding, represented by a smaller numerical Kd value.
  • an antibody which has an affinity for an antigen of "0.6 nM or better” the antibody's affinity for the antigen is ⁇ 0.6 nM, i.e. 0.59 nM, 0.58 nM, 0.57 nM etc. or any value less than 0.6 nM.
  • an antibody binds to an epitope via its antigen binding domain, and that the binding entails some complementarity between the antigen binding domain and the epitope. According to this definition, an antibody is said to "specifically bind” to an epitope when it binds to that epitope, via its antigen binding domain more readily than it would bind to a random, unrelated epitope.
  • the term “specificity” is used herein to qualify the relative affinity by which a certain antibody binds to a certain epitope.
  • antibody “A” may be deemed to have a higher specificity for a given epitope than antibody "B,” or antibody “A” may be said to bind to epitope “C” with a higher specificity than it has for related epitope “D.”
  • preferentially binds it is meant that the antibody specifically binds to an epitope more readily than it would bind to a related, similar, homologous, or analogous epitope.
  • an antibody which "preferentially binds" to a given epitope would more likely bind to that epitope than to a related epitope, even though such an antibody may cross-react with the related epitope.
  • An antibody is said to "competitively inhibit" binding of a reference antibody to a given epitope if it preferentially binds to that epitope to the extent that it blocks, to some degree, binding of the reference antibody to the epitope.
  • Competitive inhibition may be determined by any method known in the art, for example, competition ELISA assays.
  • An antibody may be said to competitively inhibit binding of the reference antibody to a given epitope by at least 90%, at least 80%, at least 70%, at least 60%, or at least 50%.
  • the phrase "substantially similar,” or “substantially the same”, as used herein, denotes a sufficiently high degree of similarity between two numeric values (generally one associated with an antibody of the invention and the other associated with a reference/comparator antibody) such that one of skill in the art would consider the difference between the two values to be of little or no biological and/or statistical significance within the context of the biological characteristic measured by said values (e.g., Kd values).
  • the difference between said two values can be less than about 50%, less than about 40%, less than about 30%, less than about 20%, or less than about 10% as a function of the value for the reference/comparator antibody.
  • a polypeptide, antibody, polynucleotide, vector, cell, or composition which is "isolated” is a polypeptide, antibody, polynucleotide, vector, cell, or composition which is in a form not found in nature.
  • Isolated polypeptides, antibodies, polynucleotides, vectors, cell or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature.
  • an antibody, polynucleotide, vector, cell, or composition which is isolated is substantially pure.
  • substantially pure refers to material which is at least 50% pure (i.e., free from contaminants), at least 90% pure, at least 95% pure, at least 98% pure, or at least 99% pure.
  • Immunoconjugates can also be defined by the generic formula in reverse order: A-L-C.
  • a "linker” is any chemical moiety that is capable of linking a compound, usually a drug, such as a maytansinoid, to a cell-binding agent such as an anti CD37 antibody or a fragment thereof in a stable, covalent manner.
  • Linkers can be susceptible to or be substantially resistant to acid-induced cleavage, light-induced cleavage, peptidase-induced cleavage, esterase-induced cleavage, and disulfide bond cleavage, at conditions under which the compound or the antibody remains active.
  • Suitable linkers are well known in the art and include, for example, disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups and esterase labile groups. Linkers also include charged linkers, and hydrophilic forms thereof as described herein and know in the art.
  • cancer refers to or describe the physiological condition in mammals in which a population of cells are characterized by unregulated cell growth.
  • examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia.
  • Tumor and “neoplasm” refer to one or more cells that result from excessive cell growth or proliferation, either benign (noncancerous) or malignant (cancerous) including pre-cancerous lesions.
  • B-cell lymphomas including NHL, precursor B-cell lymphoblastic leukemia/lymphoma and mature B-cell neoplasms, such as B-cell chronic lymphocytic leukemia (CLL)/small lymphocytic lymphoma (SLL), B-cell prolymphocytic leukemia, lymphoplasmacytic lymphoma, mantle cell lymphoma (MCL), follicular lymphoma (FL), including low- grade, intermediate-grade and high-grade FL, cutaneous follicle center lymphoma, marginal zone B-cell lymphoma (MALT type, nodal and splenic type), hairy cell leukemia, diffuse large B-cell lymphoma, Burkitt's lymphoma, plasmacytoma, plasma cell myeloma, post-transplant lymphoproliferative disorder, Waldenstrom's macroglobulinemia, and an
  • cancer cell refers to the total population of cells derived from a tumor or a pre-cancerous lesion, including both non-tumorigenic cells, which comprise the bulk of the tumor cell population, and tumorigenic stem cells (cancer stem cells).
  • tumorigenic stem cells cancer stem cells.
  • tumorigenic stem cells cancer stem cells
  • subject refers to any animal (e.g., a mammal), including, but not limited to humans, non-human primates, rodents, and the like, which is to be the recipient of a particular treatment.
  • subject and patient are used interchangeably herein in reference to a human subject.
  • Administration "in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and consecutive administration in any order.
  • composition refers to a preparation which is in such form as to permit the biological activity of the active ingredient to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
  • the formulation can be sterile.
  • an “effective amount” of an antibody as disclosed herein is an amount sufficient to carry out a specifically stated purpose.
  • An “effective amount” can be determined empirically and in a routine manner, in relation to the stated purpose.
  • the term "therapeutically effective amount” refers to an amount of an antibody or other drug effective to "treat” a disease or disorder in a subject or mammal.
  • the therapeutically effective amount of the drug can reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., slow to some extent or stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent or stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the cancer. See the definition herein of "treating”.
  • the drug can prevent growth and/or kill existing cancer cells, it can be cytostatic and/or cytotoxic.
  • prophylactically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
  • label when used herein refers to a detectable compound or composition which is conjugated directly or indirectly to the antibody so as to generate a "labeled" antibody.
  • the label can be detectable by itself (e.g. radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, can catalyze chemical alteration of a substrate compound or composition which is detectable.
  • a "chemotherapeutic agent” is a chemical compound useful in the treatment of cancer, regardless of mechanism of action.
  • Chemotherapeutic agents include, for example, antagonists of CD20 such as Rituximab and cyclophosphamide, doxorubicin, vincristine, predinisone, fludarabine, etoposide, methotrexate, lenalidomide, chlorambucil, bentamustine and/or modified versions of such chemotherapeutics.
  • Terms such as “treating” or “treatment” or “to treat” or “alleviating” or “to alleviate” refer to both 1) therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder and 2) prophylactic or preventative measures that prevent and/or slow the development of a targeted pathologic condition or disorder.
  • those in need of treatment include those already with the disorder; those prone to have the disorder; and those in whom the disorder is to be prevented.
  • a subject is successfully "treated” for cancer according to the methods of the present invention if the patient shows one or more of the following: a reduction in the number of or complete absence of cancer cells; a reduction in the tumor size; inhibition of or an absence of cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibition of or an absence of tumor metastasis; inhibition or an absence of tumor growth; relief of one or more symptoms associated with the specific cancer; reduced morbidity and mortality; improvement in quality of life; reduction in tumorigenicity, tumorgenic frequency, or tumorgenic capacity, of a tumor; reduction in the number or frequency of cancer stem cells in a tumor; differentiation of tumorigenic cells to a non-tumorigenic state; or some combination of effects.
  • Polynucleotide or “nucleic acid,” as used interchangeably herein, refer to polymers of nucleotides of any length, and include DNA and RNA.
  • the nucleotides can be deoxyribonucleotides, ribonucleotides, modified nucleotides or bases, and/or their analogs, or any substrate that can be incorporated into a polymer by DNA or RNA polymerase.
  • a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and their analogs. If present, modification to the nucleotide structure can be imparted before or after assembly of the polymer.
  • the sequence of nucleotides can be interrupted by non-nucleotide components.
  • a polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component.
  • Other types of modifications include, for example, "caps", substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as, for example, those with uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoamidates, cabamates, etc.) and with charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), those containing pendant moieties, such as, for example, proteins (e.g., nucleases, toxins, antibodies, signal peptides, ply-L-lysine, etc.), those with intercalators (e.g., acridine, psoralen, etc.), those containing chelators (e.g
  • any of the hydroxyl groups ordinarily present in the sugars can be replaced, for example, by phosphonate groups, phosphate groups, protected by standard protecting groups, or activated to prepare additional linkages to additional nucleotides, or can be conjugated to solid supports.
  • the 5' and 3' terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of from 1 to 20 carbon atoms.
  • Other hydroxyls can also be derivatized to standard protecting groups.
  • Polynucleotides can also contain analogous forms of ribose or deoxyribose sugars that are generally known in the art, including, for example, 2'-0-methyl-, 2'-0-allyl, 2'-fluoro- or 2'-azido-ribose, carbocyclic sugar analogs, .alpha.-anomeric sugars, epimeric sugars such as arabinose, xyloses or lyxoses, pyranose sugars, furanose sugars, sedoheptuloses, acyclic analogs and abasic nucleoside analogs such as methyl riboside.
  • One or more phosphodiester linkages can be replaced by alternative linking groups.
  • linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(0)S ("thioate”), P(S)S ("dithioate”), "(0)NR 2 ("amidate”), P(0)R, P(0)OR, CO or CH 2 ("formacetal”), in which each R or R is independently H or substituted or unsubstituted alkyl (1-20 C) optionally containing an ether (-0—) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. The preceding description applies to all polynucleotides referred to herein, including RNA and DNA.
  • vector means a construct, which is capable of delivering, and optionally expressing, one or more gene(s) or sequence(s) of interest in a host cell.
  • vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, DNA or RNA expression vectors encapsulated in liposomes, and certain eukaryotic cells, such as producer cells.
  • polypeptide polypeptide
  • peptide protein
  • the terms “polypeptide,” “peptide,” and “protein” are used interchangeably herein to refer to polymers of amino acids of any length.
  • the polymer can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids.
  • the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
  • polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
  • the polypeptides of this invention are based upon antibodies, in certain embodiments, the polypeptides can occur as single chains or associated chains.
  • nucleic acids or polypeptides refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity.
  • the percent identity can be measured using sequence comparison software or algorithms or by visual inspection.
  • sequence comparison software or algorithms or by visual inspection.
  • Various algorithms and software are known in the art that can be used to obtain alignments of amino acid or nucleotide sequences.
  • One such non- limiting example of a sequence alignment algorithm is the algorithm described in Karlin et al, 1990, Proc. Natl. Acad.
  • Gapped BLAST can be used as described in Altschul et al., 1997, Nucleic Acids Res. 25:3389-3402.
  • BLAST-2 Altschul et al., 1996, Methods in Enzymology, 266:460-480
  • ALIGN ALIGN-2
  • Megalign Megalign
  • the percent identity between two nucleotide sequences is determined using the GAP program in GCG software (e.g., using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 90 and a length weight of 1, 2, 3, 4, 5, or 6).
  • the GAP program in the GCG software package which incorporates the algorithm of Needleman and Wunsch (J.
  • Mol. Biol. (48):444-453 (1970)) can be used to determine the percent identity between two amino acid sequences (e.g., using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5).
  • the percent identity between nucleotide or amino acid sequences is determined using the algorithm of Myers and Miller (CABIOS, 4: 11- 17 (1989)).
  • the percent identity can be determined using the ALIGN program (version 2.0) and using a PAM120 with residue table, a gap length penalty of 12 and a gap penalty of 4.
  • Appropriate parameters for maximal alignment by particular alignment software can be determined by one skilled in the art.
  • the default parameters of the alignment software are used.
  • the percentage identity "X" of a first amino acid sequence to a second sequence amino acid is calculated as 100 x (Y/Z), where Y is the number of amino acid residues scored as identical matches in the alignment of the first and second sequences (as aligned by visual inspection or a particular sequence alignment program) and Z is the total number of residues in the second sequence. If the length of a first sequence is longer than the second sequence, the percent identity of the first sequence to the second sequence will be longer than the percent identity of the second sequence to the first sequence.
  • whether any particular polynucleotide has a certain percentage sequence identity can, in certain embodiments, be determined using the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, WI 5371 1). Bestfit uses the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2: 482 489 (1981), to find the best segment of homology between two sequences.
  • the parameters are set such that the percentage of identity is calculated over the full length of the reference nucleotide sequence and that gaps in homology of up to 5% of the total number of nucleotides in the reference sequence are allowed.
  • two nucleic acids or polypeptides of the invention are substantially identical, meaning they have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, and in some embodiments at least 95%, 96%, 97%, 98%, 99% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection.
  • Identity can exist over a region of the sequences that is at least about 10, about 20, about 40-60 residues in length or any integral value therebetween, and can be over a longer region than 60-80 residues, for example, at least about 90-100 residues, and in some embodiments, the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a nucleotide sequence for example.
  • a "conservative amino acid substitution” is one in which one amino acid residue is replaced with another amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
  • basic side chains e
  • substitution of a phenylalanine for a tyrosine is a conservative substitution.
  • conservative substitutions in the sequences of the polypeptides and antibodies of the invention do not abrogate the binding of the polypeptide or antibody containing the amino acid sequence, to the antigen(s), i.e., the CD37 to which the polypeptide or antibody binds.
  • Methods of identifying nucleotide and amino acid conservative substitutions which do not eliminate antigen binding are well- known in the art (see, e.g., Brummell et al., Biochem. 32: 1 180-1 187 (1993); Kobayashi et al. Protein Eng. 12(10):879-884 (1999); and Burks et al. Proc. Natl. Acad. Sci. USA 94:.412-417 (1997)).
  • CD37 binding agents agents that specifically bind CD37. These agents are referred to herein as "CD37 binding agents.”
  • the full-length amino acid sequences for human, macaca, and murine CD37 are known in the art and also provided herein as represented by SEQ ID NOs: l-3, respectively.
  • Macaca CD37 [0119] Macaca CD37:
  • Murine CD37 (NP 031671):
  • the CD37 binding agents are antibodies, immunoconjugates or polypeptides. In some embodiments, the CD37 binding agents are humanized antibodies.
  • the CD37-binding agents have one or more of the following effects: inhibit proliferation of tumor cells, reduce the tumorigenicity of a tumor by reducing the frequency of cancer stem cells in the tumor, inhibit tumor growth, increase survival, trigger cell death of tumor cells, differentiate tumorigenic cells to a non-tumorigenic state, or prevent metastasis of tumor cells.
  • the CD37-binding agents are capable of inducing complement dependent cytotoxicity.
  • treatment of cells with the CD37-binding agents can result in CDC activity that reduces cell viability to less than about 80%, less than about 70%, less than about 60%, less than about 50%, less than about 40% or less than about 35% of the cell viability of untreated cells.
  • Treatment of cells with the CD37-binding agents can also result in CDC activity that reduces cell viability to about 70-80%, about 60-70%, about 50-60%, about 40-50%, or about 30-40% of the cell viability of untreated cells.
  • the CD37-binding agents are capable of inducing complement dependent cytotoxicity in Ramos cells.
  • the CD37-binding agents are capable of inducing antibody dependent cell mediated cytotoxicity (ADCC).
  • ADCC antibody dependent cell mediated cytotoxicity
  • treatment of cells with the CD37-binding agents can result in ADCC activity that produces at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, or at least about 60% cell lysis.
  • Treatment of cells with the CD37-binding agents can result in ADCC activity that produces about 10-20%, about 20-30%, about 30-40%, or about 40-50% cell lysis.
  • Treatment of cells with the CD37-binding agents can also result in ADCC activity that produces about 10-50%, about 20- 50%, about 30-50%, or about 40-50% cell lysis.
  • the CD37-binding agents are capable of inducing ADCC in Daudi, Ramos, and/or Granata-519 cells.
  • the CD37-binding agents are capable of inducing apoptosis.
  • treatment of cells with the CD37-binding agents can induce apoptosis in at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, or at least about 55% of cells.
  • the CD37- binding agents are capable of inducing apoptosis in Ramos cells and/or Raji cells.
  • the CD37-binding agents are capable of reducing tumor volume.
  • the ability of a CD37-binding agent to reduce tumor volume can be assessed, for example, by measuring a %T/C value, which is the median tumor volume of treated subjects divided by the median tumor volume of the control subjects.
  • treatment with a CD37-binding agent results in a %T/C value that is less than about 55%, less than about 50%, less than about 45%, less than about 40%, less than about 35%, less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, or less than about 5%.
  • the CD37-binding agents can reduce tumor size in a BJAB xenograft model and/or a SU-DHL-4 xenograft model.
  • immunoconjugates or other agents that specifically bind human CD37 trigger cell death via a cytotoxic agent.
  • an antibody to a human CD37 antibody is conjugated to a maytansinoid that is activated in tumor cells expressing the CD37 by protein internalization.
  • the agent or antibody is not conjugated.
  • the CD37-binding agents are capable of inhibiting tumor growth. In certain embodiments, the CD37-binding agents are capable of inhibiting tumor growth in vivo (e.g., in a xenograft mouse model and/or in a human having cancer).
  • the CD37-binding agents include CD37 antibodies CD37-3, CD37-12, CD37-38, CD37-50, CD37-51, CD37-56 and CD37-57 and fragments, variants and derivatives thereof.
  • the CD37-binding agents also include CD37-binding agents that specifically bind to the same CD37 epitope as an antibody selected from the group consisting of CD37-3, CD37- 12, CD37-38, CD37-50, CD37-51, CD37-56 and CD37-57.
  • the CD37-binding agents also include CD37-binding agents that competitively inhibit an antibody selected from the group consisting of CD37-3, CD37-12, CD37-38, CD37-50, CD37-51, CD37- 56 and CD37-57.
  • the binding of the CD37-binding agents to CD37 does not require human CD37 amino acids 109- 138.
  • some CD37-binding agents bind to a polypeptide comprising the amino acid sequence of SEQ ID NO: 180.
  • the binding of the CD37- binding agents to CD37 is disrupted by mutation of human CD37 amino acids 202-243.
  • some CD37-binding agents do not bind to a polypeptide comprising the amino acid sequence of SEQ ID NO: 184.
  • the CD37-binding agents bind to a polypeptide of SEQ ID NO: 180 and to a polypeptide of SEQ ID NO: 183, but do not bind to a polypeptide of SEQ ID NO: 184.
  • the CD37-binding agents bind to a polypeptide of SEQ ID NO: 190. In some embodiments, the CD37-binding agents bind to a polypeptide of SEQ ID NO: 190 and a polypeptide of SEQ ID NO: 189. In some embodiments, the CD37-binding agents bind to a polypeptide of SEQ ID NO: 190 and a polypeptide of SEQ ID NO: 188.
  • the CD37-binding agent binds to a polypeptide of SEQ ID NO: 192, but does not bind to a polypeptide of SEQ ID NO: 194. In some embodiments, the CD37-binding agent binds to a polypeptide of SEQ ID NO: 193, but does not bind to a polypeptide of SEQ ID NO: 194.
  • CD37 peptide fragments to which certain CD37-binding agents bind to include, but are not limited to, CD37 fragments comprising, consisting essentially of, or consisting of amino acids 200-243 of SEQ ID NO: 1, amino acids 202-220 or SEQ ID NO: 1, or amino acids 221-243 of SEQ ID NO: l .
  • the CD37-binding agent is specifically binds to a human CD37 epitope comprising amino acids 202-243 of SEQ ID NO: l .
  • the binding of the CD37-binding agent to CD37 requires amino acids 202-243 of SEQ ID NO: l .
  • the binding of the CD37- binding agent to CD37 requires amino acids 200-220 of SEQ ID NO: l . In some embodiments, the binding of the CD37-binding agent to CD37 requires amino acids 221-243 of SEQ ID NO: l .
  • the CD37-binding agents also include CD37-binding agents that comprise the heavy and light chain CDR sequences of CD37-3, CD37-12, CD37-38, CD37-50, CD37-51, CD37-56 or CD37-57.
  • the heavy and light chain CDRs of CD37-38, CD37-50, CD37-51, CD37-56 and CD37-57 contain related sequences. Therefore, the CD-37 binding agents can also comprise heavy and light chain CDR sequences that comprise a consensus sequence obtained by the alignment of CD37-38, CD37-50, CD37-51, CD37-
  • CD37-57 The CDR sequences of CD37-3, CD37- 12, CD37-38, CD37-50, CD37-51, CD37-56 and CD37-57, as well as the consensus sequence of CD37-38, CD37-50, CD37-51, CD37-56 and CD37-57
  • the CD37 binding molecules can be antibodies or antigen binding fragments that specifically bind to CD37 that comprise the CDRs of CD37-3, CD37-12, CD37-50, CD37-51, CD37-56, or CD37-57 with up to four (i.e. 0, 1, 2, 3, or 4) conservative amino acid substitutions per CDR.
  • Polypeptides an comprise one of the individual variable light chains or variable heavy chains described herein.
  • Antibodies and polypeptides can also comprise both a variable light chain and a variable heavy chain.
  • the variable light chain and variable heavy chain sequences of murine, chimeric, and humanized CD37-3, CD37- 12, CD37-50, CD37-51, CD37-56, and CD37-57 antibodies are provided in Tables 3 and 4 below.
  • muCD37-56 DVQLQESGPDLVKPSQSLSLTCTVTGYSITSGFAWHWIRQFPGNKLEWMGY
  • NLADGVPSRFSGSGSGTQYSLKINSLQSEDFGTYYCQHYWGTTWTFGGGTK LEIKR (SEQ ID NO:72)
  • HWGQGTLVTVSA (SEQ ID NO: 74)
  • polypeptides that comprise: (a) a polypeptide having at least about 90% sequence identity to SEQ ID NOs:55-71 ; and/or (b) a polypeptide having at least about 90% sequence identity to SEQ ID NOs:72-87.
  • the polypeptide comprises a polypeptide having at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to SEQ ID NOs:55-87.
  • the polypeptide comprises (a) a polypeptide having at least about 95% sequence identity to SEQ ID NOs:55-71, and/or (b) a polypeptide having at least about 95% sequence identity to SEQ ID NOs:72-87.
  • the polypeptide comprises (a) a polypeptide having the amino acid sequence of SEQ ID NOs:55-71 ; and/or (b) a polypeptide having the amino acid sequence of SEQ ID NOs:72-87.
  • the polypeptide is an antibody and/or the polypeptide specifically binds CD37.
  • the polypeptide is a murine, chimeric, or humanized antibody that specifically binds CD37.
  • the polypeptide having a certain percentage of sequence identity to SEQ ID NOs:55-87 differs from SEQ ID NOs:55-87 by conservative amino acid substitutions only.
  • Polypeptides can comprise one of the individual light chains or heavy chains described herein. Antibodies and polypeptides can also comprise both a light chain and a heavy chain.
  • the light chain and variable chain sequences of murine, chimeric, and humanized CD37-3, CD37- 12, CD37-50, CD37-51, CD37-56, and CD37-57 antibodies are provided in Tables 5 and 6 below.
  • VVDVSEDDPDVQISWFVN VEVHTAQTQTHREDYNSTLRVVSALPIQHQD
  • KKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK (SEQ ID NO:92) chCD37-12 QIQLVQSGPELKKPGETVKISCKASGYTFTKYGMNWVKQAQGKGLKWMG
  • DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (SEQ ID NO:93) muCD37-38 DVQLQESGPDLVKPSQSLSLTCTVTGYSITSGFGWHWIRQFPGNKLEWMAY
  • VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID NO:95) huCD37-38 QVQLQESGPGLVKPSQSLSLTCTVSGYSITSGFGWHWIRQFPGKGLEWMAYI
  • VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID NO:96) muCD37-50 DVQLQESGPDLLKPSQSLSLTCTVTGYSITSGFAWHWIRQFPGNKLEWMGYI
  • VEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK (SEQ ID NO:97) huCD37-50 QVQLQESGPGLLKPSQSLSLTCTVSGYSITSGFAWHWIRQHPGNKLEWMGY
  • VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID NO:98) muCD37-51 DVQLQESGPDLLKPSQSLSLTCTVTGYSISSGFAWHWIRQFPGNKLEWMGYI
  • VVVDVSEDDPDVQISWFVN VEVHTAQTQTHREDYNSTLRVVSALPIQHQD
  • KKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK (SEQ ID NO:99) huCD37-51 EVQLVESGPEVLKPGESLSLTCTVSGYSISSGFAWHWIRQFPGKGLEWMGYI
  • VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID NO: 100) muCD37-56 DVQLQESGPDLVKPSQSLSLTCTVTGYSITSGFAWHWIRQFPGNKLEWMGY
  • TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID NO: 102) muCD37-57 DVQLQESGPDLLKPSQSLSLTCTVTGYSITSGFAWHWIRQFPGNKLEWMGYI
  • VEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK (SEQ ID NO: 103) huCD37-57 QVQLQESGPGLLKPSQSLSLTCTVSGYSITSGFAWHWIRQFPGKGLEWMGYI
  • VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 1044
  • polypeptides that comprise: (a) a polypeptide having at least about 90% sequence identity to SEQ ID NOs:88-104; and/or (b) a polypeptide having at least about 90% sequence identity to SEQ ID NOs: 105- 120.
  • the polypeptide comprises a polypeptide having at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% sequence identity to SEQ ID NOs:88-120.
  • the polypeptide comprises (a) a polypeptide having at least about 95% sequence identity to SEQ ID NOs:88-104, and/or (b) a polypeptide having at least about 95% sequence identity to SEQ ID NOs: 105-120.
  • the polypeptide comprises (a) a polypeptide having the amino acid sequence of SEQ ID NOs:88-104; and/or (b) a polypeptide having the amino acid sequence of SEQ ID NOs: 105- 120.
  • the polypeptide is an antibody and/or the polypeptide specifically binds CD37.
  • the polypeptide is a murine, chimeric, or humanized antibody that specifically binds CD37.
  • the polypeptide having a certain percentage of sequence identity to SEQ ID NOs:88-120 differs from SEQ ID NOs:88-120 by conservative amino acid substitutions only.
  • the CD37 antibody can be the antibody produced from a hybridoma selected from the group consisting of consisting of ATCC Deposit Designation PTA- 10664, deposited with the ATCC on February 18, 2010, ATCC Deposit Designation PTA- 10665, deposited with the ATCC on February 18, 2010, ATCC Deposit Deisgnation PTA- 10666, deposited with the ATCC on February 18, 2010, ATCC Deposit Designation PTA- 10667 deposited with the ATCC on February 18, 2010, ATCC Deposit Designation PTA- 10668, deposited with the ATCC on February 18, 2010, ATCC Deposit Designation PTA- 10669, deposited with the ATCC on February 18, 2010, and ATCC Deposit Designation PTA- 10670, deposited with the ATCC on February 18, 2010 (ATCC at 10801 University Boulevard, Manassas, Virginia 20110).
  • the antibody comprises the VH-CDRs and the VL-CDRS of the antibody produced from a hydridoma selected from the group consisting of PTA- 10665, PTA- 10666, PTA- 10667, PTA- 10668, PTA- 10669, and PTA- 10670.
  • the CD37 antibody can comprise a light chain encoded by the recombinant plasmid DNA phuCD37-3LC (ATCC Deposit Designation PTA- 10722, deposited with the ATCC on March 18, 2010). In certain embodiments, the CD37 antibody can comprise a heavy chain encoded by the recombinant plasmid DNA phuCD37-3HCv. l .O (ATCC Deposit Designation PTA- 10723, deposited with the ATCC on March 18, 2010).
  • the CD37 antibody can comprise a light chain encoded by the recombinant plasmid DNA phuCD37-3LC (PTA- 10722) and a heavy chain encoded by the recombinant plasmid DNA phuCD37-3HCv. l .O (PTA- 10723).
  • the CD37 antibody can comprise the VL-CDRs encoded by the recombinant plasmid DNA phuCD37-3LC (PTA- 10722) and the VH-CDRs encoded by the recombinant plasmid DNA phuCD37-3HCv. l .O (PTA- 10723).
  • Monoclonal antibodies can be prepared using hybridoma methods, such as those described by Kohler and Milstein (1975) Nature 256:495. Using the hybridoma method, a mouse, hamster, or other appropriate host animal, is immunized as described above to elicit the production by lymphocytes of antibodies that will specifically bind to an immunizing antigen. Lymphocytes can also be immunized in vitro. Following immunization, the lymphocytes are isolated and fused with a suitable myeloma cell line using, for example, polyethylene glycol, to form hybridoma cells that can then be selected away from unfused lymphocytes and myeloma cells.
  • a suitable myeloma cell line using, for example, polyethylene glycol
  • Hybridomas that produce monoclonal antibodies directed specifically against a chosen antigen as determined by immunoprecipitation, immunoblotting, or by an in vitro binding assay e.g. radioimmunoassay (RIA); enzyme-linked immunosorbent assay (ELISA)
  • an in vitro binding assay e.g. radioimmunoassay (RIA); enzyme-linked immunosorbent assay (ELISA)
  • RIA radioimmunoassay
  • ELISA enzyme-linked immunosorbent assay
  • monoclonal antibodies can also be made using recombinant DNA methods as described in U.S. Patent 4,816,567.
  • the polynucleotides encoding a monoclonal antibody are isolated from mature B-cells or hybridoma cell, such as by RT-PCR using oligonucleotide primers that specifically amplify the genes encoding the heavy and light chains of the antibody, and their sequence is determined using conventional procedures.
  • the isolated polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors, which when transfected into host cells such as E.
  • monoclonal antibodies are generated by the host cells.
  • recombinant monoclonal antibodies or fragments thereof of the desired species can be isolated from phage display libraries expressing CDRs of the desired species as described (McCafferty et al., 1990, Nature, 348:552- 554; Clackson et al., 1991, Nature, 352:624-628; and Marks et al., 1991, J. Mol. Biol., 222:581-597).
  • the polynucleotide(s) encoding a monoclonal antibody can further be modified in a number of different manners using recombinant DNA technology to generate alternative antibodies.
  • the constant domains of the light and heavy chains of, for example, a mouse monoclonal antibody can be substituted 1) for those regions of, for example, a human antibody to generate a chimeric antibody or 2) for a non-immunoglobulin polypeptide to generate a fusion antibody.
  • the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody. Site-directed or high-density mutagenesis of the variable region can be used to optimize specificity, affinity, etc.
  • the monoclonal antibody against the human CD37 is a humanized antibody.
  • such antibodies are used therapeutically to reduce antigenicity and HAMA (human anti-mouse antibody) responses when administered to a human subject.
  • Humanized antibodies can be produced using various techniques known in the art.
  • the antibody to CD37 is a human antibody.
  • Human antibodies can be directly prepared using various techniques known in the art. Immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produce an antibody directed against a target antigen can be generated (See, e.g., Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boemer et al., 1991, J. Immunol., 147 (1):86- 95; and U.S. Patent 5,750,373). Also, the human antibody can be selected from a phage library, where that phage library expresses human antibodies, as described, for example, in Vaughan et al., 1996, Nat.
  • Humanized antibodies can also be made in transgenic mice containing human immunoglobulin loci that are capable upon immunization of producing the full repertoire of human antibodies in the absence of endogenous immunoglobulin production. This approach is described in U.S. Patents 5,545,807; 5,545,806; 5,569,825; 5,625, 126; 5,633,425; and 5,661,016.
  • This invention also encompasses bispecific antibodies that specifically recognize a CD37.
  • Bispecific antibodies are antibodies that are capable of specifically recognizing and binding at least two different epitopes.
  • the different epitopes can either be within the same molecule (e.g. the same CD37) or on different molecules such that both, for example, the antibodies can specifically recognize and bind a CD37 as well as, for example, 1) an effector molecule on a leukocyte such as a T-cell receptor (e.g. CD3) or Fc receptor (e.g. CD64, CD32, or CD 16) or 2) a cytotoxic agent as described in detail below.
  • T-cell receptor e.g. CD3
  • Fc receptor e.g. CD64, CD32, or CD 16
  • bispecific antibodies can bind to two different epitopes, at least one of which originates in a polypeptide of the invention.
  • an anti-antigenic arm of an immunoglobulin molecule can be combined with an arm which binds to a triggering molecule on a leukocyte such as a T cell receptor molecule (e.g. CD2, CD3, CD28, or B7), or Fc receptors for IgG so as to focus cellular defense mechanisms to the cell expressing the particular antigen.
  • Bispecific antibodies can also be used to direct cytotoxic agents to cells which express a particular antigen.
  • bispecific antibodies possess an antigen- binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA.
  • a cytotoxic agent or a radionuclide chelator such as EOTUBE, DPTA, DOTA, or TETA.
  • Techniques for making bispecific antibodies are common in the art (Millstein et al., 1983, Nature 305:537-539; Brennan et al., 1985, Science 229:81 ; Suresh et al, 1986, Methods in Enzymol. 121 : 120; Traunecker et al., 1991, EMBO J. 10:3655-3659; Shalaby et al., 1992, J. Exp. Med. 175:217-225; Kostelny et al., 1992, J.
  • Antibodies with more than two valencies are also contemplated.
  • trispecific antibodies can be prepared (Tutt et al., J. Immunol. 147:60 (1991)).
  • the antibodies to CD37 are multispecific.
  • an antibody fragment to, for example, increase tumor penetration.
  • Various techniques are known for the production of antibody fragments. Traditionally, these fragments are derived via proteolytic digestion of intact antibodies (for example Morimoto et al., 1993, Journal of Biochemical and Biophysical Methods 24: 107-1 17; Brennan et al., 1985, Science, 229:81).
  • antibody fragments are produced recombinantly. Fab, Fv, and scFv antibody fragments can all be expressed in and secreted from E. coli or other host cells, thus allowing the production of large amounts of these fragments.
  • Such antibody fragments can also be isolated from the antibody phage libraries discussed above.
  • the antibody fragment can also be linear antibodies as described in U.S. Patent 5,641,870, for example, and can be monospecific or bispecific. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
  • Antibody fragments can be produced by techniques in the art including, but not limited to: (a) a F(ab')2 fragment produced by pepsin digestion of an antibody molecule; (b) a Fab fragment generated by reducing the disulfide bridges of an F(ab')2 fragment, (c) a Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent, and (d) Fv fragments.
  • Heteroconjugate antibodies are also within the scope of the present invention.
  • Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune cells to unwanted cells (U.S. Pat. No. 4,676,980).
  • the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents.
  • immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate.
  • modified antibodies can comprise any type of variable region that provides for the association of the antibody with the polypeptides of a human CD37.
  • the variable region can comprise or be derived from any type of mammal that can be induced to mount a humoral response and generate immunoglobulins against the desired tumor associated antigen.
  • the variable region of the modified antibodies can be, for example, of human, murine, non-human primate (e.g. cynomolgus monkeys, macaques, etc.) or lupine origin. In some embodiments both the variable and constant regions of the modified immunoglobulins are human.
  • variable regions of compatible antibodies can be engineered or specifically tailored to improve the binding properties or reduce the immunogenicity of the molecule.
  • variable regions useful in the present invention can be humanized or otherwise altered through the inclusion of imported amino acid sequences.
  • variable domains in both the heavy and light chains are altered by at least partial replacement of one or more CDRs and, if necessary, by partial framework region replacement and sequence changing.
  • the CDRs can be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived from an antibody of different class and possibly from an antibody from a different species. It is not alway necessary to replace all of the CDRs with the complete CDRs from the donor variable region to transfer the antigen binding capacity of one variable domain to another. Rather, in some cases it is only necessary to transfer those residues that are necessary to maintain the activity of the antigen binding site. Given the explanations set forth in U.S. Pat. Nos. 5,585,089, 5,693,761 and 5,693,762, it will be well within the competence of those skilled in the art, either by carrying out routine experimentation or by trial and error testing to obtain a functional antibody with reduced immunogenicity.
  • the modified antibodies of this invention will comprise antibodies (e.g., full-length antibodies or immunoreactive fragments thereof) in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as increased tumor localization or reduced serum half-life when compared with an antibody of approximately the same immunogenicity comprising a native or unaltered constant region.
  • the constant region of the modified antibodies will comprise a human constant region.
  • Modifications to the constant region compatible with this invention comprise additions, deletions or substitutions of one or more amino acids in one or more domains.
  • the modified antibodies disclosed herein can comprise alterations or modifications to one or more of the three heavy chain constant domains (CHI, CH2 or CH3) and/or to the light chain constant domain (CL).
  • modified constant regions wherein one or more domains are partially or entirely deleted are contemplated.
  • the modified antibodies will comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed (ACH2 constructs).
  • the omitted constant region domain will be replaced by a short amino acid spacer (e.g. 10 residues) that provides some of the molecular flexibility typically imparted by the absent constant region.
  • the constant region mediates several effector functions.
  • binding of the CI component of complement to antibodies activates the complement system.
  • Activation of complement is important in the opsonisation and lysis of cell pathogens.
  • the activation of complement also stimulates the inflammatory response and can also be involved in autoimmune hypersensitivity.
  • antibodies bind to cells via the Fc region, with a Fc receptor site on the antibody Fc region binding to a Fc receptor (FcR) on a cell.
  • Fc receptors There are a number of Fc receptors which are specific for different classes of antibody, including IgG (gamma receptors), IgE (eta receptors), IgA (alpha receptors) and IgM (mu receptors).
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • the CD37-binding antibodies provide for altered effector functions that, in turn, affect the biological profile of the administered antibody.
  • the deletion or inactivation (through point mutations or other means) of a constant region domain can reduce Fc receptor binding of the circulating modified antibody thereby increasing tumor localization.
  • constant region modifications consistent with this invention, moderate complement binding and thus reduce the serum half life and nonspecific association of a conjugated cytotoxin.
  • modifications of the constant region can be used to eliminate disulfide linkages or oligosaccharide moieties that allow for enhanced localization due to increased antigen specificity or antibody flexibility.
  • modifications to the constant region in accordance with this invention can easily be made using well known biochemical or molecular engineering techniques well within the purview of the skilled artisan.
  • a CD37-binding agent that is an antibody does not have one or more effector functions.
  • the antibody has no antibody-dependent cellular cytotoxicity (ADCC) activity and/or no complement-dependent cytotoxicity (CDC) activity.
  • ADCC antibody-dependent cellular cytotoxicity
  • CDC complement-dependent cytotoxicity
  • the antibody does not bind to an Fc receptor and/or complement factors.
  • the antibody has no effector function.
  • the modified antibodies can be engineered to fuse the CH3 domain directly to the hinge region of the respective modified antibodies. In other constructs it can be desirable to provide a peptide spacer between the hinge region and the modified CH2 and/or CH3 domains.
  • compatible constructs could be expressed wherein the CH2 domain has been deleted and the remaining CH3 domain (modified or unmodified) is joined to the hinge region with a 5-20 amino acid spacer.
  • a spacer can be added, for instance, to ensure that the regulatory elements of the constant domain remain free and accessible or that the hinge region remains flexible.
  • amino acid spacers can, in some cases, prove to be immunogenic and elicit an unwanted immune response against the construct. Accordingly, in certain embodiments, any spacer added to the construct will be relatively non-immunogenic, or even omitted altogether, so as to maintain the desired biochemical qualities of the modified antibodies.
  • the antibodies of the present invention can be provided by the partial deletion or substitution of a few or even a single amino acid.
  • the mutation of a single amino acid in selected areas of the CH2 domain can be enough to substantially reduce Fc binding and thereby increase tumor localization.
  • Such partial deletions of the constant regions can improve selected characteristics of the antibody (serum half-life) while leaving other desirable functions associated with the subject constant region domain intact.
  • the constant regions of the disclosed antibodies can be modified through the mutation or substitution of one or more amino acids that enhances the profile of the resulting construct.
  • a conserved binding site e.g. Fc binding
  • Certain embodiments can comprise the addition of one or more amino acids to the constant region to enhance desirable characteristics such as decreasing or increasing effector function or provide for more cytotoxin or carbohydrate attachment. In such embodiments it can be desirable to insert or replicate specific sequences derived from selected constant region domains.
  • the present invention further embraces variants and equivalents which are substantially homologous to the chimeric, humanized and human antibodies, or antibody fragments thereof, set forth herein.
  • These can contain, for example, conservative substitution mutations, i.e. the substitution of one or more amino acids by similar amino acids.
  • conservative substitution refers to the substitution of an amino acid with another within the same general class such as, for example, one acidic amino acid with another acidic amino acid, one basic amino acid with another basic amino acid or one neutral amino acid by another neutral amino acid. What is intended by a conservative amino acid substitution is well known in the art.
  • polypeptides of the present invention can be recombinant polypeptides, natural polypeptides, or synthetic polypeptides comprising an antibody, or fragment thereof, against a human CD37. It will be recognized in the art that some amino acid sequences of the invention can be varied without significant effect of the structure or function of the protein. Thus, the invention further includes variations of the polypeptides which show substantial activity or which include regions of an antibody, or fragment thereof, against CD37 protein. Such mutants include deletions, insertions, inversions, repeats, and type substitutions.
  • polypeptides and analogs can be further modified to contain additional chemical moieties not normally part of the protein.
  • Those derivatized moieties can improve the solubility, the biological half life or absorption of the protein.
  • the moieties can also reduce or eliminate any desirable side effects of the proteins and the like. An overview for those moieties can be found in REMINGTON'S PHARMACEUTICAL SCIENCES, 20th ed., Mack Publishing Co., Easton, PA (2000).
  • the isolated polypeptides described herein can be produced by any suitable method known in the art. Such methods range from direct protein synthetic methods to constructing a DNA sequence encoding isolated polypeptide sequences and expressing those sequences in a suitable transformed host.
  • a DNA sequence is constructed using recombinant technology by isolating or synthesizing a DNA sequence encoding a wild-type protein of interest.
  • the sequence can be mutagenized by site-specific mutagenesis to provide functional analogs thereof. See, e.g. Zoeller et al., Proc. Nat'l. Acad. Sci. USA 81 :5662-5066 (1984) and U.S. Pat. No. 4,588,585.
  • a DNA sequence encoding a polypeptide of interest would be constructed by chemical synthesis using an oligonucleotide synthesizer.
  • Such oligonucleotides can be designed based on the amino acid sequence of the desired polypeptide and selecting those codons that are favored in the host cell in which the recombinant polypeptide of interest will be produced. Standard methods can be applied to synthesize an isolated polynucleotide sequence encoding an isolated polypeptide of interest. For example, a complete amino acid sequence can be used to construct a back- translated gene.
  • a DNA oligomer containing a nucleotide sequence coding for the particular isolated polypeptide can be synthesized. For example, several small oligonucleotides coding for portions of the desired polypeptide can be synthesized and then ligated. The individual oligonucleotides typically contain 5' or 3' overhangs for complementary assembly.
  • the polynucleotide sequences encoding a particular isolated polypeptide of interest will be inserted into an expression vector and operatively linked to an expression control sequence appropriate for expression of the protein in a desired host. Proper assembly can be confirmed by nucleotide sequencing, restriction mapping, and expression of a biologically active polypeptide in a suitable host. As is well known in the art, in order to obtain high expression levels of a transfected gene in a host, the gene must be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
  • recombinant expression vectors are used to amplify and express DNA encoding antibodies, or fragments thereof, against human CD37.
  • Recombinant expression vectors are replicable DNA constructs which have synthetic or cDNA-derived DNA fragments encoding a polypeptide chain of an anti-CD37 antibody, or fragment thereof, operatively linked to suitable transcriptional or translational regulatory elements derived from mammalian, microbial, viral or insect genes.
  • a transcriptional unit generally comprises an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, transcriptional promoters or enhancers, (2) a structural or coding sequence which is transcribed into mRNA and translated into protein, and (3) appropriate transcription and translation initiation and termination sequences, as described in detail below.
  • Such regulatory elements can include an operator sequence to control transcription.
  • the ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants can additionally be incorporated.
  • DNA regions are operatively linked when they are functionally related to each other.
  • DNA for a signal peptide is operatively linked to DNA for a polypeptide if it is expressed as a precursor which participates in the secretion of the polypeptide; a promoter is operatively linked to a coding sequence if it controls the transcription of the sequence; or a ribosome binding site is operatively linked to a coding sequence if it is positioned so as to permit translation.
  • Structural elements intended for use in yeast expression systems include a leader sequence enabling extracellular secretion of translated protein by a host cell.
  • recombinant protein is expressed without a leader or transport sequence, it can include an N-terminal methionine residue. This residue can optionally be subsequently cleaved from the expressed recombinant protein to provide a final product.
  • Useful expression vectors for eukaryotic hosts include, for example, vectors comprising expression control sequences from SV40, bovine papilloma virus, adenovirus and cytomegalovirus.
  • Useful expression vectors for bacterial hosts include known bacterial plasmids, such as plasmids from Esherichia coli, including pCR 1, pBR322, pMB9 and their derivatives, wider host range plasmids, such as Ml 3 and filamentous single-stranded DNA phages.
  • Suitable host cells for expression of a CD37-binding polypeptide or antibody include prokaryotes, yeast, insect or higher eukaryotic cells under the control of appropriate promoters.
  • Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli.
  • Higher eukaryotic cells include established cell lines of mammalian origin as described below. Cell- free translation systems could also be employed.
  • Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described by Pouwels et al.
  • Suitable mammalian host cell lines include the COS-7 lines of monkey kidney cells, described by Gluzman (Cell 23: 175, 1981), and other cell lines capable of expressing an appropriate vector including, for example, L cells, C127, 3T3, Chinese hamster ovary (CHO), HeLa and BHK cell lines.
  • Mammalian expression vectors can comprise nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5' or 3' flanking nontranscribed sequences, and 5' or 3' nontranslated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
  • nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5' or 3' flanking nontranscribed sequences, and 5' or 3' nontranslated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
  • the proteins produced by a transformed host can be purified according to any suitable method.
  • standard methods include chromatography (e.g., ion exchange, affinity and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for protein purification.
  • Affinity tags such as hexahistidine, maltose binding domain, influenza coat sequence and glutathione-S-transferase can be attached to the protein to allow easy purification by passage over an appropriate affinity column.
  • Isolated proteins can also be physically characterized using such techniques as proteolysis, nuclear magnetic resonance and x-ray crystallography.
  • supernatants from systems which secrete recombinant protein into culture media can be first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. Following the concentration step, the concentrate can be applied to a suitable purification matrix.
  • a suitable purification matrix for example, an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups.
  • the matrices can be acrylamide, agarose, dextran, cellulose or other types commonly employed in protein purification.
  • a cation exchange step can be employed. Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups.
  • RP-HPLC reversed-phase high performance liquid chromatography
  • hydrophobic RP-HPLC media e.g., silica gel having pendant methyl or other aliphatic groups
  • Recombinant protein produced in bacterial culture can be isolated, for example, by initial extraction from cell pellets, followed by one or more concentration, salting-out, aqueous ion exchange or size exclusion chromatography steps. High performance liquid chromatography (HPLC) can be employed for final purification steps.
  • Microbial cells employed in expression of a recombinant protein can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
  • Methods known in the art for purifying antibodies and other proteins also include, for example, those described in U.S. Patent Publication No. 2008/0312425, 2008/0177048, and 2009/0187005, each of which is hereby incorporated by reference herein in its entirety.
  • the CD37-binding agent is a polypeptide that is not an antibody.
  • a variety of methods for identifying and producing non-antibody polypeptides that bind with high affinity to a protein target are known in the art. See, e.g., Skerra, Curr. Opin. Biotechnol., 18:295-304 (2007), Hosse et al., Protein Science, 15: 14-27 (2006), Gill et al., Curr. Opin. Biotechnol., 17:653-658 (2006), Nygren, FEBS J., 275:2668-76 (2008), and Skerra, FEBS J., 275:2677-83 (2008), each of which is incorporated by reference herein in its entirety.
  • phage display technology has been used to identify/produce the CD37-binding polypeptide.
  • the polypeptide comprises a protein scaffold of a type selected from the group consisting of protein A, a lipocalin, a fibronectin domain, an ankyrin consensus repeat domain, and thioredoxin.
  • the agent is a non-protein molecule.
  • the agent is a small molecule.
  • Combinatorial chemistry libraries and techniques useful in the identification of nonprotein CD37-binding agents are known to those skilled in the art. See, e.g., Kennedy et al., J. Comb. Chem, 10:345-354 (2008), Dolle et al, J. Comb. Chem., 9:855-902 (2007), and Bhattacharyya, Curr. Med. Chem., 8: 1383-404 (2001), each of which is incorporated by reference herein in its entirety.
  • the agent is a carbohydrate, a glycosaminoglycan, a glycoprotein, or a proteoglycan.
  • the agent is a nucleic acid aptamer.
  • Aptamers are polynucleotide molecules that have been selected (e.g., from random or mutagenized pools) on the basis of their ability to bind to another molecule.
  • the aptamer comprises a DNA polynucleotide.
  • the aptamer comprises an RNA polynucleotide.
  • the aptamer comprises one or more modified nucleic acid residues.
  • the present invention is also directed to conjugates (also referred to herein as immunoconjugates), comprising the anti-CD37 antibodies, antibody fragments, and their functional equivalents as disclosed herein, linked or conjugated to a drug or prodrug.
  • Suitable drugs or prodrugs are known in the art.
  • the drugs or prodrugs can be cytotoxic agents.
  • the cytotoxic agent used in the cytotoxic conjugate of the present invention can be any compound that results in the death of a cell, or induces cell death, or in some manner decreases cell viability, and includes, for example, maytansinoids and maytansinoid analogs.
  • cytotoxic agents are for example benzodiazepines, taxoids, CC- 1065 and CC- 1065 analogs, duocarmycins and duocarmycin analogs, enediynes, such as calicheamicins, dolastatin and dolastatin analogs including auristatins, tomaymycin derivaties, leptomycin derivaties, methotrexate, cisplatin, carboplatin, daunorubicin, doxorubicin, vincristine, vinblastine, melphalan, mitomycin C, chlorambucil and morpholino doxorubicin.
  • Such conjugates can be prepared by using a linking group in order to link a drug or prodrug to the antibody or functional equivalent.
  • Suitable linking groups are well known in the art and include, for example, disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups and esterase labile groups.
  • the drug or prodrug can, for example, be linked to the anti-CD37 antibody or fragment thereof through a disulfide bond.
  • the linker molecule or crosslinking agent comprises a reactive chemical group that can react with the anti-CD37 antibody or fragment thereof.
  • the reactive chemical groups for reaction with the cell-binding agent can be N-succinimidyl esters and N-sulfosuccinimidyl esters.
  • the linker molecule comprises a reactive chemical group, which can be a dithiopyridyl group that can react with the drug to form a disulfide bond.
  • Linker molecules include, for example, N- succinimidyl 3-(2-pyridyldithio) propionate (SPDP) (see, e.g., Carlsson et al., Biochem. J., 173: 723-737 (1978)), N-succinimidyl 4-(2-pyridyldithio)butanoate (SPDB) (see, e.g., U.S. Patent No. 4,563,304), N- succinimidyl 4-(2-pyridyldithio)2-sulfobutanoate (sulfo-SPDB) (see US Publication No.
  • SPDP N- succinimidyl 3-(2-pyridyldithio) propionate
  • SPDB N-succinimidyl 4-(2-pyridyldithio)butanoate
  • sulfo-SPDB N- succinimidyl 4-(2-pyridyldithio)
  • N-succinimidyl 4-(2-pyridyldithio) pentanoate SPP
  • 2- iminothiolane 2- iminothiolane
  • acetylsuccinic anhydride the antibody or cell binding agent can be modified with crosslinking reagents and the antibody or cell binding agent containing free or protected thiol groups thus derived is then reacted with a disulfide- or thiol-containing maytansinoid to produce conjugates.
  • the conjugates can be purified by chromatography, including but not limited to HPLC, size- exclusion, adsorption, ion exchange and affinity capture, dialysis or tangential flow filtration.
  • the anti-CD37 antibody is linked to cytotoxic drugs via disulfide bonds and a polyethylene glycol spacer in enhancing the potency, solubility or the efficacy of the immunoconjugate.
  • cleavable hydrophilic linkers are described in WO2009/0134976.
  • the additional benefit of this linker design is the desired high monomer ratio and the minimal aggregation of the antibody-drug conjugate.
  • CB represents an anti-CD37 antibody or fragment
  • D represents a drug
  • X represents an aliphatic, an aromatic or a heterocyclic unit attached to the cell-binding agent via a thioether bond, an amide bond, a carbamate bond, or an ether bond;
  • Y represents an aliphatic, an aromatic or a heterocyclic unit attached to the drug via a disulfide bond
  • l is O or l ;
  • m is an integer from 2 to 8.
  • n is an integer from 1 to 24.
  • m is an integer from 2 to 6.
  • m is an integer from 3 to 5.
  • n is an integer form 2 to 8.
  • the drug can be first modified to introduce a reactive ester suitable to react with a cell-binding agent. Reaction of these drugs containing an activated linker moiety with a cell-binding agent provides another method of producing a cell-binding agent drug conjugate. Maytansinoids can also be linked to anti-CD37 antibody or fragment using PEG linking groups, as set forth for example in U.S. Patent 6,716,821.
  • PEG non-cleavable linking groups are soluble both in water and in non-aqueous solvents, and can be used to join one or more cytotoxic agents to a cell binding agent.
  • Exemplary PEG linking groups include heterobifunctional PEG linkers that react with cytotoxic agents and cell binding agents at opposite ends of the linkers through a functional sulfhydryl or disulfide group at one end, and an active ester at the other end.
  • Synthesis begins with the reaction of one or more cytotoxic agents bearing a reactive PEG moiety with a cell-binding agent, resulting in displacement of the terminal active ester of each reactive PEG moiety by an amino acid residue of the cell binding agent, to yield a cytotoxic conjugate comprising one or more cytotoxic agents covalently bonded to a cell binding agent through a PEG linking group.
  • the cell binding can be modified with the bifunctional PEG crosslinker to introduce a reactive disulfide moiety (such as a pyridyldisulfide), which can then be treated with a thiol-containing maytansinoid to provide a conjugate.
  • the cell binding can be modified with the bifunctional PEG crosslinker to introduce a thiol moiety which can then can be treated with a reactive disulfide-containing maytansinoid (such as a pyridyldisulfide), to provide a conjugate.
  • a reactive disulfide-containing maytansinoid such as a pyridyldisulfide
  • Antibody-maytansinoid conjugates with non-cleavable links can also be prepared.
  • Such crosslinkers are described in the art (see US Publication No. 20050169933) and include but are not limited to, N-succinimidyl 4-(maleimidomethyl) cyclohexanecarboxylate (SMCC).
  • the antibody is modified with crosslinking reagents such as succinimidyl 4-(N-maleimidomethyl)- cyclohexane- 1 -carboxylate (SMCC), sulfo-SMCC, maleimidobenzoyl-N-hydroxysuccinimide ester (MBS), sulfo-MBS or succinimidyl-iodoacetate, as described in the literature, to introduce 1-10 reactive groups (Yoshitake et al, Eur. J. Biochem., 101 :395-399 (1979); Hashida et al, J.
  • crosslinking reagents such as succinimidyl 4-(N-maleimidomethyl)- cyclohexane- 1 -carboxylate (SMCC), sulfo-SMCC, maleimidobenzoyl-N-hydroxysuccinimide ester (MBS), sulfo-MBS or succinimidyl-iodoacetate,
  • the modified antibody is then reacted with the thiol- containing maytansinoid derivative to produce a conjugate.
  • the conjugate can be purified by gel filtration through a Sephadex G25 column or by dialysis or tangential flow filtration.
  • the modified antibodies are treated with the thiol-containing maytansinoid (1 to 2 molar equivalent/maleimido group) and antibody- maytansinoid conjugates are purified by gel filtration through a Sephadex G-25 column, chromatography on a ceramic hydroxyapatite column, dialysis or tangential flow filtration or a combination of methods thereof.
  • an average of 1 - 10 maytansinoids per antibody are linked.
  • One method is to modify antibodies with succinimidyl 4-(N-maleimidomethyl)-cyclohexane-l -carboxylate (SMCC) to introduce maleimido groups followed by reaction of the modified antibody with a thiol-containing maytansinoid to give a thioether-linked conjugate.
  • SMCC succinimidyl 4-(N-maleimidomethyl)-cyclohexane-l -carboxylate
  • thiol-containing maytansinoid to give a thioether-linked conjugate.
  • Maytansinoid conjugates of antibodies, antibody fragments, and other proteins are made in the same way.
  • the CD37 antibody is linked to the drug via a non- cleavable bond through the intermediacy of a PEG spacer.
  • Suitable crosslinking reagents comprising hydrophilic PEG chains that form linkers between a drug and the anti-CD37 antibody or fragment are also well known in the art, or are commercially available (for example from Quanta Biodesign, Powell, Ohio).
  • Suitable PEG-containing crosslinkers can also be synthesized from commercially available PEGs themselves using standard synthetic chemistry techniques known to one skilled in the art.
  • the drugs can be reacted with bifunctional PEG-containing cross linkers to give compounds of the following formula, Z by methods described in detail in US Patent Publication 20090274713 and in WO2009/0134976, which can then react with the cell binding agent to provide a conjugate.
  • the cell binding can be modified with the bifunctional PEG crosslmker to introduce a thiol- reactive group (such as a maleimide or haloacetamide) which can then be treated with a thiol-containing maytansinoid to provide a conjugate.
  • a thiol- reactive group such as a maleimide or haloacetamide
  • the cell binding can be modified with the bifunctional PEG crosslmker to introduce a thiol moiety which can then be treated with a thiol-reactive maytansinoid (such as a maytansinoid bearing a maleimide or haloacetamide), to provide a conjugate.
  • a thiol-reactive maytansinoid such as a maytansinoid bearing a maleimide or haloacetamide
  • Another aspect of the present invention is an anti-CD37 antibody drug conjugate of formula (II) or of formula (IV):
  • CB represents an anti-CD37 antibody or fragment
  • [0200] D represents a drug
  • X represents an aliphatic, an aromatic or a heterocyclic unit bonded to the cell4 nding agent via a thioether bond, an amide bond, a carbamate bond, or an ether bond;
  • Y represents an aliphatic, an aromatic, or a heterocyclic unit bonded to the drug via a covalent bond selected from the group consisting of a thioether bond, an amide bond, a carbamate bond, an ether bond, an amine bond, a carbon-carbon bond and a hydrazone bond;
  • [0203] 1 is 0 or 1 ;
  • p is 0 or 1 ;
  • m is an integer from 2 to 15;
  • n is an integer from 1 to 2000.
  • n is an integer from 2 to 8.
  • n is an integer from 1 to 24.
  • m is an integer from 2 to 6.
  • m is an integer from 3 to 5.
  • n is an integer from 2 to 8.
  • suitable PEG-containin; linkers include linkers having an N-succinimidyl ester or N-sulfosuccinimidyl ester moiety for reaction with the anti-CD37 antibody or fragment thereof, as well as a maleimido- or haloacetyl-based moiety for reaction with the compound.
  • a PEG spacer can be incorporated into any crosslmker known in the art by the methods described herein.
  • Many of the linkers disclosed herein are described in detail in U.S. Patent Publication Nos. 20050169933 and 20090274713, and in WO2009/0134976; the contents of which are entirely incorporated herein by reference.
  • the present invention includes aspects wherein about 2 to about 8 drug molecules ("drug load”), for example, maytansinoid, are linked to an anti-CD37 antibody or fragment thereof, the antitumor effect of the conjugate is much more efficacious as compared to a drug load of a lesser or higher number of drugs linked to the same cell binding agent.
  • drug load refers to the number of drug molecules (e.g., a maytansinoid) that can be attached to a cell binding agent (e.g., an anti-CD37 antibody or fragment thereof).
  • the number of drug molecules that can be attached to a cell binding agent can average from about 2 to about 8 (e.g., 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1).
  • N 2' -deacetyl-N 2' -(3-mercapto-l-oxopropyl)-maytansine (DM1) and N 2' -deacetyl-N 2' - (4-mercapto-4-methyl- 1 -oxopentyl) maytansine (DM4) can be used.
  • an immunocongugate comprises 1 maytansinoid per antibody. In another aspect, an immunocongugate comprises 2 maytansinoids per antibody. In another aspect, an immunocongugate comprises 3 maytansinoids per antibody. In another aspect, an immunocongugate comprises 4 maytansinoids per antibody. In another aspect, an immunocongugate comprises 5 maytansinoids per antibody. In another aspect, an immunocongugate comprises 6 maytansinoids per antibody. In another aspect, an immunocongugate comprises 7 maytansinoids per antibody. In another aspect, an immunocongugate comprises 8 maytansinoids per antibody.
  • an immunoconjugate comprises about 1 to about 8 maytansinoids per antibody. In another aspect, an immunoconjugate comprises about 2 to about 7 maytansinoids per antibody. In another aspect, an immunoconjugate comprises about 2 to about 6 maytansinoids per antibody. In another aspect, an immunoconjugate comprises about 2 to about 5 maytansinoids per antibody. In another aspect, an immunoconjugate comprises about 3 to about 5 maytansinoids per antibody. In another aspect, an immunoconjugate comprises about 3 to about 4 maytansinoids per antibody.
  • a composition comprising immunoconjugates has an average of about 2 to about 8 (e.g., 1.9, 2.0, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4.0, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1) drug molecules (e.g., maytansinoids) attached per antibody.
  • drug molecules e.g., maytansinoids
  • a composition comprising immunoconjugates has an average of about 1 to about 8 drug molecules (e.g., maytansinoids) per antibody. In one aspect, a composition comprising immunoconjugates has an average of about 2 to about 7 drug molecules (e.g., maytansinoids) per antibody. In one aspect, a composition comprising immunoconjugates has an average of about 2 to about 6 drug molecules (e.g., maytansinoids) per antibody. In one aspect, a composition comprising immunoconjugates has an average of about 2 to about 5 drug molecules (e.g., maytansinoids) per antibody.
  • a composition comprising immunoconjugates has an average of about 3 to about 5 drug molecules (e.g., maytansinoids) per antibody. In one aspect, a composition comprising immunoconjugates has an average of about 3 to about 4 drug molecules (e.g., maytansinoids) per antibody.
  • a composition comprising immunoconjugates has an average of about 2 ⁇ 0.5, about 3 ⁇ 0.5, about 4 ⁇ 0.5, about 5 ⁇ 0.5, about 6 ⁇ 0.5, about 7 ⁇ 0.5, or about 8 ⁇ 0.5 drug molecules (e.g., maytansinoids) attached per antibody.
  • a composition comprising immunoconjugates has an average of about 3.5 ⁇ 0.5 drug molecules (e.g., maytansinoids) per antibody.
  • the anti-CD37 antibody or fragment thereof can be modified by reacting a bifunctional crosslinking reagent with the anti-CD37 antibody or fragment thereof, thereby resulting in the covalent attachment of a linker molecule to the anti-CD37 antibody or fragment thereof.
  • a "bifunctional crosslinking reagent” is any chemical moiety that covalently links a cell-binding agent to a drug, such as the drugs described herein.
  • a portion of the linking moiety is provided by the drug.
  • the drug comprises a linking moiety that is part of a larger linker molecule that is used to join the cell-binding agent to the drug.
  • the side chain at the C-3 hydroxyl group of maytansine is modified to have a free sulfhydryl group (SH).
  • This thiolated form of maytansine can react with a modified cell-binding agent to form a conjugate. Therefore, the final linker is assembled from two components, one of which is provided by the crosslinking reagent, while the other is provided by the side chain from DM1.
  • the drug molecules can also be linked to the antibody molecules through an intermediary carrier molecule such as serum albumin.
  • an intermediary carrier molecule such as serum albumin.
  • the expression "linked to a cell-binding agent” or “linked to an anti-CD37 antibody or fragment” refers to the conjugate molecule comprising at least one drug derivative bound to a cell-binding agent anti-CD37 antibody or fragment via a suitable linking group, or a precursor thereof.
  • One linking group is SMCC.
  • cytotoxic agents useful in the present invention are maytansinoids and maytansinoid analogs.
  • suitable maytansinoids include esters of maytansinol and maytansinol analogs. Included are any drugs that inhibit microtubule formation and that are highly toxic to mammalian cells, as are maytansinol and maytansinol analogs.
  • suitable maytansinol esters include those having a modified aromatic ring and those having modifications at other positions.
  • Such suitable maytansinoids are disclosed in U.S. Patent Nos. 4,424,219; 4,256,746; 4,294,757; 4,307,016; 4,313,946; 4,315,929; 4,331,598; 4,361,650; 4,362,663; 4,364,866; 4,450,254; 4,322,348; 4,371,533; 5,208,020; 5,416,064; 5,475,092; 5,585,499; 5,846,545; 6,333,410; 7,276,497 and 7,473,796.
  • the immunoconjugates of the invention utilize the thiol-containing maytansinoid (DM1), formally termed N 2 -deacetyl-N 2 -(3-mercapto- l- oxopropyl)-maytansine, as the cytotoxic agent.
  • DM1 thiol-containing maytansinoid
  • the conjugates of the present invention utilize the thiol-containing maytansinoid N 2 -deacetyl-N 2 (4-methyl-4-mercapto- l- oxopentyl)-maytansine (e.g., DM4) as the cytotoxic agent.
  • DM4 is re resented by the following structural formula (IV):
  • N 2 -deacetyl-N- 2 (4-mercapto- 1 -oxopentyl)-maytansine (termed DM3), represented by the following structural formula (V):
  • maytansinoids can serve as the position to chemically link the linking moiety.
  • the C-3 position having a hydroxyl group, the C-14 position modified with hydroxymethyl, the C- 15 position modified with hydroxy and the C-20 position having a hydroxy group are all expected to be useful.
  • the C-3 position serves as the position to chemically link the linking moiety
  • the C-3 position of maytansinol serves as the position to chemically link the linking moiety.
  • a solution of an antibody in aqueous buffer can be incubated with a molar excess of maytansinoids having a disulfide moiety that bears a reactive group.
  • the reaction mixture can be quenched by addition of excess amine (such as ethanolamine, taurine, etc.).
  • the maytansinoid-antibody conjugate can then be purified by gel filtration.
  • the number of maytansinoid molecules bound per antibody molecule can be determined by measuring spectrophotometrically the ratio of the absorbance at 252 nm and 280 nm.
  • the average number of maytansinoid molecules/antibody can be, for example, about 1- 10, 2-5, 3-4, or about 3.5. In one aspect, the average number of maytansinoid molecules/antibody is about 3.5 ⁇ 0.5.
  • Anthracycline compounds as well as derivatives, intermediates and modified versions thereof, can also be used to prepare anti-CD37 immunoconjugates.
  • doxorubicin, doxorubicin derivatives, doxorubicin intermediates, and modified doxorubicins can be used in anti-CD37 conjugates.
  • Exemplary compounds are described in WO 2010/009124, which is herein incorporated by reference in its entirety. Such compounds include, for example, compounds of the following formula:
  • Ri is a hydrogen atom, hydroxy or methoxy group and R 2 is a Ci-C 3 alkoxy group, or a pharmaceutically acceptable salt thereof.
  • Conjugates of antibodies with maytansinoid or other drugs can be evaluated for their ability to suppress proliferation of various unwanted cell lines in vitro.
  • cell lines such as the human lymphoma cell line Daudi and the human lymphoma cell line Ramos, can easily be used for the assessment of cytotoxicity of these compounds.
  • Cells to be evaluated can be exposed to the compounds for 4 to 5 days and the surviving fractions of cells measured in direct assays by known methods. IC 50 values can then be calculated from the results of the assays.
  • the immunoconjugates can, according to some embodiments described herein, be internalized into cells.
  • the immunocongugate therefore, can exert a therapeutic effect when it is taken up by, or internalized, by a CD37-expressing cell.
  • the immunoconjugate comprises an antibody, antibody fragment, or polypeptide, linked to a cytotoxic agent by a cleavable linker, and the cytotoxic agent is cleaved from the antibody, antibody fragment, or polypeptide, wherein it is internalized by a CD37-expressing cell.
  • the immunoconjugates are capable of reducing tumor volume.
  • treatment with an immunoconjugate results in a %T/C value that is less than about 50%, less than about 45%, less than about 40%, less than about 35%, less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, or less than about 5%.
  • the immunoconjugates can reduce tumor size in a BJAB xenograft model and/or a SU-DHL-4 xenograft model.
  • siRNA molecules can be linked to the antibodies of the present invention instead of a drug.
  • siRNAs can be linked to the antibodies of the present invention by methods commonly used for the modification of oligonucleotides (see, for example, US Patent Publications 20050107325 and 20070213292).
  • the siRNA in its 3' or 5'-phosphoromidite form can be reacted with one end of the crosslinker bearing a hydroxyl functionality to give an ester bond between the siRNA and the crosslinker.
  • reaction of the siRNA phosphoramidite with a crosslinker bearing a terminal amino group results in linkage of the crosslinker to the siRNA through an amine.
  • the siRNA can be derivatized by standard chemical methods to introduce a thiol group.
  • This thiol-containing siRNA can be reacted with an antibody, that has been modified to introduce an active disulfide or maleimide moiety, to produce a cleavable or non cleavable conjugate.
  • an antibody that has been modified to introduce an active disulfide or maleimide moiety, to produce a cleavable or non cleavable conjugate.
  • an antibody that has been modified to introduce an active disulfide or maleimide moiety
  • the invention encompasses polynucleotides comprising polynucleotides that encode a polypeptide that specifically binds CD37 or a fragment of such a polypeptide.
  • the invention provides a polynucleotide comprising a nucleic acid sequence that encodes an antibody to a human CD37 or encodes a fragment of such an antibody.
  • the polynucleotides of the invention can be in the form of RNA or in the form of DNA.
  • DNA includes cDNA, genomic DNA, and synthetic DNA; and can be double-stranded or single-stranded, and if single stranded can be the coding strand or non-coding (anti-sense) strand.
  • the polynucleotides are isolated. In certain embodiments, the polynucleotides are substantially pure.
  • the invention provides a polynucleotide comprising a polynucleotide encoding a polypeptide comprising a sequence selected from the group consisting of SEQ ID NOs:4-120.
  • the invention further provides a polynucleotide comprising a sequence selected from those shown in Tables 7- 10 below.
  • muCD37-3 caggtgcaggtgaaggagtcaggacctggcctggtggcgccctcacagagcctgtccattacatgcactg
  • muCD37-12 cagatccagttggtgcagtctggacctgagctgaagaagcctggagagacagtcaagatctcctgcaagg
  • chCD37- 12 aagcttgccaccatggggtggtcatgcataatcctctttctggtcgctactgctaccggtgtgcactcacagattcagctgg ttcaaagtggcccagagctgaaaaagccaggggaaacagtgaaaataagttgcaaggcatccggttacactttcacaaa gtacggcatgaactgggtcaagcaggcccagggcaaggggctcaaatggatgggttggatcaataccaacactggcg agtctaggaatgctgaggagtttaagggccggtttgccttcagcctggagacaagtgccagcagcttacctgcaaatc aatc aacag
  • muCD37-38 gatgtgcagcttcaggagtcaggacctgacctggtgaaaccttctcagtcactttcactcacctgcactg
  • chCD37-38 aagcttgccaccatgggctggagttgtatcattctgtttttggtggtggccaccgccactggagtccattcccaagtgcaactcc aggaatctggccctgacctggttaagccatctcagagcctctccctgacctgcactgttacaggatactcaatcacatcag gctttggctggcactggatcagacaatttcccgggaacaagttggaatggatggcttacattctgtatagcgggggtaccg attacaatccttccctcaagagccgaatctctatcaccagggatacaagcaagaaccaattttttctccgctgtg actaccgaagataccgctacttactattg
  • muCD37-51 gatgtgcagcttcaggagtcaggacctgacctgttgaaaccttctcagtcactttcactcacctgcactg
  • muCD37-38 caaattgttctcacccagtctccagcaatcatgtctgcatctccaggggagaaggtcaccatgacctgca
  • muCD37-50 caaattgttctcacccagtctccagcaatcatgtctgcatctccaggggagaaggtcaccatgacctgca
  • muCD37-56 caaattgttctcacccagtctccagcattcatgtctgcatctccaggggataaggtcaccatgacctgca
  • muCD37-57 caaattgttctcacccagtctccagcaatcatgtctgcatctccaggggagaaggtcaccatgacctgca
  • polypeptide comprises (a) a polypeptide having at least about 95% sequence identity to SEQ ID NOs: 121-135 or 152-161, and/or (b) a polypeptide having at least about 95% sequence identity to SEQ ID NOs: 136-151 or 162-170.
  • the polypeptide comprises (a) a polypeptide having the amino acid sequence of SEQ ID NOs: 121-135 or 152-161 ; and/or (b) a polypeptide having the amino acid sequence of SEQ ID NOs: 136-151 or 162-170.
  • the polynucleotide encodes the light chain encoded by the recombinant plasmid DNA phuCD37-3LC (ATCC Deposit Designation PTA- 10722, deposited with the ATCC on March 18, 2010) or a light chain that is at least about 85%, at least about 90%, at least about 95%, or at least about 99% to the light chain encoded by phuCD37-3LC (PTA- 10722).
  • the polynucleotide encodes the heavy chain encoded by the recombinant plasmid DNA phuCD37-3HCv.1.0 (ATCC Deposit Designation PTA- 10723, deposited with the ATCC on March 18, 2010) or a heavy chain that is at least about 85%, at lesat about 90%, at least about 95%, or at least about 99% identical to the heavy chain encoded by phuCD37-3HCv. l .O (PTA- 10723).
  • the polynucleotide is the recombinant plasmid DNA phuCD37-3LC (PTA- 10722) or the recombinant plasmid phuCD37- 3HCv. l .O (PTA- 10723).
  • the polynucleotides comprise the coding sequence for the mature polypeptide fused in the same reading frame to a polynucleotide which aids, for example, in expression and secretion of a polypeptide from a host cell (e.g. a leader sequence which functions as a secretory sequence for controlling transport of a polypeptide from the cell).
  • the polypeptide having a leader sequence is a preprotein and can have the leader sequence cleaved by the host cell to form the mature form of the polypeptide.
  • the polynucleotides can also encode for a proprotein which is the mature protein plus additional 5' amino acid residues.
  • a mature protein having a prosequence is a proprotein and is an inactive form of the protein. Once the prosequence is cleaved an active mature protein remains.
  • the polynucleotides comprise the coding sequence for the mature polypeptide fused in the same reading frame to a marker sequence that allows, for example, for purification of the encoded polypeptide.
  • the marker sequence can be a hexa-histidine tag supplied by a pQE-9 vector to provide for purification of the mature polypeptide fused to the marker in the case of a bacterial host, or the marker sequence can be a hemagglutinin (HA) tag derived from the influenza hemagglutinin protein when a mammalian host (e.g. COS-7 cells) is used.
  • a mammalian host e.g. COS-7 cells
  • the present invention further relates to variants of the hereinabove described polynucleotides encoding, for example, fragments, analogs, and derivatives.
  • the polynucleotide variants can contain alterations in the coding regions, non-coding regions, or both. In some embodiments the polynucleotide variants contain alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide. In some embodiments, nucleotide variants are produced by silent substitutions due to the degeneracy of the genetic code. Polynucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host (change codons in the human mRNA to those preferred by a bacterial host such as E. coli).
  • the CD37-binding agents (including antibodies, immunoconjugates, and polypeptides) of the invention are useful in a variety of applications including, but not limited to, therapeutic treatment methods, such as the treatment of cancer, such as B-cell malignancies.
  • the agents are useful for inhibiting tumor growth, inducing differentiation, reducing tumor volume, and/or reducing the tumorigenicity of a tumor.
  • the methods of use can be in vitro, ex vivo, or in vivo methods.
  • the CD37-binding agent or antibody or immunoconjugate, or polypeptide is an antagonist of the human CD37 to which it binds.
  • anti-CD37 antibodies and immunoconjugates of the invention are useful for detecting the presence of CD37 in a biological sample.
  • detecting encompasses quantitative or qualitative detection.
  • a biological sample comprises a cell or tissue.
  • tissue include normal and/or cancerous tissues that express CD37 at higher levels relative to other tissues, for example, B cells and/or B cell associated tissues.
  • the invention provides a method of detecting the presence of CD37 in a biological sample.
  • the method comprises contacting the biological sample with an anti-CD37 antibody under conditions permissive for binding of the anti-CD37 antibody to CD37, and detecting whether a complex is formed between the anti-CD37 antibody and CD37.
  • the invention provides a method of diagnosing a disorder associated with increased expression of CD37.
  • the method comprises contacting a test cell with an anti-CD37 antibody; determining the level of expression (either quantitatively or qualitatively) of CD37 by the test cell by detecting binding of the anti-CD37 antibody to CD37; and comparing the level of expression of CD37 by the test cell with the level of expression of CD37 by a control cell (e.g., a normal cell of the same tissue origin as the test cell or a cell that expresses CD37 at levels comparable to such a normal cell), wherein a higher level of expression of CD37 by the test cell as compared to the control cell indicates the presence of a disorder associated with increased expression of CD37.
  • a control cell e.g., a normal cell of the same tissue origin as the test cell or a cell that expresses CD37 at levels comparable to such a normal cell
  • the test cell is obtained from an individual suspected of having a disorder associated with increased expression of CD37.
  • the disorder is a cell proliferative disorder, such as a cancer or a tumor.
  • a method of diagnosis or detection comprises detecting binding of an anti-CD37 antibody to CD37 expressed on the surface of a cell or in a membrane preparation obtained from a cell expressing CD37 on its surface.
  • the method comprises contacting a cell with an anti-CD37 antibody under conditions permissive for binding of the anti-CD37 antibody to CD37, and detecting whether a complex is formed between the anti-CD37 antibody and CD37 on the cell surface.
  • An exemplary assay for detecting binding of an anti-CD37 antibody to CD37 expressed on the surface of a cell is a "FACS" assay.
  • Certain other methods can be used to detect binding of anti-CD37 antibodies to CD37.
  • Such methods include, but are not limited to, antigen-binding assays that are well known in the art, such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, fluorescent immunoassays, protein A immunoassays, and immunohistochemistry (IHC).
  • anti-CD37 antibodies are labeled.
  • Labels include, but are not limited to, labels or moieties that are detected directly (such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels), as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g., through an enzymatic reaction or molecular interaction.
  • anti-CD37 antibodies are immobilized on an insoluble matrix. Immobilization entails separating the anti-CD37 antibody from any CD37 that remains free in solution. This conventionally is accomplished by either insolubilizing the anti-CD37 antibody before the assay procedure, as by adsorption to a water-insoluble matrix or surface (Bennich et al., U.S. Pat. No. 3,720,760), or by covalent coupling (for example, using glutaraldehyde cross-linking), or by insolubilizing the anti-CD37 antibody after formation of a complex between the anti-CD37 antibody and CD37, e.g., by immunoprecipitation.
  • the disease treated with the CD37-binding agent or antagonist is a cancer.
  • the cancer is characterized by CD37 expressing cells to which the CD37-binding agent (e.g., antibody) binds.
  • the present invention provides for methods of treating cancer comprising administering a therapeutically effective amount of a CD37-binding agent to a subject (e.g., a subject in need of treatment).
  • a subject e.g., a subject in need of treatment.
  • the cancer is a B-cell malignancy.
  • the cancer is selected from the group consisting of B cell lymphomas, NHL, precursor B cell lymphoblastic leukemia/lymphoma and mature B cell neoplasms, B cell chronic lymphocytic leukemia (CLL)/small lymphocytic lymphoma (SLL), B cell prolymphocytic leukemia, lymphoplasmacytic lymphoma, mantle cell lymphoma (MCL), follicular lymphoma (FL), low grade, intermediate-grade and high-grade (FL), cutaneous follicle center lymphoma, marginal zone B cell lymphoma, MALT type marginal zone B cell lymphoma, nodal marginal zone B cell lymphoma, splenic type marginal zone B cell lymphoma, hairy cell leukemia, diffuse large B cell lymphoma, Burkitt's lymphoma, plasmacytoma, plasma cell myeloma, post-transplant lymphoproliferative disorder, Waldenstrom's macroglobin, IL
  • the present invention further provides methods for inhibiting tumor growth using the antibodies or other agents described herein.
  • the method of inhibiting the tumor growth comprises contacting the cell with a CD37-binding agent (e.g., antibody ) in vitro.
  • a CD37-binding agent e.g., antibody
  • an immortalized cell line or a cancer cell line that expresses CD37 is cultured in medium to which is added the antibody or other agent to inhibit tumor growth.
  • tumor cells are isolated from a patient sample such as, for example, a tissue biopsy, pleural effusion, or blood sample and cultured in medium to which is added an CD37-binding agent to inhibit tumor growth.
  • the method of inhibiting tumor growth comprises contacting the tumor or tumor cells with the CD37-binding agent (e.g., antibody) in vivo.
  • contacting a tumor or tumor cell with a CD37-binding agent is undertaken in an animal model.
  • CD37- binding agents can be administered to xenografts expressing one or more CD37s that have been grown in immunocompromised mice (e.g. NOD/SCID mice) to inhibit tumor growth.
  • cancer stem cells are isolated from a patient sample such as, for example, a tissue biopsy, pleural effusion, or blood sample and injected into immunocompromised mice that are then administered a CD37-binding agent to inhibit tumor cell growth.
  • the CD37-binding agent is administered at the same time or shortly after introduction of tumorigenic cells into the animal to prevent tumor growth. In some embodiments, the CD37-binding agent is administered as a therapeutic after the tumorigenic cells have grown to a specified size.
  • the method of inhibiting tumor growth comprises administering to a subject a therapeutically effective amount of a CD37-binding agent.
  • the subject is a human.
  • the subject has a tumor or has had a tumor removed.
  • the tumor expresses the CD37 to which the CD37-binding agent or antibody binds. In certain embodiments, the tumor overexpresses the human CD37.
  • the invention provides a method of reducing the tumorigenicity of a tumor in a subject, comprising administering a therapeutically effective amount of a CD37-binding agent to the subject.
  • the tumor comprises cancer stem cells.
  • the frequency of cancer stem cells in the tumor is reduced by administration of the agent.
  • the invention further provides methods of differentiating tumorigenic cells into non- tumorigenic cells comprising contacting the tumorigenic cells with a CD37-binding agent (for example, by administering the CD37-binding agent to a subject that has a tumor comprising the tumorigenic cells or that has had such a tumor removed.
  • CD37-binding agents, polypeptides, or antibodies described herein to induce the differentiation of cells, including, but not limited to tumor cells.
  • methods of inducing cells to differentiate comprising contacting the cells with an effective amount of a CD37-binding agent (e.g., an anti-CD37 antibody) described herein are envisioned.
  • Methods of inducing cells in a tumor in a subject to differentiate comprising administering a therapeutically effective amount of a CD37-binding agent, polypeptide, or antibody to the subject are also provided.
  • the tumor is a pancreatic tumor.
  • the tumor is a colon tumor.
  • the treatment methods comprise administering a therapeutically effective amount of the CD37-binding agent, polypeptide, or antibody to the subject.
  • the present invention further provides pharmaceutical compositions comprising one or more of the CD37-binding agents described herein.
  • the pharmaceutical compositions further comprise a pharmaceutically acceptable vehicle. These pharmaceutical compositions find use in inhibiting tumor growth and treating cancer in human patients.
  • formulations are prepared for storage and use by combining a purified antibody or agent of the present invention with a pharmaceutically acceptable vehicle (e.g. carrier, excipient) (Remington, The Science and Practice of Pharmacy 20th Edition Mack Publishing, 2000).
  • a pharmaceutically acceptable vehicle e.g. carrier, excipient
  • suitable pharmaceutically acceptable vehicles include, but are not limited to, nontoxic buffers such as phosphate, citrate, and other organic acids; salts such as sodium chloride; antioxidants including ascorbic acid and methionine; preservatives (e.g.
  • octadecyldimethylbenzyl ammonium chloride hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens, such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight polypeptides (e.g.
  • proteins such as serum albumin, gelatin, or immunoglobulins
  • hydrophilic polymers such as polyvinylpyrrolidone
  • amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine
  • carbohydrates such as monosacchandes, disaccharides, glucose, mannose, or dextrins
  • chelating agents such as EDTA
  • sugars such as sucrose, mannitol, trehalose or sorbitol
  • salt-forming counter-ions such as sodium
  • metal complexes e.g. Zn-protein complexes
  • non-ionic surfactants such as TWEEN or polyethylene glycol (PEG).
  • compositions of the present invention can be administered in any number of ways for either local or systemic treatment.
  • Administration can be topical (such as to mucous membranes including vaginal and rectal delivery) such as transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powders; pulmonary (e.g., by inhalation or insufflation of powders or aerosols, including by nebulizer; intratracheal, intranasal, epidermal and transdermal); oral; or parenteral including intravenous, intraarterial, subcutaneous, intraperitoneal or intramuscular injection or infusion; or intracranial (e.g., intrathecal or intraventricular) administration.
  • topical such as to mucous membranes including vaginal and rectal delivery
  • transdermal patches such as transdermal patches, ointments, lotions, creams, gels, drops, suppositories, sprays, liquids and powder
  • An antibody or immunoconjugate of the invention can be combined in a pharmaceutical combination formulation, or dosing regimen as combination therapy, with a second compound having anti-cancer properties.
  • the second compound of the pharmaceutical combination formulation or dosing regimen can have complementary activities to the ADC of the combination such that they do not adversely affect each other.
  • Pharmaceutical compositions comprising the CD37-binding agent and the second anti-cancer agent are also provided.
  • CD37-binding agents can be administered in combination with CD20 antagonists, such as Rituximab.
  • the appropriate dosage of an antibody or agent of the present invention depends on the type of disease to be treated, the severity and course of the disease, the responsiveness of the disease, whether the antibody or agent is administered for therapeutic or preventative purposes, previous therapy, patient's clinical history, and so on all at the discretion of the treating physician.
  • the antibody or agent can be administered one time or over a series of treatments lasting from several days to several months, or until a cure is effected or a diminution of the disease state is achieved (e.g. reduction in tumor size).
  • Optimal dosing schedules can be calculated from measurements of drug accumulation in the body of the patient and will vary depending on the relative potency of an individual antibody or agent.
  • the administering physician can easily determine optimum dosages, dosing methodologies and repetition rates.
  • dosage is from 0.01 ⁇ g to 100 mg per kg of body weight, and can be given once or more daily, weekly, monthly or yearly.
  • the antibody or other CD37-binding agent is given once every two weeks or once every three weeks.
  • the dosage of the antibody or other CD37-binding agent is from about 0.1 mg to about 20 mg per kg of body weight.
  • the treating physician can estimate repetition rates for dosing based on measured residence times and concentrations of the drug in bodily fluids or tissues.
  • the combination therapy can provide "synergy” and prove “synergistic", i.e. the effect achieved when the active ingredients used together is greater than the sum of the effects that results from using the compounds separately.
  • a synergistic effect can be attained when the active ingredients are: (1) co-formulated and administered or delivered simultaneously in a combined, unit dosage formulation; (2) delivered by alternation or in parallel as separate formulations; or (3) by some other regimen.
  • a synergistic effect can be attained when the compounds are administered or delivered sequentially, e.g. by different injections in separate syringes.
  • an effective dosage of each active ingredient is administered sequentially, i.e. serially, whereas in combination therapy, effective dosages of two or more active ingredients are administered together.
  • kits that comprise the antibodies, immunoconjugates or other agents described herein and that can be used to perform the methods described herein.
  • a kit comprises at least one purified antibody against CD37 in one or more containers.
  • the kits contain all of the components necessary and/or sufficient to perform a detection assay, including all controls, directions for performing assays, and any necessary software for analysis and presentation of results.
  • the disclosed antibodies, immunoconjugates or other agents of the present invention can be readily incorporated into one of the established kit formats which are well known in the art.
  • kits comprising a CD37-binding agent (e.g., a CD37-binding antibody), as well as a second anti-cancer agent.
  • a CD37-binding agent e.g., a CD37-binding antibody
  • the second anti-cancer agent is a chemotherapeutic agent (e.g., rituximab).
  • Embodiments of the present disclosure can be further defined by reference to the following non-limiting examples, which describe in detail preparation of certain antibodies of the present disclosure and methods for using antibodies of the present disclosure. It will be apparent to those skilled in the art that many modifications, both to materials and methods, can be practiced without departing from the scope of the present disclosure.
  • WSU-DLCL-2 B-NHL diffuse large B-cell lymphoma DSMZ (ACC 575) RL B-NHL, diffuse large B-cell lymphoma DSMZ (ACC 613)
  • An expression plasmid pSRa-CD37 was constructed that contained the entire CD37 coding sequence (CDS) flanked by Xbal and BamHI restriction sites that allowed expression of human CD37.
  • CDS CD37 coding sequence
  • 300-19 cells a pre-B cell line derived from a Balb/c mouse (M. G. Reth et al. 1985, Nature, 317: 353- 355), were transfected with this expression plasmid to stably express high levels of human CD37 on the cell surface and used for immunization of Balb/c VAF mice. Mice were subcutaneously immunized with approximately 5xl0 6 CD37-expressing 300-19 cells per mouse every 2-3 weeks by standard immunization protocols used at ImmunoGen, Inc.
  • mice were boosted with another dose of antigen three days before being sacrificed for hybridoma generation.
  • the spleen from the mouse was collected according to standard animal protocols and was ground between two sterile, frosted microscopic slides to obtain a single cell suspension in RPMI- 1640 medium.
  • the spleen cells were pelleted, washed, and fused with murine myeloma P3X63Ag8.653 cells (J. F. Kearney et al. 1979, J Immunol, 123: 1548-1550) by using polyethylene glycol- 1500 (Roche 783 641).
  • the fused cells were resuspended in RPMI-1640 selection medium containing hypoxanthine-aminopterin-thymidine (HAT) (Sigma H-0262) and selected for growth in 96-well flat-bottomed culture plates (Corning-Costar 3596, 200 ⁇ ⁇ of cell suspension per well) at 37 °C with 5% CO 2 . After 5 days of incubation, 100 ⁇ ⁇ of culture supernatant were removed from each well and replaced with 100 ⁇ ⁇ of RPMI- 1640 medium containing hypoxanthine-thymidine (HT) supplement (Sigma H-0137). Incubation at 37 °C with 5% CO 2 was continued until hydridoma clones were ready for antibody screening.
  • HAT hypoxanthine-aminopterin-thymidine
  • the cells were pelleted, washed, and incubated for 1 h with 100 ⁇ ⁇ of PE-conjugated goat anti-mouse IgG-antibody (Jackson Laboratory, 6 ⁇ g/mL in FACS buffer). The cells were pelleted again, washed with FACS buffer and resuspended in 200 ⁇ ⁇ of PBS containing 1% formaldehyde. Samples were acquired using a FACSCalibur flow cytometer with the HTS multiwell sampler or a FACS array flow cytometer and analyzed using CellQuest Pro (all from BD Biosciences, San Diego, US).
  • hybridoma clones that tested positive were subcloned by limiting dilution.
  • Stable subclones were cultured and the isotype of each secreted anti-CD37 antibody was identified using commercial isotyping reagents (Roche 1493027).
  • Antibodies were purified from hybridoma subclone supernatants using standard methods, such as, for example Protein A or G chromatography (HiTrap Protein A or G HP, 1 mL, Amersham Biosciences). Briefly, supernatant was prepared for chromatography by the addition of 1/10 volume of 1 M Tris/HCl buffer, pH 8.0. The pH-adjusted supernatant was filtered through a 0.22 ⁇ filter membrane and loaded onto column equilibrated with binding buffer (PBS, pH 7.3). The column was washed with binding buffer until a stable baseline was obtained with no absorbance at 280 nm.
  • binding buffer PBS, pH 7.3
  • Antibody was eluted with 0.1 M acetic acid buffer containing 0.15 M NaCl, pH 2.8, using a flow rate of 0.5 mL/min. Fractions of approximately 0.25 mL were collected and neutralized by the addition of 1/10 volume of 1M Tris/HCl, pH 8.0. The peak fraction(s) was dialyzed overnight twice against lx PBS and sterilized by filtering through a 0.2 ⁇ filter membrane. Purified antibody was quantified by absorbance at A280.
  • Protein A purified fractions were further polished using ion exchange chromatography (IEX) with quaternary ammonium (Q) chromatography for murine antibodies. Briefly, samples from protein A purification were buffer exchanged into binding buffer (10 mM Tris, 10 mM sodium chloride, pH 8.0) and filtered through 0.22 ⁇ filer. The prepared sample was then loaded onto a Q fast flow resin (GE Lifesciences) that was equilibrated with binding buffer at a flow rate of 120 cm/hr. Column size was chosen to have sufficient capacity to bind all the MAb in the sample. The column was then washed with binding buffer until a stable baseline was obtained with no absorbance at 280 nm.
  • binding buffer (10 mM Tris, 10 mM sodium chloride, pH 8.0
  • Q quaternary ammonium
  • Antibody was eluted by initiating a gradient from 10 mM to 500 mM sodium chloride in 20 column volume (CV). Peak fractions were collected based on absorbance measurement at 280 nm (A280). The percentage of monomer was assessed with size exclusion chromatography (SEC) on a TSK gel G3000SWXL, 7.8 x 300 mm with a SWXL guard column, 6.0 x 40 mm (Tosoh Bioscience, Montgomeryville, PA) using an Agilent HPLC 1 100 system (Agilent, Santa Clara, CA ).
  • SEC size exclusion chromatography
  • Binding specificity was tested by flow cytometry using purified antibodies. FACS histograms demonstrating the binding of muCD37-3, muCD37- 12, muCD37-38, muCD37-50, muCD37-51, muCD37-56 and muCD37-57 to CD37-expressing 300- 19 cells and the absence of binding to the parental 300-19 cells are shown in Figure 1 and Figure 2. All murine antibodies were incubated for 3 h with either CD37-expressing 300-19 cells or the non-transfected 300-19 cells (1 xlO 5 cells per sample) in 100 ⁇ ⁇ FACS buffer (RPMI-1640 medium supplemented with 2% normal goat serum).
  • the cells were pelleted, washed, and incubated for 1 h with 100 ⁇ ⁇ of FlTC-conjugated goat anti-mouse IgG-antibody (Jackson Laboratory, 6 ⁇ g/mL in FACS buffer). The cells were pelleted again, washed with FACS buffer and resuspended in 200 ⁇ ⁇ of PBS containing 1% formaldehyde. Samples were acquired using a FACSCalibur flow cytometer with the HTS multiwell sampler or a FACS array flow cytometer and analyzed using CellQuest Pro (all from BD Biosciences, San Diego, US).
  • a dose-response curve was generated by non-linear regression and the EC50 value of each curve, which corresponds to the apparent dissociation constant (Kd) of each antibody, was calculated using GraphPad Prism v4 (GraphPad software, San Diego, CA). A strong shift in fluorescence was observed for all antibodies tested and the Kd values correspond to 0.52 tiM, 1.7 nM, 2.7 ⁇ , ⁇ .1 nM or 0.91 nM for muCD37-3, muCD37-8, muCD37- 10, muCD37-12 or muCD37-14 antibodies, respectively.
  • the murine anti-CD37 antibodies induced apoptosis of Ramos and Raji lymphoma cell lines.
  • the degree of apoptosis was measured by flow cytometry analysis after staining with FITC conjugates of Annexin-V (Invitrogen) and with TO-PRO-3 (Invitrogen).
  • Annexin V binds phosphatidylserine on the outside but not on the inside of the cell membrane bilayer of intact cells.
  • TO-PRO-3 is a monomeric cyanine nucleic acid stain that can only penetrate the plasma membrane when the membrane integrity is breached, as occurs in the later stages of apoptosis.
  • Three populations of cells are distinguishable in two-color flow cytometry: Non-apoptotic cells (Annexin-V negative and TO-PRO-3 negative), early apoptotic cells (Annexin-V positive and TO-PRO-3 negative) and necrotic cells or late apoptotic cells (Annexin-V positive and TO-PRO-3 positive).
  • Exponentially growing cells were plated at about 2 x 10 5 cells/mL in 24-well plates in RMPI- 1640 medium supplemented with 10% fetal bovine serum (FBS), 2mM L glutamine, and 50 ⁇ g/mL gentamycin (denoted below as complete RMPI- 1640 medium). Cells were generally grown in complete RMPI-1640 medium, unless stated otherwise. Cells were incubated with 10 nM of anti-CD37 antibodies for 20 to 24 h at 37°C in a humidified 5% C0 2 incubator. The cells were then pelleted, washed twice with 500 ⁇ PBS, resuspended in 100 ⁇ .
  • FBS fetal bovine serum
  • 2mM L glutamine 2mM L glutamine
  • 50 ⁇ g/mL gentamycin denoted below as complete RMPI- 1640 medium. Cells were generally grown in complete RMPI-1640 medium, unless stated otherwise. Cells were incubated with 10 nM of anti-CD
  • binding buffer (10 mM Hepes-NaOH, pH 7.4, 140 mM NaCl, 2.5 mM CaC12), and stained with 5 ⁇ . of Annexin V-FITC for 15 min on ice. Then, 400 ⁇ . of binding buffer with 1 ⁇ of TO-PRO-3 was added to the mix, and the cell-associated fluorescence of FITC and TO- PPvO-3 was immediately measured by flow cytometry. Five thousand events were collected for each sample. The dot plots for fluorescence of TO-PRO-3 (FL4-H; y-axis) and fluorescence of Annexin V- FITC (FL1-H; x-axis) were generated using BD CellQuest software.
  • Annexin-V positive cells include both TO-PRO-3 positive and negative cells
  • the percentage of Annexin-V positive cells were determined for each sample from these plots and are shown in Figure 4 for Ramos cells.
  • Several antibodies isolated from our antibody screen were tested for pro-apoptotic activity in comparison to rituximab.
  • some of the isolated murine anti-CD37 antibodies, such as muCD37-3 and muCD37-12 showed very strong pro-apoptotic activity.
  • Approximately 39% of Ramos cells exposed to muCD37-3 and 46% of Ramos cells exposed to muCD37-12 were Annexin-V positive.
  • the murine antibodies were tested their ability to induce apoptosis in Raji lymphoma cells. As seen for Ramos cells, of the many antibodies isolated that bound CD37 with high affinity, only some had pro-apoptotic activity. Treatment with muCD37-3 or muCD37-12 resulted in 36% or 49% Annexin-V positive cells, respectively. In contrast, treatment with the anti-CD20 antibody rituximab resulted in only 20% of Annexin-V positive cells, while untreated control samples contained 4% Annexin-V positive cells.
  • Target cells were plated at 5,000 cells per well in 100 ⁇ ⁇ in complete RPMI media (RPMI- 1640, 10% fetal bovine serum, 2 mM glutamine, l% penicillin-streptomycin, all reagents from Invitrogen).
  • Antibodies were diluted into complete RPMI media using 3-fold dilution series and 100 ⁇ ⁇ were added per well. The final concentration typically ranged from 3 x 10 "8 M to 4.6 x 10 "12 M. Cells were incubated at 37°C in a humidified 5% CO 2 incubator for 4 to 5 days.
  • WST-8 is reduced by dehydrogenases in living cells to an orange formazan product that is soluble in tissue culture medium. The amount of formazan produced is directly proportional to the number of living cells.
  • WST-8 was added to 10% of the final volume and plates were incubated at 37°C in a humidified 5% C02 incubator for an additional 2-4 hours. Plates were analyzed by measuring the absorbance at 450 nm (A450) in a multiwell plate reader. Background A450 absorbance of wells with media and WST-8 only was subtracted from all values.
  • treatment with muCD37-50 or muCD37-51 reduced the cell viability to 38% at the highest antibody concentration tested with an EC50 of 0.25 nM or 0.5 nM, respectively.
  • treatment with for example CD37-16 did not reduce cell viability in a dose-dependent manner.
  • Total cellular RNA was prepared from 5 x 10 6 cells of the CD37-3 hybridoma using an RNeasy kit (QIAgen) according to the manufacturer's protocol. cDNA was subsequently synthesized from total RNA using the Superscript II cDNA synthesis kit (Invitrogen). [0296] The procedure for the first round degenerate PCR reaction on the cDNA derived from hybridoma cells was based on methods described in Wang et al. ((2000) J Immunol Methods . 233: 167-77) and Co et al. ( (1992) J Immunol. 74$: 1149-54).
  • VH sequences were amplified by PCR using the following degenerate primers: EcoMHl CTTCCGGAATTCSARGTNMAGCTGSAGSAGTC (SEQ ID NO: 171), EcoMH2 CTTCCGGAATTCSARGTNMAGCTGSAGSAGTCWGG (SEQ ID NO: 172) and BamlgGl GGAGGATCCATAGACAGATGGGGGTGTCGTTTTGGC (SEQ ID NO: 173).
  • VL sequences were amplified by PCR using the following degenerate primers: SacIMK GGAGCTCGAYATTGTGMTSACMCARWCTMCA (SEQ ID NO: 174) and HindKL TATAGAGCTCAAGCTTGGATGGTGGGAAGATGGATACAGTTGGTGC (SEQ ID NO: 175).
  • SacIMK GGAGCTCGAYATTGTGMTSACMCARWCTMCA SEQ ID NO: 174
  • HindKL TATAGAGCTCAAGCTTGGATGGTGGGAAGATGGATACAGTTGGTGC SEQ ID NO: 175.
  • the PCR reaction mixtures were then run on a 1% low melt agarose gel, the 300 to 400 bp bands were excised, purified using Zymo DNA mini columns, and sent to Agencourt Biosciences for sequencing.
  • the respective 5' and 3' PCR primers were used as sequencing primers to generate the variable region cDNAs from both directions.
  • the amino acid sequences of VH and VL regions were predicted from the DNA sequencing results.
  • the cDNA sequence information for the variable region was combined with the germline constant region sequence to obtain full length antibody cDNA sequences.
  • the molecular weights of the heavy chain and light chain were then calculated and compared with the molecular weights obtained by LC/MS analyses of the murine CD37-3 antibody. The molecular weight measurements are consistent with the cDNA sequences for both the CD37-3 light and heavy chain.
  • variable sequence for the light chain variable region is cloned into EcoRI and BsiWI sites in the pchCD37-3LCZ plasmid.
  • the heavy chain variable region is cloned into the Hindlll and Apal sites in the pchCD37-3HCN plasmid.
  • Equivalent plasmids were constructed for chCD37-12. These plasmids were used to express chimeric antibodies in HEK-293T cells using a standard calcium phosphate procedure (BD Biosciences, CalPhos Mammalian Transfection Kit, Cat # 631312).
  • CM carboxymethyl
  • IEX carboxymethyl
  • CD37-3 and huCD37-50 antibodies were humanized following resurfacing methods previously described, such as, for example in Roguska et al., Proc. Natl. Acad. Sci., USA, 91(3):969-973 (1994) and Roguska et al., Protein Eng. 9(10):895-904 (1996), which are incorporated in their entirety herein by reference.
  • Resurfacing generally involves identification of the variable region framework surface residues in both light and heavy chains and replacing them with human equivalents.
  • the murine CDR's are preserved in the resurfaced antibody.
  • Exemplary CDRs of CD37-3 and CD37-50 are defined as indicated in Table 1 1.
  • the table provides exemplary Kabat defined heavy chain CDR2's for both the murine and human CD37-3 and CD37-50.
  • the underlined sequence marks the portion of the Kabat heavy chain CDR2 not considered a CDR for resurfacing.
  • Murine HC CDR2 Murine HC CDR2:
  • Human HC CDR2 Human HC CDR2:
  • CD37-3 and CD7-50 light and heavy chain CDR's as defined for the resurfacing are given by way of example in Table 11. Lysine 53 in murine CD37-50 light chain CDR2 was replaced with asparagine in humanized CD37-50 (shown in italic) so both versions of the LC CDR2 are given.
  • the Kabat definition for heavy chain CDR2 is also given for both the murine and human CD37-3.
  • the underlined sequence marks the portion of the Kabat heavy chain CDR2 not considered a CDR for resurfacing.
  • variable region sequences for huCD37-3 and CD37-50 were codon-optimized and synthesized by Blue Heron Biotechnology. The sequences are flanked by restriction enzyme sites for cloning in-frame with the respective constant sequences in single chain mammalian expression plasmids.
  • the light chain variable region is cloned into EcoRI and BsiWI sites in the pAbKZeo plasmid.
  • the heavy chain variable region is cloned into the Hindlll and Apal sites in the pAbGlNeo plasmid. These plasmids can be used to express the recombinant antibodies in either transient or stable mammalian cell transfections.
  • Transient transfections to express recombinant antibodies in HEK 293T cells were performed using a modified PEI procedure (Durocher, Y. et al., Nucleic Acids Res. 30:E9 (2002)). Supernatant was purified by Protein A and polishing chromatography steps using standard procedures as described above for chimerized antibodies.
  • Flow cytometry binding assays using BJAB cells and a competitive binding format were used to evaluate binding affinity of chimeric and humanized versions of CD37-3.
  • BJAB cells were incubated with a 1 nM concentration of PE-labeled muCD37-3 antibody and competition was measured by adding varying amounts of muCD37-3, chCD37-3, huCD37-3vl.O or huCD37-3vl .01. The samples were incubated for 3 hrs at 4°C. Then, the cells were pelleted, washed with FACS buffer and resuspended in 200 )L of PBS containing 1% formaldehyde.
  • the EC50 of competition binding for muCD37- 3, chCD37-3, huCD37-3vl .O or huCD37-3vl .01 corresponds to 0.8 nM, 0.7 nM, 1 nM and 0.6 nM, respectively.
  • the humanized antibodies huCD37-38, huCD37-50, huCD37-51, huCD37-56 and chCD37- 57 were assayed for their binding affinity to BJAB cells in comparison to their murine counterparts.
  • Flow cytometry binding assays were carried out using secondary FITC-conjugated goat-anti-murine and -anti- human antibodies, analyzed as described in Example 2 and dose-response curves were generated by nonlinear regression for each antibody.
  • the value for the apparent dissociation constant (Kd) of each antibody was calculated using GraphPad Prism v4 (GraphPad software, San Diego, CA). It is apparent that humanization did not greatly affect the binding affinity of any antibody.
  • the Kd for muCD37-3 and huCD37-3 corresponds to 0.2 nM
  • the Kd for muCD37-38 and huCD37-38 corresponds to 0.4 nM and 0.3 nM, respectively.
  • the Kd for muCD37-50 and huCD37-50 corresponds to 0.6 nM and 0.2 nM, respectively
  • the Kd for muCD37-51 and huCD37-51 corresponds to 0.6 nM and 0.8 nM, respectively.
  • the Kd for muCD37-56 and huCD37-56 corresponds to 0.4 nM and 0.2 nM, respectively, while the Kd for muCD37-57 and huCD37-57 corresponds to 1.0 nM and 0.3 nM, respectively.
  • the CD37 AA sequence of macaque CD37 was obtained from Genbank (GI: 718718). The sequence was codon-optimized and synthesized by Blue Heron Biotechnology.
  • An expression plasmid pSRa-CD37mac was constructed that contained the entire CD37 coding sequence (CDS) from macaque flanked by Xbal and BamHI restriction sites that allowed expression of macaque CD37. 300-19 cells, a pre-B cell line derived from a Balb/c mouse (M. G. Reth et al. 1985, Nature, 317: 353-355), was transfected with this expression plasmid to stably express macaque CD37 on the cell surface.
  • the murine antibodies muCD37-3, muCD37-12, muCD37-38, huCD37-50, muCD37-51, muCD37-56 and muCD37-57 were assayed for their ability to bind to 300-19/CD37mac cells expressing macaque CD37.
  • Flow cytometry binding assays were carried out using secondary FITC-conjugated goat- anti-murine or goat-anti-human antibodies, analyzed as described in Example 2. Binding was compared to the previously described anti-CD37 antibody WR17 and the anti-CD37 SMIP TRU-016.
  • the humanized antibodies huCD37-38, huCD37-50, huCD37-51, huCD37-56 and huCD37- 57 were assayed for their binding affinity to 300-19/CD37mac cells expressing macaque CD37.
  • Flow cytometry binding assays were carried out using secondary FITC-conjugated goat-anti-human antibodies, analyzed as described in Example 2 and dose-response curves were generated by non-linear regression for each antibody.
  • the value for the apparent dissociation constant (Kd) of each antibody was calculated using GraphPad Prism v4 (GraphPad software, San Diego, CA).
  • the pro-apoptotic activity of chimeric and humanized antibodies was evaluated on Ramos cells.
  • Cells were incubated with lOnM concentration of antibodies or an hulgG isotype control antibody for 20 hrs followed by Annexin-V-FITC and TO-PRO-3 staining and flow cytometry analysis.
  • ChCD37- 12 retained strong pro-apoptotic activity of muCD37-12.
  • Approximately 40% of Ramos cells are Annexin-V positive after treatment with either muCD37-12 or chCD37- 12 antibody as compared to 4% of untreated control cells.
  • Ramos cells approximately 40% of Ramos cells are Annexin-V positive after treatment with huCD37-3, huCD37-38, huCD37-50, huCD37-51, huCD37-56 or huCD37-57 antibody as compared to 4% of isotype control treated or untreated cells.
  • treatment with the anti-CD20 antibody rituximab resulted in only 13% of Annexin-V positive cells. This result demonstrates that the strong pro-apoptotic activity of the murine anti-CD37 antibodies isolated here is retained by the chimeric or humanized antibodies derived from them.
  • TRU-016 The pro-apoptotic activity of huCD37-3 against Ramos and Raji lymphoma cells was compared to the anti-CD37 SMIP TRU-016.
  • TRU-016 has been described as a compound with no pro- apoptotic activity unless cross-linked with a secondary antibody.
  • exemplary anti-CD37 antibodies huCD37-3 and chCD37-38 have much stronger pro-apoptotic activity against both lymphoma cell lines.
  • Treatment with huCD37-3 or chCD37-38 resulted in 40% or 49% Annexin-V positive Ramos cells, as compared to 3% of untreated control cells.
  • Rituximab treatment resulted in only 15% Annexin-V positive Ramos cells.
  • TRU-016 treatment did not increase the percentage of Annexin-V positive Ramos cells.
  • Treatment with huCD37-3 or chCD37-38 resulted in 34% or 30% Annexin-V positive Raji cells, as compared to 7% of untreated control cells.
  • Rituximab treatment resulted in only 19% Annexin-V positive Raji cells.
  • TRU-016 treatment did not increase the percentage of Annexin-V positive Ramos cells.
  • the EC50 for this activity corresponds to 0.41, 0.57 and 1.01 nM for huCD37-51, huCD37-56 and huCD37-57, respectively.
  • treatment with the anti-CD20 antibody rituximab resulted in a maximum percentage of Annexin-V positive cells of only 15% compared with 4% of cells treated with isotype control antibody.
  • treatment with chCD37-3, huCD37-3vl .O or huCD37-3vl .01 reduced the viability of SU-DHL-4 cells to approximately 30% at the highest antibody concentration tested with an EC50 of 0.03 nM, 0.06 nM or 0.03 nM, respectively.
  • all antibodies were able to inhibit proliferation of DOHH-2 follicular lymphoma cells substantially and in a dose-dependent manner.
  • treatment with muCD37-3 reduced the viability of DOHH-2 cells to 45% with an EC50 of 0.05 nM.
  • Additional humanized anti-CD37 antibodies were tested in similar in vitro cytotoxicity assays. All humanized antibodies tested were able to inhibit proliferation of SU-DHL-4 cells substantially and in a dose-dependent manner. For example, treatment with huCD37-38 reduced the viability of SU- DHL-4 cells to 24% with an EC50 of 0.42 nM, while treatment with huCD37-50 reduced the viability of SU-DHL-4 cells to 31% with an EC50 of 0.39 nM. In contrast, treatment with the anti-CD20 antibody rituximab reduced the viability of SU-DHL-4 cells to 35% with an EC50 of 1.6 nM.
  • treatment with huCD37-51 or huCD37-56 reduced the viability of SU-DHL-4 cells to 24% with an EC50 of 0.60 nM or 0.68 nM, respectively.
  • treatment with huCD37-57 reduced the viability of SU-DHL-4 cells to 31% with an EC50 of 0.42 nM.
  • Treatment with an isotype control antibody did not have an effect on the viability of SU-DHL-4 cells.
  • Table 12 CD37 staining on lymphoma tumor microarrays in comparison to CD20 staining.
  • Non-Hodgkin B cell 21 (95%) 21 (95%) 22 lymphoma (unspecified)
  • huCD37-3 treatment resulted in a reduction in cell viability in a dose-dependent manner.
  • treatment with huCD37-3 reduced the viability of Granta-519 cells to approximately 37% with an EC50 of 0.062 nM.
  • Rituximab treatment reduced the viability of Granta-519 cells to approximately 47% with an EC50 of 0.36 nM.
  • treatment with huCD37-3 reduced the viability of SU-DHL-4 cells to approximately 17% with an EC50 of 0.053 nM.
  • Rituximab treatment reduced the viability of SU-DHL-4 cells to approximately 20% with an EC50 of 0.2 nM.
  • treatment with TRU-016 did not reduce the viability of Granta-519 or SU-DHL-4 cells to a significant degree or in a dose-dependent manner.
  • treatment with huCD37-3 reduced the viability of Namalwa cells to approximately 47% with an EC50 of 0.1 nM and reduced the viability of Daudi cells to approximately 68% with an EC50 of 0.25 nM.
  • Rituximab treatment did not have an effect on Namalwa cells but reduced the viability of Daudi cells to approximately 69% with an EC50 of 2.6 nM.
  • treatment with TRU-016 did not reduce the viability of Namalwa or Daudi cells to a significant degree or in a dose-dependent manner.
  • Target cells were added to the antibodies at 5 x 10 4 cells in 100 ⁇ ⁇ of RHBP medium per well.
  • Lyophilized human complement (Sigma-Aldrich, St. Louis, US) was reconstituted with 1 mL sterile purified water per vial and diluted 5-fold to a 20% stock with RHBP media immediately before use. 50 ⁇ of complement solution was added to each well for a final concentration of 5%. Plates were incubated for 2 h at 37°C in 5% CO 2 humidified incubator to allow for complement mediated lysis. After this incubation time, Alamar Blue reagent (Invitrogen) was added to each well at a final concentration of 10% to measure the viability of the remaining cells.
  • Alamar Blue reagent Invitrogen
  • the plate was incubated for 16 to 20 hours at 37°C before measuring the fluorescence (in relative fluorescence units, RFU) at EX540/EM590 nm.
  • Controls included triplicate wells with media and complement but without cells (media only, 0% viability) and wells with cells and complement but without antibody (cells only, 100% viability).
  • chCD37- 12 has potent CDC activity against Ramos cells. It reduced the viability of Ramos cells to 32% at the highest antibody concentration tested with an EC50 of 0.037 ⁇ g/mL.
  • several isolated antibodies showed CDC activity against Ramos to a varying degree.
  • Treatment with huCD37-3, huCD37-38, huCD37-50 resulted in a reduction in cell viability to 59%, 50% and 45%, respectively.
  • Treatment with huCD37-51, huCD37-56 or huCD37-56 moderately reduced cell viability of Ramos cells to approximately 70 - 80% at the highest antibody concentration tested.
  • a lactate dehydrogenase (LDH) release assay was used to measure antibody-dependent cell mediated cytotoxicity (ADCC) of tumor cells lines using freshly isolated human natural killer (NK) cells as effector cells (Shields RL, J Biol Chem. 2001 276(9):6591-604).
  • the NK cells were first isolated from human blood from a normal donor (Research Blood Components, Inc., Brighton, MA) using a modified protocol for the NK Isolation Kit II (Miltenyi Biotech, 130-091-152). Blood was diluted 2-fold with lx PBS.
  • PBMC peripheral blood mononuclear cells
  • the Biotin-Antibody Cocktail contains biotinylated antibodies that bind to the lymphocytes, except for NK cells, resulting in a negative selection of NK cells.
  • the mixture was incubated at 4°C for 10 min, and then 1.5 mL of NK- isolation buffer and 1 mL of Anti-Biotin Micro Beads were added.
  • the cell-antibody mixture was incubated for another 15 min at 4°C. Next, cells were washed once with 50 mL of NK-isolation buffer and resuspended in 3 mL of NK-isolation buffer.
  • a MACS LS column was mounted on the autoMACS separator (Miltenyi Biotech) and pre-washed with 3 mL of NK-isolation Buffer.
  • the cell suspension was automatically applied onto the column, washed and the effluent fraction with unlabeled NK cells was collected into a new 50-mL conical tube.
  • the resulting NK cells were plated into 30 mL of complete RPMI media (RPMI-1640 supplemented with 5% fetal bovine serum, 1% penicillin-streptomycin, 1 mM HEPES, 1 mM Sodium Pyruvate, 1% 100X MEM non-essential Amino Acid Solution) overnight.
  • the subsequent assay and all dilutions were carried out in RHBP medium (RPMI- 1640 medium supplemented with 20 mM HEPES, pH 7.4, 0.1% BSA and 1% penicillin-streptomycin).
  • the mixtures were incubated at 37°C for 4 h to allow for cell lysis. Plates were centrifuged for 10 min at 1200 rpm, and 100 ⁇ ⁇ of the supernatant was carefully transferred to a new flat- bottom 96-well plate.
  • huCD37-51, huCD37-56 and huCD37-57 resulted in approximately 39%, 36% or 36% of Daudi cell lysis with an EC50 value of 5.7 ng/mL, 4.3 ng/mL, or 7.9 ng/mL, respectively.
  • the ADCC activity of the isolated antibodies against Ramos lymphoma cells was compared with the ADCC activity of TRU-016.
  • Treatment with huCD37-3, huCD37-38 or huCD37-50 antibodies resulted in approximately 43%, 42% or 46% Ramos cell lysis with an EC50 value of 0.95 ng/mL, 2.0 ng/mL, or 3.0 ng/mL respectively.
  • This activity was similar to that resulting from TRU-016 treatment with 59% Ramos cell lysis observed and an EC50 value of 1.53 ng/mL.
  • CD37 The localization of amino acid requirements for the epitopes of different CD37 antibodies can help tie common or unique functional characteristics to specific molecular interactions.
  • the extracellular domain of CD37 contains two extracellular loops, a small loop of about 18 residues, and a larger one consisting of approximately 135 amino acids. Epitope requirements have not been described for previously published CD37 antibodies.
  • CD37 antigen variants we constructed several CD37 antigen variants with AA substitution in the larger extracellular loop.
  • Mammalian expression plasmids were built containing either the entire human or macaca CD37 cDNA sequences, codon optimized and synthesized by Blue Heron Biotechnologies, and flanked by Xbal and BamHI restriction sites to facilitate cloning into the pSRa vector multiple cloning site. Since the human and macaca CD37 sequences are highly homologous ( Figure 16), the expression of these constructs could distinguish the human and macaca cross reactive antibodies from those that recognize epitopes requiring at least one of the 1 1 extracellular CD37 amino acid differences between in these two species as described in Example 8.
  • the human R176 was included in all of the murine/human chimeric constructs.
  • the murine and human CD37 cassettes were ordered from Blue Heron and cloned into the pSRa vector together with a 5' end fragment of the original human CD37 construct generated by PCR to incorporate the EcoRV site and the 3' end Pstl to Xbal restriction fragment taken from the original macaca CD37 construct.
  • the murine and human chimeric CD37 cassettes were then built using standard restriction digests and ligations taking advantage of the common unique restriction sites.
  • the hCD37-Ml variant was created by inserting a EcoRV-SacII restriction fragment encoding the AA S109 to A138 of the analogous murine CD37 sequence.
  • the hCD37-M3 variant was created by inserting a Kpnl-Blpl restriction fragment encoding the AA VI 77 to L201 of the analogous murine CD37 sequence.
  • the hCD37-M45 variant was created by inserting a Blpl-Pstl restriction fragment encoding the AA S202 to 1243 of the analogous murine CD37 sequence. The resulting clones were verified by restriction enzyme digestion followed by DNA sequencing.
  • Stable cell lines were obtained by transfection of the murine and human chimeric CD37 variant expression plasmids into 300-19 cells using standard electroporation procedures. Briefly, 5 x 10 6 300-19 cells were electroporated in cold RPMI-1640 media using a BioRad Gene Pulser set at 260V and 960 ⁇ . Subsequently, cells were diluted and plated into 96-well plates in RPMI-1640 media supplemented with 10% FBS and 50 ⁇ ⁇ -mercaptoethanol. After 24 hours G418 (Invitrogen) was added at a final concentration of 2 mg/mL to select for transfected cells. After 2 weeks, single colonies were isolated, analyzed for CD37 surface expression by flow cytometry and expanded.
  • Binding of various CD37 antibodies to cells expressing human CD37 wildtype and variants was analyzed by flow cytometry using 1.5 ⁇ g/mL of each antibody.
  • the isolated antibodies of this invention were compared to commercially available CD37 antibody WR17, as well as the TRU-016 SMIP. As can be seen in Figure 18A, all antibodies bound to wild type CD37 expressing cells. Likewise, all antibodies tested bound the hCD37-M3 variant ( Figure 18B). In contrast, the isolated antibodies of this invention bound the hCD37-Ml variant, while TRU-016 and WR17 were unable to bind hCD37-Ml variant ( Figure 19A).
  • the CD37-50 and CD37-51 antibodies and TRU-016 were also able to bind the hCD37-M45 variant.
  • WR17 showed partial binding to the hCD37-M45 variant, while the other antibodies CD37-3, CD37-12, CD37-38, CD37-56 and CD37-57 were unable to bind (Figure 19B).
  • Figure 19B This suggests that all of the isolated antibodies of this invention do not require the 12 AA residues in the hCD37-Ml variant that were changed to the corresponding murine AA residues for binding to the CD37 antigen.
  • CD37-3, CD37- 12, CD37-38, CD37-56 and CD37-57 antibodies require at least one of the 10 AA residues in the hCD37-M45 variant that were changed to the corresponding murine AA residues for binding to the CD37 antigen.
  • constructs contain various combinations of murine, human and/or macaca sequences encoding the large extracellular loop of CD37 (see Figure 17). Examples of constructs with a single human section inserted into the murine large extracellular loop sequence are:
  • single point mutations are generated in the human large extracellular loop sequence to identify residues important for antibody binding.
  • Binding of CD37 binding agents to cells expressing SEQ ID NOs: 185- 194 is analyzed by flow cytometry as described above.
  • SPP linker N-succinimidyl 4-(2-pyridyldithio)pentanoate (SPP) linker was dissolved in ethanol.
  • the huCD37-3 antibody was incubated at 5 mg/mL with a 7 fold molar excess of SPP linker for approximately 100 minutes at room temperature in 50 mM potassium phosphate buffer (pH 6.5) containing 50 mM NaCl, 2 mM EDTA, and 5% ethanol.
  • the reaction mixture was purified using a SEPHADEXTM G25F column equilibrated with the aforementioned potassium phosphate buffer. Antibody containing fractions were pooled and used for subsequent steps.
  • the maytansinoid DM1 was dissolved in dimethylacetamide (DMA, final concentration is 3%) and a 1.7 fold molar excess relative to the linker was added drop wise to the SPP modified antibody. After overnight incubation at room temperature, the conjugated antibody was purified by chromatography on SEPHADEXTM G25F equilibrated in phosphate buffered saline (PBS), pH 6.5. The huCD37-3-SPP- DM1 conjugate was then dialyzed into buffer containing 10 mM histidine, 250 mM glycine, 1% sucrose pH 5.5.
  • DMA dimethylacetamide
  • PBS phosphate buffered saline
  • the number of DM1 molecules linked per antibody molecule was determined using the previously reported extinction coefficients for antibody and DM1 (Liu et al., Proc. Natl. Acad. Sci. USA, 93, 8618-8623 (1996)).
  • the percentage of free maytansinoid present after the conjugation reaction was determined by injecting 20-50 ⁇ g conjugate onto a HiSep column equilibrated in 25% acetonitrile in 100 mM ammonium acetate buffer, pH 7.0, and eluting in acetonitrile.
  • the peak area of total free maytansinoid species was measured using an absorbance detector set to a wavelength of 252 nm and compared with the peak area related to bound maytansinoid (eluted in the conjugate peak in the column flow-through fractions) to calculate the percentage of total free maytansinoid species.
  • Conjugates with 3.5-4 DM1 molecules per huCD37-3 antibody were obtained with ⁇ 1% present as unconjugated maytansinoid.
  • the SMCC-modified antibody was reacted with a 10 mM solution of DM1 at a 1.7 molar excess relative to the maleimide linker. The reaction was stirred at ambient temperature under for approximately 18 hours. The conjugation reaction mixture was filtered through a SEPHADEXTM G25 gel filtration column equilibrated with l PBS at pH 6.5. The huCD37-3-SMCC-DMl conjugate was then dialyzed into buffer containing 10 mM histidine, 250 mM glycine, 1% sucrose pH 5.5. The number of DM1 molecules linked per antibody molecule and the percentage of total free maytansinoid species were determined as described above. Conjugates with 3.5-4 DM1 molecules per huCD37-3 antibody were obtained with ⁇ 1% present as unconjugated maytansinoid.
  • the linker and DM4 were mixed together in DMA containing up to 40 % v/v of 200 mM succinate buffer, 2 mM EDTA, pH 5.0 to give a ratio of DM4 to linker of 1.6 and a final concentration of DM4 equal to 15 mM.
  • the reaction was left for 2 h added to a mixture of huCD37-3 antibody in phosphate buffer (pH 7.5) under final conjugation conditions of 4 mg/ml Ab, 90% phosphate buffer/10% DMA, pH 7.5.
  • the conjugation reaction was allowed to proceed at ambient temperature for 2 h.
  • the huCD37-3-sulfo-mal-DM4 conjugate was purified from excess unreacted DM4 and unconjugated linker products dialysis in PBS, followed by a final dialysis into buffer containing 10 mM histidine, 250 mM glycine, 1% sucrose pH 5.5. The conjugate was filtered through a 0.22 ⁇ filter for final storage. The number of DM4 molecules per huCD37-3 antibody molecule (average) in the final conjugate the percentage of total free maytansinoid species were determined as described above. Conjugates with 3.5-4 DM4 molecules per huCD37-3 antibody were obtained with ⁇ 1% present as unconjugated maytansinoid.
  • N-hydroxysuccinimidyl-(polyethylene glycol)4-(N-maleimidomethyl)-DMl (NHS- PEG4-mal-DMl) reagent was dissolved in DMA.
  • the huCD37-3 antibody was incubated at 5 mg/mL in 50 mM potassium phosphate, 150 mM NaCl, 2 mM EDTA, pH 7.5 with a 7 fold molar excess of NHS- PEG4-mal-DMl (10% DMA total). After approximately 2 hours at ambient temperature, the reaction mixture was purified using a SEPHADEXTM G25 column equilibrated in lx PBS, pH 7.4.
  • Antibody containing fractions were pooled and dialyzed into buffer containing 10 mM histidine, 250 mM glycine, 1% sucrose, pH 5.5. The number of DM1 molecules linked per antibody and the percentage of total free maytansinoid species were determined as described above. Conjugates with 3.5-4 DM4 molecules per huCD37-3 antibody were obtained with ⁇ 1% present as unconjugated maytansinoid.
  • Binding affinity of the exemplary huCD37-3 after conjugation to SMCC-DM1, SPP-DM1 or sulfo-mal-DM4 was assayed by flow cytometry as described in the above example.
  • the value for the apparent dissociation constants (Kd) were calculated from the binding curves shown in Figure 20A and correspond to 0.26 nM for huCD37-3, 0.46 for huCD37-3-SMCC-DMl, 0.56 nM for huCD37-3-SPP- DM1, and 0.89 nM for huCD37-3-sulfo-mal-DM4 conjugates.
  • Kd apparent dissociation constants
  • Binding affinity of huCD37-38 after conjugation to SMCC-DM1 was assayed by flow cytometry as described in the above example.
  • the value for the apparent dissociation constants (Kd) were calculated from the binding curves shown in Figure 20B and correspond to 1.04 nM for huCD37-38 and 1.2 nM for huCD37-38-SMCC-DMl conjugates. This result demonstrates that SMCC-DM1 conjugation does not notably alter the affinity of the huCD38 antibody.
  • binding affinity of huCD37-50, huCD37-51, huCD37-56 and huCD37-57 after conjugation to SMCC-DM1 was assayed by flow cytometry.
  • the value for the apparent dissociation constants (Kd) were calculated from binding curves and correspond to 0.43 nM for huCD37-50, 0.70 nM for huCD37-50-SMCC-DMl, 2.0 nM for huCD37- 51, 1.6 nM for huCD37-51-SMCC-DMl, 0.3 nM for huCD37-56, 0.34 nM for huCD37-56-SMCC-DMl, 0.30 for huCD37-57 and 0.34 for huCD37-57-SMCC-DMl .
  • This result demonstrates that SMCC-DM1 conjugation also does not notably alter the affinity of the huCD37-50, huCD37-51, huCD37-56
  • Binding affinity of the exemplary huCD37-3 and huCD37-50 antibodies after conjugation to PEG4-mal-DMl was assayed by flow cytometry as described in the above example.
  • the value for the apparent dissociation constants (Kd) were calculated from binding curves and correspond to 0.28 nM for huCD37-3, 0.35 nM for huCD37-3-PEG4-mal-DMl, 0.68 nM for huCD37-50 and 1.1 nM for huCD37- 50-PEG4-mal-DMl conjugates. This result demonstrates that PEG4-mal-DMl conjugation does not notably alter the affinity of the exemplary huCD37-3 or huCD50 antibodies.
  • ADCC activity of huCD37-3 after conjugation to SMCC-DM1 or PEG4-mal-DMl was evaluated on Daudi and Ramos cells in the presence of human NK effector cells by LDH release assay as described above.
  • huCD37-3-SMCC-DMl or huCD37-3-PEG4-mal-DMl conjugates have similar ADCC activity as the unconjugated huCD37-3 antibody on Daudi cells.
  • huCD37-3 Treatment with huCD37-3, huCD37-3 SMCC-DM1 or huCD37-3-PEG4-mal-DMl resulted in approximately 41%, 39% or 36% Daudi cell lysis with an EC50 value of 0.42 ng/mL, 1.13 ng/mL, or 0.91 ng/mL, respectively. Similar results were obtained using Ramos cells as target cells. As before, huCD37- 3-SMCC-DM1 or huCD37-3-PEG4-mal-DMl conjugates have comparable ADCC activity to the unconjugated huCD37-3 antibody on Ramos cells ( Figure 22B).
  • Cells were incubated overnight for 16 to 20 hrs at 37°C in a humidified 5% CO 2 incubator. The next day, cells were harvested by transferring into 5 mL polystyrene tubes, washed once with 3 mL PBS, and fixed in 1 mL 70% ethanol for 30 minutes on ice. The samples were then washed again with 3 mL PBS once and resuspended in 0.5 mL PBS. RNase was added to the sample at 5 ⁇ / ⁇ and incubated at 37°C for 30 minutes. The samples were then stained with propidium iodide at a final concentration of 50 ⁇ g/mL. Samples were acquired within 24 hours of PI staining.
  • Viability of remaining cells was determined by colorimetric WST-8 assay as described for antibody assays and the absorbance at 450 nm (A450) was measured in a multiwell plate reader (Dojindo Molecular Technologies, Inc., Rockville, MD, US). The percent viability was calculated by dividing each treated sample value by the average value of wells with untreated cells. The percent viability value was plotted against the antibody-conjugate concentration in a semi-log plot for each treatment.
  • SMCC-DM1 conjugates of huCD37-3, huCD37-38, huCD37-50, huCD37-51, huCD37-56 and huCD37-57 respectively.
  • SMCC-DMl conjugates of a non-binding isotype control antibody resulted in cell killing with an EC50 value of only 20 nM.
  • Figure 24B shows the results of a typical cytotoxicity assay using Granta-519 cells incubated with huCD37-3-SMCC-DMl, huCD37-38-SMCC-DMl, huCD37-50-SMCC-DMl, huCD37- 51-SMCC-DM1, or a non-binding hulgGI -SMCC-DMl control conjugate for 5 days.
  • SMCC-DMl conjugates of huCD37-3, huCD37-38, huCD37-50, and huCD37-51 were treated with all specific SMCC-DMl completely reduced viability at the highest concentration tested with an EC50 of 0.047 nM, 0.074 nM, 0.12 nM and 0.25 nM for SMCC-DMl conjugates of huCD37-3, huCD37-38, huCD37-50, and huCD37-51, respectively.
  • SMCC-DMl conjugates of a non-binding isotype control antibody resulted in cell killing with an EC50 value of only 20 nM.
  • the nonspecific hulgG- SMCC-DMl conjugate had an EC50 of 19 nM.
  • all conjugates tested reduced viability of Granta-519 cells completely at the highest concentration tested with an EC50 value of 0.047 nM, 0.13 nM and 0.088 nM for huCD37-3-SMCC-DMl, huCD37-3-SPP-DMl and huCD37-3-sulfo-mal- DM4, respectively.
  • the non-specific hulgG-SMCC-DMl conjugate had an EC50 of 19 nM.
  • non-binding isotype control conjugates reduced viability with an EC50 of 16 nM or greater than 30 nM for hulgG-SMCC-DMl or huIgG-PEG4-mal-DMl, respectively.
  • treatment with huCD37-3 conjugates completely reduced Granta-519 cell viability at the highest concentration tested with an EC50 of 0.014 nM or 0.012 nM for huCD37-3-SMCC-DMl or huCD37-3-PEG4-mal-DMl conjugates, respectively.
  • non- binding isotype control conjugates reduced viability with an EC50 of 6.5 nM or greater than 12 nM for hulgG-SMCC-DMl or huIgG-PEG4-mal-DMl, respectively.
  • non-binding isotype control conjugates reduced viability with an EC50 of 13 nM or 17 nM for hulgG-SMCC-DMl or huIgG-PEG4- mal-DMl, respectively.
  • treatment with huCD37-3 conjugates completely reduced SU-DHL-4 cell viability at the highest concentration tested with an EC50 of 0.031 nM or 0.024 nM for huCD37-3- SMCC-DM1 or huCD37-3-PEG4-mal-DMl conjugates, respectively.
  • non-binding isotype control conjugates reduced viability with an EC50 of greater than 30 nM for both hulgG-SMCC-DMl or huIgG-PEG4-mal-DMl .
  • the huCD37-3-SMCC-DMl conjugate also showed potency against the FL cell line DOHH-2 as well as CLL cell lines such as JVM-2 and JVM-3 ( Figure 32B).
  • huCD37-3 conjugates completely reduced Raji-VCR cell viability at the highest concentration tested with an EC50 of 0.1 1 nM or 0.037 nM for huCD37-3-SMCC-DMl or huCD37-3-PEG4-mal-DMl conjugates, respectively.
  • the non-binding isotype control conjugates reduced viability with an EC50 of 46 nM or 100 nM for hulgG-SMCC-DMl or huIgG-PEG4-mal-DMl , respectively.
  • the huCD37-3 antibody was also active against many cell lines including DOHH-2, Granata-519, SU-DHL-4, JVM-2, and JVM-3.
  • the anti-CD37 SMIP TRU-016 compound had no direct effect on survival of any of these cell lines.
  • the anti-CD20 antibody showed less direct activity than huCD37-3 in most of these cell lines despite the often higher CD20 expression levels as measured by quantitative flow cytometry (Figure 32A).
  • Anti-CD37 antibodies and their SMCC-DM1 conjugates were tested in an established xenograft model using BJAB lymphoma cells implanted subcutaneous into SCID mice. Animals were randomized by tumor volume into treatment groups when tumors reached a mean tumor volume of approximately 120 mm 3 and treated once on day 12 post cell inoculation with either 10 mg/kg of (A) huCD37-3 Ab, huCD37-3-SMCC-DMl, huCD37-50 Ab, huCD37-50-SMCC-DMl or (B) huCD37-38 Ab, huCD37-38-SMCC-DMl, huCD37-56 Ab, huCD37-56-SMCC-DMl .
  • A huCD37-3 Ab, huCD37-3-SMCC-DMl, huCD37-50 Ab, huCD37-50-SMCC-DMl
  • B huCD37-38 Ab, huCD37-38-SMCC-DM
  • the mean tumor volume of the different treatment groups is plotted against time post tumor cell inoculation in Figure 25. It is apparent that treatment with any of the antibodies resulted in a moderate reduction in mean tumor volume, while treatment with any of the SMCC-DM1 conjugates resulted in a more significant reduction in mean tumor volume.
  • a %T/C value was calculated which corresponds to the median tumor volume of each treated group divided by the median tumor volume of the vehicle treated group.
  • a treatment with a % T/C value of below 42% is considered active, while a treatment with a % T/C value of below 12% is considered highly active.
  • Treatment with all SMCC-DM1 conjugates tested resulted in a significant reduction in median tumor volume.
  • the %T/C value on day 29 post cell inoculation corresponded to 20%, 20%, 9% or 4% for huCD37-3-SMCC-DMl, huCD37-50-SMCC-DMl, huCD37- 38-SMCC-DM1 or huCD37-56-SMCC-DMl, respectively.
  • the sulfo-mal- DM4 and SPP-DM1 conjugates of the exemplary huCD37-3 antibody were compared to SMCC-DM1 conjugates in a xenograft model using BJAB lymphoma cells implanted intravenously into SCID mice.
  • the %T/C value on day 21 post cell inoculation corresponded to 49%, 5%, 7% or 4% for huCD37-3, huCD37-3-SMCC-DMl, huCD37-3- sulfo-mal-DM4 or huCD37-3-SPP-DMl, respectively.
  • huCD37-3- sulfo-mal-DM4 treatment resulted in 3 of 8 tumor-free survivors (TFS), while huCD37-3-SPP-DMl treatment resulted in 1 of 8 TFS.
  • TFS tumor-free survivors
  • No TFS were observed in the huCD37-3 antibody, huCD37-3-SMCC- DM1 or PBS vehicle control groups. This indicated that maytansinoid conjugates of the huCD37-3 antibody, such as for example SMCC-DM1, sulfo-mal-DM4 or SPP-DM1 conjugates, were highly active in the BJAB model.
  • a second xenograft model using SU-DHL-4 diffuse large B-cell lymphoma cells implanted subcutaneous into SCID mice was utilized to evaluate the in vivo efficacy of the sulfo-mal-DM4 and SPP- DM1 conjugates of the exemplary huCD37-3 antibody as compared to SMCC-DM1 conjugates.
  • Animals were randomized by body weight into treatment groups when tumors were established and treated once on day 17 post cell inoculation with either 10 mg/kg of huCD37-3 Ab, huCD37-3-SMCC-DMl, huCD37-3- sulfo-mal-DM4 or 5 mg/kg of huCD37-3-SPP-DMl .
  • the median tumor volume of the different treatment groups is plotted against time post tumor cell inoculation in Figure 27. It is apparent that treatment with the huCD37-3 antibody resulted in a reduction in median tumor volume, while treatment with any of the conjugates resulted in a more significant reduction in median tumor volume.
  • the %T/C value was calculated as described above for each treatment. The %T/C value on day 37 post cell inoculation corresponded to 32%, 1%, 1% or 3% for huCD37-3, huCD37-3-SMCC-DMl, huCD37-3-sulfo-mal-DM4 or huCD37-3-SPP-DMl, respectively.
  • huCD37-3-SMCC-DMl or huCD37-3-sulfo-mal-DM4 treatment resulted in 8 of 10 tumor- free survivors (TFS), while huCD37-3- SPP-DM1 treatment resulted in 9 of 10 TFS.
  • TFS tumor- free survivors
  • No TFS were observed in the huCD37-3 antibody or PBS vehicle control groups.
  • the huCD37-3 antibody itself was active with a single 10 mg/kg dose in the SU-DHL-4 model.
  • maytansinoid conjugates such as for example SMCC- DM1, sulfo-mal-DM4 or SPP-DM1 conjugates, added efficacy to the antibody and result in even greater potency in this model.
  • huCD37-3 antibody and its PEG4-mal-DMl and SMCC-DM1 conjugates were tested in an established xenograft model using BJAB lymphoma cells implanted subcutaneous into SCID mice. Animals were randomized by tumor volume into treatment groups when tumors reached a mean tumor volume of approximately 120 mm 3 and treated once on day 9 post cell inoculation with either 10 mg/kg of huCD37-3 Ab, huCD37-3-SMCC-DMl or huCD37-3-PEG4-mal-DMl . As seen in Figure 28, treatment with either conjugate resulted in a significant reduction in mean tumor volume.
  • the %T/C value was calculated as described above for each treatment using the median tumor volume for each treatment group.
  • the %T/C value on day 24 post cell inoculation corresponded to 48%, 16% or 5% for huCD37-3, huCD37-3-SMCC-DMl or huCD37-3-PEG4-mal-DMl, respectively.
  • huCD37-3-SMCC-DMl treatment resulted in 1 of 9 tumor-free survivors (TFS), while huCD37- PEG4- mal-DMl treatment resulted in 1 of 9 TFS. No TFS were observed in the huCD37-3 antibody or PBS vehicle control groups.
  • huCD37-3-SMCC-DMl was also active at a single dose of 5 mg/kg in this model with a %T/C value on day 24 post cell innoculation of 34%.
  • maytansinoid conjugates of the huCD37-3 antibody such as for example SMCC-DM1 or PEG4-mal-DMl conjugates, were highly active in the BJAB model.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Immunology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Epidemiology (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Cell Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Hematology (AREA)
  • Biomedical Technology (AREA)
  • Microbiology (AREA)
  • Oncology (AREA)
  • Urology & Nephrology (AREA)
  • Mycology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Food Science & Technology (AREA)
  • Biotechnology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Toxicology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/US2011/028172 2010-03-12 2011-03-11 Cd37-binding molecules and immunoconjugates thereof Ceased WO2011112978A1 (en)

Priority Applications (28)

Application Number Priority Date Filing Date Title
ES11754195T ES2748347T3 (es) 2010-03-12 2011-03-11 Moléculas de unión a CD37 e inmunoconjugados de las mismas
MX2015008742A MX375439B (es) 2010-03-12 2011-03-11 Moleculas de union cd37 y sus inmunoconjugados.
SM20190549T SMT201900549T1 (it) 2010-03-12 2011-03-11 Molecole leganti il cd37 e loro immunoconiugati
EP19183557.8A EP3620467A1 (en) 2010-03-12 2011-03-11 Cd37-binding molecules and immunoconjugates thereof
HRP20191688TT HRP20191688T1 (hr) 2010-03-12 2011-03-11 Cd37-vezujuće molekule i njihovi imunokonjugati
CN201180013661.2A CN102971012B (zh) 2010-03-12 2011-03-11 Cd37结合分子及其免疫缀合物
RSP20191291 RS59389B1 (sr) 2010-03-12 2011-03-11 Cd37-vezujući molekuli i njihovi imunokonjugati
BR112012023010A BR112012023010A8 (pt) 2010-03-12 2011-03-11 Anticorpo ou fragmento de ligação a antígeno do mesmo que se liga especificamente a cd37, imunoconjugado compreendendo os mesmos, uso dos referidos anticorpo, fragmento e imunoconjugado, composição compreendendo os mesmos, kit, célula isolada, bem como método in vitro para inibir o crescimento de uma célula que expressa cd37
LT11754195T LT2544719T (lt) 2010-03-12 2011-03-11 Cd37 surišančios molekulės, ir jų imunokonjugatai
KR1020157000870A KR101764572B1 (ko) 2010-03-12 2011-03-11 Cd37―결합 분자 및 이의 면역접합체
UAA201210674A UA110698C2 (uk) 2010-03-12 2011-03-11 Антитіло проти cd37 та його імунокон'югати
SG2012064168A SG183542A1 (en) 2010-03-12 2011-03-11 Cd37-binding molecules and immunoconjugates thereof
KR1020127026626A KR101644674B1 (ko) 2010-03-12 2011-03-11 Cd37―결합 분자 및 이의 면역접합체
EP11754195.3A EP2544719B1 (en) 2010-03-12 2011-03-11 Cd37-binding molecules and immunoconjugates thereof
SI201131793T SI2544719T1 (sl) 2010-03-12 2011-03-11 CD37-povezovalne molekule in njihovi imunokonjugati
AU2011226672A AU2011226672B2 (en) 2010-03-12 2011-03-11 CD37-binding molecules and immunoconjugates thereof
DK11754195.3T DK2544719T3 (da) 2010-03-12 2011-03-11 Cd37-bindingsmolekyler og immunkonjugater deraf
RU2012139045A RU2610662C9 (ru) 2010-03-12 2011-03-11 Cd37-связывающие молекулы и их иммуноконъюгаты
JP2012557290A JP5932672B2 (ja) 2010-03-12 2011-03-11 Cd37結合分子及びそのイムノコンジュゲート
PL11754195T PL2544719T3 (pl) 2010-03-12 2011-03-11 Cząsteczki wiążące cd37 i ich immunokoniugaty
MX2012010514A MX338932B (es) 2010-03-12 2011-03-11 Moleculas de union cd37 y sus inmunoconjugados.
CA2792618A CA2792618C (en) 2010-03-12 2011-03-11 Cd37-binding molecules and immunoconjugates thereof
NZ602176A NZ602176A (en) 2010-03-12 2011-03-11 Cd37-binding molecules and immunoconjugates thereof
IL221682A IL221682A (en) 2010-03-12 2012-08-29 Molecules bind 37cd and their immune couplings
AU2015246118A AU2015246118B2 (en) 2010-03-12 2015-10-22 CD37-Binding Molecules And Immunoconjugates Thereof
IL252398A IL252398B (en) 2010-03-12 2017-05-21 cd37-binding molecules and their immunoconjugates
AU2017248441A AU2017248441A1 (en) 2010-03-12 2017-10-17 CD37-Binding Molecules and Immunoconjugates Thereof
CY20191101025T CY1122091T1 (el) 2010-03-12 2019-10-02 Μορια δεσμευσης-cd37 και ανοσοσυζευγματα εξ αυτων

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US31362810P 2010-03-12 2010-03-12
US61/313,628 2010-03-12
US32731410P 2010-04-23 2010-04-23
US61/327,314 2010-04-23
US41264410P 2010-11-11 2010-11-11
US61/412,644 2010-11-11

Publications (1)

Publication Number Publication Date
WO2011112978A1 true WO2011112978A1 (en) 2011-09-15

Family

ID=44563875

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2011/028172 Ceased WO2011112978A1 (en) 2010-03-12 2011-03-11 Cd37-binding molecules and immunoconjugates thereof

Country Status (28)

Country Link
US (5) US8765917B2 (https=)
EP (2) EP2544719B1 (https=)
JP (5) JP5932672B2 (https=)
KR (2) KR101764572B1 (https=)
CN (2) CN106046159B (https=)
AR (1) AR080513A1 (https=)
AU (3) AU2011226672B2 (https=)
BR (1) BR112012023010A8 (https=)
CA (2) CA3015111C (https=)
CY (1) CY1122091T1 (https=)
DK (1) DK2544719T3 (https=)
ES (1) ES2748347T3 (https=)
HR (1) HRP20191688T1 (https=)
HU (1) HUE046360T2 (https=)
IL (2) IL221682A (https=)
LT (1) LT2544719T (https=)
MX (2) MX338932B (https=)
MY (2) MY173839A (https=)
NZ (2) NZ703481A (https=)
PL (1) PL2544719T3 (https=)
PT (1) PT2544719T (https=)
RS (1) RS59389B1 (https=)
RU (2) RU2610662C9 (https=)
SG (3) SG10201501803YA (https=)
SI (1) SI2544719T1 (https=)
SM (1) SMT201900549T1 (https=)
TW (2) TWI593424B (https=)
WO (1) WO2011112978A1 (https=)

Cited By (38)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8258268B2 (en) 2005-08-19 2012-09-04 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
JP2015501654A (ja) * 2011-12-13 2015-01-19 ノルディック ナノベクター アーエス 治療用キメラ型抗cd37抗体hh1
CN104334580A (zh) * 2012-02-24 2015-02-04 施特姆森特Rx股份有限公司 抗sez6抗体及使用方法
WO2015017552A1 (en) * 2013-08-01 2015-02-05 Agensys, Inc. Antibody drug conjugates (adc) that bind to cd37 proteins
CN104364651A (zh) * 2012-03-30 2015-02-18 伊缪诺金公司 用于增加基于cd37的疗法的功效的方法
EP2694105A4 (en) * 2011-04-01 2015-04-29 Immunogen Inc CD37 BINDING MOLECULES AND IMMUNOCONJUGATES THEREOF
WO2015081891A1 (en) * 2013-12-06 2015-06-11 Baikang (Suzhou) Co., Ltd Bioreversable promoieties for nitrogen-containing and hydroxyl-containing drugs
WO2016036804A1 (en) 2014-09-03 2016-03-10 Immunogen, Inc. Cytotoxic benzodiazepine derivatives
WO2016054603A2 (en) 2014-10-02 2016-04-07 City Of Hope Multivalent meditopes, meditope-binding antibodies and uses thereof
US9346887B2 (en) 2010-03-12 2016-05-24 Immunogen, Inc. CD37-binding molecules and immunoconjugates thereof
WO2017091745A1 (en) 2015-11-25 2017-06-01 Immunogen, Inc. Pharmaceutical formulations and methods of use thereof
EP3311846A1 (en) 2014-09-02 2018-04-25 ImmunoGen, Inc. Methods for formulating antibody drug conjugate compositions
WO2018160539A1 (en) 2017-02-28 2018-09-07 Immunogen, Inc. Maytansinoid derivatives with self-immolative peptide linkers and conjugates thereof
WO2018178396A1 (en) 2017-03-31 2018-10-04 Genmab Holding B.V. Bispecific anti-cd37 antibodies, monoclonal anti-cd37 antibodies and methods of use thereof
WO2018195243A1 (en) 2017-04-20 2018-10-25 Immunogen, Inc. Cytotoxic benzodiazepine derivatives and conjugates thereof
EP3302561A4 (en) * 2015-06-08 2019-02-06 Debiopharm International SA COMBINATIONS OF ANTI-CD37 IMMUNOCONJUGATE AND ANTI-CD20 ANTIBODIES
WO2019133652A1 (en) 2017-12-28 2019-07-04 Immunogen, Inc. Benzodiazepine derivatives
WO2019145455A1 (en) 2018-01-24 2019-08-01 Genmab B.V. Polypeptide variants and uses thereof
WO2019211472A1 (en) 2018-05-03 2019-11-07 Genmab B.V. Antibody variant combinations and uses thereof
WO2019243626A1 (en) 2018-06-22 2019-12-26 Genmab A/S Method for producing a controlled mixture of two or more different antibodies
WO2019243636A1 (en) 2018-06-22 2019-12-26 Genmab Holding B.V. Anti-cd37 antibodies and anti-cd20 antibodies, compositions and methods of use thereof
WO2020070313A1 (en) 2018-10-04 2020-04-09 Genmab Holding B.V. Pharmaceutical compositions comprising bispecific anti-cd37 antibodies
US10640508B2 (en) 2017-10-13 2020-05-05 Massachusetts Institute Of Technology Diazene directed modular synthesis of compounds with quaternary carbon centers
US10918627B2 (en) 2016-05-11 2021-02-16 Massachusetts Institute Of Technology Convergent and enantioselective total synthesis of Communesin analogs
US10918735B2 (en) 2012-12-04 2021-02-16 Massachusetts Institute Of Technology Substituted pyrazino[1′,2′:1,5]pyrrolo[2,3-b]indole-1,4-diones for cancer treatment
EP3778601A1 (en) 2014-09-03 2021-02-17 ImmunoGen, Inc. Cytotoxic benzodiazepine derivatives
WO2021089850A1 (en) 2019-11-06 2021-05-14 Genmab B.V. Antibody variant combinations and uses thereof
WO2021165488A1 (en) 2020-02-21 2021-08-26 Genmab B.V. Methods for the quantification of glycoproteins
US11104740B2 (en) 2015-08-28 2021-08-31 Debiopharm International, S.A. Antibodies and assays for detection of CD37
US11278629B2 (en) 2016-11-02 2022-03-22 Debiopharm International, S.A. Methods for improving anti-CD37 immunoconjugate therapy
US11535634B2 (en) 2019-06-05 2022-12-27 Massachusetts Institute Of Technology Compounds, conjugates, and compositions of epipolythiodiketopiperazines and polythiodiketopiperazines and uses thereof
WO2023198884A1 (en) 2022-04-14 2023-10-19 Debiopharm Research & Manufacturing S.A. Ligand-drug-conjugates with improved pharmacokinetic and drug release properties
US11932650B2 (en) 2017-05-11 2024-03-19 Massachusetts Institute Of Technology Potent agelastatin derivatives as modulators for cancer invasion and metastasis
KR20240099178A (ko) 2021-10-18 2024-06-28 다이이찌 산쿄 가부시키가이샤 항 cd37 항체-약물 콘주게이트
US12030888B2 (en) 2021-02-24 2024-07-09 Massachusetts Institute Of Technology Himastatin derivatives, and processes of preparation thereof, and uses thereof
WO2024219442A1 (ja) 2023-04-19 2024-10-24 第一三共株式会社 抗体-薬物コンジュゲートと他の薬剤との組み合わせ
US12144818B2 (en) 2018-05-30 2024-11-19 Debiopharm International, S.A. Method for treating cancer in a human patient by administering an anti-CD37 immunoconjugate using various dosing regimens
WO2025083205A1 (en) 2023-10-18 2025-04-24 Debiopharm International S.A. Drug combination comprising anti-cd37 antibody maytansine conjugate and bcl2 inhibitor or pi3k inhibitor

Families Citing this family (40)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JPH0737792B2 (ja) 1986-02-14 1995-04-26 株式会社日立製作所 ポンプ運転台数の制御装置
US8088387B2 (en) 2003-10-10 2012-01-03 Immunogen Inc. Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates
US7960139B2 (en) 2007-03-23 2011-06-14 Academia Sinica Alkynyl sugar analogs for the labeling and visualization of glycoconjugates in cells
NZ610239A (en) 2008-04-30 2014-11-28 Immunogen Inc Cross-linkers and their uses
ES2442024T3 (es) 2008-07-15 2014-02-07 Academia Sinica Matrices de glucano sobre portaobjetos de vidrio revestidos con aluminio de tipo PTFE y métodos relacionados
US11377485B2 (en) 2009-12-02 2022-07-05 Academia Sinica Methods for modifying human antibodies by glycan engineering
US10087236B2 (en) 2009-12-02 2018-10-02 Academia Sinica Methods for modifying human antibodies by glycan engineering
US10338069B2 (en) 2010-04-12 2019-07-02 Academia Sinica Glycan arrays for high throughput screening of viruses
WO2012103763A1 (zh) 2011-02-01 2012-08-09 华为技术有限公司 功率节省方法、接入点设备和终端站点设备
MY171008A (en) 2011-03-29 2019-09-23 Immunogen Inc Preparation of maytansinoid antibody conjugates by a one-step process
ME03353B (me) 2011-03-29 2019-10-20 Immunogen Inc Priprema konjugata antitela i majtanzinoida jednostepenim postupkom
US10130714B2 (en) 2012-04-14 2018-11-20 Academia Sinica Enhanced anti-influenza agents conjugated with anti-inflammatory activity
WO2014031498A1 (en) 2012-08-18 2014-02-27 Academia Sinica Cell-permeable probes for identification and imaging of sialidases
RU2661083C2 (ru) 2012-10-04 2018-07-11 Иммуноджен, Инк. Использование пвдф-мембраны для очистки конъюгатов клеточно-связывающий агент - цитотоксический агент
US9168300B2 (en) 2013-03-14 2015-10-27 Oncomed Pharmaceuticals, Inc. MET-binding agents and uses thereof
CA2900955A1 (en) * 2013-03-14 2014-10-02 Oncomed Pharmaceuticals, Inc. Met-binding agents and uses thereof
EP3013365B1 (en) 2013-06-26 2019-06-05 Academia Sinica Rm2 antigens and use thereof
EP3013347B1 (en) 2013-06-27 2019-12-11 Academia Sinica Glycan conjugates and use thereof
JP6486368B2 (ja) 2013-09-06 2019-03-20 アカデミア シニカAcademia Sinica 改変されたグリコシル基を含む糖脂質を用いたヒトiNKT細胞の活性化
AU2015206370A1 (en) 2014-01-16 2016-07-07 Academia Sinica Compositions and methods for treatment and detection of cancers
US10150818B2 (en) 2014-01-16 2018-12-11 Academia Sinica Compositions and methods for treatment and detection of cancers
CN106415244B (zh) 2014-03-27 2020-04-24 中央研究院 反应性标记化合物及其用途
WO2015175533A2 (en) * 2014-05-13 2015-11-19 Immunogen, Inc. Anti-cd37 immunoconjugate dosing regimens
JP7093612B2 (ja) 2014-05-27 2022-06-30 アカデミア シニカ Bacteroides由来のフコシダーゼおよびそれを使用する方法
CA2950415A1 (en) 2014-05-27 2015-12-03 Academia Sinica Anti-cd20 glycoantibodies and uses thereof
CN106661099A (zh) 2014-05-27 2017-05-10 中央研究院 抗her2醣抗体及其用途
US10118969B2 (en) 2014-05-27 2018-11-06 Academia Sinica Compositions and methods relating to universal glycoforms for enhanced antibody efficacy
WO2015184001A1 (en) 2014-05-28 2015-12-03 Academia Sinica Anti-tnf-alpha glycoantibodies and uses thereof
TWI745275B (zh) 2014-09-08 2021-11-11 中央研究院 使用醣脂激活人類iNKT細胞
US10413615B2 (en) 2014-11-19 2019-09-17 Immunogen, Inc. Process for preparing cell-binding agent-cytotoxic agent conjugates
US10495645B2 (en) 2015-01-16 2019-12-03 Academia Sinica Cancer markers and methods of use thereof
US9975965B2 (en) 2015-01-16 2018-05-22 Academia Sinica Compositions and methods for treatment and detection of cancers
SMT202000614T1 (it) 2015-06-29 2021-01-05 Immunogen Inc Coniugati di anticorpi ingegnerizzati con cisteina
WO2017107817A1 (zh) * 2015-12-21 2017-06-29 江苏恒瑞医药股份有限公司 一种抗体药物偶联物的制备方法
TW201731532A (zh) 2016-02-05 2017-09-16 伊繆諾金公司 用於製備細胞結合劑-細胞毒性劑結合物之有效方法
EP3426693A4 (en) 2016-03-08 2019-11-13 Academia Sinica PROCESS FOR MODULAR SYNTHESIS OF N-GLYCANES AND ARRANGEMENTS THEREOF
CA3034057A1 (en) 2016-08-22 2018-03-01 CHO Pharma Inc. Antibodies, binding fragments, and methods of use
WO2018098258A2 (en) 2016-11-23 2018-05-31 Immunogen, Inc. Selective sulfonation of benzodiazepine derivatives
CN118599009A (zh) 2017-03-16 2024-09-06 综合医院公司 靶向cd37的嵌合抗原受体
SG11202110922QA (en) 2019-04-26 2021-10-28 Immunogen Inc Camptothecin derivatives

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080227198A1 (en) * 2001-11-09 2008-09-18 Biogen Idec Inc. Immunoregulatory antibodies and uses thereof
US20090274692A1 (en) * 2008-04-11 2009-11-05 Trubion Pharmaceuticals, Inc. Cd37 immunotherapeutic and combination with bifunctional chemotherapeutic thereof

Family Cites Families (137)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3720760A (en) 1968-09-06 1973-03-13 Pharmacia Ab Method for determining the presence of reagin-immunoglobulins(reagin-ig)directed against certain allergens,in aqueous samples
US4307016A (en) 1978-03-24 1981-12-22 Takeda Chemical Industries, Ltd. Demethyl maytansinoids
US4256746A (en) 1978-11-14 1981-03-17 Takeda Chemical Industries Dechloromaytansinoids, their pharmaceutical compositions and method of use
JPS55102583A (en) 1979-01-31 1980-08-05 Takeda Chem Ind Ltd 20-acyloxy-20-demethylmaytansinoid compound
JPS55162791A (en) 1979-06-05 1980-12-18 Takeda Chem Ind Ltd Antibiotic c-15003pnd and its preparation
JPS5645483A (en) 1979-09-19 1981-04-25 Takeda Chem Ind Ltd C-15003phm and its preparation
EP0028683A1 (en) 1979-09-21 1981-05-20 Takeda Chemical Industries, Ltd. Antibiotic C-15003 PHO and production thereof
JPS5645485A (en) 1979-09-21 1981-04-25 Takeda Chem Ind Ltd Production of c-15003pnd
WO1982001188A1 (en) 1980-10-08 1982-04-15 Takeda Chemical Industries Ltd 4,5-deoxymaytansinoide compounds and process for preparing same
US4450254A (en) 1980-11-03 1984-05-22 Standard Oil Company Impact improvement of high nitrile resins
US4313946A (en) 1981-01-27 1982-02-02 The United States Of America As Represented By The Secretary Of Agriculture Chemotherapeutically active maytansinoids from Trewia nudiflora
US4315929A (en) 1981-01-27 1982-02-16 The United States Of America As Represented By The Secretary Of Agriculture Method of controlling the European corn borer with trewiasine
US4563304A (en) 1981-02-27 1986-01-07 Pharmacia Fine Chemicals Ab Pyridine compounds modifying proteins, polypeptides or polysaccharides
JPS57192389A (en) 1981-05-20 1982-11-26 Takeda Chem Ind Ltd Novel maytansinoid
US4588585A (en) 1982-10-19 1986-05-13 Cetus Corporation Human recombinant cysteine depleted interferon-β muteins
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US5681718A (en) 1986-03-14 1997-10-28 Celltech Limited Methods for enhanced production of tissue plasminogen activator in cell culture using alkanoic acids or salts thereof
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
IL106992A (en) 1988-02-11 1994-06-24 Bristol Myers Squibb Co Acylhydrazone derivatives of anthracycline and methods for their preparation
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
US5208020A (en) 1989-10-25 1993-05-04 Immunogen Inc. Cytotoxic agents comprising maytansinoids and their therapeutic use
US5270163A (en) 1990-06-11 1993-12-14 University Research Corporation Methods for identifying nucleic acid ligands
US5496938A (en) 1990-06-11 1996-03-05 Nexstar Pharmaceuticals, Inc. Nucleic acid ligands to HIV-RT and HIV-1 rev
US6344321B1 (en) 1990-06-11 2002-02-05 Gilead Sciences, Inc. Nucleic acid ligands which bind to hepatocyte growth factor/scatter factor (HGF/SF) or its receptor c-met
US5705337A (en) 1990-06-11 1998-01-06 Nexstar Pharmaceuticals, Inc. Systematic evolution of ligands by exponential enrichment: chemi-SELEX
US5683867A (en) 1990-06-11 1997-11-04 Nexstar Pharmaceuticals, Inc. Systematic evolution of ligands by exponential enrichment: blended SELEX
US6172197B1 (en) 1991-07-10 2001-01-09 Medical Research Council Methods for producing members of specific binding pairs
GB9015198D0 (en) 1990-07-10 1990-08-29 Brien Caroline J O Binding substance
ATE158021T1 (de) 1990-08-29 1997-09-15 Genpharm Int Produktion und nützung nicht-menschliche transgentiere zur produktion heterologe antikörper
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
CA2095633C (en) 1990-12-03 2003-02-04 Lisa J. Garrard Enrichment method for variant proteins with altered binding properties
US5840867A (en) 1991-02-21 1998-11-24 Gilead Sciences, Inc. Aptamer analogs specific for biomolecules
US5582981A (en) 1991-08-14 1996-12-10 Gilead Sciences, Inc. Method for identifying an oligonucleotide aptamer specific for a target
PT1024191E (pt) 1991-12-02 2008-12-22 Medical Res Council Produção de auto-anticorpos a partir de reportórios de segmentos de anticorpo e exibidos em fagos
EP0563475B1 (en) 1992-03-25 2000-05-31 Immunogen Inc Cell binding agent conjugates of derivatives of CC-1065
US5756291A (en) 1992-08-21 1998-05-26 Gilead Sciences, Inc. Aptamers specific for biomolecules and methods of making
US5595756A (en) 1993-12-22 1997-01-21 Inex Pharmaceuticals Corporation Liposomal compositions for enhanced retention of bioactive agents
US5977316A (en) 1995-01-17 1999-11-02 The Board Of Trustees Of The University Of Kentucky Monoclonal antibody 1A7 and related polypeptides
US5731168A (en) 1995-03-01 1998-03-24 Genentech, Inc. Method for making heteromultimeric polypeptides
US5641870A (en) 1995-04-20 1997-06-24 Genentech, Inc. Low pH hydrophobic interaction chromatography for antibody purification
US7264963B1 (en) 1995-08-18 2007-09-04 Morphosys Ag Protein(poly)peptide libraries
ES2176484T3 (es) 1995-08-18 2002-12-01 Morphosys Ag Bancos de proteinas/(poli)peptidos.
US20060057573A1 (en) 2002-02-15 2006-03-16 Somalogic, Inc Methods and reagents for detecting target binding by nucleic acid ligands
US20030054360A1 (en) 1999-01-19 2003-03-20 Larry Gold Method and apparatus for the automated generation of nucleic acid ligands
WO2001002588A2 (en) 1999-07-02 2001-01-11 Morphosys Ag Generation of specific binding partners binding to (poly)peptides encoded by genomic dna fragments or ests
AU775373B2 (en) 1999-10-01 2004-07-29 Immunogen, Inc. Compositions and methods for treating cancer using immunoconjugates and chemotherapeutic agents
US7303749B1 (en) 1999-10-01 2007-12-04 Immunogen Inc. Compositions and methods for treating cancer using immunoconjugates and chemotherapeutic agents
AU6461201A (en) * 2000-07-12 2002-01-21 Idec Pharma Corp Treatment of b cell malignancies using combination of b cell depleting antibody and immune modulating antibody related applications
US6333410B1 (en) 2000-08-18 2001-12-25 Immunogen, Inc. Process for the preparation and purification of thiol-containing maytansinoids
US7312325B2 (en) 2000-09-26 2007-12-25 Duke University RNA aptamers and methods for identifying the same
US7829084B2 (en) 2001-01-17 2010-11-09 Trubion Pharmaceuticals, Inc. Binding constructs and methods for use thereof
US7754208B2 (en) 2001-01-17 2010-07-13 Trubion Pharmaceuticals, Inc. Binding domain-immunoglobulin fusion proteins
KR20080087184A (ko) * 2001-01-31 2008-09-30 바이오겐 아이덱 인크. 종양질환 치료를 위한 cd23 길항제의 용도
CN100574803C (zh) * 2001-01-31 2009-12-30 拜奥根Idec公司 免疫调节抗体在治疗肿瘤性疾病中的用途
US6441163B1 (en) 2001-05-31 2002-08-27 Immunogen, Inc. Methods for preparation of cytotoxic conjugates of maytansinoids and cell binding agents
CA2450793A1 (en) * 2001-06-20 2002-12-27 Prochon Biotech Ltd. Antibodies that block receptor protein tyrosine kinase activation, methods of screening for and uses thereof
BR122015016384B8 (pt) 2001-11-08 2021-07-27 Beijing Wantai Biological Pharmacy Entpr Co Ltd polipeptídio recombinante ou isolado, molécula de ácido nucléico, kit de diagnóstico para detectar a infecção pelo vírus da hepatite e, composição de vacina, composição farmacêutica, vetor de expressão recombinante, célula hospedeira transformada e uso do polipeptídeo recombinante ou isolado
MXPA04004634A (es) 2001-11-16 2004-08-12 Idec Pharma Corp Expresion policistronica de anticuerpos.
US6716821B2 (en) 2001-12-21 2004-04-06 Immunogen Inc. Cytotoxic agents bearing a reactive polyethylene glycol moiety, cytotoxic conjugates comprising polyethylene glycol linking groups, and methods of making and using the same
GB0216648D0 (en) 2002-07-18 2002-08-28 Lonza Biologics Plc Method of expressing recombinant protein in CHO cells
EP1560596A1 (en) * 2002-11-15 2005-08-10 Immunomedics, Inc. Use of multi-specific, non-covalent complexes for targeted delivery of therapeutics
US20050124565A1 (en) 2002-11-21 2005-06-09 Diener John L. Stabilized aptamers to platelet derived growth factor and their use as oncology therapeutics
CA2508831C (en) 2002-12-13 2012-05-01 Immunomedics, Inc. Immunoconjugates with an intracellularly-cleavable linkage
US7534427B2 (en) 2002-12-31 2009-05-19 Immunomedics, Inc. Immunotherapy of B cell malignancies and autoimmune diseases using unconjugated antibodies and conjugated antibodies and antibody combinations and fusion proteins
ES2702942T3 (es) 2003-04-17 2019-03-06 Alnylam Pharmaceuticals Inc Agentes de ARNi modificados
CN1802388B (zh) 2003-05-09 2011-01-05 杜克大学 Cd20特异抗体及使用它们的方法
US8088387B2 (en) 2003-10-10 2012-01-03 Immunogen Inc. Method of targeting specific cell populations using cell-binding agent maytansinoid conjugates linked via a non-cleavable linker, said conjugates, and methods of making said conjugates
US7276497B2 (en) 2003-05-20 2007-10-02 Immunogen Inc. Cytotoxic agents comprising new maytansinoids
US7754209B2 (en) 2003-07-26 2010-07-13 Trubion Pharmaceuticals Binding constructs and methods for use thereof
WO2005024042A2 (en) 2003-09-04 2005-03-17 The Regents Of The University Of California Aptamers and methods for their in vitro selection and uses thereof
US20080187954A1 (en) 2004-03-10 2008-08-07 Lonza Ltd. Method For Producing Antibodies
FR2867784B1 (fr) 2004-03-17 2006-06-09 Commissariat Energie Atomique Aptameres selectionnes a partir de cellules vivantes tumorales et leurs applications
US20050239134A1 (en) 2004-04-21 2005-10-27 Board Of Regents, The University Of Texas System Combinatorial selection of phosphorothioate single-stranded DNA aptamers for TGF-beta-1 protein
US7241598B2 (en) 2004-06-29 2007-07-10 The Chinese University Of Hong Kong Frame-shifting PCR for germline immunoglobulin genes retrieval and antibody engineering
CA2572289A1 (en) 2004-06-30 2006-08-17 Centocor, Inc. Anti-mcp-1 antibodies, compositions, methods and uses
CA2581208A1 (en) 2004-08-30 2006-03-09 Lonza Biologics Plc. Affinity- plus ion exchange- chromatography for purifying antibodies
EP1838736B1 (en) 2005-01-05 2013-03-06 Biogen Idec MA Inc. Cripto binding molecules
CN101155831B (zh) 2005-02-10 2015-08-19 贝勒研究院 抗干扰素α单克隆抗体及其使用方法
US8318906B2 (en) 2005-04-15 2012-11-27 The Regents Of The University Of California EMP2 antibodies and their therapeutic uses
US20090041783A1 (en) 2005-04-28 2009-02-12 Mochida Pharmaceutical Co., Ltd. Anti-platelet membrane glycoprotein vi monoclonal antibody
ZA200709956B (en) 2005-05-20 2009-02-25 Genentech Inc Pretreatment of a biological sample from an autoimmune disease subject
JP2008546647A (ja) * 2005-06-08 2008-12-25 デューク ユニバーシティ 移植のための抗−cd19抗体治療
RU2423381C2 (ru) * 2005-07-25 2011-07-10 Трабьон Фармасьютикалз, Инк. Снижение количества в-клеток с использованием cd37-специфических и cd20-специфических связывающих молекул
US20080279850A1 (en) 2005-07-25 2008-11-13 Trubion Pharmaceuticals, Inc. B-Cell Reduction Using CD37-Specific and CD20-Specific Binding Molecules
US20070213292A1 (en) 2005-08-10 2007-09-13 The Rockefeller University Chemically modified oligonucleotides for use in modulating micro RNA and uses thereof
EP1806365A1 (en) * 2006-01-05 2007-07-11 Boehringer Ingelheim International GmbH Antibody molecules specific for fibroblast activation protein and immunoconjugates containing them
EP2032606B1 (en) 2006-05-30 2013-11-27 Genentech, Inc. Antibodies and immunoconjugates and uses therefor
NZ573646A (en) 2006-06-12 2012-04-27 Wyeth Llc Single-chain multivalent binding proteins with effector function
CN101563365B (zh) 2006-08-03 2012-10-31 瓦西尼斯公司 抗-il-6单克隆抗体及其用途
JP2010507394A (ja) 2006-10-24 2010-03-11 トルービオン ファーマスーティカルズ インコーポレイテッド 改良免疫糖タンパク質のための物質および方法
US7846434B2 (en) 2006-10-24 2010-12-07 Trubion Pharmaceuticals, Inc. Materials and methods for improved immunoglycoproteins
US7691980B2 (en) 2007-01-09 2010-04-06 Bio-Rad Laboratories, Inc. Enhanced capacity and purification of antibodies by mixed mode chromatography in the presence of aqueous-soluble nonionic organic polymers
RS53008B2 (sr) * 2007-04-03 2022-12-30 Amgen Res Munich Gmbh Interspecijski specifičan cd3-epsilon vezujući domen
CA2685830C (en) * 2007-05-24 2012-12-18 Abbott Laboratories Immunoassays exhibiting reduced cross-reactivity with hydrophobic drug analyte metabolites
JP2010532764A (ja) * 2007-07-06 2010-10-14 トゥルビオン・ファーマシューティカルズ・インコーポレーテッド C末端に配置された特異的結合性ドメインを有する結合性ペプチド
PE20140196A1 (es) * 2007-08-09 2014-03-19 Boehringer Ingelheim Int Anticuerpos anti-cd37
GB2454915B (en) 2007-11-23 2012-02-15 Schlumberger Holdings Spooling apparatus for well intervention system
WO2009085576A2 (en) 2007-12-28 2009-07-09 Spring Bioscience Corporation Positive control cell pellets for immunohistochemistry and methods of use thereof
EP2238154B1 (en) 2008-01-18 2015-09-16 Bio-Rad Laboratories, Inc. Enhanced purification of phosphorylated and non-phosphorylated biomolecules by apatite chromatography
US7740844B2 (en) 2008-04-29 2010-06-22 Taiwan Liposome Co. Ltd Anti-VEGF monoclonal antibody
SG189817A1 (en) 2008-04-30 2013-05-31 Immunogen Inc Potent conjugates and hydrophilic linkers
NZ610239A (en) 2008-04-30 2014-11-28 Immunogen Inc Cross-linkers and their uses
CA2727278A1 (en) 2008-06-16 2010-01-21 Immunogen, Inc. Novel synergistic effects
AU2009270988A1 (en) 2008-07-15 2010-01-21 Genentech, Inc. Anthracycline derivative conjugates, process for their preparation and their use as antitumor compounds
WO2010057047A1 (en) 2008-11-13 2010-05-20 Trubion Pharmaceutics, Inc. Cd37 immunotherapeutic combination therapies and uses thereof
CN102459335B (zh) * 2009-04-17 2015-11-25 伊缪纳斯制药株式会社 特异性结合Aβ寡聚体的抗体及其用途
CN102596922A (zh) 2009-10-06 2012-07-18 免疫基因公司 有效的缀合物和亲水性连接体
CA2785907A1 (en) 2009-12-29 2011-07-28 Emergent Product Development Seattle, Llc Ron binding constructs and methods of use thereof
KR20130009760A (ko) 2010-02-10 2013-01-23 이뮤노젠 아이엔씨 Cd20 항체 및 이의 용도
US9175086B2 (en) 2010-02-10 2015-11-03 Immunogen, Inc. CD20 antibodies and uses thereof
SG10201501803YA (en) * 2010-03-12 2015-05-28 Immunogen Inc Cd37-binding molecules and immunoconjugates thereof
WO2011130580A1 (en) 2010-04-15 2011-10-20 Alper Biotech, Llc Monoclonal antibodies against her2 antigens, and uses therefor
ME03353B (me) 2011-03-29 2019-10-20 Immunogen Inc Priprema konjugata antitela i majtanzinoida jednostepenim postupkom
AU2012236210B2 (en) 2011-04-01 2016-02-04 Immunogen, Inc. CD37-binding molecules and immunoconjugates thereof
US20130058947A1 (en) 2011-09-02 2013-03-07 Stem Centrx, Inc Novel Modulators and Methods of Use
CA2858964A1 (en) 2011-12-13 2013-06-20 Nordic Nanovector As Chimeric therapeutic anti-cd37 antibodie hh1
RU2014140119A (ru) 2012-03-30 2016-05-27 Иммьюноджен, Инк. Способы повышения эффективности терапии на основе cd37
EP2849783A1 (en) 2012-05-16 2015-03-25 Boehringer Ingelheim International GmbH Combination of cd37 antibodies with further agents
US20140120083A1 (en) 2012-11-01 2014-05-01 Infinity Pharmaceuticals, Inc. Treatment of cancers using pi3 kinase isoform modulators
CN107753954A (zh) 2012-12-13 2018-03-06 免疫医疗公司 功效改进且毒性降低的抗体与sn‑38的免疫缀合物的剂量
WO2014143807A2 (en) 2013-03-15 2014-09-18 Stromatt Scott Anti-cd37 antibody and bcr pathway antagonist combination therapy for treatment of b-cell malignancies and disorders
US20160130659A1 (en) 2013-06-05 2016-05-12 Merck Sharp & Dohme Corp. Compositions and methods for treating cancer
CA2911962A1 (en) 2013-06-07 2014-12-11 Roy H. Larsen Method for upregulating antigen expression
IL312865B2 (en) 2013-09-11 2025-06-01 Eagle Biologics Inc Liquid protein formulations containing viscosity-lowering agents
JP6478989B2 (ja) 2013-11-07 2019-03-06 エフ.ホフマン−ラ ロシュ アーゲーF. Hoffmann−La Roche Aktiengesellschaft 抗cd20抗体とbtk阻害剤とを用いた併用療法
WO2015116729A2 (en) 2014-01-28 2015-08-06 Emergent Product Development Seattle, Llc Anti-cd37 antibody and anti-cd20 antibody combination therapy for treatment of b-cell malignancies and disorders
WO2015175533A2 (en) 2014-05-13 2015-11-19 Immunogen, Inc. Anti-cd37 immunoconjugate dosing regimens
EP3302561A4 (en) 2015-06-08 2019-02-06 Debiopharm International SA COMBINATIONS OF ANTI-CD37 IMMUNOCONJUGATE AND ANTI-CD20 ANTIBODIES
KR102766022B1 (ko) 2015-08-28 2025-02-10 데비오팜 인터네셔날 에스 에이 Cd37 의 검출을 위한 항체 및 검정
EP3535297B1 (en) 2016-11-02 2022-08-10 Debiopharm International, S.A. Methods for improving anti-cd37 immunoconjugate therapy
US12144818B2 (en) 2018-05-30 2024-11-19 Debiopharm International, S.A. Method for treating cancer in a human patient by administering an anti-CD37 immunoconjugate using various dosing regimens

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20080227198A1 (en) * 2001-11-09 2008-09-18 Biogen Idec Inc. Immunoregulatory antibodies and uses thereof
US20090274692A1 (en) * 2008-04-11 2009-11-05 Trubion Pharmaceuticals, Inc. Cd37 immunotherapeutic and combination with bifunctional chemotherapeutic thereof

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
BERNSTEIN ET AL.: "High dose radiolabeled antibody therapy of lymphoma.", CANCER RES, vol. 50, no. SUP.3, 1 February 1990 (1990-02-01), pages 1017S - 1021S *

Cited By (72)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8258268B2 (en) 2005-08-19 2012-09-04 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
US10202460B2 (en) 2010-03-12 2019-02-12 Debiopharm International, S.A. CD37-binding molecules and immunoconjugates thereof
US12559566B2 (en) 2010-03-12 2026-02-24 Debiopharm International, S.A. CD37-binding molecules immunoconjugates thereof
US11466095B2 (en) 2010-03-12 2022-10-11 Debiopharm International S.A. CD37-binding molecules and immunoconjugates thereof
US9346887B2 (en) 2010-03-12 2016-05-24 Immunogen, Inc. CD37-binding molecules and immunoconjugates thereof
US10556958B2 (en) 2011-04-01 2020-02-11 Debiopharm International, S.A. CD37-binding molecules and immunoconjugates thereof
EP2694105A4 (en) * 2011-04-01 2015-04-29 Immunogen Inc CD37 BINDING MOLECULES AND IMMUNOCONJUGATES THEREOF
AU2012236210B2 (en) * 2011-04-01 2016-02-04 Immunogen, Inc. CD37-binding molecules and immunoconjugates thereof
US9447189B2 (en) 2011-04-01 2016-09-20 Immunogen, Inc. CD37-binding molecules and immunoconjugates thereof
JP2015501654A (ja) * 2011-12-13 2015-01-19 ノルディック ナノベクター アーエス 治療用キメラ型抗cd37抗体hh1
US10533051B2 (en) 2012-02-24 2020-01-14 Abbvie Stemcentrx Llc Anti SEZ6 antibodies and methods of use
CN104334580B (zh) * 2012-02-24 2018-03-30 艾伯维施特姆森特克斯有限责任公司 抗sez6抗体及使用方法
CN104334580A (zh) * 2012-02-24 2015-02-04 施特姆森特Rx股份有限公司 抗sez6抗体及使用方法
CN104364651A (zh) * 2012-03-30 2015-02-18 伊缪诺金公司 用于增加基于cd37的疗法的功效的方法
EP2831585A4 (en) * 2012-03-30 2015-12-02 Immunogen Inc METHOD FOR INCREASING THE EFFECTIVENESS OF THERAPY BASED ON CD37
US10918735B2 (en) 2012-12-04 2021-02-16 Massachusetts Institute Of Technology Substituted pyrazino[1′,2′:1,5]pyrrolo[2,3-b]indole-1,4-diones for cancer treatment
CN105722534A (zh) * 2013-08-01 2016-06-29 艾更斯司股份有限公司 结合cd37蛋白的抗体药物偶联物(adc)
US10646583B2 (en) 2013-08-01 2020-05-12 Agensys, Inc. Antibody drug conjugates (ADC) that bind to CD37 proteins
US9925273B2 (en) 2013-08-01 2018-03-27 Agensys, Inc. Antibody drug conjugates (ADC) that bind to CD37 proteins
WO2015017552A1 (en) * 2013-08-01 2015-02-05 Agensys, Inc. Antibody drug conjugates (adc) that bind to cd37 proteins
US11633500B2 (en) 2013-08-01 2023-04-25 Agensys, Inc. Antibody drug conjugates (ADC) that bind to CD37 proteins
TWI646108B (zh) * 2013-08-01 2019-01-01 艾澤西公司 結合至cd37蛋白質之抗體藥物結合物(adc)
CN105722534B (zh) * 2013-08-01 2019-05-31 艾更斯司股份有限公司 结合cd37蛋白的抗体药物偶联物(adc)
US12528852B2 (en) 2013-12-06 2026-01-20 Jie Han Bioreversable promoieties for nitrogen-containing and hydroxyl-containing drugs
US10626156B2 (en) 2013-12-06 2020-04-21 Jie Han Bioreversable promoieties for nitrogen-containing and hydroxyl-containing drugs
WO2015081891A1 (en) * 2013-12-06 2015-06-11 Baikang (Suzhou) Co., Ltd Bioreversable promoieties for nitrogen-containing and hydroxyl-containing drugs
US10603388B2 (en) 2014-09-02 2020-03-31 Immunogen, Inc. Methods for formulating antibody drug conjugate compositions
EP3311846A1 (en) 2014-09-02 2018-04-25 ImmunoGen, Inc. Methods for formulating antibody drug conjugate compositions
EP3778601A1 (en) 2014-09-03 2021-02-17 ImmunoGen, Inc. Cytotoxic benzodiazepine derivatives
WO2016036804A1 (en) 2014-09-03 2016-03-10 Immunogen, Inc. Cytotoxic benzodiazepine derivatives
WO2016054603A2 (en) 2014-10-02 2016-04-07 City Of Hope Multivalent meditopes, meditope-binding antibodies and uses thereof
AU2016276158B2 (en) * 2015-06-08 2022-06-30 Debiopharm International, S.A. Anti-CD37 immunoconjugate and anti-CD20 antibody combinations
EP3302561A4 (en) * 2015-06-08 2019-02-06 Debiopharm International SA COMBINATIONS OF ANTI-CD37 IMMUNOCONJUGATE AND ANTI-CD20 ANTIBODIES
US12239732B2 (en) 2015-06-08 2025-03-04 Debiopharm International, S.A. Anti-CD37 immunoconjugate and anti-CD20 antibody combinations
US11395796B2 (en) 2015-06-08 2022-07-26 Debiopharm International, S.A. Anti-CD37 immunoconjugate and anti-CD20 antibody combinations
US11104740B2 (en) 2015-08-28 2021-08-31 Debiopharm International, S.A. Antibodies and assays for detection of CD37
EP4335851A2 (en) 2015-11-25 2024-03-13 ImmunoGen, Inc. Pharmaceutical formulations and methods of use thereof
WO2017091745A1 (en) 2015-11-25 2017-06-01 Immunogen, Inc. Pharmaceutical formulations and methods of use thereof
US10918627B2 (en) 2016-05-11 2021-02-16 Massachusetts Institute Of Technology Convergent and enantioselective total synthesis of Communesin analogs
US11278629B2 (en) 2016-11-02 2022-03-22 Debiopharm International, S.A. Methods for improving anti-CD37 immunoconjugate therapy
WO2018160539A1 (en) 2017-02-28 2018-09-07 Immunogen, Inc. Maytansinoid derivatives with self-immolative peptide linkers and conjugates thereof
IL269645B1 (en) * 2017-03-31 2025-01-01 Genmab Holding B V Bispecific anti-CD37 antibodies, monoclonal anti-CD37 antibodies and methods of using them
US11034772B2 (en) 2017-03-31 2021-06-15 Genmab Holding B.V. Bispecific anti-CD37 antibodies, monoclonal anti-CD37 antibodies and methods of use thereof
US12577316B2 (en) 2017-03-31 2026-03-17 Genmab Holding B.V. Methods of use of anti-CD37 antibodies, monoclonal anti-CD37 antibodies
WO2018178396A1 (en) 2017-03-31 2018-10-04 Genmab Holding B.V. Bispecific anti-cd37 antibodies, monoclonal anti-cd37 antibodies and methods of use thereof
US12448459B2 (en) 2017-03-31 2025-10-21 Genmab Holding B.V. Bispecific anti-CD37 antibodies, monoclonal anti-CD37 antibodies and methods of use thereof
US11396553B2 (en) 2017-03-31 2022-07-26 Genmab Holding B.V. Bispecific anti-CD37 antibodies, monoclonal anti-CD37 antibodies and methods of use thereof
IL269645B2 (en) * 2017-03-31 2025-05-01 Genmab Holding B V Bispecific anti-cd37 antibodies, monoclonal anti-cd37 antibodies and methods of use thereof
AU2018242227B2 (en) * 2017-03-31 2025-04-10 Genmab Holding B.V. Bispecific anti-CD37 antibodies, monoclonal anti-CD37 antibodies and methods of use thereof
US11512137B2 (en) 2017-03-31 2022-11-29 Genmab Holding B.V. Bispecific anti-CD37 antibodies, monoclonal anti-CD37 antibodies and methods of use thereof
WO2018195243A1 (en) 2017-04-20 2018-10-25 Immunogen, Inc. Cytotoxic benzodiazepine derivatives and conjugates thereof
US11932650B2 (en) 2017-05-11 2024-03-19 Massachusetts Institute Of Technology Potent agelastatin derivatives as modulators for cancer invasion and metastasis
US10640508B2 (en) 2017-10-13 2020-05-05 Massachusetts Institute Of Technology Diazene directed modular synthesis of compounds with quaternary carbon centers
WO2019133652A1 (en) 2017-12-28 2019-07-04 Immunogen, Inc. Benzodiazepine derivatives
WO2019145455A1 (en) 2018-01-24 2019-08-01 Genmab B.V. Polypeptide variants and uses thereof
WO2019211472A1 (en) 2018-05-03 2019-11-07 Genmab B.V. Antibody variant combinations and uses thereof
US12144818B2 (en) 2018-05-30 2024-11-19 Debiopharm International, S.A. Method for treating cancer in a human patient by administering an anti-CD37 immunoconjugate using various dosing regimens
EP3810194A1 (en) * 2018-06-22 2021-04-28 Genmab Holding B.V. Anti-cd37 antibodies and anti-cd20 antibodies, compositions and methods of use thereof
WO2019243636A1 (en) 2018-06-22 2019-12-26 Genmab Holding B.V. Anti-cd37 antibodies and anti-cd20 antibodies, compositions and methods of use thereof
US12275797B2 (en) 2018-06-22 2025-04-15 Genmab Holding B.V. Anti-CD37 antibodies and anti-CD20 antibodies, compositions and methods of use thereof
WO2019243626A1 (en) 2018-06-22 2019-12-26 Genmab A/S Method for producing a controlled mixture of two or more different antibodies
WO2020070313A1 (en) 2018-10-04 2020-04-09 Genmab Holding B.V. Pharmaceutical compositions comprising bispecific anti-cd37 antibodies
US11535634B2 (en) 2019-06-05 2022-12-27 Massachusetts Institute Of Technology Compounds, conjugates, and compositions of epipolythiodiketopiperazines and polythiodiketopiperazines and uses thereof
US12180228B2 (en) 2019-06-05 2024-12-31 Massachusetts Institute Of Technology Compounds, conjugates, and compositions of epipolythiodiketopiperazines and polythiodiketopiperazines and uses thereof
WO2021089850A1 (en) 2019-11-06 2021-05-14 Genmab B.V. Antibody variant combinations and uses thereof
WO2021165488A1 (en) 2020-02-21 2021-08-26 Genmab B.V. Methods for the quantification of glycoproteins
US12030888B2 (en) 2021-02-24 2024-07-09 Massachusetts Institute Of Technology Himastatin derivatives, and processes of preparation thereof, and uses thereof
US12138315B2 (en) 2021-10-18 2024-11-12 Daiichi Sankyo Company, Limited Anti-CD37 antibody-drug conjugate
KR20240099178A (ko) 2021-10-18 2024-06-28 다이이찌 산쿄 가부시키가이샤 항 cd37 항체-약물 콘주게이트
WO2023198884A1 (en) 2022-04-14 2023-10-19 Debiopharm Research & Manufacturing S.A. Ligand-drug-conjugates with improved pharmacokinetic and drug release properties
WO2024219442A1 (ja) 2023-04-19 2024-10-24 第一三共株式会社 抗体-薬物コンジュゲートと他の薬剤との組み合わせ
WO2025083205A1 (en) 2023-10-18 2025-04-24 Debiopharm International S.A. Drug combination comprising anti-cd37 antibody maytansine conjugate and bcl2 inhibitor or pi3k inhibitor

Also Published As

Publication number Publication date
DK2544719T3 (da) 2019-10-14
US20160326258A1 (en) 2016-11-10
AU2015246118B2 (en) 2017-07-20
RU2017102767A3 (https=) 2020-06-08
CA2792618C (en) 2018-09-25
US20190218303A1 (en) 2019-07-18
RU2610662C9 (ru) 2017-07-24
TW201206481A (en) 2012-02-16
US9346887B2 (en) 2016-05-24
CA2792618A1 (en) 2011-09-15
RU2742743C2 (ru) 2021-02-10
IL252398B (en) 2018-10-31
JP2015091267A (ja) 2015-05-14
ES2748347T3 (es) 2020-03-16
EP3620467A1 (en) 2020-03-11
AR080513A1 (es) 2012-04-11
PL2544719T3 (pl) 2020-01-31
KR101644674B1 (ko) 2016-08-02
JP5932672B2 (ja) 2016-06-08
SI2544719T1 (sl) 2019-11-29
CN106046159B (zh) 2020-06-16
CN106046159A (zh) 2016-10-26
TWI638662B (zh) 2018-10-21
RS59389B1 (sr) 2019-11-29
PT2544719T (pt) 2019-10-17
HRP20191688T1 (hr) 2019-12-27
CA3015111A1 (en) 2011-09-15
TWI593424B (zh) 2017-08-01
EP2544719A4 (en) 2013-10-09
JP6133340B2 (ja) 2017-05-24
NZ703481A (en) 2016-02-26
RU2017102767A (ru) 2019-01-18
JP2016127867A (ja) 2016-07-14
SMT201900549T1 (it) 2019-11-13
SG183542A1 (en) 2012-10-30
BR112012023010A2 (pt) 2017-02-07
JP2013524777A (ja) 2013-06-20
LT2544719T (lt) 2019-10-25
MX2012010514A (es) 2013-03-20
US20130295104A1 (en) 2013-11-07
AU2017248441A1 (en) 2017-11-02
KR101764572B1 (ko) 2017-08-03
JP2018138053A (ja) 2018-09-06
AU2011226672B2 (en) 2015-07-23
CN102971012B (zh) 2016-05-04
SG10201501803YA (en) 2015-05-28
US20110256153A1 (en) 2011-10-20
BR112012023010A8 (pt) 2017-12-26
EP2544719A1 (en) 2013-01-16
IL252398A0 (en) 2017-07-31
RU2610662C2 (ru) 2017-02-14
AU2015246118A1 (en) 2015-11-12
US12559566B2 (en) 2026-02-24
US11466095B2 (en) 2022-10-11
US20230287137A1 (en) 2023-09-14
MY177062A (en) 2020-09-03
CN102971012A (zh) 2013-03-13
KR20130016272A (ko) 2013-02-14
MY173839A (en) 2020-02-24
CA3015111C (en) 2022-05-17
AU2011226672A1 (en) 2012-09-27
JP2020141693A (ja) 2020-09-10
MX375439B (es) 2025-03-04
KR20150021112A (ko) 2015-02-27
TW201607558A (zh) 2016-03-01
IL221682A (en) 2017-06-29
HUE046360T2 (hu) 2020-03-30
CY1122091T1 (el) 2020-11-25
MX338932B (es) 2016-05-06
SG10202001677QA (en) 2020-04-29
NZ602176A (en) 2015-01-30
US8765917B2 (en) 2014-07-01
RU2012139045A (ru) 2014-04-20
US10202460B2 (en) 2019-02-12
EP2544719B1 (en) 2019-07-03

Similar Documents

Publication Publication Date Title
US12559566B2 (en) CD37-binding molecules immunoconjugates thereof
US10752683B2 (en) Folate receptor 1 antibodies and immunoconjugates and uses thereof
HK40025578A (en) Cd37-binding molecules and immunoconjugates thereof
AU2017279600B2 (en) Folate Receptor 1 Antibodies and Immunoconjugates and Uses Thereof
HK1180613B (en) Cd37-binding molecules and immunoconjugates thereof
HK1180613A (en) Cd37-binding molecules and immunoconjugates thereof

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201180013661.2

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11754195

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 221682

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2011226672

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 7802/DELNP/2012

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2792618

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2012557290

Country of ref document: JP

Ref document number: MX/A/2012/010514

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2011754195

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2011226672

Country of ref document: AU

Date of ref document: 20110311

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: A201210674

Country of ref document: UA

ENP Entry into the national phase

Ref document number: 20127026626

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2012139045

Country of ref document: RU

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112012023010

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112012023010

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20120912