WO2011103453A2 - Vaccines for use in the prophylaxis and treatment of influenza virus disease - Google Patents

Vaccines for use in the prophylaxis and treatment of influenza virus disease Download PDF

Info

Publication number
WO2011103453A2
WO2011103453A2 PCT/US2011/025467 US2011025467W WO2011103453A2 WO 2011103453 A2 WO2011103453 A2 WO 2011103453A2 US 2011025467 W US2011025467 W US 2011025467W WO 2011103453 A2 WO2011103453 A2 WO 2011103453A2
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
amino acid
core polypeptide
flu
core
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2011/025467
Other languages
English (en)
French (fr)
Other versions
WO2011103453A3 (en
Inventor
Adolfo Garcia-Sastre
Peter Palese
Taia T. Wang
Gene S. Tan
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Icahn School of Medicine at Mount Sinai
Original Assignee
Mount Sinai School of Medicine
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from US12/788,103 external-priority patent/US8673314B2/en
Priority to JP2012554060A priority Critical patent/JP2013520172A/ja
Priority to KR1020127024205A priority patent/KR20120132506A/ko
Priority to BR112012020839A priority patent/BR112012020839A2/pt
Priority to US13/579,845 priority patent/US9701723B2/en
Priority to MX2012009581A priority patent/MX342716B/es
Application filed by Mount Sinai School of Medicine filed Critical Mount Sinai School of Medicine
Priority to EP11745345.6A priority patent/EP2536425B1/en
Priority to AU2011217903A priority patent/AU2011217903B2/en
Priority to CN201180019658.1A priority patent/CN102939096B/zh
Priority to CA2790380A priority patent/CA2790380A1/en
Publication of WO2011103453A2 publication Critical patent/WO2011103453A2/en
Publication of WO2011103453A3 publication Critical patent/WO2011103453A3/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • C07K14/08RNA viruses
    • C07K14/11Orthomyxoviridae, e.g. influenza virus
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/12Viral antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12Antivirals
    • A61P31/14Antivirals for RNA viruses
    • A61P31/16Antivirals for RNA viruses for influenza or rhinoviruses
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/555Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
    • A61K2039/55511Organic adjuvants
    • A61K2039/55566Emulsions, e.g. Freund's adjuvant, MF59
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6012Haptens, e.g. di- or trinitrophenyl (DNP, TNP)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/60Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    • A61K2039/6031Proteins
    • A61K2039/6081Albumin; Keyhole limpet haemocyanin [KLH]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/16011Orthomyxoviridae
    • C12N2760/16111Influenzavirus A, i.e. influenza A virus
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/16011Orthomyxoviridae
    • C12N2760/16111Influenzavirus A, i.e. influenza A virus
    • C12N2760/16122New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2760/00MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
    • C12N2760/00011Details
    • C12N2760/16011Orthomyxoviridae
    • C12N2760/16111Influenzavirus A, i.e. influenza A virus
    • C12N2760/16134Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • polypeptides comprising portions of the influenza virus hemagglutinin, compositions comprising such polypeptides that can be used as immunogens in vaccines and methods of their use to generate an immune response against multiple influenza subtypes in a subject.
  • Influenza viruses are enveloped RNA viruses that belong to the family of Orthomyxoviridae (Palese and Shaw (2007) Orthomyxoviridae: The Viruses and Their Replication, 5th ed. Fields' Virology, edited by B.N. Fields, D.M. nipe and P.M.
  • influenza viruses are avians, but influenza viruses (including those of avian origin) also can infect and cause illness in humans and other animal hosts (canines, pigs, horses, sea mammals, and mustelids).
  • H5 1 avian influenza virus circulating in Asia has been found in pigs in China and Indonesia and has also expanded its host range to include cats, leopards, and tigers, which general ly have not been considered susceptible to influenza A (CIDRAP - Avian Influenza: Agricultural and Wildlife Considerations).
  • CIDRAP - Avian Influenza Agricultural and Wildlife Considerations.
  • the occurrence of influenza virus infections in animals could potentially give rise to human pandemic influenza strains.
  • influenza viruses infect an estimated 10- 1 5% of the population (Glezen and Couch RB ( 1978) Interpandemic influenza in the Houston area, 1974-76. N Engl J Med 298: 587-592; Fox et al. ( 1982) influenza virus infections in Seattle families, 1975- 1979.
  • influenza viruses are the cause of infrequent pandem ics.
  • influenza A viruses can cause pandemics such as those that occurred in 1 91 8, 1957 and 1968.
  • pandemic influenza viruses Due to the lack of pre-formed immunity against the major viral antigen, hemagglutinin (HA), pandemic influenza viruses can affect greater than 50% of the population in a single year and often cause more severe disease than seasonal influenza viruses.
  • HA hemagglutinin
  • pandemic influenza viruses can affect greater than 50% of the population in a single year and often cause more severe disease than seasonal influenza viruses.
  • a stark example is the pandemic of 191 8, in which an estimated 50- 1 00 million people were killed (Johnson and Mueller (2002) Updating the Accounts: Global Mortality of the 191 8- 1 920 "Spanish" Influenza Pandemic Bulletin of the History of Medicine 76: 105- 1 1 5).
  • influenza viruses are constantly undergoing change: every 3-5 years the predominant strain of influenza A virus is replaced by a variant that has undergone sufficient antigenic drift to evade existing antibody responses. Isolates to be included in vaccine preparations must therefore be selected each year based on the intensive surveillance efforts of the World Health Organization (WHO) collaborating centers. Second, to allow sufficient time for vaccine manufacture and distribution, strains must be selected approximately six months prior to the initiation of the influenza season. Occasionally, the predictions of the vaccine strain selection committee are inaccurate, resulting in a substantial drop in the efficacy of vaccination.
  • WHO World Health Organization
  • flu polypeptide compositions are described that can be used in a subject (animal subjects, including human subjects) to generate an immune response that is cross-reactive with a plurality of influenza virus strains of a particular subtype or strains from different subtypes.
  • the flu polypeptides comprise "core polypeptides” that correspond in am ino acid sequence and/or structure to a region of the long alpha helix of the HA2 subunit of influenza hemagglutinin described herein, or modified core polypeptides.
  • the invention is based, in part, on the design of flu polypeptides that mimic the structure and function/activity of the long alpha helix region of the HA2 subunit of influenza hemagglutinin. Surprisingly, immunization with a flu polypeptide
  • the flu polypeptides provided herein may be used in immunogenic compositions (e.g., vaccines) capable of generating immune responses against a plurality of different influenza strains and subtypes - in other words, a "universal" flu vaccine.
  • the long alpha helix region of the HA2 subunit of influenza hemagglutinin contains a conserved epitope(s)/region recognized by rare, cross reactive antibodies (e.g. , such as monoclonal antibody 12D1 which has broad neutralizing activity against H3 influenza viruses).
  • nucleic acids encoding a fluoride
  • polypeptide(s), viruses and immunogenic compositions comprising a flu polypeptide(s) and methods of immunization.
  • amino acid or any reference to a specific amino acid is meant to include naturally occurring proteogenic amino acids as well as non-naturally occurring amino acids such as amino acid analogs.
  • Those skilled in the art would know that this definition includes, unless otherwise specifically noted, naturally occurring proteogenic (L)-amino acids, their optical (D)-isomers, chemically modified amino acids, including amino acid analogs such as penicillamine (3-mercapto-D-valine), naturally occurring non-proteogenic amino acids such as norleucine and chemically synthesized amino acids that have properties known in the art to be characteristic of an amino acid.
  • amino acid equivalent refers to compounds that depart from the structure of the naturally occurring amino acids, but which have substantially the structure of an amino acid, such that they can be substituted within a peptide, which retains its biological activity despite the substitution.
  • amino acid equivalents can include amino acids having side chain modifications or substitutions, and also include related organic ac ids, amides or the like.
  • amino acid is intended to include amino acid equivalents.
  • amino acid sequence identity refers to the degree of identity or similarity between a pair of aligned am ino acid sequences, usually expressed as a percentage. As used herein, the terms “percent identity,” “percent identical,”
  • % identity and “% identical” with respect to amino acid sequence refer to the percentage of amino acid residues in a candidate sequence that are identical (i. e. , the amino acid residues at a given position in the alignment are the same residue) to the corresponding amino acid residue in the peptide after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence homology.
  • percent similarity percent similar
  • percent similarity percent similar
  • % similarity % similarity
  • % simi lar with respect to amino acid sequence refer to the percentage of amino acid residues in a candidate sequence that are similar (i. e.
  • sequence homology including percentages of sequence identity and similarity, are determined using sequence alignment techniques well-known in the art, preferably computer algorithms designed for this purpose, using the default parameters of said computer algorithms or the software packages containing them.
  • Non-limiting examples of computer algorithms and software packages incorporating such algorithms include the following.
  • the BLAST family of programs exemplify a particular, non-limiting example of a mathematical algorithm utilized for the comparison of two sequences (e.g., Karlin & A ltschul, 1990, Proc. Natl.
  • FASTA program Pearson W. R. and Lipman D.J., Proc. Nat. Acad. Sci. USA, 85 :2444-2448, 1 988
  • BESTFIT uses the "local homology” algorithm of Smith and Waterman (Advances in Applied Mathematics, 2:482-489, 1981 ) to find the best single region of similarity between two sequences, and which is preferable where the two sequences being compared are dissimilar in length
  • GAP which aligns two sequences by finding a "maximum similarity” according to the algorithm of Neddleman and Wunsch (J. Mol. Biol.
  • Constant substitution refers to replacement of an amino acid of one class is with another amino acid of the same class.
  • a conservative substitution does not alter the structure or function, or both, of a polypeptide.
  • Classes of amino acids for the purposes of conservative substitution include hydrophobic (Met, A la, Val, Leu, l ie), neutral hydroph ilic (Cys, Ser, Thr), acidic (Asp, Glu), basic (Asn, G in, His, Lys, Arg), conformation disrupters (Gly, Pro) and aromatic (Trp, Tyr, Phe).
  • core polypeptide refers to a polypeptide segment that corresponds to a region of an influenza hemagglutinin HA2 polypeptide, i.e., core polypeptides as referred to herein do not comprise an entire influenza hemagglutinin HA2 polypeptide.
  • the term refers to a polypeptide segment that corresponds to a region of the long alpha helix region of an influenza hemagglutinin HA2 polypeptide. See Section 5.1 .1 for examples of core polypeptides.
  • fragment refers to a portion of a particular polypeptide.
  • a fragment of a polypeptide e.g. , a core polypeptide
  • a fragment of a polypeptide e.g.
  • a core polypeptide is between 8 to 1 5, 8 to 20, 8 to 25, 8 to 30, 8 to 40, 1 0 to 1 5, 1 0 to 20, 10 to 25, 10 to 30, 1 0 to 40, 1 0 to 45, 10 to 50, 1 5 to 20, 1 5 to 25, 1 5 to 30, 1 5 to 35, 1 5 to 40,
  • modified core polypeptide refers to a core polypeptide that has been modified in some manner to extend or increase the half-life of the core polypeptide in vivo. Techniques of modifying a polypeptide to extend or increase the half-life of the core polypeptide are known to those of skill in the art.
  • the core polypeptide may be modified by substitution of terminal L- amino acids with D-amino acids, by pegylation of the polypeptide, by amidation of the C-terminus of the polypeptide, or by acetylation of the N-terminus of the polypeptide. See Section 5. 1 .2 for examples of modified core polypeptides.
  • flu polypeptide refers to a polypeptide comprising a core polypeptide or a modified core polypeptide.
  • the flu polypeptide consists of a core polypeptide.
  • the flu polypeptide consists of a modified core polypeptide.
  • the flu polypeptide comprises a peglylated core polypeptide.
  • the flu polypeptide is pegylated at its N- and/or C- terminus.
  • the flu polypeptide comprises a core polypeptide acetylated at its N- and/or C- terminus.
  • the flu polypeptide is acetylated at its N- and/or C- terminus.
  • the flu polypeptide comprises a core polypeptide or modified core polypeptide and a linker.
  • the flu polypeptide comprises a core polypeptide or modified core polypeptide linked to a carrier.
  • the flu polypeptide comprises one, two, three or more core polypeptides and/or modified core polypeptides and one, two, three or more or all of the following: 1 ) one, two, or more T cell epitopes (e.g. , CD8 T cell epitope); 2) one, two, or more immunogenic polypeptides; 3) a polypeptide that facilitates multimerization of the flu polypeptide; 4) one, two, or more protein tags that facilitate purification and/or solubility of the flu polypeptide; 5) one, two or more carriers; and 6) one, two or more linkers.
  • T cell epitopes e.g. , CD8 T cell epitope
  • immunogenic polypeptides e.g., CD8 T cell epitope
  • 3) a polypeptide that facilitates multimerization of the flu polypeptide e.g., CD8 T cell epitope
  • 3) a polypeptide that facilitates multimerization of the flu polypeptide 4) one,
  • an "effective amount" in the context of administering a therapy to a subject refers to the amount of a therapy which has a prophylactic and/or therapeutic effect(s).
  • an "effective amount" in the context of administration of a therapy to a subject refers to the amount of a therapy which is sufficient to achieve one, two, three, four, or more of the following effects: (i) reduce or ameliorate the severity of an influenza virus infection, disease or symptom associated therewith; ii) reduce the duration of an influenza virus infection, disease or symptom associated therewith; (i ii) prevent the progression of an influenza virus infection, disease or symptom associated therewith; (iv) cause regression of an influenza virus infection, disease or symptom associated therewith; (v) prevent the development or onset of an influenza virus infection, disease or symptom associated therewith; (vi) prevent the recurrence of an influenza virus infection, disease or symptom associated therewith; (vii) reduce or prevent the spread of an influenza virus from one cel l to
  • the effective amount does not result in complete protection from an influenza virus disease, but results in a lower titer or reduced number of influenza viruses compared to an untreated subject. In certain embodiments, the effective amount results in a 0.5 fold, 1 fold, 2 fold, 4 fold, 6 fold, 8 fold, 1 0 fold, 1 5 fold, 20 fold, 25 fold, 50 fold, 75 fold, 100 fold, 125 fold, 1 50 fold, 1 75 fold, 200 fold, 300 fold, 400 fold, 500 fold, 750 fold, or 1 ,000 fold or greater reduction in titer of influenza virus relative to an untreated subject. In some embodiments, the effective amount results in a reduction in titer of influenza virus relative to an untreated subject of approximately 1 log or more, approximately 2 logs or more, approximately 3 logs or more,
  • Benefits of a reduction in the titer, number or total burden of influenza virus include, but are not limited to, less severe symptoms of the infection
  • Hemagglutinin and “HA” refer to any hemagglutinin known to those of skill in the art.
  • the hemagglutinin is influenza hemagglutinin, such as an influenza A hemagglutinin, an influenza B hemagglutinin or an influenza C hemagglutinin.
  • influenza hemagglutinin such as an influenza A hemagglutinin, an influenza B hemagglutinin or an influenza C hemagglutinin.
  • a typical hemagglutinin comprises domains known to those of skil l in the art including a signal peptide (optional herein), a stem domain, a globular head domain, a luminal domain (optional herein), a transmembrane domain (optional herein) and a cytoplasmic domain (optional herein).
  • a hemagglutinin consists of a single polypeptide chain, such as HAO.
  • a hemagglutinin consists of more than one polypeptide chain in quaternary association, e.g. , HA 1 and HA2.
  • hemagglutininin HAO (approximately 20 amino ac ids) yielding a mature hemagglutinin HAO.
  • a hemagglutinin HAO might be cleaved at another site to yield HA 1 polypeptide (approximately 320 amino acids, including the globular head domain and a portion of the stem domain) and HA2 polypeptide (approximately 220 amino acids, including the remainder of the stem domain, a luminal domain, a transmembrane domain and a cytoplasmic domain).
  • a hemagglutinin comprises a signal peptide, a transmembrane domain and a cytoplasmic domain.
  • a hemagglutinin lacks a signal peptide, i.e. the hemagglutinin is a mature hemagglutinin. In certain embodiments, a hemagglutinin lacks a transmembrane domain or cytoplasmic domain, or both.
  • the terms "hemagglutinin” and "HA” encompass hemagglutinin polypeptides that are modified by post-translational processing such as signal peptide cleavage, disulfide bond formation, glycosylation ⁇ e.g. , N-linked glycosylation), protease cleavage and lipid modification (e.g. , S-palmitoylation).
  • HA2 refers to a polypeptide domain that corresponds to the HA2 domain of an influenza hemagglutinin polypeptide known to those of skill in the art.
  • an HA2 consists of a stem domain, a luminal domain, a transmembrane domain and a cytoplasmic domain (see, e.g., Scheiffle et ai, 2007, EMBO J. 1 6( 1 8):5501 -5508, the contents of which are incorporated by reference in their entirety).
  • an HA2 consists of a stem domain, a luminal domain and a transmembrane domain.
  • an HA2 consists of a stem domain and a luminal domain; in such embodiments, the HA2 might be soluble. In certain embodiments, an HA2 consists of a stem domain; in such embodiments, the HA2 might be soluble.
  • heterologous in the context of a polypeptide, nucleic acid or virus refers to a polypeptide, nucleic acid or virus, respectively, that is not normally found in nature or not normally associated in nature with a polypeptide, nucleic acid or virus of interest.
  • a “heterologous polypeptide” may refer to a polypeptide derived from a different virus, e.g. , a different influenza strain or subtype, or an unrelated virus or different species.
  • the term "in combination,” in the context of the administration of two or more therapies to a subject, refers to the use of more than one therapy (e.g. , more than one prophylactic agent and/or therapeutic agent).
  • the use of the term “in combination” does not restrict the order in which therapies are administered to a subject.
  • a first therapy e.g. , a first prophylactic or therapeutic agent
  • can be administered prior to e.g.
  • an infection means the invasion by, multiplication and/or presence of a virus in a cell or a subject.
  • an infection is an "active" infection, i.e. , one in which the virus is replicating in a cell or a subject.
  • An infection is characterized by the spread of the virus to other cells, tissues, and/or organs, from the cells, tissues, and/or organs initially infected by the virus.
  • An infection may also be a latent infection, i. e. , one in which the virus is not replicating.
  • an infection refers to the pathological state resulting from the presence of the virus in a cell or a subject, or by the invasion of a cell or subject by the virus.
  • influenza virus disease refers to the pathological state resulting from the presence of an influenza (e.g. , influenza A or B virus) virus in a cell or subject or the invasion of a cell or subject by an influenza virus.
  • influenza virus disease refers to a respiratory illness caused by an influenza virus.
  • I FN deficient system or "I FN-deficient substrate” refer to systems, e.g. , cells, cell lines and animals, such as pigs, mice, chickens, turkeys, rabbits, rats, etc., which do not produce one or more types of interferon (l FN)(e.g. , lFN- ⁇ ) or produce low levels of I FN (i.e.
  • the numeric term "log" refers to logio-
  • MOI multiplicity of infection
  • the MOI is determined by dividing the number of infectious virus particles added (ml added x PFU/ml) by the number of cells added (m l added x cells/ml).
  • nucleic acid is intended to include DNA molecules (e.g. , cDNA or genom ic DNA) and RNA molecules (e.g., mRNA) and analogs of the DNA or RNA generated using nucleotide analogs.
  • the nucleic acid can be single- stranded or double-stranded.
  • a nucleic acid may include natural (e.g., A, G, C, or .T) or modified nucleotide bases (6-dimethylamino purine, 5-fluoro cystine, 2- pyridone, 7-deazaguanosine, inosine, etc.).
  • Polypeptide refers to a polymer of amino acids linked by amide bonds as is known to those of skill in the art.
  • the polypeptide can be a polymer of 5, 6, 7, 8, 9, 10, 1 5, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 1 00, 150, 200, 250, 300, 350, 400, 450, 500, 550 or more amino acids linked by covalent amide bonds.
  • the polypeptide is a polymer of 10 to 25, 1 0 to 30, 1 0 to 40, 10 to 50, or 25 to 50 amino acids linked by covalent amide bonds.
  • the polypeptide is a polymer of 1 00 to 1 50, 100 to 200, 100 to 250, 1 00 to 300, 1 00 to 350, 1 00 to 400, 1 00 to 450, 100 to 500, 1 00 to 550, 100 to 600, 100 to 650, 100 to 700, or 100 to 750 amino acids linked by covalent amide bonds.
  • the polypeptide is a polymer of 50 to 55, 50 to 60, 50 to 65, 50 to 75, 50 to 80, 50 to 85, 50 to 90, 50 to 95, 50 to 1 00, 75 to 80, 75 to 85, 75 to 90, 75 to 95, or 75 to 1 00 amino acids linked by covalent amide bonds.
  • the polypeptide is 55 to 60, 55 to 65, 55 to 70, 55 to 75, 55 to 80, 55 to 85, 55 to 90, 55 to 95, 55 to 1 00, or 60 to 75 amino acids linked by covalent amide bonds.
  • the term can refer to a single polypeptide chain linked by covalent amide bonds.
  • the term can also refer to multiple polypeptide chains associated by non-covalent interactions such as ionic contacts, hydrogen bonds, Van der Waals contacts and hydrophobic contacts.
  • Those of skill in the art wi ll recognize that the term includes polypeptides that have been modified, for example by post-translational processing such as signal peptide cleavage, disulfide bond formation, glycosylation (e.g. , N-linked glycosylation), protease cleavage and lipid modification (e.g., S-palmitoylation).
  • the terms "purified” and “isolated” when used in the context of a polypeptide (including antibody) that is obtained from a natural source, e.g. , cells refers to a polypeptide which is substantially free of contaminating materials from the natural source, e.g. , soil particles, minerals, chemicals from the environment, and/or cel lular materials from the natural source, such as but not l imited to cell debris, cell wall materials, membranes, organelles, the bulk of the nucleic acids, carbohydrates, proteins, and/or lipids present in cells.
  • a polypeptide that- is isolated includes preparations of a polypeptide having less than about 30%, 20%, 10%, 5%, 2%, or 1 % (by dry weight) of cellular materials and/or contam inating materials.
  • the terms "purified” and "isolated” when used in the context of a polypeptide (including antibody) that is chemical ly synthesized refers to a polypeptide which is substantially free of chemical precursors or other chemicals which are involved in the syntheses of the polypeptide. Accordingly, such preparations of the polypeptide have less than about 30%, 20%, 10%, or 5% (by dry weight) of chemical precursors or compounds other than the peptide of interest.
  • a flu polypeptide is chemically synthesized.
  • a flu polypeptide is recombinantly expressed.
  • a flu polypeptide is isolated.
  • replication refers to one or more, or all, of the stages of a viral life cycle which result in the propagation of virus.
  • the steps of a viral life cycle include, but are not limited to, virus attachment to the host cell surface, penetration or entry of the host cell (e.g., through receptor mediated endocytosis or membrane fusion), uncoating (the process whereby the viral capsid is removed and degraded by viral enzymes or host enzymes thus releasing the viral genomic nucleic acid), genome replication, synthesis of viral messenger RNA (mRNA), viral protein synthesis, and assembly of viral ribonucleoprotein complexes for genome replication, assembly of virus particles, post- translational modification of the viral proteins, and release from the host cell by lysis or budding and acquisition of a phospholipid envelope which contains embedded viral glycoproteins.
  • the terms “replication,” “viral replication” and “virus replication” refer to the replication of the viral genome. In other embodiments, the terms “replication,” “viral repl ication” and “virus replication” refer to the synthesis of viral proteins. In other embodiments, the terms “replication,” “viral replication” and “virus replication” refer to the synthesis of new viral particles.
  • a subject or “patient” are used interchangeably to refer to an animal (e.g., birds, reptiles, and mammals).
  • a subject is a bird.
  • a subject is a mammal including a non-primate (e.g., a camel, donkey, zebra, cow, pig, horse, goat, sheep, cat, dog, rat, and mouse) and a primate (e.g., a monkey, chimpanzee, and a human).
  • a subject is a non-human animal.
  • a subject is a farm animal or pet (e.g., a dog, cat, horse, goat, sheep, pig, donkey, or chicken).
  • a subject is a human.
  • a subject is a human infant.
  • a subject is a human child.
  • a subject is a human adult.
  • a subject is an elderly human.
  • a subject is a premature human infant.
  • premature human infant refers to a human infant born at less than 37 weeks of gestational age.
  • human infant refers to a newborn to 1 year old human.
  • human toddler refers to a human that is 1 years to 3 years old.
  • human child refers to a human that is 1 year to 1 8 years old.
  • human adult refers to a human that is 1 8 years or older.
  • yielderly human refers to a human 65 years or older.
  • Tertiary structure and “quaternary structure” have the meanings understood by those of skill in the art.
  • Tertiary structure refers to the three-dimensional structure of a single polypeptide chain.
  • Quaternary structure refers to the three dimensional structure of a polypeptide having multiple polypeptide chains.
  • the terms “therapies” and “therapy” can refer to any protocol(s), method(s), compound(s), composition(s), formulation(s), and/or agent(s) that can be used in the prevention or treatment of a viral infection or a disease or symptom associated therewith.
  • the terms “therapies” and “therapy” refer to biological therapy, supportive therapy, and/or other therapies useful in the treatment or prevention of a viral infection or a disease or symptom associated therewith known to one of skil l in the art.
  • the term “therapy” refers to a nucleic acid encoding a flu polypeptide, or a vector, or composition comprising said nucleic acid encod ing a flu polypeptide.
  • the term “therapy” refers to an antibody that specifically binds to a flu polypeptide.
  • the terms “prevent,” “preventing” and “prevention” in the context of the administration of a therapy(ies) to a subject to prevent an influenza virus disease refer to one or more of the fol lowing effects resulting from the adm inistration of a therapy or a combination of therapies: (i) the inhibition of the development or onset of an influenza virus disease or a symptom thereof; (i i) the inhibition of the recurrence of an influenza virus disease or a symptom associated therewith; and (iii) the reduction or inhibition in influenza virus infection and/or replication.
  • the terms “prevent”, “preventing” and “prevention” in the context of administering a therapy to a subject to prevent an influenza virus infection refers to the inhibition or reduction of onset or development of one or more symptoms associated with influenza virus infection.
  • the terms “treat,” “treatment,” and “treating” refer in the context of administration of a therapy(ies) to a subject to treating an influenza virus disease to obtain a beneficial or therapeutic effect of a therapy or a combination of therapies.
  • such terms refer to one, two, three, four, five or more of the following effects resulting from the administration of a therapy or a combination of therapies: (i) the reduction or amelioration of the severity of an influenza virus infection or a disease or a symptom associated therewith; (ii) the reduction in the duration of an influenza virus infection or a disease or a symptom associated therewith; (i ii) the regression of an influenza virus infection or a disease or a symptom associated therewith; (iv) the reduction of the titer of an influenza virus; (v) the reduction in organ failure associated with an influenza virus.
  • the terms “treat”, “treatment” and “treating” in the context of administering a therapy to a subject to treat an influenza virus infection refers to: (i) the reduction in influenza virus repl ication; (i i) the reduction in influenza virus titers; (iii) the reduction in the spread of influenza virus from one cell, organ or tissue to another cell, organ or tissue; (iv) the reduction in the severity and/or number of symptoms associated with an influenza virus infection; (v) the reduction in the duration of a symptom(s) associated with an influenza virus infection; and/or (vi) the inhibition or reduction in the progression of an influenza virus infection.
  • wild-type in the context of a virus refers to the types of a virus that are prevalent, circulating naturally and producing typical outbreaks of disease.
  • wild-type in the context of a virus refers to a parental virus.
  • Fig. 1 MAb 1 2D 1 reacts by Western blot with truncated hemagglutinin constructs. 1 2D 1 makes dominant contacts with the HA2 subunit in the region of amino acids 30 to 1 06 (H3 numbering (see, e.g. , Wilson et al., Nature 1981 ; 289 (5796):
  • Fig. 2 Monoclonal antibody (mAb) 1 2D 1 reacts with the long alpha-helix of HA2. Lysates from 293T cells transfected with GFP or GFP HA76- 1 30 were incubated with mAb 1 2D 1 and pulled-down with protein G beads. Pulled-down fractions were blotted with mAb 1 2D 1 or rabbit anti-GFP. Anti-mouse HRP used to detect 1 2D 1 binding reacts with the mouse Ig heavy and light chains within the pulled-down fraction (A). Structural integrity of the 12D1 epitope within the HApep- LH conjugate was confirmed by direct binding ELISA. MAb 36A7 binds outside of the 76- 1 30 region of HA2 (B).
  • Fig.4 Immunization with flu polypeptide (76- 130)- LH (“HApep-KLH”) protects mice against lethal challenge. Average weight change of mice infected with lethal dose of H3N2 virus (A). Vaccination with HApep-KLH protects H3N2-infected mice against death (B). HApep-KLH vaccine protects 80% of mice against lethal dose of H1N1 virus (C). Anti-HI titer correlates with weight loss after PR8 challenge (D).
  • Fig.5 Sequence alignment between various influenza A virus subtypes using selected strains from subtypes HI, H2, H3, H5 and H7 (A). Sequence alignment shows conserved amino acids between the different subtypes (B).
  • Fig.6 Sequence alignment between strains of various influenza A virus subtypes including H1N1 (A) (SEQ ID NOS: 8-11), H2N2 (B) (SEQ ID NOS: 13 and 14), H3N2(C) (SEQIDNOS: 16 and 18), H5N1 (D) (SEQ ID NO: 22), H7 (E) (SEQ ID NOS: 31-35), H4 (F) (SEQ ID NOS: 20 and 21), H6 (G) (SEQ ID NOS: 24-29), H8 (H) SEQ ID NOS: 37 and 38), H9 (I) (SEQ ID NOS: 40 and 41), HI 0 (J) (SEQ ID NOS: 43 and 44), HI 1 (K) (SEQ ID NOS: 46 and 47), H12 (L) (SEQ ID NOS: 49 and 50), H13 (M) (SEQ IDS NO: 52-54), H14 (N) (SEQ ID NO: 55), HI 5 (O) (A)
  • [0058J Fig.7 Monoclonal antibody 12D1 reacts with the long alpha-helix of HA2.
  • A Hemagglutinin monomer. Amino acids 76-130 of HA2 are depicted.
  • B Lysates from 293T cells were transfected with pCAGGs-GFP or pCAGGs-GFP HA276-130, incubated with mAb 12D1 and pulled-down with protein G beads. Pulled-down fractions were blotted with mAb 12D1 or rabbit anti-GFP. Arrows indicate location of 76-130 GFP fusion protein. Anti-mouse HRP was used to detect 12D1 binding with the mouse Ig heavy and light chains within the pulled-down fraction.
  • C Structural integrity of the 12D1 epitope within the LAH-KLH conjugate was confirmed by direct binding ELISA. Hemagglutinin specific mAb 36A7 does not bind within the 76-130 region of HA2.
  • Fig.8 LAH-KLH vaccine acts as a robust immunogen and serum antibody elicited reacts with multiple hemagglutinin subtypes.
  • A, B Sera from individual mice were taken 10-days post primary and secondary immunization and were tested for binding to H3 or H I hemagglutinin by ELISA.
  • Gray highlight/white letters residue conserved in 4/5 HAs OR less stringent conservation (R vs H near middle conserves charge but change in size).
  • mice Immunization with LAH-KLH protects mice in vivo.
  • A, B Two weeks following secondary immunization, mice were challenged with 4 x 10 5 pfu of X3 1 , a mouse adapted H3 influenza virus, (C, D) 500 pfu of the mouse adapted H I virus PR8, or (E, F) with 500 pfu of an H5 highly-pathogenic avian influenza virus modified to remove the poly-basic cleavage site in the viral hemagglutinin (HAlo virus) (see Steel J, et al. (2009) J Virol 83(4): 1 742- 1 753). Each experimental group comprises 5 BALB/c mice. Because of differences in pathogenicity, survival was defined as 20% weight loss for X3 I (H3) and PR8 (H I ) viruses, 30% weight loss for VN/2004 virus (H5).
  • Fig. 10 Antibody mediates protection afforded by immunization with LA H- KLH.
  • A Analysis of pre-challenge serum from mice infected with PR8 reveals a positive correlation between hemagglutinin-specific antibody titer and increase in body weight on days 1 -3 following infection.
  • B, C Pooled sera from mice immunized with LAH-KLH, mice infected with H I or H3 virus, or from mice immunized with KLH alone were transferred to mice two hours prior to infection with A/Georgia/81 , a seasonal human H3 virus, or with the H I virus PR8. Lung titers were evaluated on day 2 post infection.
  • LAH-KLH antiserum reacts with both Group 1 and Group 2 hemagglutinin proteins while HA2 antiserum reacts with Group 2 hemagglutinin proteins only.
  • A, B, and C Activity of antisera against Group 2 hemagglutinin proteins.
  • HA2 and LAH-KLH serum pools demonstrate comparable binding activity against the HK/68 H3 hemagglutinin but have different binding activities against other Group 2
  • flu polypeptides are useful for presenting one or more relatively conserved antigenic regions of the HA2 hemagglutinin subunit (e.g., the HA2 hemagglutinin subunit long alpha-helix) to a subject's immune system in order to generate an immune response that is capable of cross reacting with, and preferably protecting against, a plurality of influenza virus strains from a single subtype or 2, 3 , 4 or more different subtypes. , ⁇
  • a flu polypeptide comprises a core polypeptide or modified core polypeptide.
  • a flu polypeptide is acetylated at its N- and/or C- terminus. In certain embodiments, a flu polypeptide is pegylated.
  • a flu polypeptide comprises one, two, three or more core polypeptides and/or modified polypeptides.
  • a flu polypeptide comprises one, two, three or more core polypeptides or modified polypeptides and one, two, three or more T cell epitopes.
  • a flu polypeptide comprises one, two, three or more core polypeptides or modified polypeptides and one, two, three or more immunogenic polypeptides.
  • a flu polypeptide comprises one, two, three or more core polypeptides or modified core polypeptides and a polypeptide that facilitates multimerization (e.g. , trimerization of the flu polypeptide).
  • a flu polypeptide comprises one, two, three or more core polypeptides or modified core polypeptides and one, two, three or more, or all of the following: 1 ) one, two, three or more carriers; 2) one, two, three or more T cell epitopes (e.g. , CD8 T cell epitopes); 3) one, two, three or more immunogenic polypeptides (e.g. , Salmonella flagellin, see, Section 5.1 .6); 4) one, two, three or more protein tags (e.g. , His- or FLAG-tag, see, Section 5. 1 .3); 5) one or more polypeptides that facil itate multimerization of the flu polypeptide (e.g. , T4 foldon domain, see, Section 5. 1 .8)
  • a flu polypeptide comprises a core polypeptide or a modified core polypeptide linked to a linker polypeptide. In certain embodiments, a flu polypeptide comprises a core polypeptide or modified core polypeptide linked to a carrier protein.
  • the flu polypeptide comprises a core polypeptide.
  • the core polypeptide comprises one or more relatively conserved antigenic regions of the HA2 hemagglutinin subunit long alpha-helix.
  • the core polypeptide is capable of generating an immune response in a subject that is capable of cross reacting with, and preferably protecting against, a plurality of influenza virus strains from a single subtype, or strains from 2, 3, 4 or more subtypes.
  • a core polypeptide to generate an immune response in avsubject that is capable of cross reacting with, and preferably protecting against, a plurality of influenza virus strains from a single subtype, or strains from 2, 3 , 4 or more subtypes can be assessed using methods known to those of skill in the art and described herein (see Sections 5. 1 3 and 6, infra).
  • the core polypeptide is capable of generating an immune response in a subject that is capable of neutralizing a plural ity of influenza virus strains from a single subtype, or strains from 2, 3, 4 or more subtypes.
  • a core polypeptide to generate an immune response that is capable of neutralizing a plurality of influenza virus strains from a single subtype, or strains from 2, 3, 4 or more subtypes can be assessed using methods known to those of skill in the art and described herein (see Sections 5.13 and 6, infra).
  • the core polypeptide is capable of generating an immune response in a subject that is capable of inhibiting or reducing the replication of a plurality of influenza virus strains from a single subtype, or strains from 2, 3, 4 or more subtypes.
  • a core polypeptide to generate an immune response that is capable of inhibiting or reducing the replication of a plurality of influenza virus strains from a single subtype, or strains from 2, 3, 4 or more subtypes can be assessed using methods known to those of skill in the art and described herein (see Sections 5.13 and 6, infra).
  • a core polypeptide comprises the long alpha-helix of the HA2 hemagglutinin subunit of an influenza virus. In a specific embodiment, a core polypeptide comprises a portion of the long alpha-helix of the HA2 hemagglutinin subunit of an influenza virus. In a specific embodiment, a core polypeptide comprises a portion of the long alpha-helix of the HA2, wherein the native conformation of the portion is maintained. In a specific embodiment, a core polypeptide comprises a portion of the long alpha-helix of the HA2, wherein the portion maintains a native alpha-helix conformation.
  • alpha-helix conformation is maintained using any method known in the art such as, e.g., NMR, X-ray crystal lographic methods, or secondary structure prediction methods, e.g., circular dichroism.
  • a core polypeptide does not include the amino acid sequence of a full length influenza virus hemagglutinin.
  • a core polypeptide comprises or consists of between 25 to 50, 50 to 55, 50 to 60, 50 to 65, 50 to 70, 50 to 75, 50 to 80, 50 to 85, 50 to 90, 50 to 95, 50 to 1 00, 100 to 1 50, 1 00 to 200, or 100 to 250 amino acids.
  • a core polypeptide comprises or consists of between 50 to 55, 50 to 60, 50 to 65, 50 to 75, 50 to 80, 50 to 85, 50 to 90, 50 to 95, 50 to 100, 75 to 80, 75 to 85, 75 to 90, 75 to 95, or 75 to 100 amino acids
  • a core polypeptide comprises or consists of amino acids 1 ( ⁇ 5) to 1 84( ⁇ 5), 16( ⁇ 5) to 1 84( ⁇ 5), 30( ⁇ 5) to 184( ⁇ 5), 31 ( ⁇ 5) to 184( ⁇ 5), 46( ⁇ 5) to 184( ⁇ 5), 61 ( ⁇ 5) to 1 84( ⁇ 5), 70( ⁇ 5) to 1 10( ⁇ 5), 76( ⁇ 5) to 106( ⁇ 5), 76( ⁇ 5) to 130( ⁇ 5) or 76( ⁇ 5) to 1 84( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide comprises or consists of amino acids 1 ( ⁇ 5) to 1 84( ⁇ 5), 16( ⁇ 5) to 184( ⁇ 5), 30( ⁇ 5) to 184( ⁇ 5), 31 ( ⁇ 5) to 1 84( ⁇ 5), 46( ⁇ 5) to 184( ⁇ 5), 61 ( ⁇ 5) to 184( ⁇ 5), 70( ⁇ 5) to 1 84( ⁇ 5), (70( ⁇ 5) to 1 10( ⁇ 5), 76( ⁇ 5) to 1 06( ⁇ 5), 76( ⁇ 5) to 1 30( ⁇ 5) or 76( ⁇ 5) to 1 84( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system, wherein the core polypeptide is less than 300, 275, 250, 200, 190, 1 85, or 1 80 amino acids in length.
  • a core polypeptide comprises or consists of amino acids 76 to 106 of a hemagglutinin polypeptide numbered according to the classic H3 subtype number
  • a core polypeptide comprises amino acids 76 to 130 of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide comprises or consists of amino acids 76 to 1 30 of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system, wherein the core polypeptide is less than 300, 275, 250, 200, 1 90, 1 85, 1 80, 1 75, 1 50, 145, 130, 130, 125, 100, or 75 amino acids in length.
  • a core polypeptide consists of amino acids 76 to 1 30 of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide comprises or consists of amino acids 70( ⁇ 5) to 125( ⁇ 5), 80( ⁇ 5) to 1 1 5( ⁇ 5), 90( ⁇ 5) to 1 05( ⁇ 5), or 76( ⁇ 5) to 95( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide comprises or consists of amino acids 70( ⁇ 5) to 1 25( ⁇ 5), 80( ⁇ 5) to 1 15( ⁇ 5), 90( ⁇ 5) to 1 05( ⁇ 5), or 76( ⁇ 5) to 95( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system, wherein the core polypeptide is less than 300, 275, 250, 200, 190, 1 85, 1 80, 1 75, 1 50, 145, 1 30, 1 30, 1 25, 1 00, or 75 amino acids in length.
  • a core polypeptide comprises or consists of amino acids 70( ⁇ 5) to 1 30( ⁇ 5), 70( ⁇ 5) to 1 20( ⁇ 5), 70( ⁇ 5) to 1 10( ⁇ 5), 70( ⁇ 5) to 100( ⁇ 5), or 70( ⁇ 5) to 95( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide comprises or consists of amino acids 70( ⁇ 5) to 1 30( ⁇ 5), 70( ⁇ 5) to 120( ⁇ 5), 70( ⁇ 5) to 1 10( ⁇ 5), 70( ⁇ 5) to 100( ⁇ 5), or 70( ⁇ 5) to 95( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system, wherein the core polypeptide is less than 300, 275, 250, 200, 190, 1 85, 1 80, 1 75, 1 50, 145, 1 30, 1 30, 125, 100, or 75 amino acids in length.
  • a core polypeptide comprises or consists of amino acids 70( ⁇ 5) to 1 30( ⁇ 5), 80( ⁇ 5) to 1 30( ⁇ 5), 90( ⁇ 5) to 130( ⁇ 5), 1 00( ⁇ 5) to 1 30( ⁇ 5), or 1 10( ⁇ 5) to 1 30( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide comprises or consists of amino acids 70( ⁇ 5) to 130( ⁇ 5), 80( ⁇ 5) to 1 30( ⁇ 5), 90( ⁇ 5) to 1 30( ⁇ 5), 1 00( ⁇ 5) to 1 30( ⁇ 5), or 1 1 0( ⁇ 5) to 1 30( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system, wherein the core polypeptide is less than 300, 275, 250, 200, 1 0, 1 85, 1 80, 1 75, 1 50, 145, 130, 130, 125, 100, or 75 amino acids in length.
  • a core polypeptide comprises or consists of amino acids 1 - 1 84, 1 0( ⁇ 5) to 1 84, 20( ⁇ 5) to 1 84, 30( ⁇ 5) to 1 84, 40( ⁇ 5) to 1 84, 50( ⁇ 5) to 1 84, 60( ⁇ 5) to 1 84, 70( ⁇ 5) to 1 84 or 80( ⁇ 5) to 1 84 of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide comprises or consists of amino acids 1 - 1 84, 1 0( ⁇ 5) to 1 84, 20( ⁇ 5) to 1 84, 30( ⁇ 5) to 1 84, 40( ⁇ 5) to 1 84, 50( ⁇ 5) to 1 84, 60( ⁇ 5) to 1 84, 70( ⁇ 5) to 1 84 or 80( ⁇ 5) to 1 84 of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system, wherein the core polypeptide is less than 300, 275, 250, 200, 190, 1 85, 1 80, 1 75, 1 50, 145, 130, 1 30, 125, 1 00, or 75 amino acids in length.
  • a core polypeptide comprises or consists of the long alpha-helix of the HA2 hemagglutinin subunit of the influenza virus strain A/Hong Kong/1 /1968 (H3) or a fragment thereof (i.e., amino acids 76- 1 30, numbered according to the classic H3 subtype numbering system or a fragment thereof), i. e. , the core polypeptide comprises or consists of the following amino acid sequence:
  • the core polypeptide comprising the amino acid sequence SEQ ID NO: 2 comprises at least 56 amino acids or more.
  • the core polypeptide corresponding to SEQ ID NO:2 can be modified at the N-terminus, at the C-terminus, or both.
  • the core polypeptide is modified at the N-terminus.
  • the core polypeptide is modified at the C-terminus.
  • the core polypeptide is acetylated at the N-term inus.
  • the core polypeptide is linked to a linker, such as a FLAG-tag, at the C-terminus.
  • a linker such as a FLAG-tag
  • the C- terminus of the core polypeptide is linked to a linker, e.g. , a FLAG-tag, and a cysteine residue which can be used, e.g. , to couple/link the core polypeptide to a carrier (e.g. , KLH).
  • a core polypeptide comprises or consists of a region of hemagglutinin subunit of the influenza virus strain A/Hong Kong/1 /1968 (H3) or a fragment thereof that corresponds to amino acids 79-134, numbered according to the classic H3 subtype numbering system or a fragment thereof (i.e. , the core polypeptide comprises or consists of the following amino acid sequence:
  • a core polypeptide is linked to a FLAG-tag and a C- terminal cysteine residue, and such a polypeptide with the FLAG-tag and cysteine residue comprises or consists of the following amino acid sequence:
  • the core polypeptide shares at least 50% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO: 2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1968 (H3), numbered according to the classic H3 subtype numbering system. In certain embodiments, the core polypeptide shares at least 60% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 65% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1968 (H3), numbered according to the classic H3 subtype numbering system. In certain embodiments, the core polypeptide shares at least 70% amino acid sequence identity with the amino acid sequence of SEQ ID NO: l or SEQ ID NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 75% amino acid sequence identity with the amino acid sequence of SEQ ID NO: l or SEQ ID NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1968 (H3), numbered according to the classic H3 subtype numbering system. In certain embodiments, the core polypeptide shares at least 80% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO:2 and maintains the native conformation of am ino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1 968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 85% amino acid sequence identity with the amino acid sequence of SEQ I D NO: 1 or SEQ ID NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 90% amino acid sequence identity with the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 95% am ino acid sequence identity with the amino acid sequence of SEQ ID NO: l or SEQ I D NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1 968 (H3), numbered according to the classic H3 subtype numbering system. In certain embodiments, the core polypeptide shares at least 98% amino acid sequence identity with the amino acid sequence of SEQ I D NO: 1 or SEQ I D NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1 968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 99% amino acid sequence identity with the amino acid sequence of SEQ I D NO: l or SEQ ID NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 50% amino acid sequence simi larity with the amino acid sequence of SEQ I D NO: 1 or SEQ I D NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 60% amino acid sequence simi larity with the amino acid sequence of SEQ ID NO: l or SEQ ID NO:2 and maintains the native conformation of amino acids 76- 1 30 of the influenza virus strain A/Hong Kong/1 /1 968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 65% amino acid sequence similarity with the amino acid sequence of SEQ I D NO: 1 or SEQ ID NO:2 and maintains the native conformation of amino acids 76- 1 30 of the influenza virus strain A/Hong Kong/1 /1 968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 70% amino acid sequence simi larity with the amino acid sequence of SEQ I D NO: 1 or SEQ I D NO:2 and maintains the native conformation of amino ac ids 76- 130 of the influenza virus strain A/Hong Kong/1 /1 968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 75% amino acid sequence simi larity with the amino acid sequence of SEQ I D NO: l or SEQ ID NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 80% amino acid sequence similarity with the amino acid sequence of SEQ I D NO: 1 or SEQ I D NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1 968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 85% amino acid sequence simi larity with the amino acid sequence of SEQ I D NO: 1 or SEQ ID NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 90% amino acid sequence simi larity with the amino acid sequence of SEQ I D NO: 1 or SEQ I D NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 / 1968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 95% amino acid sequence similarity with the amino acid sequence of SEQ I D NO: 1 or SEQ ID NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 98% amino acid sequence similarity with the amino acid sequence of SEQ I D NO: 1 or SEQ ID NO:2 and maintains the native conformation of amino acids 76- 1 30 of the influenza virus strain A/Hong Kong/1 /1968 (H3), numbered according to the classic H3 subtype numbering system.
  • the core polypeptide shares at least 99% amino acid sequence similarity with the amino acid sequence of SEQ I D NO: 1 or SEQ I D NO:2 and maintains the native conformation of amino acids 76- 130 of the influenza virus strain A/Hong Kong/1 /1968 (H3), numbered according to the classic H3 subtype numbering system.
  • a core polypeptide does not comprise the long alpha-hel ix of the HA2 hemagglutinin subunit of the influenza virus strain A/Hong Kong/ 1 /1 968 (H3) (i.e., amino acids 76- 130, numbered according to the classic H3 subtype numbering system), i. e. , the core polypeptide does not comprise the following amino acid sequence:
  • a core polypeptide is not l inked to a FLAG-tag and a C-terminal cysteine residue which can be used, e.g. , to couple/link the core polypeptide to a carrier ⁇ e.g. , KLH).
  • a core polypeptide described herein does not comprise the following amino acid sequence:
  • a core polypeptide is not acetylated at the N-terminus.
  • a core polypeptide does not comprise amino acids 70( ⁇ 5) to 1 25( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide does not comprise amino acids 80( ⁇ 5) to 1 1 5( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide does not comprise amino acids 90( ⁇ 5) to 105( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide does not comprise amino acids 76( ⁇ 5) to 95( ⁇ 5), of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide does not comprise amino acids 70( ⁇ 5) to 1 30( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system. In a specific embodiment, a core polypeptide does not comprise amino acids 70( ⁇ 5) to 120( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system. In a specific embodiment, a core polypeptide does not comprise amino acids 70( ⁇ 5) to 1 1 0( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide does not comprise amino acids 70( ⁇ 5) to 1 00( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system. In a specific embodiment, a core polypeptide does not comprise amino acids 70( ⁇ 5) to 95( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide does not comprise amino acids 70( ⁇ 5) to 1 30( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system. In a specific embodiment, a core polypeptide does not comprise amino acids 80( ⁇ 5) to 130( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system. In a specific embodiment, a core polypeptide does not comprise amino acids 90( ⁇ 5) to 130( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide does not comprise amino acids 1 00( ⁇ 5) to 1 30( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system. In a specific embodiment, a core polypeptide does not comprise amino acids 1 1 0( ⁇ 5) to 130( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide does not comprise amino acids 1 - 1 84 of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system. In a specific embodiment, a core polypeptide does not comprise amino acids 1 0( ⁇ 5) to 1 84 of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system. In a specific embodiment, a core polypeptide does not comprise amino acids 20( ⁇ 5) to 1 84 of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide does not comprise amino acids 30( ⁇ 5) to 1 84 of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system. In a specific embodiment, a core polypeptide does not comprise amino acids 40( ⁇ 5) to 1 84 of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system. I n a specific embodiment, a core polypeptide does not comprise amino acids 50( ⁇ 5) to 1 84 of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide does not comprise amino acids 60( ⁇ 5) to 1 84 of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system. In a specific embodiment, a core polypeptide does not comprise amino acids 70( ⁇ 5) to 1 84 of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system. In a specific embodiment, a core polypeptide does not comprise amino acids 80( ⁇ 5) to 1 84 of a hemagglutinin polypeptide numbered according to the classic H3 subtype numbering system.
  • a core polypeptide does not comprise amino acids 1 ( ⁇ 5) to 1 84( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype number system. In a specific embodiment, a core polypeptide does not comprise amino acids 1 6( ⁇ 5) to 1 84( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype number system. In a specific embodiment, a core polypeptide does not comprise amino acids 30( ⁇ 5) to 1 84( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype number system.
  • a core polypeptide does not comprise amino acids 3 1 ( ⁇ 5) to 1 84( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype number system. In a specific embodiment, a core polypeptide does not comprise amino acids 46( ⁇ 5) to 1 84( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype number system. In a specific embodiment, a core polypeptide does not comprise amino acids 6 1 ( ⁇ 5) to 1 84( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype number system.
  • a core polypeptide does not comprise amino acids 70( ⁇ 5) to 1 84( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype number system. In a specific embodiment, a core polypeptide does not comprise amino acids 76( ⁇ 5) to 1 06( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype number system. In a specific embodiment, a core polypeptide does not comprise amino acids 76( ⁇ 5) to 1 84( ⁇ 5) of a hemagglutinin polypeptide numbered according to the classic H3 subtype number system.
  • the core polypeptide is a generic core polypeptide comprising the amino acid sequence:
  • X is a hydrophil ic amino acid
  • X2 is a hydrophobic amino acid
  • X3 is a hydroph i lic amino acid
  • X4 is a hydrophilic amino acid
  • X5 is a hydrophobic amino acid
  • is N, E or I
  • X 7 is a hydrophilic amino acid
  • X & is , R, Y or W
  • X9 is M, V or T
  • X 10 is a hydrophilic residue
  • X n is A, G, T or S
  • X 12 is F, I, , L or M
  • X 13 is L, I or T
  • X i4 is a hydrophilic, acidic amino acid
  • 5 is a hydrophobic amino acid
  • 6 is a hydrophilic amino acid
  • 7 is a hydrophilic amino acid
  • Xi 8 is a hydrophobic amino acid
  • X 1 is a hydrophobic amino acid
  • 5 is V, I or L; X
  • X ig is L or M
  • X 2 o is E or Q
  • X22 is L or I
  • X23 is F, V, M, Y or L
  • X 24 is H, T or A
  • X25 is N or E
  • X26 is V or M
  • X 27 is K , N , R or S
  • X 28 is or N
  • X29 is Y or F
  • X30 is D or E
  • X31 is or R
  • X 32 is T or V
  • X33 is K or R
  • X34 is K, L, M, S or R
  • X35 is K or R
  • the core polypeptide is acetylated at the N-term inus.
  • the core polypeptide is a fragment of a generic core polypeptide.
  • the core polypeptide is a fragment of a generic core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of a generic core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of a generic core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of a generic core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5) or 25( ⁇ 5)amino acids from a generic core polypeptide's N-terminus and 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5) or 25( ⁇ 5) amino acids from a generic core polypeptide 's C- term inus.
  • the core polypeptide has an alpha-helical conformation.
  • the core polypeptide is a generic core polypeptide that is not ful l length influenza virus HA. In some embodiments, the core polypeptide is a generic core polypeptide that is between 5 1 to 300, 5 1 to 275, 5 1 to 250, 5 1 to 225, 5 1 to 200, 5 1 to 1 75, 5 1 to 1 50, 5 1 to 125, 5 1 to 1 00, or 5 1 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is a generic core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 125, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is a generic core polypeptide less than 1 50, 1 25, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 am ino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of the generic core polypeptide, wherein the derivative comprises a generic core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10( ⁇ 5) amino acids attached to either of a generic core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of the generic core polypeptide, wherein the derivative comprises a generic core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to the generic core polypeptide's N-terminus and 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to the generic core polypeptide's C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a consensus core polypeptide comprising or consisting of the amino acid sequence:
  • X is M, V, T; 2 is a hydrophobic amino acid; X 3 is L, M, S, K, R; and X is a hydroph ilic amino acid.
  • is , V, T; X? is F, Y or L; X3 is L, , S, K, R; and X is D, N or E.
  • the core polypeptide is acetylated at the N-terminus.
  • the core polypeptide is a fragment of the consensus core polypeptide.
  • the core polypeptide is a fragment of a consensus core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of a consensus core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of a consensus core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of a consensus core polypeptide, wherein the fragment lacks 1 , 2, 3 , 4, 5, or more amino acids from both of a consensus core polypeptide's N- and C- termini.
  • the core polypeptide has an alpha-helical conformation.
  • the core polypeptide is a consensus core polypeptide that is not full length influenza virus HA. In some embodiments, the core polypeptide is a consensus core polypeptide that is between 51 to 300, 5 1 to 275, 51 to 250, 5 1 to 225, 5 1 to 200, 5 1 to 1 75, 5 1 to 150, 51 to 125, 5 1 to 100, or 5 1 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is a consensus core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 1 25, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is a consensus core polypeptide less than 1 50, 125, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of the consensus core polypeptide, wherein the derivative comprises a consensus core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10( ⁇ 5) amino acids attached to either of a consensus core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha- helical conformation.
  • the core polypeptide is a derivative of the consensus core polypeptide, wherein the derivative comprises a consensus core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to both of the consensus core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha- helical conformation.
  • the core polypeptide is a group 1 core polypeptide comprising or consisting of the amino acid sequence:
  • is a hydrophobic amino acid
  • X 2 is a hydrophobic amino acid
  • X3 is a hydrophilic amino acid
  • X4 is a hydrophobic amino acid
  • X5 is a hydrophobic amino acid
  • X 6 is a hydrophobic acidic amino acid
  • X 7 is a hydrophilic, acidic amino acid
  • Xg is L, M, or S
  • X9 is a hydrophilic, basic amino acid
  • Xio is a hydrophilic amino acid
  • X n is a hydrophobic am ino acid.
  • is L or I ; X 2 or V; X3 is E or D; X 4 V or I ; X 5 is or L; X 6 is F or Y; X 7 is D or E; X 8 L, or S; X 9 R or ; X )0 is D or N and X
  • this core polypeptide can be used to induce an immune response against group 1 hemagglutinin subtypes. In certain embodiments, the immune response induced neutralizes 2 or more influenza virus group 1 hemagglutinin subtypes. In certain embodiments, the core polypeptide is acetylated at the N-terminus.
  • the core polypeptide is a fragment of a group 1 core polypeptide.
  • the core polypeptide is a fragment of a group 1 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of a group 1 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of a group 1 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of the group 1 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of a group 1 core polypeptide's N- and C- termini.
  • the core polypeptide has an alpha-helical conformation.
  • the core polypeptide is a group 1 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 1 25, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is a group 1 core polypeptide less than 1 50, 1 25, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of the group 1 core polypeptide, wherein the derivative comprises a group 1 core polypeptide with either 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) am ino acids attached to either of a group 1 core polypeptide 's N- or C- term inus and wherein the core polypeptide maintains an alpha- helical conformation.
  • the core polypeptide is a derivative of the group 1 core polypeptide, wherein the derivative comprises a group 1 core polypeptide with either 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) am ino acids attached to both of a group 1 core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha- helical conformation.
  • the core polypeptide is a group 2 core polypeptide comprising or consisting of the amino acid sequence:
  • Xi is a hydrophilic amino acid
  • X 2 is a hydrophilic amino acid
  • X3 is a hydrophilic amino acid
  • X 4 is a hydrophobic amino acid
  • X5 is E or I
  • Xe is a hydrophilic amino acid
  • X7 is a hydrophobic amino acid
  • X 8 is V or T
  • X9 is a hydrophilic amino acid
  • X10 is a hydrophil ic amino acid
  • Xn is or M
  • X 12 is I or T
  • X 13 is a hydrophilic, acidic amino acid
  • X] 4 is a hydrophobic amino acid
  • X 15 is a hydrophobic am ino acid
  • X i 6 is T or A
  • 7 is a hydrophobic amino acid
  • 8 is a hydrophilic basic amino acid
  • X 19 is T or V
  • X20 is a hydrophil ic, basic amino acid.
  • this core polypeptide can be used to induce an immune response against group 2 hemagglutinin subtypes.
  • the immune response induced neutralizes 2 or more influenza virus group 2 hemagglutinin subtypes.
  • the core polypeptide is acetylated at the N-terminus.
  • the core polypeptide is a fragment of a group 2 core polypeptide.
  • the core polypeptide is a fragment of a group 2 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of a group 2 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of a group 2 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of a group 2 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of a group 2 core polypeptide's N- and C- termini.
  • the core polypeptide has an alpha-helical conformation.
  • the core polypeptide is a group 2 core polypeptide that is not full length influenza virus HA. In some embodiments, the core polypeptide is a group 2 core polypeptide that is between 5 1 to 5 1 1 , 51 to 500, 5 1 to 450, 51 to 400, 5 1 to 350, 5 1 to 300, 5 1 to 275, 5 1 to 250, 51 to 225, 51 to 200, 51 to 1 75, 51 to 1 50, 5 1 to 1 25, 5 1 to 1 00, or 5 1 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is a group 2 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 1 25, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 am ino acids in length.
  • the core polypeptide is a group 2 core polypeptide less than 1 50, 1 25, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of a group 2 core polypeptide, wherein the derivative comprises a group 2 core polypeptide with either 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to either of a group 2 core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of a group 2 core polypeptide, wherein the derivative comprises a group 2 core polypeptide with either 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to both of a group 2 core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H I core polypeptide comprising or consisting of the amino acid sequence:
  • RX 1 ENLNKKVDDGFX2DIWTYNAELLVLLENERTLDX 3 HDSNVX4NLY EKVX5SQL NNA (SEQ ID NO: 7),
  • is a hydrophobic amino acid
  • X2 is a hydrophobic amino acid
  • X3 is a hydrophobic amino acid
  • X 4 is a hydrophil ic, basic amino acid
  • X5 is a hydrophi lic, basic amino acid.
  • is M or I
  • X 2 is L or I
  • X3 is F or Y
  • X 4 is K or R
  • X5 is K or R.
  • This sequence corresponds with amino acids 76- 130 of an H I subtype hemagglutinin numbered according to the classic H3 subtype numbering system.
  • the core polypeptide is acetylated at the N- terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 6A (SEQ I D NOS: 8- 1 1 ) or a fragment thereof.
  • the core polypeptide is acetylated at the N-terminus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H I .
  • the immune response induced neutralizes strains of influenza virus subtype H 1 .
  • the core polypeptide is a fragment of an H I core polypeptide.
  • the core polypeptide is a fragment of a H I core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H 1 core polypeptide's N- or C- term inus.
  • the core polypeptide is a fragment of an H I core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H I core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of an H I core polypeptide's N- and C- termini.
  • the core polypeptide has an alpha-helical conformation.
  • the core polypeptide is an H I core polypeptide that is not ful l length influenza virus HA. In some embodiments, the core polypeptide is an H I core polypeptide that is between 5 1 to 300, 5 1 to 275, 5 1 to 250, 5 1 to 225, 5 1 to 200, 51 to 1 75, 5 1 to 1 50, 5 1 to 1 25, 5 1 to 1 00, or 51 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H I core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 125, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is an H I polypeptide less than 1 50, 125, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H I core polypeptide, wherein the derivative comprises an H I core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to either of the H I core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H I core polypeptide, wherein the derivative comprises an H I core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10( ⁇ 5) amino acids attached to both of the H I core polypeptide's N- or C- termini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H2 core polypeptide comprising or consisting of the amino acid sequence:
  • X is a hydrophilic, acidic amino acid.
  • X is D or E.
  • the core polypeptide is acetylated at the N-terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 6B (SEQ I D NO: 1 3 or 14) or a fragment thereof.
  • the core polypeptide is acetylated at the N-terminus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H2. In certain embodiments, the immune response induced neutral izes strains of influenza virus subtype H2.
  • the core polypeptide is a fragment of an H2 core polypeptide.
  • the core polypeptide is a fragment of an H2 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H2 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of an H2 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- term inus.
  • the core polypeptide is a fragment of an H2 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more am ino acids from both of an H2 core polypeptide's N- and C- term ini.
  • the core polypeptide has an alpha-hel ical conformation.
  • the core polypeptide is an H2 core polypeptide that is not full length influenza virus HA. In some embodiments, the core polypeptide is an H2 core polypeptide that is between 5 1 to 300, 51 to 275, 5 1 to 250, 51 to 225, 5 1 to 200, 51 to 1 75, 5 1 to 1 50, 51 to 125, 5 1 to 100, or 51 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H2 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 125, 1 00, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is an H2 polypeptide less than 1 50, 125, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H2 core polypeptide, wherein the derivative comprises an H2 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to either of the H2 core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H2 core polypeptide, wherein the derivative comprises an H2 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10( ⁇ 5) amino acids attached to both of the H2 core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H3 core polypeptide comprising or consisting of the amino acid sequence:
  • Xi is a hydrophilic, basic amino acid
  • X 2 is a hydrophilic, basic amino acid
  • X3 is a hydrophilic, basic amino acid.
  • Xi is K or R
  • X 2 is or R
  • X3 is K or R.
  • the core polypeptide is acetylated at the N-terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 6C (SEQ ID NOS: 1 6- 1 8) or a fragment thereof.
  • the core polypeptide is acetylated at the N- terminus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H3.
  • the immune response induced neutralizes strains of influenza virus subtype H3.
  • the core polypeptide is a fragment of an H3 core polypeptide.
  • the core polypeptide is a fragment of an H3 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H3 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of an H3 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H3 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of an H3 core polypeptide's N- and C- termini.
  • the core polypeptide has an alpha-helical conformation.
  • the core polypeptide is an H3 core polypeptide that is not full length influenza virus HA. In some embodiments, the core polypeptide is an H3 core polypeptide that is between 51 to 300, 51 to 275, 5 1 to 250, 51 to 225, 51 to 200, 51 to 1 75, 51 to 1 50, 5 1 to 125, 5 1 to 100, or 51 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H3 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 125, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is an H3 polypeptide less than 1 50, 125, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H3 core polypeptide, wherein the derivative comprises an H3 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to either of the H3 core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H3 core polypeptide, wherein the derivative comprises an H3 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to both of the H3 core polypeptide's N- and C- term in i and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H4 core polypeptide comprising or consisting of the amino acid sequence:
  • is a hydrophilic, basic amino acid.
  • is R or H .
  • the core polypeptide is acetylated at the N-terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 6F (SEQ ID NOS: 20 and 21 ) or a fragment thereof.
  • the core polypeptide is acetylated at the N-terminus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H4. In certain embodiments, the immune response induced neutralizes strains of influenza virus subtype H4.
  • the core polypeptide is a fragment of an H4 core polypeptide.
  • the core polypeptide is a fragment of an H4 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H4 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of an H4 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H4 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of an H4 core polypeptide's N- and C- term ini.
  • the core polypeptide has an alpha-helical conformation.
  • the core polypeptide is an H4 core polypeptide that is not ful l length influenza virus HA.
  • the core polypeptide is an H4 core polypeptide that is between 5 1 to 300, 5 1 to 275, 5 1 to 250, 5 1 to 225, 5 1 to 200, 51 to 1 75, 5 1 to 1 50, 5 1 to 1 25, 51 to 1 00, or 5 1 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H4 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 125, 1 00, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 am ino acids in length.
  • the core polypeptide is an H4 polypeptide less than 1 50, 1 25, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H4 core polypeptide, wherein the derivative comprises an H4 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to either of the H4 core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H4 core polypeptide, wherein the derivative comprises an H4 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10( ⁇ 5) amino acids attached to both of the H4 core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H5 core polypeptide comprising or consisting of the amino acid sequence:
  • the core polypeptide is acetylated at the N-terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 6D (SEQ ID NO: 22) or a fragment thereof.
  • the core polypeptide is acetylated at the N-terminus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H5. In certain embodiments, the immune response induced neutralizes strains of influenza virus subtype H5.
  • the core polypeptide is a fragment of an H5 core polypeptide.
  • the core polypeptide is a fragment of an H5 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H5 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of an H5 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H5 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more am ino acids from both of the H5 core polypeptide's N- and C- termini.
  • the core polypeptide has an alpha-hel ical conformation.
  • In some embodiments, the core polypeptide is an H5 core polypeptide that is not ful l length influenza virus HA.
  • the core polypeptide is an H5 core polypeptide that is between 51 to 51 1 , 5 1 to 500, 5 1 to 450, 5 1 to 400, 5 1 to 350, 5 1 to 300, 5 1 to 275, 51 to 250, 51 to 225, 5 1 to 200, 51 to 1 75, 5 1 to 1 50, 51 to 125, 51 to 1 00, or 5 1 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H5 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 1 25, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is an H5 polypeptide less than 1 50, 125, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H5 core polypeptide, wherein the derivative comprises an H5 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to either of the H5 core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H5 core polypeptide, wherein the derivative comprises an H5 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10( ⁇ 5) amino acids attached to both of the H5 core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H6 core polypeptide comprising or consisting of the amino acid sequence:
  • the core polypeptide is acetylated at the N- terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 6G (SEQ I D NOS: 24-29)or a fragment thereof.
  • the core polypeptide is acetylated at the N-terminus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H6.
  • the core polypeptide is a fragment of an H6 core polypeptide.
  • the core polypeptide is a fragment of an H6 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H6 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of an H6 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H6 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of an H6 core polypeptide's N- and C- termini.
  • the core polypeptide has an alpha-helical conformation.
  • the core polypeptide is an H6 core polypeptide that is not full length influenza virus HA. In some embodiments, the core polypeptide is an H6 core polypeptide that is between 5 1 to 300, 51 to 275, 5 1 to 250, 51 to 225, 5 1 to 200, 51 to 1 75, 5 1 to 1 50, 5 1 to 125, 5 1 to 100, or 51 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H6 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 1 25, 1 00, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino ac ids in length.
  • the core polypeptide is an H6 polypeptide less than 1 50, 1 25, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H6 core polypeptide, wherein the derivative comprises an H6 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to either of the H6 core polypeptide's N- or C- term inus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H6 core polypeptide, wherein the derivative comprises an H6 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10( ⁇ 5) amino acids attached to both of the H6 core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H7 core polypeptide comprising or consisting of the amino acid sequence:
  • X is a hydrophobic amino acid or a hydrophi lic amino acid
  • X 2 is a hydrophobic amino acid
  • X3 is a hydrophilic amino acid
  • X 4 is a hydrophilic, basic amino acid.
  • Xi is A or S
  • X 2 is V or I
  • X3 is N or S
  • X 4 is or R.
  • the core polypeptide is acetylated at the N-terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 6E (SEQ I D NOS: 3 1 -35) or a fragment thereof.
  • the core polypeptide is acetylated at the N-terminus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H7.
  • the core polypeptide is a fragment of an H7 core polypeptide.
  • the core polypeptide is a fragment of an H7 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H7 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of an H7 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H7 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of an H7 core polypeptide's N- and C- term ini.
  • the core polypeptide has an alpha-hel ical conformation.
  • the core polypeptide is an H7 core polypeptide that is not full length influenza virus HA. In some embodiments, the core polypeptide is an H7 core polypeptide that is between 5 1 to 300, 51 to 275, 51 to 250, 51 to 225, 51 to 200, 51 to 1 75, 5 1 to 1 50, 5 1 to 1 25, 5 1 to 100, or 51 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H7 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 125, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is an H7 polypeptide less than 1 50, 125, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H7 core polypeptide, wherein the derivative comprises an H7 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10( ⁇ 5) amino acids attached to either of the H7 core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H7 core polypeptide, wherein the derivative comprises an H7 core polypeptide with either 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to both of the H7 core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha-helical
  • the core polypeptide is an H8 core polypeptide comprising or consisting of the amino acid sequence:
  • RINM INDKIDDQI EX LWAYNAELLVLLENQ TLDEHDSNV NLFDEVKRRLSAN A (SEQ ID NO: 36), wherein X , is a hydrophilic amino acid.
  • X is D or N .
  • a core polypeptide comprises any one of the am ino acid sequences shown in Figure 6H (SEQ ID NOS: 37 and 38) or a fragment thereof.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H8.
  • the core polypeptide is a fragment of an H8 core polypeptide.
  • the core polypeptide is a fragment of an H8 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H8 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of an H8 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H8 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of an H8 core polypeptide's N- and C- termini.
  • the core polypeptide has an alpha-helical conformation.
  • the core polypeptide is an H8 core polypeptide that is not ful l length influenza virus HA. In some embodiments, the core polypeptide is an H8 core polypeptide that is between 51 to 300, 5 1 to 275, 5 1 to 250, 51 to 225, 5 1 to 200, 51 to 1 75, 5 1 to 1 50, 5 1 to 1 25, 51 to 100, or 51 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H8 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 125, 1 00, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is an H8 polypeptide less than 1 50, 125, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H8 core polypeptide, wherein the derivative comprises an H8 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to either of the H8 core polypeptide's N- or C- term inus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H8 core polypeptide, wherein the derivative comprises an H8 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to both of the H8 core polypeptide's N- and C- term ini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H9 core polypeptide comprising or consisting of the amino acid sequence:
  • is a hydrophobic amino acid.
  • is V or I .
  • the core polypeptide is acetylated at the N-terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 61 (SEQ ID NOS: 40 and 41 ) or a fragment thereof.
  • the core polypeptide is acetylated at the N-terminus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H9. In certain embodiments, the immune response induced neutralizes strains of influenza virus subtype H9.
  • the core polypeptide is a fragment of an H9 core polypeptide.
  • the core polypeptide is a fragment of an H9 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H9 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of an H9 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H9 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more am ino acids from both of an H9 core polypeptide's N- and C- term in i.
  • the core polypeptide has an alpha-helical conformation.
  • the core polypeptide is an H9 core polypeptide that is not full length influenza virus HA. In some embodiments, the core polypeptide is an H9 core polypeptide that is between 5 1 to 300, 5 1 to 275, 5 1 to 250, 5 1 to 225, 51 to 200, 5 1 to 1 75, 5 1 to 1 50, 5 1 to 125, 5 1 to 100, or 51 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H9 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 125, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is an H9 polypeptide less than 1 50, 1 25, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H9 core polypeptide, wherein the derivative comprises an H9 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to either of the H9 core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H9 core polypeptide, wherein the derivative comprises an H9 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to both of the H9 core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H 10 core polypeptide comprising or consisting of the amino acid sequence:
  • X is a hydrophilic amino acid.
  • X i is Q or N.
  • the core polypeptide is acetylated at the N-terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 6J (SEQ ID NOS: 43 and 44) or a fragment thereof.
  • the core polypeptide is acetylated at the N-terminus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H 10. In certain embodiments, the immune response induced neutralizes strains of influenza virus subtype H 1 0.
  • the core polypeptide is a fragment of an H 10 core polypeptide.
  • the core polypeptide is a fragment of an H 10 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H 1 0 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of an H 1 0 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H 1 0 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of an H 10 core polypeptide's N- and C- termini.
  • the core polypeptide has an alpha-helical conformation.
  • the core polypeptide is an H 10 core polypeptide that is not ful l length influenza virus HA.
  • the core polypeptide is an H 1 0 core polypeptide that is between 51 to 300, 5 1 to 275, 5 1 to 250, 5 1 to 225, 5 1 to 200, 5 1 to 1 75, 5 1 to 1 50, 5 1 to 125, 5 1 to 1 00, or 5 1 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H 1 0 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 125, 1 00, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 am ino acids in length.
  • the core polypeptide is an H 1 0 polypeptide less than 1 50, 1 25, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H 1 0 core polypeptide, wherein the derivative comprises an H 1 0 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to either of the H 10 core polypeptide's N- or C- term inus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H 1 0 core polypeptide, wherein the derivative comprises an H 1 0 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10( ⁇ 5) amino acids attached to both of the H 1 0 core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H I 1 core polypeptide comprising or consisting of the amino acid sequence:
  • is a hydrophobic amino acid.
  • is V or I .
  • the core polypeptide is acetylated at the N-terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 6 (SEQ ID NOS: 46 and 47) or a fragment thereof.
  • the core polypeptide is acetylated at the N-term inus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H I 1 .
  • the core polypeptide is a fragment of an H 1 1 core polypeptide.
  • the core polypeptide is a fragment of an H I 1 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H I 1 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of an H I 1 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H I 1 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of an H I 1 core polypeptide's N- and C- termini.
  • the core polypeptide has an alpha-helical conformation.
  • the core polypeptide is an H I 1 core polypeptide that is not full length influenza virus HA. In some embodiments, the core polypeptide is an H I 1 core polypeptide that is between 5 1 to 300, 5 1 to 275, 5 1 to 250, 5 1 to 225, 5 1 to 200, 5 1 to 1 75, 5 1 to 1 50, 5 1 to 125, 5 1 to 100, or 51 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H I 1 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 125, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is an H I 1 polypeptide less than 1 50, 125, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H I 1 core polypeptide, wherein the derivative comprises an H I 1 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to either of the H 1 1 core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H I 1 core polypeptide, wherein the derivative comprises an H I 1 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to both of the H I 1 core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H I 2 core polypeptide comprising or consisting of the amino acid sequence:
  • Xi is a hydrophobic amino acid and X 2 is a hydrophilic, basic amino acid.
  • X is V or I and X 2 is R or .
  • the core polypeptide is acetylated at the N-terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 6L (SEQ ID NOS: 49 and 50) or a fragment thereof.
  • the core polypeptide is acetylated at the N-terminus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H I 2. In certain embodiments, the immune response induced neutralizes strains of influenza virus subtype H 1 2.
  • the core polypeptide is a fragment of an H I 2 core polypeptide.
  • the core polypeptide is a fragment of an H 12 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H I 2 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of an H I 2 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H I 2 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of an H I 2 core polypeptide's N- and C- termini.
  • the core polypeptide has an alpha-hel ical conformation.
  • the core polypeptide is an H I 2 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 125, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is an H I 2 polypeptide less than 1 50, 125, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H I 2 core polypeptide, wherein the derivative comprises an H 12 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10( ⁇ 5) amino acids attached to either of the H 1 2 core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H I 2 core polypeptide, wherein the derivative comprises an H 12 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10( ⁇ 5) amino acids attached to both of the H I 2 core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H 13 core polypeptide comprising or consisting of the amino acid sequence: 100204] RINMLADRIDDAVTDXi WSY AKLLVLLEND TLDMHDANVRNLHX 2 QVRR X 3 L X 4 NA (SEQ ID NO: 5 1 ),
  • X is a hydrophobic amino acid; ⁇ is a hydrophi lic, acidic amino acid; X3 is A, S or E and X 4 is a hydrophil ic amino acid.
  • X i is V or I ; X2 is D or E; X3 is A, S or E and X4 is T or D.
  • the core polypeptide is acetylated at the N-terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 6M (SEQ ID NOS: 52- 54) or a fragment thereof.
  • the core polypeptide is acetylated at the N-terminus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H I 3.
  • the immune response induced neutralizes strains of influenza virus subtype H 1 3.
  • the core polypeptide is a fragment of an H 1 3 core polypeptide.
  • the core polypeptide is a fragment of an H 13 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H I 3 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of an H I 3 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H I 3 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of an H I 3 core polypeptide's N- and C- termini.
  • the core polypeptide has an alpha-helical conformation.
  • the core polypeptide is an H I 3 core polypeptide that is not ful l length influenza virus HA. In some embodiments, the core polypeptide is an H I 3 core polypeptide that is between 5 1 to 300, 51 to 275, 51 to 250, 5 1 to 225, 5 1 to 200, 51 to 1 75, 51 to 1 50, 51 to 1 25, 5 1 to 1 00, or 51 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H I 3 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 1 25, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is an H 1 3 polypeptide less than 1 50, 125, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H I 3 core polypeptide, wherein the derivative comprises an H I 3 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to either of the H I 3 core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H I 3 core polypeptide, wherein the derivative comprises an H I 3 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to both of the H 13 core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H 14 core polypeptide comprising or consisting of the amino acid sequence:
  • the core polypeptide is acetylated at the N-terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 6N (SEQ I D NO: 55) or a fragment thereof.
  • the core polypeptide is acetylated at the N-terminus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains ' of subtype H I 4. In certain embodiments, the immune response induced neutralizes strains of influenza virus subtype H 1 .
  • the core polypeptide is a fragment of an H 14 core polypeptide.
  • the core polypeptide is a fragment of an H 14 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H 14 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of an H 14 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H I 4 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of an H I 4 core polypeptide 's N- and C- termini.
  • the core polypeptide has an alpha-hel ical conformation.
  • the core polypeptide is an H 14 core polypeptide that is not ful l length influenza virus HA. In some embodiments, the core polypeptide is an H 14 core polypeptide that is between 5 1 to 300, 51 to 275, 5 1 to 250, 5 1 to 225, 5 1 to 200, 51 to 1 75, 5 1 to 1 50, 5 1 to 125, 51 to 100, or 51 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H I 4 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 1 25, 1 00, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is an H 14 polypeptide less than 1 50, 125, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H 14 core polypeptide, wherein the derivative comprises an H 14 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to either of the H 14 core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H I 4 core polypeptide, wherein the derivative comprises an H 14 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to both of the H 14 core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H I 5 core polypeptide comprising or consisting of the am ino acid sequence:
  • the core polypeptide is acetylated at the N-terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 60 or a fragment thereof.
  • the core polypeptide is acetylated at the N-terminus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H I 5.
  • the immune response induced neutralizes strains of influenza virus subtype H I 5
  • the core polypeptide is a fragment of an H 1 5 core polypeptide.
  • the core polypeptide is a fragment of an H I 5 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H 15 core polypeptide's N- or C- term inus.
  • the core polypeptide is a fragment of an H I 5 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H I 5 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of an H I 5 core polypeptide's N- and C- termini.
  • the core polypeptide has an alpha-helical conformation.
  • the core polypeptide is an H I 5 core polypeptide that is not full length influenza virus HA .
  • the core polypeptide is an H I 5 core polypeptide that is between 5 1 to 300, 5 1 to 275, 5 1 to 250, 5 1 to 225, 5 1 to 200, 5 1 to 1 75, 5 1 to 1 50, 5 1 to 125, 5 1 to 100, or 51 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H I 5 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 1 25, 1 00, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is an H I 5 polypeptide less than 1 50, 125, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 15, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H I 5 core polypeptide, wherein the derivative comprises an H I 5 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10( ⁇ 5) amino acids attached to either of the H I 5 core polypeptide's N- or C- terminus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an H I 5 core polypeptide, wherein the derivative comprises an H I 5 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to both of the H I 5 core polypeptide's N- and C- term ini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is an H I 6 core polypeptide comprising or consisting of the amino acid sequence:
  • Xi is a hydrophobic amino acid
  • X2 is a hydrophilic, basic amino acid
  • X3 is a hydrophilic, acidic amino acid
  • X 4 is a hydrophilic amino acid.
  • is L or I
  • X 2 is K or R
  • X 3 is D or E
  • X4 is S or N.
  • the core polypeptide is acetylated at the N-terminus.
  • a core polypeptide comprises any one of the amino acid sequences shown in Figure 6P (SEQ I D NOS: 58-60) or a fragment thereof.
  • the core polypeptide is acetylated at the N-terminus.
  • this core polypeptide can be used to induce an immune response against influenza virus strains of subtype H I 6. In certain embodiments, the immune response induced neutralizes strains of influenza virus subtype H 1 6.
  • the core polypeptide is a fragment of an H I 6 core polypeptide.
  • the core polypeptide is a fragment of an H 16 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10( ⁇ 5), 1 5( ⁇ 5), 20( ⁇ 5), 25( ⁇ 5), 30( ⁇ 5), or 35( ⁇ 5) amino acids from either of an H 16 core polypeptide's N- or C- terminus.
  • the core polypeptide is a fragment of an H 16 core polypeptide, wherein the fragment lacks 24( ⁇ 5) amino acids from its C- terminus.
  • the core polypeptide is a fragment of an H I 6 core polypeptide, wherein the fragment lacks 1 , 2, 3, 4, 5, or more amino acids from both of an H 16 core polypeptide's N- and C- termini.
  • the core polypeptide has an alpha-hel ical conformation.
  • the core polypeptide is an H I 6 core polypeptide that is not ful l length influenza virus HA. In some embodiments, the core polypeptide is an H I 6 core polypeptide that is between 5 1 to 300, 5 1 to 275, 5 1 to 250, 5 1 to 225, 5 1 to 200, 51 to 1 75, 5 1 to 1 50, 5 1 to 125, 5 1 to 100, or 5 1 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is an H I 6 core polypeptide that is less than 500, 450, 400, 350, 300, 275, 250, 225, 200, 1 75, 1 50, 125, 1 00, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30 or 25 amino acids in length.
  • the core polypeptide is an H 1 6 polypeptide less than 1 50, 1 25, 95, 90, 85, 80, 75, 65, 60, 55, 50, 45 or 40 amino acids in length but at least 1 5, 20, 25, 30 or 35 amino acids in length.
  • the core polypeptide is a derivative of an H 16 core polypeptide, wherein the derivative comprises an H 16 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 10( ⁇ 5) amino acids attached to either of an H I 6 core polypeptide's N- or C- term inus and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide is a derivative of an HI 6 core polypeptide, wherein the derivative comprises an H I 6 core polypeptide with 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0( ⁇ 5) amino acids attached to both of an H I 6 core polypeptide's N- and C- termini and wherein the core polypeptide maintains an alpha-helical conformation.
  • the core polypeptide comprises or consists of the sequence:
  • the core polypeptide is acetylated at the N-terminus.
  • a core polypeptide comprises or consists of any one of the amino acid sequences shown in Figure 5A or a fragment thereof. In certain embodiments, the core polypeptide is acetylated at the N-terminus. In a specific embodiment, a core polypeptide comprises or consists of any one of the amino acid sequences shown in Figure 5 B or fragment thereof.
  • the core polypeptide is between 5 1 to 300, 51 to 275, 51 to 250, 51 to 225, 51 to 200, 51 to 1 75, 5 1 to 1 50, 5 1 to 125, 5 1 to 1 00, or 51 to 75, 1 5 to 50, 20 to 50, 25 to 50, 1 5 to 37, 1 5 to 35, 20 to 37, 20 to 35, 1 5 to 30, 20 to 30 or 20 to 25 amino acids in length.
  • the core polypeptide is less than 500, 450, 400, 350, 300, 275, 250, 225,
  • the core polypeptide is less than 1 50, 1 25, 95,
  • the flu polypeptides and core polypeptides described herein are modified to have an extended (or increased) half-life in vivo (i.e., modified core polypeptides).
  • modified core polypeptides which have a half-life in a subject of from about 3 days to about 1 80 days (or more), and in some embodiments greater than 3 days, greater than 7 days, greater than 1 0 days, greater than 1 5 days, greater than 20 days, greater than 25 days, greater than 30 days, greater than 35 days, greater than 40 days, greater than 45 days, greater than 50 days, at least about 60 days, greater than 75 days, greater than 90 days, greater than 105 days, greater than 1 20 days, greater than 135 days, greater than 1 50 days, greater than 1 65 days, or greater than 1 80 days.
  • flu or core polypeptides having an increased half-life in vivo are generated by acetylation of the N- terminus of the flu or core polypeptides.
  • Acetylation of polypeptides is a technique well-known to those of skill in the art and comprises the addition of an acetyl group to the N- terminus of the polypeptide.
  • Acetylation of the core polypeptide can render the core polypeptide less vulnerable to degradation by exopeptidases.
  • flu or core polypeptides having an increased half-life in vivo are generated by amidation of the C-terminus of the flu or core polypeptides.
  • flu or core polypeptides having an increased half-life in vivo are generated by pegylation, i.e., attaching inert polymer molecules such as high molecular weight polyethyleneglycol (PEG) to the flu or core polypeptides with or without a multifunctional linker either through site-specific conjugation of the PEG to the N- or C-terminus of the flu or core polypeptides or via epsilon-amino groups present on lysine residues.
  • PEG polyethyleneglycol
  • PEG polyethyleneglycol
  • the N-terminus of the flu or core polypeptides is pegylated.
  • Linear or branched polymer derivatization that results in minimal loss of biological activity can be used.
  • the degree of conjugation can be closely monitored by SDS-PAGE and mass spectrometry to ensure proper conjugation of PEG molecules to the flu or core polypeptides.
  • Unreacted PEG can be separated from flu or core polypeptide-PEG conjugates by size-exclusion or by ion-exchange chromatography.
  • PEG-derivatized flu or core polypeptides can be tested for in vivo efficacy using methods well-known to those of skill in the art, for example, by using animal model systems described herein.
  • flu or core polypeptides can be conjugated to albumin in order to make the core polypeptides more stable in vivo or have a longer half-life in vivo.
  • albumin Such techniques are well-known in the art, see, e.g., International Publication Nos. WO 93/1 5199, WO 93/1 5200, and WO 01 /77137; and European Patent No. EP 41 3,622, all of which are incorporated herein by reference.
  • flu or core polypeptides having an increased half-life in vivo are generated by substitution of terminal L-amino acids of the core polypeptides with D-amino acids.
  • the flu polypeptides described herein comprises a core polypeptide or modified core polypeptide linked to a linker.
  • the linkers encompassed herein can be any linker known to those of skill in the art that does not interfere with the native structure of the core polypeptide with which the linker is associated. In specific embodiments, the linkers encompassed herein are not hydrophobic.
  • the length of the linker may be varied to provide optimal linkage between a core polypeptide or a modified core polypeptide described herein and a substrate (e.g. , carrier protein, T cell epitope, immunogenic polypeptide) to which the core polypeptide or modified core polypeptide is to be linked. Further, the length of the linker may be optimized to prevent immunogenic responses due to linker.
  • Linker molecules are commonly known in the art and described in Denardo et ai , 1998, Clin. Cancer Res. 4:2483-90; Peterson et ai , 1999, Bioconjug. Chem. 1 0:553 ; and Zimmerman et ai, 1999, Nucl. Med. Biol. 26:943-50 each of which is incorporated by reference herein in its entirety.
  • Linkers may be one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, twenty, or more than twenty amino acids in length. In some embodiments, the linker is less than 20 amino acids in length. In some
  • the linker is less than 1 5 amino acids in length. In some embodiments, the linker is less than 1 0 amino acids in length. In some embodiments, the linker is less than 9 amino acids in length. In some embodiments, the linker is less than 8 amino acids in length. I n some embodiments, the linker is less than 7 amino acids in length. In some embodiments, the linker is less than 6 amino acids in length. In some embodiments, the linker is less than 5 amino acids in length. In some embodiments, the linker is less than 4 am ino acids in length. In some embodiments, the linker is less than 3 amino acids in length. In some embodiments, the linker is less than 2 amino acids in length.
  • a linker is between 1 and 50 amino acids in length. In some embodiments, a linker is between 1 to 40 amino acids, 1 to 30 amino acids, 1 to 20 amino acids, 1 to 1 0 amino acids, 1 to 5 amino acids, 1 to 4 amino acids, 1 to 3 amino acids, 1 to 2 amino ac ids or I amino acid in length.
  • the linker is covalently attached to the core polypeptide or modified core polypeptide.
  • the linker is attached to the core polypeptide or modified core polypeptide through a peptide bond.
  • the linker is attached to the N-terminus of the core polypeptide or modified core polypeptide.
  • the linker is attached to the C-terminus of the core polypeptide or modified core polypeptide.
  • the linker comprises one or more glycine residues. In some embodiments, the linker comprises two or more glycine residues. In some embodiments, the linker comprises three or more glycine residues. In some
  • the linker comprises four or more glycine residues. In some embodiments, the linker comprises five or more glycine residues. In some embodiments, the linker comprises ten or more glycine residues. In some embodiments, the linker comprises 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0 or more glycine residues. In some embodiments, the linker comprises 2 to 4, 2 to 6, 2 to 1.0, 3 to 6, 3 to 8, 3 to 10, 5 to 1 0, 8 to 10, 1 0 to 1 5 or 10 to 20 glycine residues. I n a specific embodiment, the linker comprises three glycine residues.
  • the linker comprises one or more cysteine amino acid residues. In some embodiments, the linker comprises 1 , 2, 3, 4, 5, 6, 7, 8, 9, or 1 0 or more cysteine residues. In some embodiments, the linker comprises 2 to 4, 2 to 6, 2 to 1 0, 3 to 6, 3 to 8, 3 to 1 0, 5 to 10, 8 to 1 0, 10 to 1 5 or 1 0 to 20 cysteine residues.
  • the linker comprises a protein tag.
  • Protein tags can be useful for the isolation of protein complexes, isolation of a flu polypeptide, affinity chromatography and/or localization studies.
  • protein tags may increase the solubility of a flu polypeptide. Examples of protein tags include, but are not limited to, His tag, Strep II tag, T7-tag, FLAG-tag, S-tag, HA tag, c-Myc tag, DHFR tag, and green fluorescent protein (GFP). Protein tags may be covalently attached to the N- or C- terminus of the flu polypeptide.
  • the linker comprises a FLAG- Tag protein tag, i.e., the linker comprises the amino acid DY DDDDK.
  • the l inker comprises a FLAG-Tag covalently linked to a cysteine residue (i.e., DYKDDDDKC).
  • a flu polypeptide comprises 1 , 2, 3, 4 or more protein tags.
  • the protein tag is not used as a linker in a flu polypeptide.
  • flu polypeptides comprising two or more core polypeptides or modified core polypeptides.
  • the two or more core polypeptides or modified core polypeptides can be directly or indirectly linked/coupled to each other. Without being bound to any particular theory of operation, it is believed that administration of flu polypeptides comprising two, three or more core polypeptides or modified core polypeptides can elicit serum antibodies with broad reactivity within a subject without co-administration of a carrier protein.
  • the core polypeptides or modified core polypeptides are linked together via a linker such as described in Section 5. 1 .3 supra.
  • a flu polypeptide can comprise, for example, a core polypeptide or modified core polypeptide, linked to a l inker, which is in turned linked to a core polypeptide or modified core polypeptide.
  • the flu polypeptide comprises the sequence X-L-X.
  • the flu polypeptide comprises the sequence X-L-X-L-X.
  • the flu polypeptide comprises the sequence X-L-X-L-X-L-X.
  • the flu polypeptide comprises the sequence X-L-X-L-X-L-X-L-X. In a specific embodiment, the flu polypeptide comprises the sequence X-L-X-L-X-L-X- L-X. In a specific embodiment, the flu polypeptide comprises the sequence X-L-X-L-X- L-X-L-X-L-X-L-X. In a specific embodiment, the flu polypeptide comprises the sequence X-L-X-L-X-L-X-L-X-L-X-L-X.
  • the flu polypeptide comprises the sequence X-L-X-L-X-L-X-L-X-L-X-L-X-L-X-L-X-L-X. In a specific embodiment, the flu polypeptide comprises the sequence X-L-X-L-X-L-X-L-X- L-X-L-X-L-X-L-X-L-X. In a specific embodiment, the flu polypeptide comprises the sequence X-L-X-L-X-L-X-L-X-L-X-L-X-L-X-L-X-L-X-L-X-L-X-L-X.
  • L is absent.
  • each of the core polypeptide or modified core polypeptide of the flu polypeptide is directly linked to one or more other core polypeptide (e.g., X-X, X-X-X, X-X-X-X, X-X-X-X-X, etc.)
  • a flu polypeptide comprises two or more of the same core polypeptides or modified core polypeptides. In other embodiments, the flu polypeptide comprises or two or more different core polypeptides or core polypeptides. In a specific embodiment, the flu polypeptide comprises two or more of the same core polypeptides or modified core polypeptides. In a specific embodiment, the flu polypeptide comprises three or more of the same core polypeptides or modified core polypeptides. I n a specific embodiment, the flu polypeptide comprises four or more of the same core polypeptides or modified core polypeptides. In a specific embodiment, the flu polypeptide comprises five or more of the same core polypeptides or modified core polypeptides. In a specific embodiment, each of the core polypeptide or modified core polypeptide of the flu polypeptide is the same.
  • the flu polypeptide comprises two or more different core polypeptides or modified core polypeptides. In a specific embodiment, the flu polypeptide comprises three or more different core polypeptides or modified core polypeptides. In a specific embodiment, the flu polypeptide comprises four or more different core polypeptides or modified core polypeptides. In a specific embodiment, the flu polypeptide comprises five or more different core polypeptides or modified core polypeptides.
  • a flu polypeptide comprises the sequence X-L-X-L-X wherein X is a core polypeptide comprising the amino acid sequence
  • RIQDLEKYVEDTKI DLWSYNAELLVALENQHTIDLTDSEMNKLFEKT RRQLRENA (SEQ I D NO:2) and L is a linker consisting of three glycine residues.
  • X is not
  • a flu polypeptide in addition to comprising two or more modified core polypeptides, comprises one, two, three or more or al l of the following: a T cell epitope, a polypeptide that facilitates multimerization (e.g. , a T4 foldon domain), a protein tag, or an immunogenic polypeptide as described herein.
  • the flu polypeptide comprises a His-tag at its N-terminus.
  • a flu polypeptide comprises a FLAG-tag at its C-terminus.
  • a flu polypeptide comprises a His-tag at its N-terminus and a FLAG-tag at its C-terminus.
  • a flu polypeptide comprises an influenza A nuclear protein (NP) at its C-terminus.
  • a flu polypeptide comprises an FljB flagellin at its C-terminus.
  • a flu polypeptide comprises the amino acid sequence H-X-L-X-L-X-F, wherein H is a His tag or another protein tag that faci litates purification and/or solubil ity of the flu polypeptide, X is a core polypeptide or a modified core polypeptide, L is a linker and F is a FLAG-tag or another protein tag different from H that facilitates the purification and/or solubility of the flu polypeptide.
  • L is 3 glycine residues.
  • L is the same and in other embodiments L is different.
  • a flu polypeptide comprises a core polypeptide or modified core polypeptide described herein and a T cell epitope (e.g. , CD4 or CD8 T cell epitope).
  • a flu polypeptide comprises a core polypeptide or modified core polypeptide and a CD4 T cell epitope.
  • a flu polypeptide comprises a core polypeptide or modified core polypeptide and a CD8 T cell epitope.
  • the T-cell epitope is an influenza virus CD8 T cell epitope (e.g. , an influenza virus protein that contains a highly conserved T cell epitope).
  • the T cell epitope can be directly or indirectly linked/coupled to a core polypeptide by a modified core polypeptide.
  • flu polypeptides comprising a core polypeptide or modified core polypeptide and a CD8 T cell epitope can elicit broadly neutralizing antibodies and prime for a broad spectrum CD8 T cel l response.
  • Highly conserved influenza virus regions that contain CD8 T cell epitopes are found, for example, in influenza nuclear protein (NP), matrix 1 (M l ), neuraminidase (NA) and polymerase basic- 1 (PB 1 ).
  • NP nuclear protein
  • M l matrix 1
  • NA neuraminidase
  • PB 1 polymerase basic- 1
  • the CD8 T cell epitope is a nuclear protein (NP) or fragment thereof.
  • the CD8 T cell epitope polypeptide is a matrix 1 (M l ) protein or fragment the or fragment thereof
  • a flu polypeptide comprises a core polypeptide or a modified core polypeptide linked to a T cel l epitope.
  • the T cell epitope e.g. , CD8 T cell epitope
  • the T cell epitope can be attached to the core polypeptide or modified core polypeptide described herein using any technique known to one of skill in the art, including, but not limited to, single point attachment to a primary amino group or sulfhydryl group using amine to amine crossl inker BS (Bis[sulfosuccinimidyl] suberate), an amine-to-sulfhydryl NHS- PEG-Maleimide crosslinker, or a sulfhydryl-to-sulfhydryl BM(PEG) n PEG crosslinker.
  • the T cell epitope (e.g. , CD8 T cell epitope) is covalently linked to the N- or C- terminus of a flu polypeptide.
  • the T cell epitope (e.g. , CD8 T cell epitope) is linked to a core polypeptide or modified core polypeptide via a linker as described herein in Section 5. 1 .3 supra.
  • a flu polypeptide in addition to comprising one or more core polypeptides or modified core polypeptides and a T cell epitope comprises one, two, three or more or al l of the following: a protein tag, an immunogenic polypeptide, a carrier and/or a polypeptide that facilitates the multimerization of the flu polypeptide (e.g. , a T4 foldon domain).
  • a flu polypeptide comprises one, two, three, four or more core polypeptides or modified core polypeptides and a T cell epitope(s).
  • a flu polypeptide comprises the formula H-X-L-X-L-X-F-T, wherein H (which is optional) is a His tag or another protein tag that facilitates purification and/or solubility, X is a core polypeptide or a modified core polypeptide, L is a linker (such as described in Section 5.1 .3), F (which is optional) is a FLAG-tag or another protein tag different that H which facilitates purification and/or solubility, and T is a T cell epitope.
  • the polypeptide comprises the formula H-X-L-X-L-X-T, wherein H (which is optional) is a His tag or another protein tag that facilitates purification and/or solubility, X is a core polypeptide or a modified core polypeptide, L is a linker (such as described in Section 5. 1 .3), and T is a T cell epitope.
  • L is three glycine residues. In some embodiments, L is the same each time it occurs in the formula and in other embodiments, L is different or varies each time it occurs in the formula. In certain embodiments, there is linker between F and T. I n other embodiments, F is directly linked to T. In certain embodiments, the core polypeptide or modified core polypeptide is the same each time it occurs in the formula. In other embodiments, the core polypeptide or modified core polypeptide is different or varies each time it occurs in the formula.
  • X there is a linker between X and T.
  • X is directly linked to T.
  • a flu polypeptide comprises one or more core polypeptides or modified core polypeptides and an immunogenic polypeptide.
  • a flu polypeptide comprises a core polypeptide or a modified core polypeptide directly or indirectly linked/coupled to an immunogenic polypeptide.
  • the immunogenic polypeptide can be linked/coupled to the N- and/or C- terminus of the core polypeptide or modified core polypeptide.
  • immunogenic polypeptide is linked to the core polypeptide or modified core polypeptide via a l inker such as described in Section 5. 1 .3 supra.
  • immunogenic polypeptides include, but are not limited to, Toll Like Receptor (TLR) l igands, such as the Salmonella flagellin (a Toll like receptor 5 ligand). See, e.g. , Huleatt et al , 2008, Vaccine 26: 201 - 14; Song et al , 2009, Vaccine 27: 5875-84; and Wang ⁇ ?i ⁇ a/. , 201 0, PLos One 5 : e l 3972.
  • a flu polypeptide comprises a core polypeptide linked to FljB flagellin from Salmonella ent erica.
  • a flu polypeptide comprises one or more core polypeptides or modified core polypeptides and an immunogenic polypeptide.
  • a flu polypeptide in addition to comprising one or more core polypeptides or modified polypeptides and an immunogenic polypeptide, comprises one, two three, or more or al l of the following: a protein tag that facilitates purification and/or increases solubi lity of the flu polypeptide, a T cell epitope and/or a polypeptide ⁇ e.g. , a T4 foldon domain) that facilitates multimerization of the flu polypeptide.
  • a flu polypeptide comprises two, three, four or more core polypeptides or modified core polypeptides and an immunogenic polypeptide(s).
  • a flu polypeptide comprises H-X-L-X-L-X-F-I, wherein H is an optional His tag or another protein tag that facilitates purification and/or solubility, X is a core polypeptide or modified core polypeptide, L is an optional linker, such as described in Section 5. 1 .3, F is an optional FLAG-tag or another protein tag different than H that facilitates purification and/or solubility of the flu polypeptide, and I is an immunogenic polypeptide.
  • L is three glycine residues.
  • L is the same throughout the flu polypeptide and in other embodiments, L is different throughout the polypeptide.
  • F is directly linked to I.
  • a flu polypeptide comprises H-X-L-X-L-X-I, wherein H is an optional His tag or another protein tag that facilitates purification and/or solubility, X is a core polypeptide or modified core polypeptide, L is an optional l inker, such as described in Section 5.1 .3, and I is an immunogenic polypeptide.
  • L is three glycine residues.
  • L is the same throughout the flu polypeptide and in other embodiments, L is different throughout the polypeptide.
  • X is directly linked to I .
  • a flu polypeptides comprise a core polypeptide or modified core polypeptide described herein and a carrier.
  • a flu polypeptide comprises a core polypeptide or a modified core polypeptide coupled/linked to a carrier.
  • the core polypeptide or modified core polypeptide can be directly or indirectly linked/coupled to a carrier.
  • a core polypeptide or modified core polypeptide described herein can be coupled/linked (e.g. , directly linked by a linker) to a carrier, including but not limited to, tetanus toxoid (e.g. , chemically-inactivated tetanus toxin), diphtheria toxin (e.g.
  • a core chemically-inactivated diphtheria toxoid or CRM 197 - a non-toxic diphtheria toxin point mutant
  • keyhole limpet hemocyanin LH
  • bovine serum albumin ovalbum in, thyroglobulin or meningococcal outer membrane protein, using methods known to those of skill in the art.
  • a core chemically-inactivated diphtheria toxoid or CRM 197 - a non-toxic diphtheria toxin point mutant
  • LH keyhole limpet hemocyanin
  • bovine serum albumin ovalbum in, thyroglobulin or meningococcal outer membrane protein
  • polypeptide(s) or modified core polypeptide(s) described herein are linked to KLH.
  • a core polypeptide(s) or modified core polypeptide(s) described herein are directly linked to a carrier protein, i.e., the core polypeptide or modified core polypeptide and carrier protein are linked to one another without an intervening l inker molecule.
  • the core polypeptide(s) or modified core polypeptide(s) described herein are linked to a carrier protein by a linker.
  • a core polypeptide(s) or modified core polypeptide(s) described herein is l inked to a carrier protein by a linker described in section 5.1 .3, supra.
  • a flu polypeptide comprises a core polypeptide or modified core polypeptide coupled/linked to more than one carrier.
  • a flu polypeptide comprises a core polypeptide or modified core polypeptide coupled/linked to 2, 3, 4, 5 or more carriers.
  • 2, 3, 4, 5, 6 or more of the same core polypeptide or modified core polypeptide described herein are linked to a carrier.
  • 2, 3, 4, 5, 6 or more different core polypeptides or modified core polypeptides described herein are l inked to a carrier.
  • the core polypeptides or modified core polypeptides described herein are couple/linked to a carrier by chemical cross-linking.
  • a carrier by chemical cross-linking.
  • the cross-linker l -ethyl-3-(3-dimethylaminopropyl) carbodiimide (“EDC”) or the cross- l inker Sulfosuccinimidyl 4-[N-maleimidomethyl]cyclohexane- l -carboxylate (“Sulfo- SMCC”) can be used to cross-link a core polypeptide to a carrier.
  • EDC cross-linker l -ethyl-3-(3-dimethylaminopropyl) carbodiimide
  • Sulfo- SMCC Sulfosuccinimidyl 4-[N-maleimidomethyl]cyclohexane- l -carboxylate
  • Other cross-linkers include Glutaraldehyde and Bis
  • a flu polypeptide comprises (i) the long alpha- helix of the HA2 hemagglutinin subunit of the influenza virus strain A/Hong
  • H3 Kong/1 /1 968 (i.e., amino acids 76- 130, numbered according to the classic H3 subtype numbering system); (ii) a FLAG-tag; and (iii) a C-terminal cysteine residue which can be used, e.g., to couple/link the core polypeptide to a carrier (e.g., KLH).
  • a flu polypeptide comprises the following amino acid sequence: RIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEM KLFEKT RRQLRENADYKDDDDKC (SEQ ID NO: l ), wherein the FLAG-tag is represented by the amino acid sequence DYKDDDDK.
  • the N-terminus of the modified core polypeptide is acetylated.
  • a flu polypeptide comprises a core polypeptide or a modified core polypeptide described herein and a polypeptide that facilitates the formation of multimers (e.g. , trimers).
  • the core polypeptide or modified polypeptide is coupled/linked to a polypeptide, such as a T4 foldon domain, to allow/facilitate the the formation of a trimer.
  • the core polypeptide or modified core polypeptide is indirectly or directly linke/coupled to a polypeptide that facilitates multimerization (e.g. , trimerization, such as by a T4 foldon domain) at its C-terminus.
  • a T4 foldon domain may allow for the formation of the trimeric configuration of the influenza A long alpha helix seen in the native hemagglutinin molecule.
  • a flu polypeptide comprises two or more core polypeptides or modified polypeptides and a polypeptide that facilitates the formation of a trimer.
  • the polypeptide that facilitates formation of a trimer is a T4 foldon domain.
  • the polypeptide that facilitates the formation of a multimer is l inked/coupled to a core polypeptide or a modified pore polypeptide by a linker, such as described in section 5.1 .3 supra.
  • the flu polypeptide comprises a core polypeptide or a modified core polypeptide, a linker and a polypeptide, such as a T4 foldon domain, that facilitates the formation of multimers.
  • a flu polypeptide in addition to comprising 2, 3, 4 or more core polypeptides or modified core polypeptides and a polypeptide that facilitates multimerization, such as a T4 foldon domain comprises one, two, three or more, or all of the following: a protein tag facilitates purification and/or solubility of the flu polypeptide, an immunogenic polypeptide, and/or carrier such as described herein.
  • a flu polypeptide comprises a protein tag ⁇ e.g. , a His tag) that facilitates purification and/or solubility, a core polypeptide or a modified core polypeptide and a polypeptide that facilitates trimerization, such as a T4 foldon domain.
  • nucleic acids that encode flu polypeptides described herein are encompassed herein.
  • nucleic acids corresponding to naturally occurring influenza virus nucleic acids encoding a region of the HA2 domain (e.g. , the long alpha helix region) of the hemagglutinin protein are used to produce a flu polypeptide.
  • nucleic acids capable of hybridizing to a nucleic acid encoding a flu polypeptide are also provided herein.
  • nucleic acids capable of hybridizing to a fragment of a nucleic acid encoding a flu polypeptide. In other embodiments, provided herein are nucleic acids capable of hybridizing to the full length of a nucleic acid encoding a flu polypeptide.
  • General parameters for hybridization conditions for nucleic acids are described in Sambrook et ai , Molecular Cloning - A Laboratory Manual (2nd Ed.), Vols. 1 -3, Cold Spring Harbor Laboratory, Cold Spring Harbor, New York ( 1 989), and in Ausubel et al , Current Protocols in Molecular Biology, vol. 2, Current Protocols Publishing, New York ( 1 994).
  • Hybridization may be performed under high stringency conditions, medium stringency conditions, or low stringency conditions.
  • high stringency conditions may include temperatures within 5°C melting temperature of the nucleic acid(s), a low salt concentration (e.g. , less than 250 mM), and a high co-solvent concentration (e.g. , 1 -20% of co-solvent, e.g. , DMSO).
  • Low stringency conditions may include temperatures greater than 1 0°C below the melting temperature of the nucleic acid(s), a high salt concentration (e.g. , greater than 1 000 mM) and the absence of co-solvents.
  • a nucleic acid encoding an influenza virus flu polypeptide is isolated, i.e., a flu polypeptide described herein is isolated.
  • a nucleic acid encoding an influenza virus core polypeptide or modified core polypeptide as described herein is isolated.
  • an "isolated" nucleic acid refers to a nucleic acid molecule which is separated from other nucleic acid molecules which are present in the natural source of the nucleic acid.
  • the isolated nucleic acid can comprise heterologous nucleic acids that are not associated with it in nature.
  • an "isolated" nucleic acid such as a cDNA molecule
  • substantially free of cellular material includes preparations of nucleic acid in which the nucleic acid is separated from cellular components of the cells from which it is isolated or recombinantly produced.
  • nucleic acid that is substantially free of cellular material includes preparations of nucleic acid having less than about 30%, 20%, 1 0%, or 5% (by dry weight) of other nucleic acids.
  • substantially free of culture medium includes preparations of nucleic acid in which the culture medium represents less than about 50%, 20%, 10%, or 5% of the volume of the preparation.
  • substantially free of chemical precursors or other chemicals includes preparations in which the nucleic acid is separated from chemical precursors or other chemicals which are involved in the synthesis of the nucleic acid. In specific embodiments, such preparations of the nucleic acid have less than about 50%, 30%, 20%, 1 0%, 5% (by dry weight) of chemical precursors or compounds other than the nucleic acid of interest.
  • nucleic acids that encode a flu polypeptide comprising a core polypeptide and one or more additional components, e.g. , a linker, a carrier, a protein tag, and/or a protein that is/are associated with a core polypeptide.
  • the flu polypeptides described herein can be produced by any method known in the art for the synthesis of polypeptides, in particular, by chemical synthesis or by recombinant expression techniques.
  • the methods provided herein encompass, unless otherwise indicated, conventional techniques in molecular biology, microbiology, genetic analysis, recombinant DNA, organic chemistry, biochemistry, PCR, oligonucleotide synthesis and modification, nucleic acid hybridization, and related fields within the skill of the art. These techniques are described in the references cited herein and are fully explained in the literature. See, e.g., Maniatis et al. ( 1 982) Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press; Sambrook et al. ( 1989), Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor
  • the flu polypeptides described herein may be prepared using conventional step-wise solution or solid phase synthesis (see, e.g. , Chemical Approaches to the Synthesis of Peptides and Proteins, Wil liams et al., Eds., 1997, CRC Press, Boca Raton Fla., and references cited therein; Solid Phase Peptide Synthesis: A Practical Approach, Atherton & Sheppard, Eds., 1 989, IRL Press, Oxford, England, and references cited therein).
  • the flu polypeptides described herein may be prepared by way of segment condensation, as described, for example, in Liu et al., 1996, Tetrahedron Lett. 37(7):933-936; Baca, et al., 1995, J. Am. Chem. Soc. 1 1 7: 1 881 - 1 887; Tam et al., 1995, Int. J.. Peptide Protein Res. 45 :209-21 6; Schnolzer and Kent, 1 992, Science 256:221 -225; Liu and Tam, 1994, J. Am. Chem. Soc. 1 16( 10):4149-41 53 ; Liu and Tam, 1994, Proc. Natl. Acad. Sci.
  • Flu polypeptides comprising core polypeptides and linkers can be synthesized by adding the linker(s) to the core polypeptide chain at the appropriate step in the synthesis.
  • Suitable protecting schemes and chemistries are well known, and will be apparent to those of skill in the art.
  • Formation of disulfide linkages is generally conducted in the presence of mild oxidizing agents. Chemical oxidizing agents may be used, or the compounds may simply be exposed to atmospheric oxygen to effect these linkages.
  • oxidizing agents may be used, or the compounds may simply be exposed to atmospheric oxygen to effect these linkages.
  • Various methods are known in the art, including those described, for example, by Tam et al., 1979, Synthesis 955-957; Stewart et al., 1984, Solid Phase Peptide Synthesis, 2d Ed., Pierce Chemical Company Rockford, III.; Ahmed et al., 1975, J. Biol. Chem. 250: 8477- 8482; and Pennington et al., 1991 Peptides 1990 164- 1 66, Giralt and Andreu, Eds., ESCOM Leiden, The Netherlands.
  • Recombinant expression of a flu polypeptide requires construction of an expression vector containing a polynucleotide that encodes the flu polypeptide. Once a polynucleotide encoding a flu polypeptide has been obtained, the vector for the production of the flu polypeptide may be produced by recombinant DNA technology using techniques well-known in the art. Thus, methods for preparing a flu polypeptide by expressing a polynucleotide containing a flu polypeptide-encoding nucleotide sequence are described herein. Methods which are well known to those skilled in the art can be used to construct expression vectors containing flu polypeptide coding sequences and appropriate transcriptional and translational control signals.
  • replicable expression vectors comprising a nucleotide sequence encoding a flu polypeptide operably linked to a promoter.
  • An expression vector comprises a nucleic acid encoding a flu polypeptide in a form suitable for expression of the nucleic acid in a host cell.
  • the host cell is an isolated host cell.
  • an expression vector includes one or more regulatory sequences, selected on the basis of the host cells to be used for expression, which is operably linked to the nucleic acid to be expressed.
  • "operably linked" is intended to mean that a nucleic acid of interest is linked to the regulatory sequence(s) in a manner which allows for expression of the nucleic acid (e.g. , in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).
  • Regulatory sequences include promoters, enhancers and other expression control elements (e.g. , polyadenylation signals).
  • Regulatory sequences include those which direct constitutive expression of a nucleic acid in many types of host cells, those which direct expression of the nucleic acid only in certain host cel ls (e.g. , tissue-specific regulatory sequences), and those which direct the expression of the nucleic acid upon stimulation with a particular agent (e.g. , inducible regulatory sequences). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc.
  • the term "host cell” is intended to include a particular subject cell transformed or transfected with a nucleic acid and the progeny or potential progeny of such a cell.
  • Progeny of such a cell may not be identical to the parent cell transformed or transfected with the nucleic acid due to mutations or environmental influences that may occur in succeeding generations or integration of the nucleic acid into the host cell genome.
  • the host cell is isolated.
  • An expression vector can be introduced into host cells via conventional transformation or transfection techniques. Such techniques include, but are not limited to, calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, and electroporation.
  • a host cell is transiently transfected with an expression vector containing a nucleic acid encoding a flu polypeptide.
  • a host cell is stably transfected with an expression vector containing a nucleic acid encoding a flu polypeptide.
  • host cel ls contain ing a polynucleotide encoding a flu polypeptide described herein or generated in accordance with the methods provided herein.
  • a variety of host-expression vector systems may be utilized to express a flu polypeptide.
  • Such host-expression systems represent vehicles by which the coding sequences of interest may be produced and subsequently purified, but also represent cells which may, when transformed or transfected with the appropriate nucleotide coding sequences, express a flu polypeptide in situ.
  • These include but are not limited to microorganisms such as bacteria (e.g. , E. coli and B.
  • subtilis transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing flu polypeptide coding sequences; yeast ⁇ e.g., Saccharomyces Pichia) transformed with recombinant yeast expression vectors containing flu polypeptide coding sequences; insect cell systems infected with recombinant virus expression vectors ⁇ e.g., baculovirus) containing flu polypeptide coding sequences; plant cell systems infected with recombinant virus expression vectors ⁇ e.g., cauliflower mosaic virus, CaMV;
  • bacterial cells such as tobacco mosaic virus, TMV or transformed with recombinant plasmid expression vectors ⁇ e.g., Ti plasmid) containing flu polypeptide coding sequences; or mammalian cell systems ⁇ e.g., COS, CHO, BH , 293, NS0, and 3T3 cells) harboring recombinant expression constructs containing promoters derived from the genome of mammalian cells ⁇ e.g. , metallothionein promoter) or from mammalian viruses ⁇ e.g., the adenovirus late promoter; the vaccinia virus 7.5 promoter).
  • bacterial cells such as
  • Escherichia coli and more preferably, eukaryotic cells are used for the expression of a flu polypeptide.
  • mammalian cells such as Chinese hamster ovary cells (CHO), in conjunction with a vector such as the major intermediate early gene promoter element from human cytomegalovirus is an effective expression system for flu polypeptides (Foecking et al. , 1986, Gene 45 : 101 ; and Cockett et al. , 1990,
  • nucleotide sequences encoding the flu polypeptides described herein or generated in accordance with the methods provided herein is regulated by a constitutive promoter, inducible promoter or tissue specific promoter.
  • a number of expression vectors may be advantageously selected depending upon the use intended for the flu polypeptide being expressed. For example, when a large quantity of flu polypeptide is to be produced, for the generation of pharmaceutical compositions of a flu polypeptide, vectors which direct the expression of high levels of fusion protein products that are readily purified may be desirable.
  • vectors include, but are not limited to, the E. coli expression vector pUR278 (Ruther et al.
  • pGEX vectors may also be used to express foreign polypeptides as fusion proteins with glutathione 5- transferase (GST).
  • fusion proteins are soluble and can easily be purified from lysed cells by adsorption and binding to matrix glutathione agarose beads followed by elution in the presence of free glutathione.
  • the pGEX vectors are designed to include thrombin or factor Xa protease cleavage sites so that the cloned target gene product can be released from the GST moiety.
  • AcNPV Autographa californica nuclear polyhedrosis virus
  • the virus grows in Spodoptera frugiperda cells.
  • the flu polypeptide coding sequence may be cloned individually into non-essential regions (for example the polyhedrin gene) of the virus and placed under control of an AcNPV promoter (for example the polyhedrin promoter).
  • a number of viral-based expression systems may be utilized.
  • the flu polypeptide coding sequence of interest may be ligated to an adenovirus
  • transcription/translation control complex e.g., the late promoter and tripartite leader sequence.
  • This chimeric gene may then be inserted in the adenovirus genome by in vitro or in vivo recombination. Insertion in a non-essential region of the viral genome (e.g., region El or E3) wil l result in a recombinant virus that is viable and capable of expressing the flu polypeptide in infected hosts (e.g., see Logan & Shenk, 1984, Proc. Natl. Acad. Sci. USA 8 1 :355-359). Specific initiation signals may also be required for efficient translation of inserted flu polypeptide coding sequences.
  • These signals include the ATG initiation codon and adjacent sequences. Furthermore, the initiation codon must be in phase with the reading frame of the desired coding sequence to ensure translation of the entire insert.
  • exogenous translational control signals and initiation codons can be of a variety of origins, both natural and synthetic. The efficiency of expression may be enhanced by the inclusion of appropriate transcription enhancer elements, transcription terminators, etc. (see, e.g. , Bittner et al , 1987, Methods in Enzymol. 1 53 :51 -544).
  • a host cel l strain may be chosen which modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired. Such modifications (e.g., glycosylation) and processing (e.g. , cleavage) of protein products may be important for the function of the flu polypeptide.
  • Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins and gene products. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the foreign protein expressed. To this end, eukaryotic host cells which possess the cellular machinery for proper processing of the primary transcript, glycosylation, and
  • Such mammalian host cells include but are not limited to CHO, VERY, BHK, Hela, COS, Vero, MDC , 293, 3T3, W l 38, BT483, Hs578T, HTB2, BT20 and T47D, NSO (a murine myeloma cell line that does not endogenously produce any immunoglobulin chains), CRL7030 and HsS78Bst cells.
  • telomeres For long-term, high-yield production of recombinant flu polypeptide, stable expression is preferred.
  • cell lines which stably express the flu polypeptide molecule may be engineered.
  • host cells can be transformed with DNA controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker.
  • appropriate expression control elements e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.
  • engineered cells may be allowed to grow for 1 -2 days in an enriched media, and then are switched to a selective media.
  • the selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci which in turn can be cloned and expanded into cell l ines.
  • This method may advantageously be used to engineer cell lines which express the flu polypeptide.
  • engineered cell lines may be particularly useful in screening and evaluation of compositions that interact directly or indirectly with the flu polypeptide. Methods commonly known in the art of recombinant DNA technology may be routinely applied to select the desired recombinant clone, and such methods are described, for example, in Ausubel et al.
  • the expression levels of a flu polypeptide can be increased by vector amplification (for a review, see Bebbington and Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Vol. 3 (Academic Press, New York, 1987)).
  • vector amplification for a review, see Bebbington and Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Vol. 3 (Academic Press, New York, 1987)).
  • a marker in the vector system expressing the flu polypeptide is amplifiable
  • increase in the level of inhibitor present in culture of host cell will increase the number of copies of the marker gene. Since the ampl ified region is associated with the flu polypeptide, production of the flu polypeptide will also increase (Crouse et al, 1983, Mol. Cell. Biol. 3 :257).
  • an expression vector containing a nucleic acid encoding a flu polypeptide can be transcribed and translated in vitro using, e.g. , T7 promoter regulatory sequences and T7 polymerase.
  • a coupled transcription/translation system such as Promega TNT®, or a cell lysate or cell extract comprising the components necessary for transcription and translation may be used to produce a flu polypeptide.
  • the method comprises culturing a host cell containing a nucleic acid encoding the polypeptide in a suitable medium such that the polypeptide is produced. In some embodiments, the method further comprises isolating the polypeptide from the medium or the host cel l.
  • plants may be engineered to express a flu polypeptide described herein.
  • plants are engineered to express a flu polypeptide described herein via an agroinfiltration procedure using methods known in the art. For example, nucleic acids encoding a gene of interest, e.g. , a gene encoding a flu polypeptide described herein, are introduced into a strain of Agrobacterium. Subsequently the strain is grown in a liquid culture and the resulting bacteria are washed and suspended into a buffer solution. The plants are then exposed (e.g.
  • the plant is , a tobacco plant (i.e., Nicotiana tabacum).
  • the plant is a relative of the tobacco plant ⁇ e.g. , Nicotiana benthamiana).
  • a plant cell culture system is used for expression of a flu polypeptide. See, e.g. , U.S. Patent Nos. 5,929,304; 7,504,560; 6,770,799; 6,551 ,820; 6, 1 36,320; 6,034,298; 5,91 4,935; 5,612,487; and 5,484,71 9, U. S. patent application publication Nos. 2009/0208477, 2009/0082548, 2009/0053762, 2008/0038232,
  • carrot cells are engineered to express a flu polypeptide.
  • algae e.g. ,
  • Chlamydomonas reinhardtii may be engineered to express a flu polypeptide (see, e.g. , Rasala et al., 201 0, Plant Biotechnology Journal (Published online March 7, 201 0, which is incorporated herein by reference in its entirety).
  • the flu polypeptides described herein and generated using the approaches described in Sections 5.3.1 and 5.3. 1 , supra, may be purified by any method known in the art for purification of a polypeptide, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
  • the flu polypeptides may be fused to heterologous polypeptide sequences described herein or otherwise known in the art to faci litate purification. The actual conditions used to purify a particular flu polypeptide will depend, in part, on the synthesis strategy (e.g.
  • influenza viruses containing a flu polypeptide.
  • the flu polypeptide is incorporated into the virions of the influenza virus.
  • the influenza viruses may be conjugated to moieties that target the viruses to particular cel l types, such as immune cells.
  • the virions of the influenza virus have incorporated into them or express a heterologous polypeptide in addition to a flu polypeptide.
  • the heterologous polypeptide may be a polypeptide that has immunopotentiating activity, or that targets the influenza virus to a particular cell type, such as an antibody that binds to an antigen on a specific cell type or a l igand that binds a specific receptor on a specific cell type.
  • Influenza viruses containing a flu polypeptide may be produced by supplying in trans the flu polypeptide during production of virions using techniques known to one ski l led in the art, such as reverse genetics and helper-free plasmid rescue.
  • a parental influenza virus comprises a genome engineered to express a flu polypeptide in cells susceptible to infection with the virus wherein hemagglutinin function is provided in trans to produce progeny influenza viruses containing the influenza flu polypeptide.
  • influenza viruses comprising a genome engineered to express a flu polypeptide.
  • the genome of a parental influenza virus is engineered to encode a flu polypeptide, which is expressed by progeny influenza virus.
  • the genome of a parental influenza virus is engineered to encode a flu polypeptide, which is expressed and incorporated into the virions of progeny influenza virus.
  • the progeny influenza virus resulting from the replication of the parental influenza virus contain a flu polypeptide.
  • the virions of the parental influenza virus have incorporated into them a heterologous polypeptide.
  • the genome of a parental influenza virus is engineered to encode a heterologous polypeptide and an influenza virus flu polypeptide, which are expressed by progeny influenza virus.
  • influenza flu polypeptide, the heterologous polypeptide or both are incorporated into virions of the progeny influenza virus.
  • the heterologous polypeptide may be a polypeptide that targets the influenza virus to a particular cell type, such as an antibody that recognizes an antigen on a specific cell type or a ligand that binds a specific receptor on a specific cell type.
  • the targeting polypeptide replaces the target cell recognition function of the virus.
  • the heterologous polypeptide targets the influenza virus to the same cell types that influenza virus infects in nature.
  • the heterologous polypeptide targets the progeny influenza virus to immune cells, such as B cells, T cells, macrophages or dendritic cells.
  • the heterologous polypeptide recognizes and binds to cell-specific markers of antigen presenting cells, such as dendritic cells (e.g. , such as CD44).
  • the heterologous polypeptide is DC-SIGN which targets the virus to dendritic cells.
  • the heterologous polypeptide is an antibody (e.g., a single-chain antibody) that targets the virus to an immune cell, which may be fused with a transmembrane domain from another polypeptide so that it is incorporated into the influenza virus virion.
  • the antibody is a CD20 antibody, a CD34 antibody, or an antibody against DEC-205.
  • the heterologous polypeptide is a viral attachment protein.
  • viruses whose attachment protein(s) can be used in this aspect are viruses selected from the group of: Lassa fever virus, Hepatitis B virus, Rabies virus, Newcastle disease virus (NDV), a retrovirus such as human
  • immunodeficiency virus tick-borne encephalitis virus, vaccinia virus, herpesvirus, pol iovirus, alphaviruses such as Sem liki Forest virus, Ross River virus, and Aura virus (which comprise surface glycoproteins such as El , E2, and E3), Borna disease virus, Hantaan virus, foamyvirus, and SARS-CoV virus.
  • an influenza A virus is engineered to encode a flu polypeptide and an influenza C HEF protein, wherein the influenza C HEF protein is substituted for the influenza A neuraminidase (NA) protein.
  • NA neuraminidase
  • a flavivirus surface glycoprotein may be used, such as Dengue virus (DV) E protein.
  • DV Dengue virus
  • Sindbis virus glycoprotein from the alphavirus family is used (K. S. Wang, R. J. Kuhn, E. G. Strauss, S. Ou, J. H. Strauss, J. Virol. 66, 4992 ( 1 992)).
  • the heterologous polypeptide is derived from an NDV HN or F protein; a human immunodeficiency virus (HIV) gp l 60 (or a product thereof, such as gp41 or gpl 20); a hepatitis B virus surface antigen (HBsAg); a glycoprotein of herpesvirus (e.g. , gD, gE); or VP1 of poliovirus.
  • HIV human immunodeficiency virus
  • HBsAg hepatitis B virus surface antigen
  • a glycoprotein of herpesvirus e.g. , gD, gE
  • VP1 of poliovirus poliovirus
  • the heterologous polypeptide is derived from any non-viral targeting system known in the art.
  • a protein of a nonviral pathogen such as an intracel lular bacteria or protozoa is used.
  • the bacterial polypeptide is provided by, e.g. , Chlamydia, Rikettsia, Coxelia, Listeria, Brucella, or Legionella.
  • protozoan polypeptide is provided by, e.g. , Plasmodia species, Leishmania spp., Toxoplasma gondii, or
  • the heterologous polypeptide expressed by an influenza virus has immunopotentiating (immune stimulating) activity.
  • immunopotentiating polypeptides include, but are not limited to, stimulation molecules, cytokines, chemokines, antibodies and other agents such as Flt-3 ligands.
  • polypeptides with immunopotentiating activity include: interferon type 1 , alpha, beta, or gamma interferon, colony stimulating factors such as granulocyte- macrophage colony-stimulating factor (GM-CSF), interleukin (IL)- l , IL-2, IL-4, IL-5, I L-6, I L-7, IL- 1 2, 1 L- 1 5, IL- 1 8, I L-21 , IL-23, tumor necrosis factor (TNF)-P, TNFa., B7. 1 , B7.2, 4- 1 BB, CD40 ligand (CD40L), and drug-inducible CD40 (iCD40) (see, e.g. , Hanks, B. A., et al. 2005. Nat Med 1 1 : 1 30- 1 37, which is incorporated herein by reference in its entirety.)
  • GM-CSF granulocyte- macrophage colony-stimulating factor
  • IL interleukin
  • influenza A and B viruses consist of eight (8) single- stranded, negative sense segments (influenza C viruses consist of seven (7) single- stranded, negative sense segments)
  • the genome of a parental influenza virus may be engineered to express a flu polypeptide (and any other polypeptide, such as a
  • the recombinant segment comprises a nucleic acid encoding the flu polypeptide as wel l as the 3 ' and 5 ' incorporation signals which are required for proper replication, transcription and packaging of the vRNAs (Gao et al. , 201 0, J. of Virology 84:8062-8074, Fujii et al. , 2003, Proc. Natl. Acad. Sci.
  • the recombinant segment encoding the flu polypeptide may replace the HA.segment of a parental influenza virus. In some embodiments, the recombinant segment encoding the flu polypeptide may replace the NS 1 gene of the parental influenza virus. In some embodiments, the recombinant segment encoding the flu polypeptide may replace the NA gene of the parental influenza virus.
  • Exemplary influenza virus strains that can be used to express the flu polypeptides include Ann Arbor/1 /50, A/Puerto Rico/8/34, A/South
  • the genome of a parental influenza virus may be engineered to express a flu polypeptide using a recombinant segment that is bicistronic.
  • Bicistronic techniques allow the engineering of coding sequences of multiple proteins into a single mRNA through the use of internal ribosome entry site (I RES) sequences.
  • I RES sequences direct the internal recruitment of ribosomes to the RNA molecule and allow downstream translation in a cap independent manner. Briefly, a coding region of one protein is inserted into the open reading frame (ORF) of a second protein. The insertion is flanked by an IRES and any untranslated signal sequences necessary for proper expression and/or function. The insertion must not disrupt the ORF,
  • a parental influenza virus is engineered to contain a bicistronic RNA segment that expresses a flu polypeptide and another polypeptide, such as gene expressed by the parental influenza virus.
  • reverse genetics techniques may be used to generate such an influenza virus.
  • reverse genetics techniques generally involve the preparation of synthetic recombinant viral RNAs that contain the non-coding regions of the negative-strand, viral RNA which are essential for the recognition by viral . polymerases and for packaging signals necessary to generate a mature virion.
  • RNAs are synthesized from a recombinant DNA template and reconstituted in vitro with purified viral polymerase complex to form recombinant ribonucleoproteins (RN Ps) which can be used to transfect cells.
  • RNPs ribonucleoproteins
  • a more efficient transfection is achieved if the viral polymerase proteins are present during transcription of the synthetic RNAs either in vitro or in vivo.
  • the synthetic recombinant RNPs can be rescued into infectious virus particles.
  • helper-free plasmid technology may be used to produce an influenza virus containing a flu polypeptide and/or an influenza virus comprising a genome engineered to express a flu polypeptide.
  • full length cDNAs of viral segments are ampl ified using PCR with primers that include unique restriction sites, which allow the insertion of the PCR product into the plasmid vector (Flandorfer et al. , 2003, J. Virol. 77:91 1 6-9123; Nakaya el al. , 2001 , J. Virol. 75 : 1 1 868- 1 1 873 ; both of which are incorporated herein by reference in their entireties).
  • the plasmid vector is designed so that an exact negative (vRNA sense) transcript is expressed.
  • the plasmid vector may be designed to position the PCR product between a truncated human RNA polymerase I promoter and a hepatitis delta virus ribozyme sequence such that an exact negative (vRNA sense) transcript is produced from the polymerase I promoter.
  • Separate plasmid vectors comprising each viral segment as well as expression vectors comprising necessary viral proteins may be transfected into cells leading to production of recombinant viral particles.
  • plasmid vectors from which both the viral genomic RNA and mRNA encoding the necessary viral proteins are expressed may be used.
  • helper-free plasmid technology see, e.g. , International Publication No. WO 01 /04333; U.S. Patent Nos. 6,951 ,754, 7,384,774, 6,649,372, and 7,3 12,064; Fodor e/ al. , 1999, J. Virol. 73 :9679-9682; Quinlivan et al , 2005, J . Virol. 79:8431 -8439; Hoffmann et al. , 2000, Proc. Natl. Acad. Sci. USA 97:6108-61 1 3 ; and Neumann et ai , 1999, Proc. Natl. Acad. Sci. USA 96:9345-9350, which are incorporated herein by reference in their entireties.
  • influenza viruses described herein may be propagated in any substrate that allows the virus to grow to titers that permit their use in accordance with the methods described herein.
  • the substrate allows the viruses to grow to titers comparable to those determined for the corresponding wild-type viruses.
  • the substrate is one which is biologically relevant to the influenza virus.
  • an attenuated influenza virus by virtue of, e.g. , a mutation in the NS 1 gene, may be propagated in an I FN-deficient substrate.
  • a suitable I FN-defic ient substrate may be one that is defective in its ability to produce or respond to interferon, or is one which an I FN-deficient substrate may be used for the growth of any number of viruses which may require interferon-deficient growth environment. See, for example, U.S. Patent Nos. 6,573,079, issued June 3, 2003, 6,852,522, issued February 8, 2005, and 7,494,808, issued February 24, 2009, the entire contents of each of which is incorporated herein by reference in its entirety.
  • influenza viruses described herein may be isolated and purified by any method known to those of skill in the art.
  • the virus is removed from cell culture and separated from cellular components, typically by well known clarification procedures, e.g. , such as gradient centrifugation and column chromatography, and may be further purified as desired using procedures well known to those skilled in the art, e.g. , plaque assays.
  • influenza viruses, or influenza virus polypeptides, genes or genome segments for use as described herein are obtained or derived from an influenza A virus. In certain embodiments, the influenza viruses, or influenza virus polypeptides, genes or genome segments for use as described herein are obtained or derived from a single influenza A virus subtype or strain. In other embodiments, the influenza viruses, or influenza virus polypeptides, genes or genome segments for use as described herein are obtained or derived from two or more influenza A virus subtypes or strains.
  • influenza viruses, or influenza virus polypeptides, genes or genome segments for use as described herein are obtained or derived from an influenza B virus.
  • influenza viruses, or influenza virus polypeptides, genes or genome segments for use as described herein are obtained or derived from a single influenza B virus subtype or strain.
  • influenza viruses, or influenza virus polypeptides, genes or genome segments for use as described herein are obtained or derived from two or more influenza B virus subtypes or strains.
  • influenza viruses, or influenza virus polypeptides, genes or genome segments for use as described herein are obtained or derived from a combination of influenza A and influenza B virus subtypes or strains.
  • influenza viruses, or influenza virus polypeptides, genes or genome segments for use as described herein are obtained or derived from an influenza C virus.
  • influenza viruses, or influenza virus polypeptides, genes or genome segments for use as described herein are obtained or derived from a single influenza C virus subtype or strain.
  • influenza viruses, or influenza virus polypeptides, genes or genome segments for use as described herein are obtained or derived from two or more influenza C virus subtypes or strains.
  • influenza viruses, or influenza virus polypeptides, genes or genome segments for use as described herein are obtained or derived from a combination of influenza C virus and influenza A virus and/or influenza B virus subtypes or strains.
  • influenza A viruses include subtype H10N4, subtype H10N5, subtype H10N7, subtype H10N8, subtype H10N9, subtype HI INI, subtype HI IN 13, subtype HI 1N2, subtype HI 1N4, subtype HI 1N6, subtype HI 1N8, subtype HI 1N9, subtype H12 1, subtype H12N4, subtype H12N5, subtype H12N8, subtype H13N2, subtype H13N3, subtype H13N6, subtype H13N7, subtype H14N5, subtype H14N6, subtype H 15N8, subtype H15N9, subtype H16N3, subtype H1N1, subtype H1N2, subtype H1N3, subtype H1N6, subtype H1N9, subtype H2N1, subtype H2N2, subtype H2N3, subtype H2N5, subtype H2N7, subtype H2N8, subtype H2N9, subtype H3N1,
  • strains of influenza A virus include, but are not limited to: A/sw/lowa/15/30(HlNl); A/WSN/33 (HlNl); A/eq/Prague/1/56 (H7N7);
  • H3N2 d'Armor/3633/84
  • H3N2 A/sw/Gent 1/84
  • H3N2 A/sw/Netherlands/12/85
  • HlNl A/sw/Karrenzien/2/87
  • H3N2 A/sw/Schwerin/103/89
  • Hl l A/turkey/Germany/3/91
  • HlNl A/sw/Germany/8533/91
  • HlNl A/sw/Belgium/220/92 (H3N2);
  • HlNl A/sw/Gent/V230/92
  • H3N2 A/sw/Leipzig/ 145/92
  • H3N2 A/sw/Re220/92hp
  • H3N2 A/sw/Bakum/909/93
  • H3N2 A/sw/Schleswig-Holstein/1/93
  • A/sw/Scotland/419440/94 H1N2; A/sw/Bakum/5/95 (HlNl); A/sw/Best/5C/96 (HlNl); A/sw/England/17394/96 (H1N2); A/sw/Jena/5/96 (H3N2);
  • A/sw/Oedenrode/7C/96 H3N2
  • A/sw/Lohne/1/97 H3N2
  • A/sw/Cote d'Armor/790/97 H1N2
  • A/sw/Bakum/1362/98 H3N2
  • A/sw/ltaly/1521/98 H1N2
  • A/sw/Italy/1553- 2/98 H3N2
  • A/sw/Italy/1566/98 HlNl
  • A/sw/Italy/1589/98 HlNl
  • H3N2 A/sw/Hong Kong/9745/01
  • H3N2 A/sw/Spain/33601/01
  • H3N2 A/sw/Hong Kong/1144/02
  • H3N2 A/sw/Hong Kong/1197/02 (H3N2);
  • A/sw/Spain/50047/03 Hl l
  • A/sw/Spain/51915/03 Hl l
  • A/sw/Vechta/2623/03 Hl l
  • A/sw/VisbekIDT2869/03 H1 2
  • A/sw/Waltersdorf/IDT2527/03 H1N2
  • A/sw/Damme/lDT2890/04 H3N2
  • A/sw/Geldern/IDT2888/04 HlNl
  • H3N2 A/sw/Herzlake/IDT5337/06
  • H3N2 A/wild boar/Germany/R 169/2006
  • strains of influenza A virus include, but are not limited to: A/Toronto/3141/2009 (HlNl); A/Regensburg/D6/2009 (HlNl);
  • A/Firenze/10/2009 Hl l
  • HlNl A/Hong Kong/2369/2009
  • Hltaly/85/2009 Hl l
  • A/Santo Domingo/572N/2009 H 1 N 1
  • A/Catalonia/385/2009 H1N1;
  • A/Stockholm/36/2009 HINI
  • A/Stockholm/38/2009 HINI
  • A/Stockholm/39/2009 H1 1
  • A/Stockholm/40/2009 H 1 N 1 ;
  • A/Stockholm/42/2009 HI I
  • A/Stockholm/43/2009 HINI
  • A/Stockholm/44/2009 HI I
  • A/Utsunomiya2/2009 HINI
  • A/WRAIR/0573N/2009 HINI
  • A/Zhejiang/DTlD-ZJUO 1/2009 HINI
  • influenza B viruses include strain Aichi/5/88, strain Akita/27/2001, strain Akita/5/2001, strain Alaska/ 16/2000, strain Alaska/1777/2005, strain Argentina/69/2001, strain Arizona/146/2005, strain Arizona/148/2005, strain Bangkok/163/90, strain Bangkok/34/99, strain Bangkok/460/03, strain Bangkok/54/99, strain Barcelona/215/03, strain Beijing/15/84, strain Beijing/184/93, strain
  • strain Finland/161/2002 strain Finland/162/03, strain Finland/162/2002, strain Finland/162/91, strain Finland/164/2003, strain Finland/172/91 , strain Finland/173/2003, strain
  • strain Gyeonggi/592/2005 Guangzhou/87/92, strain Gyeonggi/592/2005, strain Hannover/2/90, strain Harbin/07/94, strain Hawaii/10/2001 , strain Hawaii/ 1990/2004, strain Hawaii/38/2001 , strain
  • strain Henan/22/97 strain Hiroshima/23/2001, strain Hong Kong/110/99, strain Hong Kong/1115/2002, strain Hong Kong/112/2001, strain Hong Kong/123/2001 , strain Hong Kong/1351/2002, strain Hong Kong/ 1434/2002, strain Hong Kong/147/99, strain Hong Kong/156/99, strain Hong Kong/157/99, strain Hong Kong/22/2001, strain Hong Kong/22/89, strain Hong Kong
  • strains Houston/1/91, strain Houston/1/96, strain Houston/2/96, strain Hunan/4/72, strain lbaraki/2/85, strain ncheon/297/2005, strain India/3/89, strain India/77276/2001, strain Israel/95/03, strain Israel/WVl 87/2002, strain Japan/1224/2005, strain Jiangsu/10/03, strain Africa/1/99, strain Africa/96/01, strain Kadoma 1076/99, strain Kadoma/ 122/99, strain Kagoshima/15/94, strain Kansas/22992/99, strain
  • Taiwan/97271 /2001 strain Tehran/80/02, strain Tokyo/6/98, strain Trieste/28/02, strain U lan Ude/4/02, strain United Kingdom/34304/99, strain USSR/1 00/83, strain
  • influenza C viruses include strain Aichi/1 /81 , strain Ann Arbor/1 /50, strain Aomori/74, strain California/78, strain England/83, strain Greece/79, strain Hiroshima/246/2000, strain Hiroshima/252/2000, strain Hyogo/1 /83, strain Africa/66, strain Kanagawa/1 /76, strain Kyoto/1 /79, strain Mississippi/80, strain Miyagi/1 /97, strain Miyagi/5/2000, strain Miyagi/9/96, strain Nara/2/85, strain NewJersey/76, strain pig/Beijing/1 1 5/81 , strain Saitama/3/2000) , strain Shizuoka/79, strain Yamagata/2/98, strain Yamagata/6/2000, strain Yamagata/9/96, strain
  • influenza viruses provided herein have an attenuated phenotype.
  • the attenuated influenza virus is based on influenza A virus. I n other embodiments, the attenuated influenza virus is based on influenza B virus. In yet other embodiments, the attenuated influenza virus is based on influenza C virus. In other embodiments, the attenuated influenza virus may comprise genes or genome segments from one or more strains or subtypes of influenza A, influenza B, and/or influenza C virus. In some embodiments, the attenuated backbone virus comprises genes from an influenza A virus and an influenza B virus.
  • Attenuation of influenza virus is desired such that the virus remains, at least partially, infectious and can replicate in vivo, but only generate low titers resulting in subclinical levels of infection that are non-pathogenic.
  • Such attenuated viruses are especially suited for embodiments described herein wherein the virus or an immunogenic composition thereof is administered to a subject to induce an immune response.
  • Attenuation of the influenza virus can be accomplished according to any method known in the art, such as, e.g., selecting viral mutants generated by chemical mutagenesis, mutation of the genome by genetic engineering, selecting reassortant viruses that contain segments with attenuated function, or selecting for conditional virus mutants (e.g., cold-adapted viruses).
  • naturally occurring attenuated influenza viruses may be used as influenza virus backbones for the influenza virus vectors.
  • an influenza virus may be attenuated, at least in part, by engineering the influenza virus to express a mutated NSl gene that impairs the ability of the virus to antagonize the cellular interferon (IFN) response.
  • IFN cellular interferon
  • Examples of the types of mutations that can be introduced into the influenza virus NSl gene include deletions, substitutions, insertions and combinations thereof.
  • One or more mutations can be introduced-any where throughout the NSl gene (e.g., the N-terminus, the C-terminus or somewhere in between) and/or the regulatory element of the NSl gene.
  • an attenuated influenza virus comprises a genome having a mutation in an influenza virus NSl gene resulting in a deletion consisting of 5, preferably 10, 15, 20, 25, 30,35,40,45, 50,55,60, 65,75,80, 85,90, 95,99, 100, 105, 110, 115, 120, 125, 126, 130, 135, 140, 145, 1 0, 155, 160, 165, 170 or 175 amino acid residues from the C- terminus of NSl, or a deletion of between 5-170, 25-170, 50-170, 100-170, 100-160, or 105-160 amino acid residues from the C-terminus.
  • an attenuated influenza virus comprises a genome having a mutation in an influenza virus NSl gene such that it encodes an NSl protein of amino acid residues 1-130, amino acid residues 1- 126, amino acid residues 1-120, amino acid residues 1-115, amino acid residues 1-110, amino acid residues 1-100, amino acid residues 1-99, amino acid residues 1-95, amino acid residues 1-85, amino acid residues 1-83, amino acid residues 1-80, amino acid residues 1-75, amino acid residues 1-73, amino acid residues 1-70, amino acid residues 1- 65, or amino acid residues 1 -60, wherein the N-terminus amino acid is number 1.
  • the amino acid residues of NSl are counted based on the PR8 virus.
  • NSl mutations and influenza viruses comprising a mutated NSl
  • non-influenza viruses containing a flu polypeptide.
  • the flu polypeptide is incorporated into the virions of the non-influenza virus.
  • the non-influenza viruses may be conjugated to moieties that target the viruses to particular cell types, such as immune cells.
  • the virions of the non-influenza virus have incorporated into them or express a heterologous polypeptide in addition to a flu polypeptide.
  • the heterologous polypeptide may be a polypeptide that has immunopotentiating activity, or that targets the non-influenza virus to a particular cell type, such as an antibody that recognizes an antigen on a specific cell type or a ligand that binds a specific receptor on a specific cell type. See Section 5.4, supra, for examples of such heterologous polypeptides.
  • Non-influenza viruses containing a flu polypeptide may be produced by supplying in trans the flu polypeptide during production of virions using techniques known to one skilled in the art.
  • a parental non-influenza virus comprises a genome engineered to express a flu polypeptide in cells susceptible to infection with the virus wherein hemagglutinin function is provided in trans to produce progeny viruses containing the influenza flu polypeptide.
  • any virus type, subtype or strain including, but not limited to, naturally occurring strains, variants or mutants, mutagenized viruses, reassortants and/or genetically modified viruses may be used as a non-influenza virus vector.
  • the parental non-influenza virus is not a naturally occurring virus.
  • the parental non-influenza virus is a genetically engineered virus.
  • an enveloped virus is preferred for the expression of a membrane bound flu polypeptide described herein.
  • the non-influenza virus vector is a Newcastle disease virus (NDV).
  • NDV Newcastle disease virus
  • the non-influenza virus vector is a vaccinia virus.
  • the non-influenza virus vector is adenovirus, adeno-associated virus (AAV), hepatitis B virus, retrovirus (such as, e.g. , a gammaretrovirus such as Mouse Stem Cell Virus (MSCV) genome or Murine Leukemia Virus (MLV), e.g. , Moloney murine leukemia virus, oncoretrovirus, or lentivirus), an alphavirus (e.g.
  • AAV adenovirus
  • AAV adeno-associated virus
  • retrovirus such as, e.g. , a gammaretrovirus such as Mouse Stem Cell Virus (MSCV) genome or Murine Leukemia Virus (MLV), e.g. , Moloney murine leukemia virus, oncoretrovirus, or
  • a rhabdovirus such as vesicular stomatitis virus or papillomaviruses, poxvirus (such as, e.g. , vaccinia virus, a VA-T7 vector, or fowlpox), metapneumovirus, measles virus, herpesvirus, such as herpes simplex virus, or foamyvirus.
  • poxvirus such as, e.g. , vaccinia virus, a VA-T7 vector, or fowlpox
  • metapneumovirus such as, e.g. , vaccinia virus, a VA-T7 vector, or fowlpox
  • metapneumovirus such as, e.g. , vaccinia virus, a VA-T7 vector, or fowlpox
  • metapneumovirus such as, e.g. , vaccinia virus, a VA-T7 vector, or fowlpox
  • the non-influenza virus vector is NDV.
  • Any N DV type, subtype or strain may serve as the backbone that is engineered to express a flu polypeptide, including, but not limited to, naturally-occurring strains, variants or mutants, mutagenized viruses, reassortants and/or genetically engineered viruses.
  • the NDV that serves as the backbone for genetic engineering is a naturally- occurring strain.
  • the NDV that serves as the backbone for genetic engineering is a lytic strain.
  • the NDV that serves as the backbone for genetic engineering is a non-lytic strain.
  • the NDV that serves as the backbone for genetic engineering is lentogenic strain.
  • the NDV that serves as the backbone for genetic engineering is a mesogenic strain. In other embodiments, the NDV that serves as the backbone for genetic engineering is a velogenic strain.
  • NDV strains include, but are not limited to, the 73-T strain, Ulster strain, MTH-68 strain, hemp strain, Hickman strain, PV701 strain, Hitchner B l strain, La Sota strain, YG97 strain, MET95 strain, and F48E9 strain.
  • the NDV that serves as the backbone for genetic engineering is the Hitchner B 1 strain.
  • the NDV that serves as the backbone for genetic engineering is the La Sota strain.
  • the NDV used as the backbone for a non-influenza virus vector is engineered to express a modified F protein in which the cleavage site of the F protein is replaced with one containing one or two extra arginine residues, al lowing the mutant cleavage site to be activated by ubiquitously expressed proteases of the furin fam i ly.
  • Specific examples of N DVs that express such a modified F protein include, but are not l imited to, rNDV/F2aa and rNDV/F3aa.
  • the non-influenza virus vector is a poxvirus.
  • a poxvirus vector may be based on any member of the poxviridae, in particular, a vaccinia virus or an avipox virus (e.g. , such as canarypox, fowlpox, etc.) that provides suitable sequences for vaccine vectors.
  • the poxviral vector is a vaccinia virus vector. Suitable vaccinia viruses include, but are not limited to, the Copenhagen (VC-2) strain (Goebel, et al. , Virol 1 79: 247-266, 1990; Johnson, et al , Virol.
  • Suitable poxviruses include fowlpox strains such as ALVAC and TROVAC vectors that provide desirable properties and are highly attenuated (see, e.g. , U.S. Pat. No. 6,265, 1 89; Tartagl ia ei al. , In AIDS Research Reviews, Koff, et al , eds., Vol. 3, Marcel Dekker, N.Y., 1993; and Tartaglia et al , 1990, Reviews in Immunology 10: 1 3-30, 1 990).
  • the non-influenza virus is attenuated.
  • Exemplary considerations for the selection of a non-influenza virus vector, particularly for use in compositions for administration to a subject, are safety, low toxicity, stabil ity, cell type specificity, and immunogenicity, particularly, antigenicity of the flu polypeptide expressed by the non-influenza virus vector.
  • VLPs general ly comprise a viral polypeptide(s) typically derived from a structural protein(s) of a virus.
  • the VLPs are not capable of replicating. I n certain embodiments, the VLPs may lack the complete genome of a virus or comprise a portion of the genome of a virus. In some embodiments, the VLPs are not capable of infecting a cel l.
  • the VLPs express on their surface one or more of viral (e.g. , virus surface glycoprotein) or non-viral (e.g. , antibody or protein) targeting moieties known to one ski lled in the art or described herein.
  • the VLP comprises a flu polypeptide and a viral structural protein such as HIV gag.
  • VLPs (00337] Methods for producing and characterizing recombinantly produced VLPs have been described based on several viruses, including influenza virus (Bright et al. (2007) Vaccine. 25 :3871 ), human papilloma virus type 1 (Hagnesee et al. ( 1 991 ) J. Virol.
  • a flu polypeptide may be incorporated into a virosome.
  • a virosome containing a flu polypeptide may be produced using techniques known to those skilled in the art.
  • a virosome may be produced by disrupting a purified virus, extracting the genome, and reassembl ing particles with the viral proteins (e.g. , a flu polypeptide) and lipids to form lipid particles containing viral proteins.
  • bacteria may be engineered to express a flu polypeptide described herein.
  • Suitable bacteria for expression of a flu polypeptide include, but are not limited to, Listeria, Salmonella, Shigella sp., Mycobacterium tuberculosis, E. coli, Neisseria meningitides, Brucella abortus, Brucella melitensis, Borrelia burgdorferi, and Francisella tularensis.
  • the bacteria engineered to express a flu polypeptide are attenuated.
  • the flu polypeptides, nucleic acids encoding such polypeptides, or vectors comprising such nucleic acids or polypeptides described herein may be used to el icit neutralizing antibodies against influenza, for example, against the long alpha-helix region of the HA2 domain of the flu polypeptide.
  • the flu polypeptides, nucleic acids encoding such polypeptides, or vectors comprising such nucleic acids or polypeptides described herein may be used to el icit neutralizing antibodies against influenza, for example, against the long alpha-helix region of the HA2 domain of the flu polypeptide.
  • the fluoride for example, against the long alpha-helix region of the HA2 domain of the flu polypeptide.
  • polypeptides, nucleic acids encoding such polypeptides, or vectors comprising such nucleic acids or polypeptides described herein may be administered to a non-human subject ⁇ e.g. , a mouse, rabbit, rat, guinea pig, etc.) to induce an immune response that includes the production of antibodies which may be isolated using techniques known to one of ski ll in the art (e.g. , immunoaffinity chromatography, centrifugation, precipitation, etc.).
  • the flu polypeptides described herein may be used to screen for antibodies from antibody libraries.
  • an isolated flu polypeptide comprising a flu polypeptide may be immobilized to a solid support ⁇ e.g. , a silica gel, a resin, a derivatized plastic film, a glass bead, cotton, a plastic bead, a polystyrene bead, an alum ina gel, or a polysaccharide, a magnetic bead), and screened for binding to antibodies.
  • the antibodies may be immobilized to a solid support and screened for binding to the isolated flu polypeptide.
  • Any screening assay such as a panning assay, ELISA, surface plasmon resonance, or other antibody screening assay known in the art may be used to screen for antibodies that bind to the flu polypeptide.
  • the antibody library screened may be a commercially available antibody library, an in vitro generated library, or a library obtained by identifying and cloning or isolating antibodies from an individual infected with influenza.
  • the antibody library is generated from a survivor of an influenza virus outbreak.
  • Antibody l ibraries may be generated in accordance with methods known in the art.
  • the antibody library is generated by cloning the antibodies and using them in phage display libraries or a phagemid display library.
  • Antibodies identified in the methods described herein may be tested for neutralizing activity and lack of autoreactivity using the biological assays known in the art or described herein.
  • an antibody isolated from a non-human animal or an antibody library neutral izes a hemagglutinin polypeptide from more than one influenza subtype.
  • an antibody elicited or identified using a flu polypeptide, a nucleic acid encoding such a polypeptide, or a vector encoding such a nucleic acid or polypeptide neutralizes an influenza H3 virus.
  • an antibody elicited or identified using a flu polypeptide, a nucleic acid encoding such a polypeptide, or a vector comprising such a nucleic acid or polypeptide neutralizes 1 , 2, 3, 4, 5, 6, 7, 8, 9, 1 0, 1 1 , 1 2, 1 3, 14, 1 5, or 1 6 or more subtypes or strains of influenza virus.
  • the neutralizing antibody neutralizes one or more influenza A viruses and one or more influenza B viruses.
  • the neutral izing antibody is not an antibody described in Wang et al. (201 0) "Broadly Protective
  • immunoglobulin molecules i. e. , molecules that contain an antigen binding site that specifically binds to a flu polypeptide.
  • the immunoglobulin molecules may be of any type ⁇ e.g. , IgG, lgE, IgM, IgD, IgA and IgY), class ⁇ e.g. , Igd , lgG 2 , IgG 3 , lgG 4 , IgA i and IgA 2 ) or subclass of immunoglobulin molecule.
  • Antibodies include, but are not l imited to, monoclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, chimeric antibodies, single-chain Fvs (scFv), single chain antibodies, Fab fragments, F(ab') fragments, disulfide-linked Fvs (sdFv), and anti- idiotypic (anti-Id) antibodies (including, e.g. , anti-Id antibodies to antibodies elicited or identified using a method described herein), and epitope-binding fragments of any of the above.
  • an antibody elicited or identified using a flu polypeptide, a nucleic acid encoding such a polypeptide, or a vector comprising such a nucleic acid or polypeptide is a human or humanized monoclonal antibody.
  • Antibodies elicited or identified using a flu polypeptide, a nucleic acid encoding such a polypeptide, or a vector comprising such a nucleic acid or polypeptide may be used to monitor the efficacy of a therapy and/or disease progression.
  • any immunoassay system known in the art may be used for this purpose including, but not l imited to, competitive and noncompetitive assay systems using techniques such as radioimmunoassays, ELISA (enzyme linked immunosorbent assays), "sandwich” immunoassays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement fixation assays, immunoradiometric assays, fluorescent immunoassays, protein A immunoassays and Immunoelectrophoresis assays, to name but a few.
  • radioimmunoassays ELISA (enzyme linked immunosorbent assays), "sandwich” immunoassays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement fixation assays, immunoradiometric assays, fluorescent immunoassays, protein A immunoassays and Immunoelectrophores
  • Antibodies el icited or identified using a flu polypeptide, a nucleic acid encoding such a polypeptide, or a vector comprising such a nucleic acid or polypeptide may be used to detect influenza virus, for example, from a plurality of influenza virus strains from a single subtype or 2, 3, 4 or more different subtypes and/or to diagnosis an influenza virus infection by, for example, a plurality of influenza virus strains from a single subtype or 2, 3, 4 or more different subtypes.
  • Antibodies el icited or identified using a flu polypeptide, a nucleic acid encoding such a polypeptide, or a vector comprising such a nucleic acid or polypeptide may be used in the production of antiid iotypic antibody.
  • the antiidiotypic antibody can then in turn be used for immunization, in order to produce a subpopulation of antibodies that bind a particular antigen of influenza, e.g., a flu polypeptide (Jerne, 1974, Ann. I mmunol. (Paris) 1 25c:373; Jerne et ai , 1982, EMBO J. 1 :234, incorporated herein by reference in its entirety).
  • the non-human subjects administered flu polypeptides, nucleic acids encoding such polypeptides, or vectors comprising such nucleic acids or polypeptides to generate antibodies in accordance with the methods described herein are transgenic animals (e.g., transgenic mice) that are capable of producing human antibodies.
  • transgenic animals e.g., transgenic mice
  • Human antibodies can be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobul ins, but which can express human immunoglobulin genes.
  • the human heavy and light chain immunoglobulin gene complexes may be introduced randomly or by homologous recombination into mouse embryonic stem cells.
  • the human variable region, constant region, and diversity region may be introduced into mouse embryonic stem cel ls in addition to the human heavy and light chain genes.
  • the mouse heavy and light chain immunoglobulin genes may be rendered non-functional separately or simultaneously with the introduction of human immunoglobulin loci by homologous recombination. In particular, homozygous deletion of the JH region prevents endogenous antibody production.
  • the modified embryonic stem cells are expanded and microinjected into blastocysts to produce chimeric mice. The chimeric mice are then bred to produce homozygous offspring which express human antibodies.
  • the human immunoglobulin transgenes harbored by the transgenic mice rearrange during B cell differentiation, and subsequently undergo class switching and somatic mutation.
  • a flu polypeptide described herein may be used in vitro to generate antibodies against the flu polypeptide or may themselves be
  • the cells are not mammalian cells (e.g. , CB- 1 cells).
  • cells that have been stimulated ex vivo with a flu polypeptide described herein are administered to a subject by, e.g. , an adoptive transfer technique known in the art. See, e.g. , United States patent application Publication No. 2008001 9998, published January 24, 2008, which is incorporated herein by reference in its entirety, for a description of adoptive transfer techniques.
  • the cells are not mammalian cells (e.g. , CB- 1 cells).
  • cells that have been stimulated ex vivo with a flu polypeptide described herein are administered to a subject by, e.g. , an adoptive transfer technique known in the art. See, e.g. , United States patent application Publication No. 2008001 9998, published January 24, 2008, which is incorporated herein by reference in its entirety, for a description of adoptive transfer techniques.
  • the cells are not mammalian cells (e.g.
  • the cells are mammalian cells (e.g. , CB- 1 cells).
  • a vector e.g. , an influenza virus vector, engineered to express a flu polypeptide described herein can be used to generate dendritic cells (DCs) that express the flu polypeptide and display immunostimulatory properties directed against a flu polypeptide.
  • DCs may be used to expand memory T cells and are potent stimulators of T cells, including influenza flu polypeptide-specific cytotoxic T lymphocyte clones. See Strobel et al. , 2000, Human Gene Therapy 1 1 .2207-22 1 8, which is incorporated herein by reference in its entirety.
  • a flu polypeptide described herein may be delivered to a target cell in any way that allows the polypeptide to contact the target cell, e.g. , a DC, and deliver the polypeptide to the target cell.
  • the flu polypeptide is delivered to a subject, as described herein.
  • cells contacted with the polypeptide may be isolated and propagated.
  • a flu polypeptide is delivered to a target cel l in vitro.
  • Techn iques known to one of skill in the art may be used to del iver the polypeptide to target cells.
  • target cells may be contacted with the polypeptide in a tissue culture plate, tube or other container.
  • the polypeptide may be suspended in media and added to the wel ls of a culture plate, tube or other container.
  • the media containing the polypeptide may be added prior to plating of the cells or after the cel ls have been plated.
  • the target cells are preferably incubated with the polypeptide for a sufficient amount of time to allow the polypeptide to contact the cells.
  • the cells are incubated with the polypeptide for about 1 hour or more, about 5 hours or more, about 1 0 hours or more, about 1 2 hours or more, about 1 6 hours or more, about 24, hours or more, about 48 hours or more, about 1 hour to about 12 hours, about 3 hours to about 6 hours, about 6 hours to about 1 2 hours, about 12 hours to about 24 hours, or about 24 hours to about 48 hours.
  • the contacting of the target cells comprises infecting the cells with the virus.
  • the target cel ls may be from any species, including, e.g. , humans, mice, rats, rabbits and guinea pigs.
  • target cells are DCs obtained from a healthy subject or a subject in need of treatment.
  • target cells are DCs obtained from a subject in whom it is desired to stimulate an immune response to the polypeptide. Methods of obtaining cells from a subject are well known in the art. 5.10 COMPOSITIONS
  • compositions are pharmaceutical compositions, such as immunogenic compositions (e.g., vaccine formulations).
  • immunogenic compositions e.g., vaccine formulations.
  • the pharmaceutical compositions provided herein can be in any form that allows for the composition to be admin istered to a subject.
  • the pharmaceutical compositions are suitable for veterinary and/or human administration.
  • the compositions may be used in methods of preventing or treating an influenza virus disease.
  • a pharmaceutical composition comprises a flu polypeptide, in an admixture with a pharmaceutically acceptable carrier.
  • a pharmaceutical composition comprises a nucleic acid encoding a flu polypeptide described herein, in an admixture with a pharmaceutically acceptable carrier.
  • a pharmaceutical composition comprises an expression vector comprising a nucleic acid encoding a flu polypeptide, in an admixture with a
  • a pharmaceutical composition comprises an influenza virus or non-influenza virus containing a flu polypeptide, in an admixture with a pharmaceutically acceptable carrier.
  • a pharmaceutical composition comprises an influenza virus or non- influenza virus having a genome engineered to express a flu polypeptide, in admixture with a pharmaceutically acceptable carrier.
  • a pharmaceutical composition comprises a viral-like particle or virosome containing a flu polypeptide, in an admixture with a pharmaceutically acceptable carrier.
  • a pharmaceutical composition comprises a bacteria expressing or engineered to express a flu polypeptide, in an admixture with a pharmaceutically acceptable carrier.
  • a pharmaceutical composition comprises cells stimulated with a flu polypeptide, in an admixture with a pharmaceutically acceptable carrier.
  • a pharmaceutical composition may comprise one or more other therapies in addition to an active compound.
  • the term "pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeiae for use in animals, and more particularly in humans.
  • carrier refers to a diluent, adjuvant, excipient, or vehicle with which the pharmaceutical composition is administered. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
  • Suitable excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, sil ica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim m ilk, glycerol, propylene, glycol, water, ethanol and the like.
  • suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences” by E.W. Martin. The formulation should suit the mode of administration.
  • compositions are formulated to be suitable for the intended route of administration to a subject.
  • the pharmaceutical composition may be formulated to be suitable for subcutaneous, parenteral, oral, intradermal, transdermal, colorectal, intraperitoneal, and rectal administration.
  • the pharmaceutical composition may be formulated for intravenous, oral, intraperitoneal, intranasal, intratracheal, subcutaneous, intramuscular, topical, intradermal, transdermal or pulmonary administration.
  • biodegradable polymers such as ethylene vinyl acetate, polyanhydrides, polyethylene glycol (PEGylation), polymethyl methacrylate polymers, polylactides, poly(lactide-co-glycolides), polyglycolic acid, collagen, polyorthoesters, and polylactic acid
  • the active compounds are prepared with carriers that increase the protection of the compound against rapid el imination from the body, such as a controlled release formulation, including implants and microencapsulated del ivery systems. Methods for preparation of such formulations will be apparent to those skilled in the art.
  • Liposomes or micelles can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Pat. No. 4,522,81 1 .
  • the pharmaceutical compositions comprise one or more adjuvants.
  • immunogenic compositions described herein are monovalent formulations. In other embodiments, immunogenic compositions described herein are multivalent formulations. In one example, a multivalent formulation comprises one or more vectors expressing a flu polypeptide derived from an influenza A virus and one or more vectors expressing a flu polypeptide derived from an influenza B virus. In another example, a multivalent formulation comprises a vector expressing a flu polypeptide derived from an H3 influenza A virus and a vector expressing a flu polypeptide derived from an H I influenza A virus.
  • a multivalent formulation comprises a vector expressing a flu polypeptide derived from an H3 influenza A virus, a vector expressing a flu polypeptide derived from an H I influenza A virus, and a vector expressing a flu polypeptide derived from an influenza B virus.
  • a multivalent formulation may comprise one or more different flu polypeptides expressed using a single vector.
  • the pharmaceutical compositions described herein additionally comprise a preservative, e.g., the mercury derivative thimerosal.
  • the pharmaceutical compositions described herein comprises 0.001 % to 0.01 % thimerosal.
  • the pharmaceutical compositions described herein do not comprise a preservative.
  • thimerosal is used during the manufacture of a pharmaceutical composition described herein and the thimerosal is removed via purification steps following production of the pharmaceutical composition, i.e., the pharmaceutical composition contains trace amounts of thimerosal ( ⁇ 0.3 ⁇ g of mercury per dose after purification; such pharmaceutical compositions are considered thimerosal-free products).
  • the pharmaceutical compositions described herein additionally comprise egg protein (e.g. , ovalbumin or other egg proteins).
  • egg protein e.g. , ovalbumin or other egg proteins.
  • the amount of egg protein in the pharmaceutical compositions described herein may range from about 0.0005 to about 1 .2. ⁇ g of egg protein to 1 ml of pharmaceutical composition. In other embodiments, the pharmaceutical compositions described herein do not comprise egg protein.
  • the pharmaceutical compositions described herein additionally comprise one or more antimicrobial agents (e.g., antibiotics) including, but not limited to gentamicin, neomycin, polymyxin (e.g. , polymyxin B), and kanamycin, streptomycin.
  • the pharmaceutical compositions described herein do not comprise any antibiotics.
  • the pharmaceutical compositions described herein additionally comprise one or more components used to inactivate a virus, e.g. , formal in or formaldehyde or a detergent such as sodium deoxycholate, octoxynol 9 (Triton X- 1 00), and octoxynol 1 0.
  • the pharmaceutical compositions described herein do not comprise any components used to inactivate a virus.
  • the pharmaceutical compositions described herein additionally comprise gelatin. In other embodiments, the pharmaceutical compositions described herein do not comprise gelatin.
  • the pharmaceutical compositions described herein additionally comprise one or more buffers, e.g., phosphate buffer and sucrose phosphate glutamate buffer. In other embodiments, the pharmaceutical compositions described herein do not comprise buffers.
  • the pharmaceutical compositions described herein additional ly comprise one or more salts, e.g., sodium chloride, calcium chloride, sodium phosphate, monosodium glutamate, and aluminum salts (e.g., aluminum hydroxide, alum inum phosphate, alum (potassium aluminum sulfate), or a mixture of such aluminum salts).
  • the pharmaceutical compositions described herein do not comprise salts.
  • the pharmaceutical compositions described herein are low-additive influenza virus vaccines, i.e., the pharmaceutical compositions do not comprise one or more additives commonly found in influenza virus vaccines.
  • Low- additive influenza vaccines have been described (see, e.g., International Application No. PCT/I B2008/002238 published as International Publication No. WO 09/001 21 7 which is herein incorporated by reference in its entirety).
  • compositions described herein can be included in a container, pack, or dispenser together with instructions for administration.
  • compositions described herein can be stored before use, e.g. , the pharmaceutical compositions can be stored frozen (e.g. , at about -20°C or at about -70°C); stored in refrigerated conditions (e.g. , at about 4 ° C); or stored at room temperature (see International Application No. PCT/1 B2007/001 149 published as International Publ ication No. WO 07/1 10776, which is herein incorporated by reference in its entirety, for methods of storing compositions comprising influenza vaccines without refrigeration).
  • frozen e.g. , at about -20°C or at about -70°C
  • refrigerated conditions e.g. , at about 4 ° C
  • room temperature see International Application No. PCT/1 B2007/001 149 published as International Publ ication No. WO 07/1 10776, which is herein incorporated by reference in its entirety, for methods of storing compositions comprising influenza vaccines without refrigeration.
  • the cells in the pharmaceutical composition are not mammalian cells (e.g. , CB- 1 cells). In certain embodiments, when the active compound in a pharmaceutical composition described herein is a cell engineered to express a flu polypeptide, the cells in the pharmaceutical composition are mammalian cells. 5.10.1 Subunit Vaccines
  • subunit vaccines comprising a core polypeptide described herein.
  • a subunit vaccine comprises a flu polypeptide and one or more surface glycoproteins (e.g. , influenza virus
  • a subunit vaccine comprises a single influenza flu polypeptide.
  • a subunit vaccine comprises two, three, four or more influenza flu polypeptides.
  • the influenza flu polypeptide(s) used in a subunit vaccine is not membrane-bound, i.e. , it is soluble.
  • subun it vaccines comprising about 1 0 ⁇ g to about 60 ⁇ g of one or more flu polypeptides described herein, about 0.001 % to 0.01 % th imerosal, about 0. 1 ⁇ g to about 1 .0 ⁇ g chicken egg protein, about 1 .0 ⁇ g to about 5.0 ⁇ g polymyxin, about 1 .0 ⁇ g to about 5.0 ⁇ g neomycin, about 0. 1 ⁇ g to about 0.5 ⁇ g betapropiolactone, and about .001 to about .05 % w/v of nonylphenol ethoxylate per dose.
  • a subunit vaccine provided herein comprises or consists of a 0.5 ml dose that comprises 45 ⁇ g of a flu polypeptide(s) provided herein, ⁇ 1 .0 ⁇ g of mercury (from thimerosal), ⁇ 1 .0 ⁇ g chicken egg protein (i.e., ovalbumin), ⁇ 3.75 ⁇ g polymyxin, and ⁇ 2.5 ⁇ g neomycin.
  • a subunit vaccine provided herein additionally comprises or consists of not more than 0.5 ⁇ g
  • the 0.5 ml dose subunit vaccine is packaged in a pre-filled syringe.
  • a subunit vaccine provided herein consists of a 5.0 ml multidose vial (0.5 ml per dose) that comprises 45 ⁇ g of a flu polypeptide(s) provided herein, 25.0 ⁇ g of mercury (from thimerosal), ⁇ 1 .0 ⁇ g chicken egg protein (i.e., ovalbumin), ⁇ 3.75 ⁇ g polymyxin, and ⁇ 2.5 ⁇ g neomycin.
  • a subunit vaccine provided herein additionally comprises or consists of not more than 0.5 ⁇ g betapropiolactone, and not more than 0.01 5 % w/v of nonylphenol ethoxylate per dose.
  • the subunit vaccine is prepared using influenza virus that was propagated in embryonated chicken eggs (i.e., the components of the subunit vaccine (e.g. , a flu polypeptide) are isolated from virus that was propagated in embryonated chicken eggs).
  • the subunit vaccine is prepared using influenza virus that was not propagated in embryonated chicken eggs (i.e., the components of the subunit vaccine (e.g. , a flu polypeptide) are isolated from virus that was not propagated in embryonated chicken eggs).
  • the subunit vaccine is prepared using influenza virus that was propagated in mammalian cells, e.g. , immortalized human cells (see, e.g. , International Application No.
  • the components of the subunit vaccine e.g. , a flu polypeptide
  • the flu polypeptide(s) in a subunit vaccine are prepared using an expression vector, e.g. , a viral vector, plant vector or a bacterial vector (i.e., the flu polypeptide(s) in the subunit vaccine are obtained/isolated from an expression vector).
  • immunogenic compositions comprising live virus containing a flu polypeptide.
  • immunogenic compositions comprising l ive virus that is engineered to encode a flu polypeptide, which is expressed by progeny virus produced in the subjects administered the compositions.
  • the flu polypeptide is membrane-bound.
  • the influenza virus flu polypeptide is not membrane-bound, i. e. , soluble.
  • the live virus is an influenza virus, such as described in Section 5.4, supra. In other
  • the live virus is a non-influenza virus, such as described in Section 5.5, supra. In some embodiments, the live virus is attenuated. In some embodiments, an immunogenic composition comprises two, three, four or more live viruses containing or engineered to express two, three, four or more different flu polypeptides.
  • immunogenic compositions comprising about 10 5 to about l O 10 fluorescent focus units (FFU) of live attenuated influenza virus containing one or more flu polypeptides described herein, about 0. 1 to about 0.5 mg monosodium glutamate, about 1 .0 to about 5.0 mg hydrolyzed procine gelatin, about 1 .0 to about 5.0 mg arginine, about 1 0 to about 1 5 mg sucrose, about 1 .0 to about 5.0 mg dibasic potassium phosphate, about 0.5 to about 2.0 mg monobasic potassium phosphate, and about 0.001 to about 0.05 g/ml gentamicin sulfate per dose.
  • the immunogenic compositions e.g. , vaccines
  • immunogenic compositions comprising I 0 6 S to 1 0 7 5 FFU of live attenuated influenza virus containing one or more flu polypeptides described herein, 0. 1 88 mg monosodium glutamate, 2.0 mg hydrolyzed procine gelatin, 2.42 mg arginine, 1 3.68 mg sucrose, 2.26 mg dibasic potassium phosphate, 0.96 mg monobasic potassium phosphate, and ⁇ 0.01 5 ⁇ g/m ! gentamic in sulfate per dose.
  • the immunogenic compositions e.g. , vaccines
  • the l ive virus that contains a flu polypeptide is propagated in embryonated chicken eggs before its use in an immunogenic composition described herein.
  • the live virus that contains a flu polypeptide is not propagated in embryonated chicken eggs before its use in an immunogenic composition described herein.
  • the live virus that contains a flu polypeptide is propagated in mammalian cells, e.g. , immortalized human cells (see, e.g. , International Application No. PCT/EP2006/067566 published as International Publication No. WO 07/045674 which is herein incorporated by reference in its entirety) or canine kidney cel ls such as MDC cells (see, e.g. , International
  • An immunogenic composition comprising a live virus for administration to a subject may be preferred because multiplication of the virus in the subject may lead to a prolonged stimulus of similar kind and magnitude to that occurring in natural infections, and therefore, confer substantial, long lasting immunity.
  • immunogenic compositions comprising an inactivated virus containing a flu polypeptide.
  • the flu polypeptide is membrane-bound.
  • the . inactivated virus is an influenza virus, such as described in Section 5.4, supra.
  • the inactivated virus is a non-influenza virus, such as described in Section 5.5, supra.
  • an immunogenic composition comprises two, three, four or more inactivated viruses containing two, three, four or more different flu polypeptides.
  • the inactivated virus immunogenic compositions comprise one or more adjuvants.
  • Techn iques known to one of skill in the art may be used to inactivate viruses containing a flu polypeptide.
  • Common methods use formal in, heat, or detergent for inactivation. See, e.g. , U. S. Patent No. 6,635,246, which is herein incorporated by reference in its entirety.
  • Other methods include those described in U.S. Patent Nos. 5,891 ,705; 5, 1 06,619 and 4,693,981 , which are incorporated herein by reference in their entireties.
  • immunogenic compositions ⁇ e.g. , vaccines
  • each dose of the immunogenic composition comprises about 1 5 to about 60 ⁇ g of flu polypeptide described herein, about 1 .0 to about 5.0 mg sodium chloride, about 20 to about 1 00 ⁇ 3 ⁇ 4 monobasic sodium phosphate, about 1 00 to about 500 ⁇ g dibasic sodium phosphate, about 5 to about 30 ⁇ g monobasic potassium phosphate, about 5 to about 30 ⁇ g potassium chloride, and about .5 to about 3.0 ⁇ g calcium chloride.
  • the immunogenic compositions ⁇ e.g. , vaccines
  • the immunogenic compositions are packaged as single 0.25 ml or single 0.5 ml doses.
  • the immunogenic compositions ⁇ e.g. , vaccines) are packaged as multi-dose formulations.
  • immunogenic compositions ⁇ e.g. , vaccines
  • each dose of the immunogenic composition comprises about 1 5 to about 60 ⁇ g of flu polypeptide described herein, about 0.001 % to 0.01 % thimerosal, about 1 .0 to about 5.0 mg sodium chloride, about 20 to about 1 00 ⁇ g monobasic sodium phosphate, about 1 00 to about 500 ⁇ g dibasic sodium phosphate, about 5 to ' about 30 ⁇ g monobasic potassium phosphate, about 5 to about 30 ⁇ g potassium chloride, and about 0.5 to about 3.0 ⁇ g calcium chloride per dose.
  • the immunogenic compositions ⁇ e.g. , vaccines
  • the immunogenic compositions are packaged as single 0.25 ml or single 0.5 ml doses.
  • the immunogenic compositions are packaged as multi-dose formulations.
  • immunogenic compositions e.g. , vaccines
  • immunogenic compositions are packaged as single 0.25 ml doses and comprise 22.5 ⁇ g of flu polypeptide described herein, 2.05 mg sodium chloride, 40 ⁇ g monobasic sodium phosphate, 1 50 ⁇ g dibasic sodium phosphate, 1 0 ⁇ g monobasic potassium phosphate, 10 g potassium chloride, and 0.75 ⁇ g calcium chloride per dose.
  • immunogenic compositions e.g. , vaccines
  • immunogenic compositions are packaged as multi-dose formulations comprising or consisting of 5.0 ml of vaccine (0.5 ml per dose) and comprise 24.5 ⁇ g of mercury (from thimerosal), 45 ⁇ g of flu polypeptide described herein, 4. 1 mg sodium chloride, 80 ⁇ g monobasic sodium phosphate, 300 ⁇ g dibasic sodium phosphate, 20 ⁇ g monobasic potassium phosphate, 20 ⁇ g potassium chloride, and 1 .5 ⁇ g calcium chloride per dose.
  • the inactivated virus that contains a flu polypeptide was propagated in embryonated chicken eggs before its inactivation and subsequent use in an immunogenic composition described herein.
  • the inactivated virus that contains a flu polypeptide was not propagated in embryonated chicken eggs before its inactivation and subsequent use in an immunogenic composition described herein.
  • the inactivated virus that contains a flu polypeptide was propagated in mammalian cells, e.g., immortalized human cells (see, e.g., International Application No. PCT/EP2006/067566 published as International Publication No.
  • WO 07/045674 which is herein incorporated by reference in its entirety
  • canine kidney cells such as MDCK cells
  • canine kidney cells such as MDCK cells
  • an immunogenic composition comprising a flu polypeptide is a split virus vaccine.
  • split virus vaccine contains two, three, four or more different flu polypeptides.
  • the flu polypeptide is/was membrane-bound.
  • the split virus vaccines comprise one or more adjuvants.
  • Techniques for producing split virus vaccines are known to those skilled in the art.
  • an influenza virus split vaccine may be prepared using inactivated particles disrupted with detergents.
  • a split virus vaccine that can be adapted for use in accordance with the methods described herein is the Fluzone®, Influenza Virus Vaccine (Zonal Purified, Subvirion) for intramuscular use, which is formulated as a sterile suspension prepared from influenza viruses propagated in embryonated chicken eggs. The virus-containing fluids are harvested and inactivated with formaldehyde. Influenza virus is concentrated and purified in a linear sucrose density gradient solution using a continuous flow centrifuge.
  • the virus is then chemically disrupted using a nonionic surfactant, octoxinol-9, (Triton® X- 1 00 - A registered trademark of Union Carbide, Co.) producing a "split virus.”
  • octoxinol-9 Triton® X- 1 00 - A registered trademark of Union Carbide, Co.
  • the split virus is then further purified by chemical means and suspended in sodium phosphate-buffered isotonic sodium chloride solution.
  • split virus vaccines comprising about 10 ⁇ g to about 60 ⁇ g of one or more flu polypeptides described herein, about 0.01 to about 1 .0 mg octoxynol- 10 (TRITON X- 100®, about 0.5 to 0.5 mg a-tocopheryl hydrogen succinate, about 0.
  • polysorbate 80 (Tween 80), about 0.001 to about 0.003 ⁇ g hydrocortisone, about 0.05 to about 0.3 ⁇ g gentamcin sulfate, about 0.5 to about 2.0 ⁇ gchicken egg protein (ovalbumin), about 25 to 75 ⁇ g formaldehyde, and about 25 to 75 ⁇ g sodium deoxycholate.
  • a split virus vaccine provided herein comprises or consists of a 0.5 ml dose that comprises 45 ⁇ g of influenza flu polypeptide(s) provided herein, ⁇ 0.085 mg octoxynol- 1 0 (TRITON X- 100®, ⁇ 0. 1 mg a-tocopheryl hydrogen succinate, ⁇ .41 5 mg polysorbate 80 (Tween 80), ⁇ 0.001 6 ⁇ g hydrocortisone, ⁇ 0.1 5 ⁇ g gentamcin sulfate, ⁇ 1 .0 chicken egg protein (ovalbumin), ⁇ 50 g formaldehyde, and ⁇ 50 ⁇ g sodium deoxycholate.
  • the 0.5 ml dose subunit vaccine is packaged in a pre-filled syringe.
  • the split virus vaccine is prepared using influenza virus that was propagated in embryonated chicken eggs. In another specific embodiment, the split virus vaccine is prepared using influenza virus that was not propagated in embryonated chicken eggs. In another specific embodiment, the split virus vaccine is prepared using influenza virus that was propagated in mammalian cells, e.g. ,
  • the compositions described herein comprise, or are administered in combination with, an adjuvant.
  • the adjuvant for administration in combination with a composition described herein may be administered before, concomitantly with, or after administration of said composition.
  • the term "adjuvant" refers to a compound that when administered in conjunction with or as part of a composition described herein augments, enhances and/or boosts the immune response to a flu polypeptide, but when the compound is administered alone does not generate an immune response to the polypeptide.
  • the adjuvant generates an immune response to the polypeptide and does not produce an allergy or other adverse reaction .
  • Adjuvants can enhance an immune response by several mechanisms including, e.g. , lymphocyte recruitment, stimulation of B and/or T cells, and stimulation of macrophages.
  • an adjuvant augments the intrinsic response to the flu polypeptide without causing conformational changes in the polypeptide that affect the qualitative form of the response.
  • adjuvants include, but are not limited to, aluminum salts (alum) (such as aluminum hydroxide, aluminum phosphate, and aluminum sulfate), 3 De-O-acylated monophosphoryl lipid A (MPL) (see GB 22202 1 1 ), MF59 (Novartis), AS03 (GlaxoSmithKline), AS04 (GlaxoSmithKline), polysorbate 80 (Tween 80; ICL Americas, Inc.), imidazopyridine compounds (see International Application No. PCT/US2007/064857, published as International
  • the adjuvant is Freund's adjuvant (complete or incomplete).
  • Other adjuvants are oil in water emulsions (such as squalene or peanut oi l), optionally in combination with immune stimulants, such as
  • monophosphoryl lipid A see Stoute et al , N. Engl. J. Med. 336, 86-91 ( 1997)).
  • Another adjuvant is CpG (Bioworld Today, Nov. 1 5, 1998).
  • Such adjuvants can be used with or without other specific immunostimulating agents such as MPL or 3-DMP, QS2 1 , polymeric or monomeric amino acids such as polyglutam ic acid or polylysine, or other immunopotentiating agents described in Section 5.4, supra. It should be understood that different formulations of flu polypeptide may comprise different adjuvants or may comprise the same adjuvant.
  • a method for inducing an immune response in a subject comprises administering to a subject in need thereof an effective amount of a flu polypeptide or an immunogenic composition thereof.
  • a method for inducing an immune response to an influenza virus in a subject comprises administering to a subject in need thereof an effective amount of a nucleic acid encoding a flu polypeptide or an immunogenic composition thereof.
  • a method for inducing an immune response to an influenza virus in a subject comprises admin istering to a subject in need thereof an effective amount of a viral vector containing or expressing a flu polypeptide or an immunogenic composition thereof.
  • a method for inducing an immune response to an influenza virus in a subject comprises administering to a subject in need thereof an effective amount of cells stimulated with a flu polypeptide or a pharmaceutical composition thereof.
  • a flu polypeptide used in the method is a purified flu polypeptide derived from a mammalian cell, a plant cell, or an insect cell.
  • a method for inducing an immune response to an influenza virus in a subject comprises administering to a subject in need thereof a subunit vaccine described herein.
  • a method for inducing an immune response to an influenza virus in a subject comprises administering to a subject in need thereof a live virus vaccine described herein.
  • the live virus vaccine comprises an attenuated virus.
  • a method for inducing an immune response to an influenza virus in a subject comprises administering to a subject in need thereof an inactivated virus vaccine described herein.
  • a method for inducing an immune response to an influenza virus in a subject comprises administering to a subject in need thereof a spl it virus vaccine described herein.
  • a method for inducing an immune response to an influenza virus in a subject comprises administering to a subject in need thereof a viral-l ike particle vaccine described herein.
  • a method for inducing an immune response to an influenza virus in a subject comprises administering to a subject in need thereof a virosome described herein.
  • a method for inducing an immune response to an influenza virus in a subject comprises administering to a subject in need thereof a bacteria expressing or engineered to express a flu polypeptide or a composition thereof.
  • a flu polypeptide used in the method is a purified flu polypeptide derived from a mammalian cell, a plant cell, or an insect cel l.
  • the immune response induced by an active compound or a composition described herein is effective to prevent and/or treat an influenza virus infection caused by any subtype or strain of influenza virus.
  • the immune response induced by an active compound or a composition described herein is effective to prevent and/or treat an influenza virus infection caused by a subtype of influenza virus that belongs to one HA group (e.g. , Group 1 , which comprises H I , H2, H5, H6, H8, H9, H I 1 , H I 2, H I 3, and H I 6) and not the other HA group (e.g. , Group 2, which comprises H3, H4, H7, H 10, H I 4, and H I 5).
  • the immune response induced may be effective to prevent and/or treat an influenza virus infection caused by an influenza virus that belongs to the HA group consisting of H I 1 , H I 3, H I 6, H9, H8, H I 2, H6, H I , H5 and H2.
  • the immune response induced may be effective to prevent and/or treat an influenza virus infection caused by an influenza virus that belongs to the HA group consisting of H3, H4, H I 4, H 1 0, H I 5 and H7.
  • the immune response induced by an active compound or a composition described herein is effective to prevent and/or treat an influenza virus infection caused by one, two, three, four or five subtypes of influenza virus.
  • the immune response induced by an active compound or a composition described herein is effective to prevent and/or treat an influenza virus infection caused by six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen or fifteen subtypes of influenza virus. In some embodiments, the immune response induced by an active compound or a composition described herein is effective to prevent and/or treat an influenza virus infection caused by one or more variants within the same subtype of influenza virus.
  • the immune response induced by an active compound or a composition described herein is effective to prevent and/or treat an influenza virus infection caused by both H l l and H2N2 subtypes. In other embodiments, the immune response induced by an active compound or a composition described herein is not effective to prevent and/or treat an influenza virus infection caused by both H l l and H2N2 subtypes. In some embodiments, the immune response induced by an active compound or a composition described herein is effective to prevent and/or treat an influenza virus infection caused by H l l , H2N2, and H3N2 subtypes.
  • the immune response induced by an active compound or a composition described herein is effective to prevent and/or treat an influenza virus infection caused by H3N2 subtypes. In other embodiments, the immune response induced by an active compound or a composition described herein is not effective to prevent and/or treat an influenza virus infection caused by H3N2 subtypes.
  • the immune response induced by an active compound or a composition described herein is effective to prevent and/or treat an influenza virus disease caused by any subtype or strain of influenza virus.
  • the immune response induced by an active compound or a composition described herein is effective to prevent and/or treat an influenza virus disease caused by a subtype of influenza virus that belongs to one HA group and not the other HA group.
  • the immune response induced may be effective to prevent and/or treat an influenza virus disease caused by an influenza virus that belongs to the HA group consisting of H I 1 , H I 3, H I 6, H9, H8, H I 2, H6, H I , H5 and H2.
  • the immune response induced may be effective to prevent and/or treat an influenza virus disease caused by an influenza virus that belongs to the HA group consisting of H3, H4, H 14, H 10, H 1 5 and H7.
  • the immune response induced by an active compound or a composition described herein is effective to prevent and/or treat an influenza virus disease caused by any of one, two, three, four or five subtypes of influenza virus.
  • the immune response induced by an active compound or a composition described herein is effective to prevent and/or treat an influenza virus disease caused by any of six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen or fifteen subtypes of influenza virus.
  • the immune response induced by an active compound or a composition described herein is effective to prevent and/or treat an influenza virus disease caused by one or more variants within the same subtype of influenza virus.
  • the immune response induced by an active compound or a composition described herein is effective to reduce symptoms resulting from an influenza virus disease/infection.
  • Symptoms of influenza virus disease/infection include, but are not limited to, body aches (especially joints and throat), fever, nausea, headaches, irritated eyes, fatigue, sore throat, reddened eyes or skin, and abdominal pain.
  • the immune response induced by an active compound or a composition described herein is effective to reduce the hospitalization of a subject suffering from an influenza virus disease/infection. In some embodiments, the immune response induced by an active compound or a composition described herein is effective to reduce the duration of hospitalization of a subject suffering from an influenza virus disease/infection.
  • a method for preventing or treating an influenza virus infection in a subject comprises administering to a subject in need thereof a flu polypeptide, a nucleic acid encoding such a polypeptide, a vector containing or expressing such a polypeptide, or a composition of any one of the foregoing.
  • a method for preventing or treating an influenza virus infection in a subject comprises administering to a subject in need thereof a subunit vaccine, a live virus vaccine, an inactivated virus vaccine, a split virus vaccine or a viral- like particle vaccine.
  • the influenza virus infection is caused by an influenza A virus.
  • the influenza virus infection is caused by an influenza B or C virus.
  • a method for preventing or treating an influenza virus disease in a subject comprises administering to a subject in need thereof an effective amount of a flu polypeptide or an immunogenic composition thereof.
  • a method for preventing or treating an influenza virus disease in a subject comprises administering to a subject in need thereof an effective amount of a nucleic acid encoding a flu polypeptide or an immunogen ic composition thereof.
  • a method for preventing or treating an influenza virus disease in a subject comprises administering to a subject in need thereof an effective amount of a viral vector containing or expressing a flu polypeptide or an immunogenic composition thereof.
  • a method for preventing or treating an influenza virus disease in a subject comprises administering to a subject in need thereof an effective amount of cells stimulated with a flu polypeptide or a pharmaceutical composition thereof.
  • a method for preventing or treating an influenza virus disease in a subject comprises administering to a subject in need thereof a subunit vaccine described herein.
  • a method for preventing or treating an influenza virus disease in a subject comprises administering to a subject in need thereof a live virus vaccine described herein.
  • the live virus vaccine comprises an attenuated virus.
  • a method for preventing or treating an influenza virus disease in a subject comprises administering to a subject in need thereof an inactivated virus vaccine described herein.
  • a method for preventing or treating an influenza virus disease in a subject comprises administering to a subject in need thereof a split virus vaccine described herein.
  • a method for preventing or treating an influenza virus disease comprises administering to a subject in need thereof a viral-like particle vaccine described herein.
  • a method for preventing or treating an influenza virus disease in a subject comprising administering to a subject in need thereof - a virosome described herein.
  • a method for preventing or treating an influenza virus disease in a subject comprising administering to a subject in need thereof a bacteria expressing or engineered to express a flu polypeptide or a composition thereof.
  • the influenza virus disease is caused by or associated with the presence of an influenza A virus.
  • the influenza virus disease is caused by or associated with the presence of an influenza B virus.
  • a method for preventing or treating an influenza virus disease in a subject comprises administering to a subject in need thereof an effective amount of a neutralizing antibody described herein, or a pharmaceutical composition thereof.
  • the neutralizing antibody is a monoclonal antibody.
  • the neutralizing antibody is not an antibody described in Wang et al. (201 0) "Broadly Protective Monoclonal Antibodies against H3 Influenza Viruses fol lowing Sequential Immunization with Different Hemagglutinins," PLOS Pathogens 6(2): 1 -9.
  • the neutralizing antibody is not an antibody described in PCT/US201 0/0361 70.
  • the methods for preventing or treating an influenza virus d isease or infection in a subject result in a reduction in the replication of the influenza virus in the subject as measured by in vivo and in vitro assays known to those of skill in the art and described herein.
  • the replication of the influenza virus is reduced by approximately 1 log or more, approximately 2 logs or more, approximately 3 logs or more, approximately 4 logs or more, approximately 5 logs or more, approximately 6 logs or more, approximately 7 logs or more, approximately 8 logs or more, approximately 9 logs or more, approximately 1 0 logs or more, 1 to 3 logs, 1 to 5 logs, 1 to 8 logs, 1 to 9 logs, 2 to 1 0 logs, 2 to 5 logs, 2 to 7 logs, 2 logs to 8 logs, 2 to 9 logs, 2 to 1 0 logs 3 to 5 logs, 3 to 7 logs, 3 to 8 logs, 3 to 9 logs, 4 to 6 logs, 4 to 8 logs, 4 to 9 logs, 5 to 6 logs, 5 to 7 logs, 5 to 8 logs, 5 to 9 logs, 6 to 7 logs, 6 to 8 logs, 6 to 9 logs, 7 to 8 logs, 7 to 9 logs, or 8 to 9 logs.
  • a flu polypeptide described herein, a nucleic acid encoding such a polypeptide, a vector (e.g. , a viral vector or a bacteria) containing or expressing such a polypeptide, cells stimulated with such a polypeptide, or a neutralizing antibody may be administered to a subject in combination with one or more other therapies (e.g. , antiviral, antibacterial, or immunomodulatory therapies).
  • a pharmaceutical composition e.g. , an immunogenic composition
  • the one or more other therapies may be beneficial in the treatment or prevention of an influenza virus disease or may ameliorate a symptom or condition associated with an influenza virus disease.
  • the one or more other therapies are pain relievers, anti-fever medications, or therapies that alleviate or assist with breath ing.
  • the therapies are.
  • admin istered less than 5 minutes apart, less than 30 m inutes apart, 1 hour apart, at about 1 hour apart, at about 1 to about 2 hours apart, at about 2 hours to about 3 hours apart, at about 3 hours to about 4 hours apart, at about 4 hours to about 5 hours apart, at about 5 hours to about 6 hours apart, at about 6 hours to about 7 hours apart, at about 7 hours to about 8 hours apart, at about 8 hours to about 9 hours apart, at about 9 hours to about 10 hours apart, at about 1 0 hours to about 1 1 hours apart, at about 1 1 hours to about 1 2 hours apart, at about 12 hours to 1 8 hours apart, 1 8 hours to 24 hours apart, 24 hours to 36 hours apart, 36 hours to 48 hours apart, 48 hours to 52 hours apart, 52 hours to 60 hours apart, 60 hours to 72 hours apart, 72 hours to 84 hours apart, 84 hours to 96 hours apart, or 96 hours to 120 hours part.
  • two or more therapies are administered within the same patent visit.
  • anti-viral agents well-known to one of skill in the art may be used in combination with an active compound or pharmaceutical composition described herein.
  • Non-limiting examples of anti-viral agents include proteins, polypeptides, peptides, fusion proteins antibodies, nucleic acid molecules, organic molecules, inorganic molecules, and small molecules that inhibit and/or reduce the attachment of a virus to its receptor, the internalization of a virus into a cell, the replication of a virus, or release of virus from a cel l.
  • anti-viral agents include, but are not limited to, nucleoside analogs (e.g., zidovudine, acyclovir, gangcyclovir, vidarabine, idoxuridine, trifluridine, and ribavirin), foscarnet, amantadine, peramivir, rimantadine, saquinavir, indinavir, ritonavir, alpha-interferons and other interferons, AZT, zanamivir (Relenza®), and oseltam ivir (Tamiflu®).
  • nucleoside analogs e.g., zidovudine, acyclovir, gangcyclovir, vidarabine, idoxuridine, trifluridine, and ribavirin
  • foscarnet e.g., amantadine, peramivir, rimantadine, saquinavir, indinavir, riton
  • Fluarix® (GlaxoSmithKline), FluMist® (Medlmmune Vaccines), Fluvirin® (Chiron Corporation), Flulaval® (GlaxoSmithKline), Afluria® (CSL Biotherapies Inc.), Agriflu® (Novartis)or Fluzone® (Aventis Pasteur).
  • the anti-viral agent is an immunomodulatory agent that is specific for a viral antigen.
  • the viral antigen is an influenza virus polypeptide other than a hemagglutinin polypeptide.
  • the viral antigen is an flu polypeptide.
  • anti-bacterial agents Any anti-bacterial agents known to one of skill in the art may used in combination with an active compound or pharmaceutical composition described herein.
  • anti-bacterial agents include Amikacin, Amoxicillin,
  • Erythromycin Flucloxacill in, Fluconazol, Flucytosin, Fosfomycin, Fusidic acid, Garenoxacin, Gatifloxacin, Gemifloxacin, Gentamicin, Imipenem, Itraconazole, Kanamycin, Ketoconazole, Levofloxacin, Lincomycin, Linezolid, Loracarbef, Mecillnam (amdinocillin), Meropenem, Metronidazole, Meziocillin, Mezlocillin-sulbactam, Minocycline, Moxifloxacin, Mupirocin, Nalidixic acid, Neomycin, Netilm icin,
  • Sparfloxacin Sparfloxacin, Spectinomycin, Spiramycin, Streptomycin, Sulbactam, Sulfamethoxazole, Teicoplan in, Telavancin, Telithromycin, Temocillin, Tetracyklin, Ticarcillin, Ticarcillin- clavulanic acid, Tigecycline, Tobramycin, Trimethoprim, Trovafloxacin, Tylosin, Vancomycin, Virginiamycin, and Voriconazole.
  • a combination therapy comprises administration of two or more different vectors described in Sections 5.4-5.7.
  • one or more vectors expressing a flu polypeptide derived from an influenza A virus and one or more vectors expressing a flu polypeptide derived from an influenza B virus are administered in combination.
  • a combination therapy comprises administration of a vector expressing a flu polypeptide derived from an H3 influenza A virus and a vector expressing a flu polypeptide derived from an H I influenza A virus.
  • the combination therapy comprises administration of a vector expressing a flu polypeptide derived from an H3 influenza A virus, a vector expressing a flu polypeptide derived from an H I influenza A virus, and a vector expressing a flu polypeptide derived from an influenza B virus.
  • a combination therapy comprises active immunization with an active compound that induces an immune response to one, two, three, or more HA subtypes in one HA group e.g. , Group 1 ) in combination with an active compound that induces an immune response to one, two, three, or more HA subtypes in the other HA group (e.g. , Group 2).
  • a combination therapy comprises active immunization with two or more flu polypeptides described in Section 5. 1 .
  • an active compound or composition described herein may be adm inistered to a naive subject, i. e. , a subject that does not have a disease caused by influenza virus infection or has not been and is not currently infected with an influenza virus infection.
  • an active compound or composition described herein is administered to a naive subject that is at risk of acquiring an influenza virus infection.
  • an active compound or composition described herein is administered to a subject that does not have a disease caused by the specific influenza virus, or has not been and is not infected with the specific influenza virus to which the flu polypeptide induces an immune response.
  • An active compound or composition described herein may also be administered to a subject that is and/or has been infected with the influenza virus or another type, subtype or strain of the influenza virus to which the flu polypeptide induces an immune response.
  • an active compound or composition described herein is administered to a patient who has been diagnosed with an influenza virus infection. In some embodiments, an active compound or composition described herein is administered to a patient infected with an influenza virus before symptoms manifest or symptoms become severe ⁇ e.g. , before the patient requires hospitalization). In some embodiments, an active compound or composition described herein is administered to a patient that is infected with or has been diagnosed with a different type of influenza virus than that of the influenza virus from which the flu polypeptide of the active compound or composition was derived.
  • an active compound or composition described herein is administered to a patient that may be or is infected with an influenza virus that belongs to the same HA group as that of the influenza flu polypeptide. In certain embodiments, an active compound or composition described herein is administered to a patient that may be or is infected with an influenza virus of the same subtype as that of the influenza flu polypeptide.
  • a subject to be administered an active compound or composition described herein is an animal.
  • the animal is a bird.
  • the animal is a canine.
  • the animal is a feline.
  • the animal is a horse.
  • the animal is a cow.
  • the animal is a mammal, e.g. , a horse, swine, mouse, or primate, preferably a human.
  • a subject to be administered an active compound or composition described herein is a human adult. In certain embodiments, a subject to be administered an active compound or composition described herein is a human adult more than 50 years old. In certain embodiments, a subject to be administered an active compound or composition described herein is an elderly human subject.
  • a subject to be administered an active compound or composition described herein is a human-child.
  • a subject to be administered an active compound or composition described herein is a human infant.
  • a subject to be administered an active compound or composition described herein is a premature human infant.
  • a patient treated or prevented in accordance with the methods provided herein is a human toddler.
  • a subject to whom an active compound or composition described herein is administered is not an infant of less than 6 months old.
  • a subject to be administered an active compound or composition described herein is 2 years old or younger.
  • a subject to be administered an active compound or composition described herein is any infant or child more than 6 months of age and any adult over 50 years of age.
  • the subject is an individual who is pregnant.
  • the subject is an individual who may or will be pregnant during the influenza season (e.g. , November to April).
  • a subject to be administered an active compound or composition described herein is a woman who has given birth 1 , 2, 3, 4, 5, 6, 7, or 8 weeks earlier.
  • the human subject to be administered an active compound or composition described herein is any individual at increased risk of influenza virus infection or disease resulting from influenza virus infection (e.g. , an immunocompromised or immunodeficient individual). In some embodiments, the human subject to be administered an active compound or composition described herein is any individual in c lose contact with an individual with increased risk of influenza virus infection or disease resulting from influenza virus infection (e.g. , immunocompromised or immunosuppressed individuals). [00424) In some embodiments, the human subject to be administered an active compound or composition described herein is an individual affected by any condition that increases susceptibility to influenza virus infection or complications or disease resulting from influenza virus infection.
  • an active compound or composition described herein is administered to a subject in which an influenza virus infection has the potential to increase complications of another condition that the individual is affected by, or for which they are at risk.
  • such conditions that increase susceptibility to influenza virus complications or for which influenza virus increases complications associated with the condition are, e.g. , conditions that affect the lung, such as cystic fibrosis, emphysema, asthma, or bacterial infections (e.g. , infections caused by Haemophilus influenzae, Streptococcus pneumoniae,
  • cardiovascular disease e.g. , congenital heart disease, congestive heart failure, and coronary artery disease
  • endocrine disorders e.g. , diabetes
  • neurological and neuron-developmental conditions e.g. , disorders of the brain, the spinal cord, the peripheral nerve, and muscle (such as cerebral palsy, epilepsy (seizure disorders), stroke, intellectual disability (e.g. , mental retardation), muscular dystrophy, and spinal cord injury)).
  • the human subject to be administered an active compound or composition described herein is an individual that resides in a group home, such as a nursing home. In some embodiments, the human subject to be administered an active compound or composition described herein works in, or spends a significant amount of time in, a group home, e.g. , a nursing home. In some embodiments, the human subject to be administered an active compound or composition described herein is a health care worker (e.g. , a doctor or nurse). In some embodiments, the human subject to be administered an active compound or composition described herein is a smoker. In a specific embodiment, the human subject to be administered an active compound or composition described herein is immunocompromised or immunosuppressed.
  • subjects at increased risk of developing complications from influenza who may be administered an active compound or composition described herein include: any individual who can transmit influenza viruses to those at high risk for complications, such as, e.g. , members of households with high-risk individuals, including households that will include infants younger than 6 months, individuals coming into contact with infants less than 6 months of age, or individuals who will come into contact with individuals who live in nursing homes or other long-term care facilities; individuals with long-term disorders of the lungs, heart, or circulation; individuals with metabolic diseases (e.g.
  • diabetes diabetes
  • kidney disorders including anemia or sickle cel l disease
  • individuals with weakened immune systems including immunosuppression caused by medications, malignancies such as cancer, organ transplant, or HIV infection
  • children who receive long-term aspirin therapy and therefore have a higher chance of developing Reye syndrome if infected with influenza.
  • subjects for administration of an active compound or composition described herein include healthy individuals six months of age or older, who: plan to travel to foreign countries and areas where flu outbreaks may be occurring, such, e.g. , as the tropics and the Southern Hemisphere from April through September; travel as a part of large organized tourist groups that may include persons from areas of the world where influenza viruses are circulating; attend school or college and reside in dormitories, or reside in institutional settings; or wish to reduce their risk of becoming ill with influenza.
  • a subject for whom administration of an active compound or composition described herein is contraindicated include any individual for whom influenza vaccination is contraindicated, such as: infants younger than six months of age; and individuals who have had an anaphylactic reaction (allergic reactions that cause difficulty breath ing, which is often followed by shock) to eggs, egg products, or other components used in the production of the immunogenic formulation.
  • anaphylactic reaction allergic reactions that cause difficulty breath ing, which is often followed by shock
  • the active compound or composition may be produced in a manner that does not include the component that causes the administration of an active compound or composition to be contraindicated (e.g., the active compound or composition may be produced without the use of eggs or egg products).
  • a live virus vaccine to one or more of the following patient populations: elderly humans; infants younger than 6 months old; pregnant individuals; infants under the age of 1 years old; children under the age of 2 years old; children under the age of 3 years old; children under the age of 4 years old; children under the age of 5 years old; adults under the age of 20 years old; adults under the age of 25 years old; adults under the age of 30 years old; adults under the age of 35 years old; adults under the age of 40 years old; adults under the age of 45 years old; adults under the age of 50 years old; elderly humans over the age of 70 years old; elderly humans over the age of 75 years old; elderly humans over the age of 80 years old; elderly humans over the age of 85 years old; elderly humans over the age of 90 years old; elderly humans over the age of 95 years old; children and adolescents (2- 1 7 years of age) receiving aspirin or aspirin-containing medications, because of the complications associated with aspirin and wild-type influenza virus infections
  • subjects preferably administered a live virus vaccine may include healthy children and adolescents, ages 2- 1 7 years, and healthy adults, ages 1 8-49.
  • an immunogenic formulation comprising a live virus vector is not given concurrently with other live-virus vaccines.
  • An active compound or composition described herein may be delivered to a subject by a variety of routes. These include, but are not l im ited to, intranasal, intratracheal, oral, intradermal, intramuscular, intraperitoneal, transdermal, intravenous, conjunctival and subcutaneous routes. In a specific embodiment, an active compound or composition described herein is delivered to a subject by the subcutaneous route. In some embodiments, a composition is formulated for topical administration, for example, for application to the skin. In specific embodiments, the route of administration is nasal, e.g. , as part of a nasal spray. In certain embodiments, a composition is formulated for intramuscular administration.
  • a composition is formulated for subcutaneous administration. In certain embodiments, a composition is not formulated for administration by injection. In specific embodiments for live virus vaccines, the vaccine is formulated for administration by a route other than injection. (00432)
  • the antigen is a viral vector, a virus-like particle vector, or a bacterial vector
  • the ability of an antigen, particularly a viral vector, to induce a vigorous secretory and cellular immune response can be used advantageously.
  • infection of the respiratory tract by a viral vector may induce a strong secretory immune response, for example in the urogenital system, with concomitant protection against an influenza virus.
  • a viral vector may induce a strong secretory immune response, for example in the urogenital system, with concomitant protection against an influenza virus.
  • Pulmonary administration can also be employed, e.g. , by use of an inhaler or nebulizer, and formulation with an aerosolizing agent for use as a spray.
  • a subunit vaccine is administered intranasally. In a specific embodiment, a subunit vaccine is administered intramuscularly. In another specific embodiment, a subunit vaccine is administered subcutaneously. In another specific embodiment, a subunit vaccine is administered intradermally.
  • a live virus vaccine is administered intranasally. In a specific embodiment, a live virus vaccine is administered intramuscularly. In another specific embodiment, a live virus vaccine is administered subcutaneously. In another specific embodiment, a l ive virus vaccine is administered intradermally.
  • an inactivated virus vaccine is administered intranasal ly. In a specific embodiment, an inactivated virus vaccine is administered intramuscularly. In another specific embodiment, an inactivated virus vaccine is administered subcutaneously. In another specific embodiment, an inactivated virus vaccine is administered intradermally.
  • a split virus vaccine is administered intranasally.
  • a spl it virus vaccine is administered intramuscularly.
  • a split virus vaccine is administered subcutaneously.
  • a split virus vaccine is administered intradermally.
  • a viral-like particle or composition thereof is administered intranasally. In a specific embodiment, a viral-like particle or composition thereof is administered intramuscularly. In another specific embodiment, a sp viral-like particle or composition thereof is administered subcutaneously. In another specific embodiment, a viral-like particle or composition thereof is administered intradermally.
  • cells stimulated with a flu polypeptide in vitro may be introduced (or re-introduced) into a subject using techniques known to one of ski ll in the art.
  • the cells can be introduced into the dermis, under the dermis, or into the peripheral blood stream.
  • the cells introduced into a subject are preferably cells derived from that subject, to avoid an adverse immune response.
  • cells also can be used that are derived from a donor host having a similar immune background. Other cells also can be used, including those designed to avoid an adverse immunogenic response.
  • an active compound or composition which will be effective in the treatment and/or prevention of an influenza virus infection or an influenza virus disease wil l depend on the nature of the disease, and can be determined by standard clinical techniques.
  • the precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the infection or disease caused by it, and should be decided according to the judgment of the practitioner and each subject's circumstances.
  • effective doses may also vary depending upon means of administration, target site, physiological state of the patient (including age, body weight, health), whether the patient is human or an animal, other medications administered, and whether treatment is prophylactic or therapeutic.
  • the patient is a human but nonhuman mammals including transgenic mammals can also be treated. Treatment dosages are optimally titrated to optimize safety and efficacy.
  • an in vitro assay is employed to help identify optimal dosage ranges.
  • Effective doses may be extrapolated from dose response curves derived from in vitro or animal model test systems.
  • Exemplary doses for nucleic acids encoding flu polypeptides range from about 1 0 ng to I g, 1 00 ng to 1 00 mg, 1 ⁇ g to 1 0 mg, or 30-300 ⁇ g nucleic acid, e.g. , DNA, per patient.
  • exemplary doses for flu polypeptide(s) range from about 5 ⁇ g to 1 00 mg, 1 5 ⁇ g to 50 mg, 1 5 ⁇ g to 25 mg, 1 5 ⁇ g to 1 0 mg, 1 5 ⁇ g to 5 mg, 1 5 ⁇ g to 1 mg, 1 5 ⁇ g to 1 00 ⁇ g, 1 5 Hg to 75 ⁇ g, 5 ⁇ g to 50 ⁇ g, 10 ⁇ g to 50 ⁇ g, 1 5 ⁇ g to 45 ⁇ g, 20 ⁇ g to 40 ⁇ g ! or 25 to 35 ⁇ g per kilogram of the patient.
  • exemplary doses for flu polypeptide(s) range from about 1 ⁇ g to 50 mg, 5 ⁇ g to 50 mg, 1 ⁇ g to 1 00 mg, 5 ⁇ g to 1 00 mg, 1 5 ⁇ g to 50 mg, 1 5 g to 25 mg, 1 5 ⁇ g to 1 0 mg, 1 5 ⁇ g to 5 mg, 1 5 ⁇ g to 1 mg, 1 5 ⁇ g to 1 00 ⁇ g, 1 5 ⁇ g to 75 ⁇ g, 5 ⁇ g to 50 ⁇ g, 1 0 ⁇ g to 50 ⁇ g, 1 5 ⁇ g to 45 ⁇ g, 20 ⁇ g to 40 ⁇ g, or 25 to 35 ⁇ g of flu polypeptide(s) per dose.
  • an exemplary dose for a flu polypeptide(s) comprises 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1 , 1 2, 1 3, 14, 1 5, 1 6, 1 7, 1 8, 19, 20, 21 , 22, 23, 24, 25, 26, 27, 28, 29, 30, 3 1 , 32, 33, 34, 35, 36, 37, 38, 39, 40, 41 , 42, 43, 44, 45, 46, 47, 48, 49, or 50 ⁇ g of flu polypeptide(s) per dose.
  • an exemplary dose for a flu polypeptide(s) comprises 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 1 00 ⁇ g of flu polypeptide(s) per dose.
  • Doses for infectious viral vectors may vary from 1 0- 100, or more, virions per dose.
  • suitable dosages of a virus vector are 10 " , 5 x 10 , 10 , 5 x 1 1 0 4 , 5 x 1 0 4 , 1 0 5 , 5 x 1 0 5 , 1 0 6 , 5 x 1 0 6 , 1 0 7 , 5 x 1 0 7 , 1 0 8 , 5 x 1 0 8 , 1 x 10 9 , 5 x 1 0 9 , 1 x 1 0'°, 5 x 1 0 10 , 1 x l O " , 5 x l O" or l O 12 pfu, and can be administered to a subject once, twice, three or more times with intervals as often as needed.
  • exemplary doses for VLPs range from about 0.01 ⁇ g to about 1 00 mg, about 0. 1 ⁇ g to about 100 mg, about 5 ⁇ g to about 1 00 mg, about 1 5 ⁇ & to about 50 mg, about 1 5 ⁇ g to about 25 mg, about 1 5 ⁇ g to about 1 0 mg, about 1 5 ⁇ g to about 5 mg, about 1 5 ⁇ g to about 1 mg, about 1 5 ⁇ g to about 100 ⁇ g, about 1 5 ⁇ g to about 75 ⁇ g, about 5 ⁇ g to about 50 ⁇ g, about 10 ⁇ g to about 50 ⁇ g, about 1 5 ⁇ g to about 45 ⁇ g, about 20 ⁇ g to about 40 ⁇ g, or about 25 to about 35 ⁇ g per kilogram of the patient.
  • exemplary doses for flu polypeptides range from about 1 ⁇ g to about 50 mg, about 5 ⁇ g to about 50 mg, about 1 ⁇ g to about 1 00 mg, about 5 ⁇ g to about 1 00 mg, about 1 5 ⁇ g to about 50 mg, about 1 5 ⁇ g to about 25 mg, about 1 5 ⁇ g to about 1 0 mg, about 1 5 ⁇ g to about 5 mg, about 1 5 ⁇ g to about 1 mg, about 1 5 ⁇ g to about 1 00 ⁇ g, about 1 5 ⁇ g to about 75 ⁇ g, about 5 ⁇ g to about 50 ⁇ g, about 10 ⁇ g to about 50 ⁇ g, about 1 5 ⁇ g to about 45 ⁇ g, about 20 ⁇ g to about 40 ⁇ g, or about 25 to about 35 ⁇ g of flu polypeptide(s) per dose, and can be administered to a subject once, twice, three or more times with intervals as often as needed.
  • an inactivated vaccine is formulated such that it contains about 5 ⁇ g to about 50 ⁇ g, about 10 ⁇ g to about 50 ⁇ g, about 1 5 ⁇ g to about 100 ⁇ g, about 1 5 ⁇ g to about 75 ⁇ g, about 1 5 ⁇ g to about 50 ⁇ g, about 1 5 ⁇ g to about 30 ⁇ g, about 20 ⁇ g to about 50 ⁇ g, about 25 ⁇ g to about 40 ⁇ g, about 25 ⁇ g to about 35 ⁇ g of a flu polypeptide(s).
  • a vaccine may contain a combination of one or more different flu polypeptides, for example, one or more flu polypeptides from an influenza A virus and one or more flu polypeptides from an influenza B virus.
  • a live attenuated influenza-vaccine is formulated such that a 0.2-mL dose contains I Q6 5-7 5 f
  • an active compound or composition is administered to a subject once as a single dose.
  • an active compound or composition is administered to a subject as a single dose followed by a second dose 3 to 6 weeks later.
  • booster inoculations may be administered to the subject at 6 to 12 month intervals following the second inoculation.
  • the booster inoculations may utilize a different active compound or composition.
  • the administration of the same active compound or composition may be repeated and the administrations may be separated by at least 1 day, 2 days, 3 days, 5 days, 10 days, 1 5 days, 30 days, 45 days, 2 months, 75 days, 3 months, or at least 6 months.
  • an active compound or composition is administered to a subject as a single dose once per year.
  • two doses of an active compound or composition, given at least one month apart are administered to a child.
  • a single dose is given.
  • two doses of an active compound or composition, given at least one month apart are administered to an adult.
  • a young child may be administered an active compound or composition for the first time in two doses given one month apart.
  • a child who received only one dose in their first year of vaccination should receive two doses in the following year.
  • two doses administered 4 weeks apart are preferred for children 2 -8 years of age who are administered an influenza vaccine, e.g., an influenza vaccine, e.g., an influenza vaccine, e.g., an influenza vaccine, e.g., an influenza vaccine, e.g., an influenza vaccine, e.g., an influenza vaccine, e.g., an influenza vaccine, e.g., an influenza vaccine, e.g., an influenza vaccine, e.g., an influenza vaccine, e.g., an influenza vaccine, e.g., an influenza vaccine
  • immunogenic formulation described herein for the first time.
  • a half dose (0.25 ml) may be preferred, in contrast to 0.5 ml which may be preferred for subjects over three years of age.
  • an active compound or composition is
  • a subject in the fall or winter i.e., prior to or during the influenza season in each hemisphere.
  • children are administered their first dose early in the season, e.g. , late September or early October, so that the second dose can be given prior to the peak of the influenza season.
  • an active compound or composition thereof is administered to a subject as 2, 3, 4, 5 or more doses 2 weeks, 3 weeks, 4 weeks, 5 weeks or 6 weeks apart.
  • 2, 3, 4, 5 or more doses of an active compound or compositions thereof are administered to a subject 2, 3, 4, 5 or 6 weeks apart at a dosage of 1 ⁇ g to 20 mg, 1 0 ⁇ g to 20 mg, 500 ⁇ to 20 mg, 1 mg to 20 mg or 5 mg to 20 mg.
  • the active compounds or compositions thereof administered is the same each time.
  • the flu polypeptides or compositions thereof administered are different each time.
  • the dosage ranges from about 0.0001 to 1 00 mg/kg, and more usually 0.01 to 5 mg/kg, of the patient body weight.
  • dosages can be 1 mg/kg body weight or 1 0 mg/kg body weight or within the range of 1 - 10 mg/kg or in other words, 70 mg or 700 mg or within the range of 70-700 mg, respectively, for a 70 kg patient.
  • An exemplary treatment regime entails administration once per every two weeks or once a month or once every 3 to 6 months for a period of one year or over several years, or over several year-intervals.
  • two or more monoclonal antibodies with different binding specificities are administered simultaneously, in which case the dosage of each antibody administered falls within the ranges indicated.
  • Antibody is usually administered on multiple occasions. Intervals between single dosages can be weekly, monthly or yearly. Intervals can also be irregular as indicated by measuring blood levels of antibody to the flu polypeptide in the patient.
  • Assays for testing the expression of a flu polypeptide in a vector disclosed herein may be conducted using any assay known in the art.
  • an assay for incorporation into a viral vector comprises growing the virus as described in this section or Sections 5.4 or 5.5, purifying the viral particles by centrifugation through a sucrose cushion, and subsequent analysis for flu polypeptide expression by an immunoassay, such as Western blotting, using methods well known in the art.
  • a flu polypeptide disclosed herein is assayed for proper folding and functionality by testing its ability to bind specifical ly to an antibody directed to a flu polypeptide using any assay for antibody-antigen interaction known in the art.
  • Antibodies for use in such assays include, for example the neutralizing antibodies described in Wang el al. (201 0) "Broadly Protective Monoclonal Antibodies against H3 Influenza Viruses fol lowing Sequential Immunization with Different Hemagglutinins," PLOS Pathogens 6(2): 1 -9, International Publication No. PCT/US2010/0361 70 and U.S. 1 2/778, 1 03..
  • a flu polypeptide disclosed herein is assayed for proper folding by determination of the structure or conformation of the flu polypeptide using any method known in the art such as, e.g. , NMR, X-ray crystallographic methods, or secondary structure prediction methods, e.g. , circular dichroism.
  • Antibodies described herein may be characterized in a variety of ways known to one of skil l in the art ⁇ e.g. ELI SA, Surface Plasmon resonance display (BIAcore), Western blot, immunofluorescence, immunostaining and/or microneutralization assays).
  • ELI SA Surface Plasmon resonance display
  • BoAcore Surface Plasmon resonance display
  • Western blot immunofluorescence
  • immunostaining and/or microneutralization assays are assayed for the ability to specifical ly bind to a flu polypeptide, or a vector comprising said polypeptide.
  • Such an assay may be performed in solution (e.g.
  • Immunoassays which can be used to analyze specific binding and cross-reactivity include, but are not limited to, competitive and non-competitive assay systems using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays,
  • the binding affinity of an antibody to a flu polypeptide and the off-rate of an antibody-antigen interaction can be determined by competitive binding assays.
  • a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen ⁇ e.g. , 3 H or l 25 I) with the antibody of interest in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen.
  • the affinity of the antibody for a flu polypeptide and the binding off- rates can be determined from the data by Scatchard plot analysis. Competition with a second antibody can also be determined using radioimmunoassays. In this case, a flu polypeptide is incubated with the test antibody conjugated to a labeled compound ⁇ e.g. , 3 H or ,25 I) in the presence of increasing amounts of an unlabeled second antibody.
  • antibody binding affinity and rate constants are measured using the inExA 3000 System (Sapidyne Instruments, Boise, ID).
  • surface plasmon resonance ⁇ e.g. , BIAcore kinetic) analysis is used to determine the binding on and off rates of the antibodies to a flu polypeptide.
  • BIAcore kinetic analysis comprises analyzing the binding and dissociation of flu polypeptide from chips with immobilized antibodies to a flu polypeptide on their surface.
  • a typical BIAcore kinetic study involves the injection of 250 ⁇ ⁇ of an antibody reagent (mAb, Fab) at varying concentration in HBS buffer containing 0.005% Tween-20 over a sensor chip surface, onto which has been immobilized the flu polypeptide. The flow rate is maintained constant at 75 ⁇ 7 ⁇ . Dissociation data is collected for 1 5 min or longer as necessary. Following each injection/dissociation cycle, the bound antibody is removed from the flu polypeptide surface using brief, 1 min pulses of dilute acid, typically 10- 100 mM HC1, though other regenerants are employed as the circumstances warrant.
  • dilute acid typically 10- 100 mM HC1
  • EDC N- diethylaminopropyl
  • a 5- 100 nM solution of the polypeptide in 1 0 mM NaOAc, pH 4 or pH 5 is prepared and passed over the EDC NHS-activated surface until approximately 30-50 RU 's worth of polypeptide are immobi lized.
  • the neutral izing activity of an antibody can be determined utilizing any assay known to one skilled in the art.
  • Antibodies described herein can be assayed for their abi lity to inhibit the binding of an influenza virus to its host cell receptor (i.e. , sialic acid) using techniques known to those of skill in the art. For example, cells expressing influenza virus receptors can be contacted with a composition comprising an influenza virus in the presence or absence of the antibody and the abi lity of the antibody to inhibit the influenza virus' binding can be measured. Alternatively, the ability of antibodies to inhibit an influenza virus from binding to its receptor can be determined in cell-free assays.
  • an antibody suitable for use in the methods described herein does not inhibit influenza virus receptor binding, yet is still found to be neutralizing in an assay described herein.
  • an antibody suitable for use in accordance with the methods described herein reduces or inhibits virus-host membrane fusion in an assay known in the art or described herein.
  • virus-host membrane fusion is assayed in an in vitro assay using an influenza virus containing a reporter and a host cell capable of being infected with the virus.
  • An antibody inhibits fusion if reporter activity is inhibited or reduced compared to a negative control (e.g. , reporter activity in the presence of a control antibody or in the absence of antibody).
  • Cel ls stimulated in accordance with the methods described herein may be analyzed, for example, for integration, transcription and/or expression of the
  • successful stimulation of the target cel l with a flu polypeptide described herein is determined by detecting production of neutralizing antibodies against the flu polypeptide using methods known in the art or described herein.
  • subjects in which the stimulated cells, e.g. , DCs, are administered can be analyzed for location of the cells, expression of a vector-delivered polynucleotide or gene encoding the flu polypeptide, stimulation of an immune response (e.g. , production of neutralizing antibodies against the flu polypeptide), and/or monitored for symptoms associated with influenza virus infection or a disease associated therewith by any methods known in the art or described herein.
  • an immune response e.g. , production of neutralizing antibodies against the flu polypeptide
  • Reporter assays can be used to determine the specificity of the targeting of the flu polypeptide.
  • a mixed population of bone marrow cells can be obtained from a subject and cultured in vitro.
  • the flu polypeptide can be administered to the mixed population of bone marrow cells, and expression of a reporter gene associated with the flu polypeptide can be assayed in the cultured cells.
  • at least about 50%, more preferably at least about 60%, 70%, 80% or 90%, stil l more preferably at least about 95% of stimulated cells in the mixed cell population are dendritic cells.
  • Antibodies described herein or compositions thereof can be assessed in vitro for antiviral activity.
  • the antibodies or compositions thereof are tested in vitro for their effect on growth of an influenza virus. Growth of influenza virus can be assessed by any method known in the art or described herein (e.g. in cell culture).
  • cel ls are infected at a Ol of 0.0005 and 0.001 , 0.001 and 0.01 , 0.01 and 0.1 , 0. 1 and l , or 1 and 1 0, or a MOI of 0.0005, 0.001 , 0.005, 0.01 , 0.05, 0.1 , 0.5, 1 , 5 or 1 0 and incubated with serum free media supplemented.
  • Viral titers are determined in the supernatant by hemagglutinin plaques or any other viral assay described herein.
  • Cells in which viral titers can be assessed include, but are not limited to, EFK-2 cel ls, Vero cells, MDC cells, primary human umbi lical vein endothelial cells (HUVEC), H292 human epithelial cell line and HeLa cells.
  • In vitro assays include those that measure altered viral replication (as determined, e.g. , by plaque formation) or the production of viral proteins (as determined, e.g. , by Western blot analysis) or viral RNAs (as determined, e.g.
  • a monolayer of the target mammalian cell line is infected with different amounts (e.g. , multiplicity of 3 plaque forming units (pfu) or 5 pfu) of virus (e.g. , influenza) and subsequently cultured in the presence or absence of various dilutions of antibodies (e.g. , 0.1 ⁇ g/ml, 1 ⁇ g/ml, 5 ⁇ g/ml, or 10 ⁇ g/ml).
  • Infected cultures are harvested 48 hours or 72 hours post infection and titered by standard plaque assays known in the art on the appropriate target cell line (e.g. , Vero cells).
  • cells are contacted with an antibody and are concurrently or subsequently infected with the virus (e.g. , at an OI of 1 ) and the virus is incubated under conditions to permit virus replication (e.g. , 20-24 hours).
  • the antibodies are preferably present throughout the course of infection.
  • Viral replication and release of viral particles is then determined by hemagglutination assays using 0.5% chicken red blood cells. See, e.g. , ashyap et al. , PNAS USA 1 05 : 5986-5991 .
  • a compound is considered an inhibitor of viral repl ication if it reduces viral replication by at least 2 wells of HA, which equals approximately a 75% reduction in viral titer.
  • an inhibitor reduces viral titer in this assay by 50% or more, by 55% or more, by 60%) or more, by 65% or more, by 70% or more, by 75% or more, by 80% or more, by 85% or more, by 90% or more, or by 95% or more.
  • an inhibitor results in a reduction of approximately 1 log or more, approximately 2 logs or more, approximately 3 logs or more, approximately 4 logs or more, approximately 5 logs or more,
  • the log- reduction in influenza virus titer may be as compared to a negative control, as compared to another treatment, or as compared to the titer in the patient prior to
  • Bromodeoxyuridine (BrdU) incorporation ⁇ See, e.g. , Hoshino et ai , 1986, Int. J. Cancer 38, 369; Campana et al , 1988, J. Immunol. Meth. 107:79), (3H) thymidine incorporation ⁇ See, e.g. , Chen, J., 1996, Oncogene 1 3 : 1395-403 ; Jeoung, J., 1995, J. Biol. Chem. 270: 1 8367 73), by direct cell count, or by detecting changes in transcription, translation or activity of known genes such as proto-oncogenes ⁇ e.g.
  • mRNA and activity can be determined by any method well known in the art.
  • protein can be quantitated by known immunodiagnostic methods such as ELISA, Western blotting or immunoprecipitation using antibodies, including commercially available antibodies.
  • mRNA can be quantitated using methods that are well known and routine in the art, for example, using northern analysis, RNase protection, or polymerase chain reaction in connection with reverse transcription. Cell viabil ity can be assessed by using trypan-blue staining or other cell death or viability markers known in the art.
  • the level of cellular ATP is measured to determined cell viability.
  • cell viability is measured in three-day and seven-day periods using an assay standard in the art, such as the CellTiter-Glo Assay Kit (Promega) which measures levels of intracellular ATP. A reduction in cellular ATP is indicative of a cytotoxic effect.
  • cell viability can be measured in the neutral red uptake assay.
  • visual observation for morphological changes may include enlargement, granularity, cells with ragged edges, a filmy appearance, rounding, detachment from the surface of the well, or other changes.
  • T 100% toxic
  • PVH partially toxic-very heavy- 80%
  • PH partially toxic-heavy-60%
  • P partially toxic-40%
  • Ps partially toxic- slight-20%)
  • 0 no toxicity-0%
  • IC50 50% cell inhibitory (cytotoxic) concentration
  • the cells used in the cytotoxicity assay are animal cells, including primary cells and cell lines.
  • the cells are human cells.
  • cytotoxicity is assessed in one or more of the following cell lines: U937, a human monocyte cell line; primary peripheral blood mononuclear cells (PBMC); Huh7, a human hepatoblastoma cell line; 293T, a human embryonic kidney cell line; and THP- 1 , monocytic cells.
  • cytotoxicity is assessed in one or more of the following cell lines: M DC , MEF, Huh 7.5, Detroit, or human tracheobronchial epithelial (HTBE) cells.
  • PBMC primary peripheral blood mononuclear cells
  • Huh7 a human hepatoblastoma cell line
  • 293T a human embryonic kidney cell line
  • THP- 1 monocytic cells.
  • cytotoxicity is assessed in one or more of the following cell lines: M DC , MEF, Huh 7.5, Detroit, or
  • Active compounds or compositions thereof can be tested for in vivo toxicity in animal models.
  • animal models, described herein and/or others known in the art, used to test the activities of active compounds can also be used to determine the in vivo toxicity of these compounds.
  • animals are administered a range of concentrations of active compounds. Subsequently, the animals are monitored over time for lethality, weight loss or failure to gain weight, and/or levels of serum markers that may be indicative of tissue damage (e.g. , creatine phosphokinase level as an indicator of general tissue damage, level of glutamic oxalic acid transaminase or pyruvic acid transaminase as indicators for possible liver damage).
  • tissue damage e.g. , creatine phosphokinase level as an indicator of general tissue damage, level of glutamic oxalic acid transaminase or pyruvic acid transaminase as indicators for possible liver damage.
  • These in vivo assays may also be
  • the toxicity and/or efficacy of an active compound can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g. , for determining the LD 5 o (the dose lethal to 50% of the population) and the ED 5 o (the dose therapeutically effective in 50% of the population).
  • the dose ratio between toxic and therapeutic effects is the therapeutic index and it can be expressed as the ratio LD50/ED50.
  • An active compound that exhibits large therapeutic indices is preferred. While an active compound that exhibits toxic side effects may be used, care should be taken to design a delivery system that targets such agents to the site of affected tissue in order to minim ize potential damage to uninfected cel ls and, thereby, reduce side effects.
  • the data obtained from the cell culture assays and animal studies can be used in formulating a range of dosage of an active compound for use in humans.
  • the dosage of such agents lies preferably within a range of circulating concentrations that include the ED50 with little or no toxicity.
  • the dosage may vary within this range depending upon the dosage form employed and the route of administration utilized.
  • the effective dose can be estimated initially from cel l culture assays.
  • a dose may be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (i. e. , the concentration of the test compound that achieves a half-maximal inhibition of symptoms) as determined in cell culture.
  • IC50 i. e. , the concentration of the test compound that achieves a half-maximal inhibition of symptoms
  • levels in plasma may be measured, for example, by high-performance liquid chromatography. Additional information concerning dosage determination is provided herein.
  • any assays known to those skilled in the art can be used to evaluate the prophylactic and/or therapeutic utility of the active compounds and compositions described herein, for example, by measuring viral infection or a condition or symptoms associated therewith.
  • the ability of a flu polypeptide to generate an immune response in a subject that is capable of cross-reacting with, and preferably protecting against, a plurality of influenza virus strains can be assessed using any approach known to those of skill in the art or described herein.
  • the ability of a flu polypeptide to generate an immune response in a subject that is capable of cross-reacting with, and preferably protecting against, a plurality of influenza virus strains can be assessed by immunizing a subject (e.g. , a mouse) or set of subjects with a flu polypeptide described herein and immunizing an additional subject (e.g. , a mouse) or set of subjects with a control (PBS).
  • the subjects or set of subjects can subsequently be challenged with a plurality of virulent influenza virus strains and the ability of the virulent influenza virus strains to cause influenza virus disease in the subjects or set of subjects can be determined.
  • Those skilled in the art wil l recognize that if the subject or set of subjects immunized with the control suffer from an influenza virus disease subsequent to challenge with the virulent influenza virus strains but the subject or set of subjects immunized with a flu polypeptide described herein do not suffer from influenza virus disease, then the flu polypeptide is able to generate an immune response in a subject that is capable of cross-reacting with a plurality of influenza virus strains.
  • a flu polypeptide described herein is able to generate an immune response that is capable of cross-reacting with a plural ity of influenza virus strains if the subject or set of subjects immunized with the flu polypeptide suffer from influenza virus disease for shorter periods of time, receive less hospitalization time, exhibit a reduction in/absence of one or more symptoms associated with influenza virus disease or have symptoms that manifest themselves for shorter periods of time compared to subjects immunized with control.
  • Methods for determining whether a subject suffers from influenza virus disease are known in the art and described herein. See, e.g. , Sections 5.1 3.7 and 6.3, infra.
  • the ability of a flu polypeptide to induce antiserum that simply cross-reacts with a plurality of influenza virus strains, or with multiple hemagglutinin subtypes can be tested by an immunoassay, such as an ELISA.
  • Active compounds and compositions thereof are preferably assayed in vivo for the desired therapeutic or prophylactic activity prior to use in humans.
  • in vivo assays can be used to determine whether it is preferable to administer an active compound or composition thereof and/or another therapy.
  • the composition can be administered before the animal is infected with influenza virus.
  • an active compound or composition thereof can be administered to the animal at the same time that the animal is infected with influenza virus.
  • the compound or composition may be administered after infecting the animal with influenza virus.
  • an active compound or composition thereof is administered to the animal more than one time.
  • Active compounds and compositions thereof can be tested for antiviral activity in animal model systems including, but are not limited to, rats, mice, chicken, cows, monkeys, pigs, goats, sheep, dogs, rabbits, guinea pigs, etc.
  • active compounds and compositions thereof are tested in a mouse model system.
  • Such model systems are widely used and well-known to the skilled artisan.
  • active compounds and compositions thereof are tested in a mouse model system.
  • Non-limiting examples of animal models for influenza virus are provided in this section.
  • animals are infected with influenza virus and concurrently or subsequently treated with an active compound or composition thereof, or placebo.
  • animals are treated with an active compound or composition thereof or placebo and subsequently infected with influenza virus.
  • Samples obtained from these animals e.g. , serum, urine, sputum, semen, saliva, plasma, or tissue sample
  • samples obtained from these animals can be tested for viral replication via well known methods in the art, e.g. , those that measure altered viral titers (as determined, e.g. , by plaque formation), the production of viral proteins (as determined, e.g. , by Western blot, ELISA, or flow cytometry analysis) or the production of viral nucleic acids (as determined, e.g. , by RT-PCR or northern blot analysis).
  • tissue samples are homogenized in phosphate- buffered saline (PBS), and dilutions of clarified homogenates are adsorbed for 1 hour at 37°C onto monolayers of cells (e.g. , Vero, CEF or MDC cel ls).
  • PBS phosphate- buffered saline
  • histopathologic evaluations are performed after infection, preferably evaluations of the organ(s) the virus is known to target for infection.
  • Virus immunohistochemistry can be performed using a viral-specific monoclonal antibody.
  • the effect of an active compound or composition thereof on the virulence of a virus can also be determined using in vivo assays in which the titer of the virus in an infected subject administered an active compound or composition thereof, the length of survival of an infected subject administered an active compound or composition thereof, the immune response in an infected subject administered an active compound or composition thereof, the number, duration and/or severity of the symptoms in an infected subject administered an active compound or composition thereof, and/or the time period before onset of one or more symptoms in an infected subject administered an active compound or composition thereof, is assessed. Techniques known to one of skill in the art can be used to measure such effects.
  • an active compound or composition thereof results in a 0.5 fold, 1 fold, 2 fold, 4 fold, 6 fold, 8 fold, 1 0 fold, 1 5 fold, 20 fold, 25 fold, 50 fold, 75 fold, 100 fold, 125 fold, 1 50 fold, 1 75 fold, 200 fold, 300 fold, 400 fold, 500 fold, 750 fold, or 1 ,000 fold or greater reduction in titer of influenza virus relative to an untreated subject.
  • an active compound or composition thereof results in a reduction in titer of influenza virus relative to an untreated subject of approximately 1 log or more, approximately 2 logs or more, approximately 3 logs or more, approximately 4 logs or more, approximately 5 logs or more, approximately 6 logs or more, approximately 7 logs or more, approximately 8 logs or more, approximately 9 logs or more, approximately 1 0 logs or more, 1 to 3 logs, 1 to 5 logs, 1 to 8 logs, 1 to 9 logs, 2 to 1 0 logs, 2 to 5 logs, 2 to 7 logs, 2 logs to 8 logs, 2 to 9 logs, 2 to 1 0 logs 3 to 5 logs, 3 to 7 logS j 3 to 8 logs, 3 to 9 logs, 4 to 6 logs, 4 to 8 logs, 4 to 9 logs, 5 to 6 logs, 5 to 7 logs, 5 to 8 logs, 5 to 9 logs, 6 to 7 logs, 6 to 8 logs, 6 to 9 logs, 7 to 8
  • Influenza virus animal models such as ferret, mouse, guinea pig, squirrel monkey, macaque, and chicken, developed for use to test antiviral agents against influenza virus have been described. See, e.g. , Sidwell et ai , Antiviral Res., 2000, 48: 1 - 1 6; Lowen A.C. et al. PNAS., 2006, 1 03 : 9988-92; and McCauley et ai , Antiviral Res., 1 995, 27: 1 79- 1 86 and Rimmelzwann el al , Avian Diseases, 2003, 47 :93 1 -933.
  • non-limiting examples of parameters that can be used to assay antiviral activity of active compounds administered to the influenza-infected mice include pneumonia-associated death, serum ct l -acid glycoprotein increase, animal weight, lung virus assayed by hemagglutinin, lung virus assayed by plaque assays, and histopathological change in the lung.
  • Statistical analysis is carried out to calculate significance (e.g., a P value of 0.05 or less).
  • histopathologic evaluations are performed after infection of an animal model subject.
  • Nasal turbinates and trachea may be examined for epithelial changes and subepithelial inflammation.
  • the lungs may be examined for bronchiolar epithelial changes and peribronchiolar inflammation in large, medium, and small or terminal bronch ioles.
  • the alveoli are also evaluated for inflammatory changes.
  • the medium bronch ioles are graded on a scale of 0 to 3+ as follows: 0 (normal : lined by medium to tal l columnar epithelial cells with ciliated apical borders and basal pseudostratified nuclei; minimal inflammation); 1 + (epithelial layer columnar and even in outline with only slightly increased prol iferation; cilia still visible on many cells); 2+ (prominent changes in the epithelial layer ranging from attenuation to marked
  • the trachea is graded on a scale of 0 to 2.5+ as follows: 0 (normal: Lined by medium to tall columnar epithel ial cells with ciliated apical border, nuclei basal and pseudostratified. Cytoplasm evident between apical border and nucleus. Occasional small focus with squamous cel ls); 1 + (focal squamous metaplasia of the epithel ial layer); 2+ (diffuse squamous metaplasia of much of the epithelial layer, cilia may be evident focally); 2.5+ (diffuse squamous metaplasia with very few cilia evident).
  • Virus immunohistochemistry is performed using a viral-specific monoclonal antibody (e.g. NP-, N- or HN-specific monoclonal antibodies). Staining is graded 0 to 3+ as follows: 0 (no infected cells); 0.5+ (few infected cells); 1 + (few infected cells, as widely separated individual cells); 1 .5+ (few infected cells, as widely separated singles and in small clusters); 2+ (moderate numbers of infected cells, usually affecting clusters of adjacent cells in portions of the epithelial layer lining bronchioles, or in small sublobular foci in alveoli); 3+ (numerous infected cells, affecting most of the epithelial layer in bronchioles, or widespread in large sublobular foci in alveoli).
  • a viral-specific monoclonal antibody e.g. NP-, N- or HN-specific monoclonal antibodies.
  • the ability to induce lung lesions and cause infection in an animal model of virus infection is compared using wild-type virus and mock virus.
  • Lung lesions can be assessed as a percentage of lung lobes that are healthy by visual inspection. Animals are euthanized 5 days p. i. by intravenous administration of pentobarbital, and their lungs are removed in toto. The percentage of the surface of each pulmonary lobe that is affected by macroscopic lesions is estimated visually. The percentages are averaged to obtain a mean value for the 7 pulmonary lobes of each animal.
  • nasal swabs can be tested to determine virus burden or titer. Nasal swabs can be taken during necropsy to determine viral burden post-infection.
  • virus is quantified in tissue samples.
  • tissue samples are homogenized in phosphate-buffered saline (PBS), and dilutions of clarified homogenates adsorbed for 1 h at 37°C onto monolayers of cel ls (e.g. , MDC cells).
  • Infected monolayers are then overlaid with a solution of minimal essential medium containing 0. 1 % bovine serum albumin (BSA), 0.01 % DEAE-dextran, 0.1 % NaHC0 3 , and 1 % agar. Plates are incubated 2 to 3 days until plaques could be visual ized.
  • BSA bovine serum albumin
  • DEAE-dextran 0.01 % DEAE-dextran
  • NaHC0 3 0.1 % NaHC0 3
  • Tissue culture infectious dose (TCI D) assays to titrate virus from PR8-infected samples are carried out as follows. Confluent monolayers of cells (e.g., MDCK cells) in 96-wel l plates are incubated with log di lutions of clarified tissue homogenates in media. Two to three days after inoculation, 0.05-ml aiiquots from each well are assessed for viral growth by hemagglutination assay (HA assay).
  • HA assay hemagglutination assay
  • an active compound or composition thereof is assessed in infected human subjects.
  • an active compound or composition thereof is administered to the human subject, and the effect of the active compound or composition on viral replication and/or survival is determined by, e.g. , analyzing the level of the virus or viral nucleic acids in a biological sample (e.g. , serum or plasma).
  • a biological sample e.g. , serum or plasma.
  • An active compound or composition thereof that alters virus repl ication and/or survival can be identified by comparing the level of virus replication and/or survival in a subject or group of subjects treated with a control to that in a subject or group of subjects treated with an active compound or composition thereof.
  • alterations in viral replication and/or survival can be identified by comparing the level of the virus replication and/or survival in a subject or group of subjects before and after the administration of an active compound or composition thereof. Techniques known to those of skill in the art can be used to obtain the biological sample and analyze the mRNA or protein expression.
  • the effect of an active compound or composition thereof on the severity of one or more symptoms associated with an influenza virus infection/disease are assessed in an infected subject.
  • an active compound or composition thereof or a control is admin istered to a human subject suffering from influenza virus infection and the effect of the active compound or composition on one or more symptoms of the virus infection is determined.
  • An active compound or composition thereof that reduces one or more symptoms can be identified by comparing the subjects treated with a control to the subjects treated with the active compound or composition.
  • an active compound or composition thereof is administered to a healthy human subject and monitored for efficacy as a vaccine (e.g. , the subject is monitored for the onset of symptoms of influenza virus infection; reduction in hospitalization, the abi lity of influenza virus to infect the subject; and/or a reduction in/absence of one or more symptoms and/or duration of symptoms associated with influenza virus infection).
  • Techniques known to physicians familiar with infectious diseases can be used to determine whether an active compound or composition thereof reduces one or more symptoms associated with the influenza virus disease.
  • a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions described herein, such as one or more active compounds provided herein.
  • a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions described herein, such as one or more active compounds provided herein.
  • Optionally ' associated with such container(s) can be a notice in the form prescribed by a
  • kits encompassed herein can be used in the above methods.
  • a kit comprises. an active compound described herein, preferably one or more influenza flu polypeptides, in one or more containers.
  • a kit comprises a vaccine described herein, e.g., a split virus vaccine, a subunit vaccine, an inactivated influenza virus vaccine, or a live influenza virus vaccine. 6.
  • Blots were produced by methods previously described (Towbin et al., Proc Natl Acad Sci U S A, 1 979. 76(9):4350-4). Samples were boiled for 5 minutes at 100°C in loading buffer containing SDS and 0.6M DTT. Immuno-precipitated complexes, cell lysates or purified virus were resolved in a 4-20% Tris-HCI SDS-PAGE gel (Bio-Rad, Inc.) and samples were blotted onto a Protran nitrocellulose membrane (Whatman). GFP and fusion G FP-HA truncated peptides were detected using rabbit anti-GFP (Santa Cruz Biotechnology, Inc) and/or mAb 12D 1 . Secondary antibodies were anti-rabbit IgG HRP (Dako) and anti-mouse Ig (GE Healtchare, Inc.).
  • 293T cells were transfected with various pCAGGs encoding the GFP- truncated HA2 fusion proteins using Lipofectam ine 2000 (Invitrogen, Inc). At 24 hours post transfection cells were lysed with radioimmuno-precipitation assay (RIPA) buffer and the truncated fusion peptides were immuno-precipitated with 1 to 5 ⁇ g of mAb 1 2D 1 bound to protein G-Agarose (Roche, Inc) overnight at 4°C. Immuno-precipitation was analyzed by Western blotting under reducing and denaturing conditions.
  • RIPA radioimmuno-precipitation assay
  • 96 well plates (Nunc Immulon 2) were coated with 2 ug/ml HApep- LH conjugate ( Figure 2B) or purified HA ( Figure 2A,C) in PBS overnight, 4°C. Plates were blocked for 30 minutes at room temperature with 1 %BSA/PBS and washed twice with PBS/.025%Tween. Antibodies or anti-serum were serially diluted in 1 %BSA/PBS, added to the plate followed by 3 hour incubation at 37°C. Plates were washed three times, anti-mouse-AP (Southern Biotech) di luted 1 :2000 was added to wells followed by 3 hour incubation, 37°C. P -nitrophenyl phosphate (PNPP) substrate was then added to wel ls and allowed to develop for 20-30 minutes at room temperature. Optical density measurements were taken at 405nm.
  • PNPP -nitrophenyl phosphate
  • mAb 1 2D 1 reacts within the region of amino acids 76- 1 30 of the HA2 molecule; th is region comprises the "long alpha-helix" of HA2.
  • mAb 1 2D 1 is known to have protective activity in vivo against H3 virus infection (demonstrated by passive transfer of mAb 1 2D 1 prior to virus challenge)
  • mAb 1 2D 1 mediates protection against influenza disease in vivo and reacts with a continuous epitope of the viral hemagglutinin (no trimeric structure required), as evidenced by reactivity with the denatured hemagglutinin monomer by Western blot, the 1 2D 1 binding epitope was focused on. Truncated hemagglutinin constructs consisting of hemagglutinin segments of varying length fused to GFP were generated. GFP expression was uti lized to assess expression of the constructs in transfected 293T cells.
  • flu polypeptide (76- 1 30)- LH acts as a robust immunogen and serum antibody elicited by HApep-KLH reacts with multiple hemagglutinin subtypes.
  • mice were boosted with 25ug HApep-KLH or KLH alone in Incomplete Freund's adjuvant.
  • mice were challenged with virus. Before virus infection, mice were anesthetized by intraperitoneal administration of a ketamine (75 mg/kg of body weighf)/xylazine ( 1 5 mg/kg of body weight) mixture.
  • Virus was administered intranasally in 50ug total PBS; challenge doses consisted of 40,000pfu X3 1 or 500pfu PR8. Body weights were monitored daily.
  • H I mouse adapted PR/8 virus
  • Serum antibody titer against H I subtype hemagglutinin was found to correlate with weight change in the days following virus challenge (4B).
  • Viruses used were: X3 1 virus (A/Hong Kong/1 /1968 hemagglutinin and neuraminidase with remaining 6 segments from PR8), A/Puerto Rico/8/34 (PR8) virus, A/USSR/90/1 977 virus, A/Georgia/81 virus, HAIo virus (A/Viet Nam/4/2005 virus with hemagglutinin modified to remove the poly-basic cleavage site).
  • Purified hemagglutinin used were from: A/Hong Kong/1 /1968; A/Brisbane/10/2007; A/Viet Nam/1203/2004 (H5); A/Singapore/ 1 /57 (H2); A/Teal/HK/3 1 2/97 (H6); A/Netherlands/219/2003 (H7); A/HK/1 073/99 (H9); and A/California/04/2009 (H I ).
  • GFP and fusion GFP-HA truncated peptides were detected using rabbit anti- GFP (Santa Cruz Biotechnology, I nc) and/or mAb 12D1 . Secondary antibodies were anti-rabbit lgG HRP (Dako) and anti-mouse Ig-HRP(GE Healtchare, Inc.).
  • the 76- 1 30 (LAH) region of the A/HK/1 /68 HA2 was generated by PCR ampl ification of viral RNA and sub-cloned into a pCAGG-green fluorescent protein (GFP) plasm id (see Basler et al., (2001 ) Proc Natl Acad Sci U S A 98(5):2746-275 1 ). GFP was present at the N-terminus of the HA2 truncation. 293T cells were transfected with the GFP-LAH construct using Lipofectamine 2000 (Invitrogen, Inc).
  • GFP pCAGG-green fluorescent protein
  • the construct was acetylated at the N-terminus and consisted of am ino acids 76- 1 30 of the H3 A/Hong Kong/1 /1 968 HA2 molecule followed by a FLAG- tag (DYKDDDDK), followed by a cysteine.
  • the polypeptide was coupled to the carrier protein keyhole limpet hemocyanin ( LH) by thiol to primary amine coupling. This conjugate was produced by CHI Scientific, Inc., Maynard, MA USA.
  • 96-well plates (Nunc Immulon 2) were coated with 2 ⁇ g/ml LAH-KLH conjugate (Fig 7B), purified hemagglutinin (Fig 7A, C), or influenza virus vaccine (FLU VI RON (R), obtained from BEI Resources) purified surface antigen (Novartis Vaccines) in PBS overnight, 4°C. Plates were blocked for 30 minutes at room temperature with 1 % BSA/PBS and washed twice with PBS/.025% Tween.
  • Antibodies, anti-serum or serum from individuals vaccinated with the 2008-2009 trivalent inactivated influenza virus vaccine (TIV) were serially diluted in 1 % BSA PBS and added to the plate followed by a 3 hour incubation at 37°C.
  • An anti-flag antibody (Sigma) was used as a positive control in wells coated with the LAH-KLH conjugate. Plates were washed three times, and anti-mouse-alkal ine phosphatase (AP) (Southern Biotech) diluted 1 :2000 was added to wel ls followed by a 3 hour incubation at 37°C.
  • anti-human IgG (Fc specific)-AP (Sigma) antibody was used at 1 :500 dilution.
  • Anti-rabbit Ig-AP (Southern Biotech) at 1 :500 dilution was used as the secondary for the anti-flag antibody.
  • P-nitrophenyl phosphate (PN PP) substrate was then added to wells and allowed to develop for 20-30 minutes at room temperature. Optical density measurements were taken at 405nm.
  • mice (Jackson Laboratories) were immunized with 25 ⁇ g LAH-KLH, HA2, KLH alone or PBS in Complete Freund's adjuvant (Sigma) by subcutaneous administration.
  • mice Three weeks fol lowing primary immunization, mice were boosted with 25 of the same immunogen or PBS in Incomplete Freund's adjuvant.
  • mice Two to three weeks following boost, mice were challenged with virus. Before virus infection, mice were anesthetized by intraperitoneal administration of a ketamine (75 mg/kg of body weight)/xylazine ( 1 5 mg/kg of body weight) mixture.
  • Virus was administered intranasally in 50 ⁇ total PBS; challenge doses consisted of 4 x 10 5 pfu X31 or 500 pfu PR8 or HAlo virus. Body weights were monitored daily. For passive transfer experiments, mice were bled two weeks following the last immunization with LH or LAH-KLH or three weeks following infection with PR8 virus or A/Hong Kong/1 /1 968 virus. Sera from mice were pooled according to vaccination antigen or virus infection and 200 ⁇ serum was transferred to each recipient mouse by
  • Mouse monoclonal antibody 12D 1 binds a continuous portion of the HA2 molecule and has broad-neutralizing activity against influenza viruses of the H3 subtype.
  • mAb 1 2D 1 binds amino acids within the highly conserved ' long alpha- helix' (LAH) region of the protein.
  • LAH alpha- helix'
  • LAH 76- 1 30 polypeptide
  • FLAG-tag a C-terminal spacer domain of eight amino ac ids
  • LH carrier protein keyhole limpet hemocyanin
  • the LAH peptide was acetylated at the N-terminus (see Werle and Bernkop-Schnurch, (2006) Amino Acids 30(4):35 1 -367).
  • the structural integrity of the mAb 1 2D 1 binding region within the conjugate was confirmed by direct-binding EL1SA ( Figure7C).
  • mice were immunized with the LAH-KLH conjugate in a prime-boost schedule with three weeks lapsing between immunizations. Sera were taken from mice 1 0 days post primary and secondary immunizations.
  • anti-sera were tested for reactivity with purified hemagglutinin protein of different subtypes. It was first noted that the LAH anti-serum reacted with hemagglutinin protein by both ELI SA and by Western blot ( Figure 8A-C).
  • hemagglutinins from these subtypes demonstrates a high degree of conservation in amino-acid sequence and amino-acid type (Figure 8E).
  • mice Two to three weeks following secondary immunization, mice were challenged by intranasal administration with 4 x 10 5 pfu of X3 1 , a mouse adapted virus expressing the hemagglutinin and neuraminidase of the 1968 pandemic H3 influenza virus.
  • Mice immunized with the LAH-KLH construct lost significantly less weight at all time points than did mice that received PBS with adjuvant.
  • all immunized mice survived challenge, while control mice succumbed to infection by day 4 ( Figure 9A and 9B).
  • M ice were infected with 500 pfu ( 10- 1 5 mLD50) of PR8, a mouse-adapted H I virus or with 500 pfu of an H5 highly-pathogenic avian influenza virus modified to remove the poly-basic cleavage site in the viral hemagglutinin (see Steel et al., (2009) J Virol 83(4): 1 742- 1 753).
  • Vaccination with the LAH-KLH conjugate was protective against weight loss caused by H I and H5 influenza disease to a highly significant degree on virtually every day during infection.
  • Vaccinated mice infected with PR8 showed a significant delay in kinetics of weight loss, while 60% of vaccinated mice infected with the H5 avian virus survived lethal challenge to ten days post infection (Figure 9C-F).
  • the ectodomain of the A/Hong Kong/1 /1968 HA2 protein was recombinantly expressed as previously described (see Chen et al., ( 1999) Proc Natl Acad Sci U S A 96( 1 6):8967-8972). M ice were vaccinated with pure, uncoupled, HA2 protein by the same methods used to vaccinate mice with LAH-KLH. Pooled antisera from 20 mice taken ten days post secondary vaccination with either LAH-KLH or HA2 protein was evaluated for binding activity against a panel of recombinantly expressed hemagglutinins.
  • the HA2 antiserum contained antibody reactive with Group 2 hemagglutinin proteins only ( Figure 1 1 A-H and Table 1 ). Since the LAH structure is present in the HA2 protein, the broad reactivity seen in the LAH-KLH antiserum must be a
  • the induction of broadly- reactive antibody may be a consequence of anchoring the LAH at the C-terminus to a carrier protein, thus rendering regions of the LAH immunogenic that are otherwise antigenically si lent in the context of the intact HA2 protein.
  • This LAH core polypeptide linked to KLH has protective activity against antigenically divergent influenza virus subtypes that currently cause seasonal and pandemic disease in humans. Additionally, the LAH core polypeptide linked to KLH has protective activity against an avian H5 1 virus, a subtype with potential to cause pandemic influenza disease in humans. Thus, the LAH core polypeptide linked to KLH represents a peptide-based influenza virus vaccine that would be inexpens

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Communicable Diseases (AREA)
  • Pulmonology (AREA)
  • Epidemiology (AREA)
  • Immunology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Oncology (AREA)
  • Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
PCT/US2011/025467 2010-02-18 2011-02-18 Vaccines for use in the prophylaxis and treatment of influenza virus disease Ceased WO2011103453A2 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
CA2790380A CA2790380A1 (en) 2010-02-18 2011-02-18 Vaccines for use in the prophylaxis and treatment of influenza virus disease
AU2011217903A AU2011217903B2 (en) 2010-02-18 2011-02-18 Vaccines for use in the prophylaxis and treatment of influenza virus disease
BR112012020839A BR112012020839A2 (pt) 2010-02-18 2011-02-18 vacinas para uso na profilaxe e tratamento de doença de vírus da influenza
US13/579,845 US9701723B2 (en) 2010-02-18 2011-02-18 Vaccines for use in the prophylaxis and treatment of influenza virus disease
MX2012009581A MX342716B (es) 2010-02-18 2011-02-18 Vacunas para su uso en la profilaxis y tratamiento de la enfermedad del virus de influenza.
JP2012554060A JP2013520172A (ja) 2010-02-18 2011-02-18 インフルエンザウイルス疾患の予防及び治療で用いるためのワクチン
EP11745345.6A EP2536425B1 (en) 2010-02-18 2011-02-18 Vaccines for use in the prophylaxis and treatment of influenza virus disease
KR1020127024205A KR20120132506A (ko) 2010-02-18 2011-02-18 인플루엔자 바이러스 질환의 예방 및 치료에 사용되는 백신
CN201180019658.1A CN102939096B (zh) 2010-02-18 2011-02-18 用于预防和治疗流感病毒疾病的疫苗

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
US30589810P 2010-02-18 2010-02-18
US61/305,898 2010-02-18
US12/788,103 US8673314B2 (en) 2009-05-26 2010-05-26 Monoclonal antibodies against influenza virus generated by cyclical administration and uses thereof
US12/788,103 2010-05-26
US35416010P 2010-06-11 2010-06-11
US61/354,160 2010-06-11
US38508310P 2010-09-21 2010-09-21
US61/385,083 2010-09-21

Publications (2)

Publication Number Publication Date
WO2011103453A2 true WO2011103453A2 (en) 2011-08-25
WO2011103453A3 WO2011103453A3 (en) 2011-12-29

Family

ID=44483593

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2011/025467 Ceased WO2011103453A2 (en) 2010-02-18 2011-02-18 Vaccines for use in the prophylaxis and treatment of influenza virus disease

Country Status (10)

Country Link
US (1) US9701723B2 (https=)
EP (1) EP2536425B1 (https=)
JP (3) JP2013520172A (https=)
KR (1) KR20120132506A (https=)
CN (1) CN102939096B (https=)
AU (1) AU2011217903B2 (https=)
BR (1) BR112012020839A2 (https=)
CA (1) CA2790380A1 (https=)
MX (1) MX342716B (https=)
WO (1) WO2011103453A2 (https=)

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9175069B2 (en) 2009-05-26 2015-11-03 Icahn School Of Medicine At Mount Sinai Monoclonal antibodies against influenza virus generated by cyclical administration and uses thereof
US9371366B2 (en) 2012-12-18 2016-06-21 Icahn School Of Medicine At Mount Sinai Influenza virus vaccines and uses thereof
US9701723B2 (en) 2010-02-18 2017-07-11 Icahn School Of Medicine At Mount Sinai Vaccines for use in the prophylaxis and treatment of influenza virus disease
US9708373B2 (en) 2010-03-30 2017-07-18 Icahn School Of Medicine At Mount Sinai Influenza virus vaccine and uses thereof
US9849172B2 (en) 2009-03-30 2017-12-26 Icahn School Of Medicine At Mount Sinai Influenza virus vaccines and uses thereof
US9908930B2 (en) 2013-03-14 2018-03-06 Icahn School Of Medicine At Mount Sinai Antibodies against influenza virus hemagglutinin and uses thereof
US10131695B2 (en) 2011-09-20 2018-11-20 Icahn School Of Medicine At Mount Sinai Influenza virus vaccines and uses thereof
CN108840911A (zh) * 2018-06-09 2018-11-20 西北农林科技大学 新城疫病毒基质蛋白的抗原表位、抗体、鉴定方法和应用
US10736956B2 (en) 2015-01-23 2020-08-11 Icahn School Of Medicine At Mount Sinai Influenza virus vaccination regimens
US11254733B2 (en) 2017-04-07 2022-02-22 Icahn School Of Medicine At Mount Sinai Anti-influenza B virus neuraminidase antibodies and uses thereof
US11266734B2 (en) 2016-06-15 2022-03-08 Icahn School Of Medicine At Mount Sinai Influenza virus hemagglutinin proteins and uses thereof
US12364746B2 (en) 2018-06-21 2025-07-22 Icahn School Of Medicine At Mount Sinai Mosaic influenza virus hemagglutinin polypeptides and uses thereof
WO2025106608A3 (en) * 2023-11-15 2025-08-14 Red Queen Therapeutics, Inc. Antiviral structurally stapled influenza peptides and uses thereof
US12545718B2 (en) 2019-04-24 2026-02-10 Icahn School Of Medicine At Mount Sinai Anti-influenza B virus neuraminidase antibodies and uses thereof

Families Citing this family (21)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9616114B1 (en) 2014-09-18 2017-04-11 David Gordon Bermudes Modified bacteria having improved pharmacokinetics and tumor colonization enhancing antitumor activity
US10676723B2 (en) 2015-05-11 2020-06-09 David Gordon Bermudes Chimeric protein toxins for expression by therapeutic bacteria
KR101768600B1 (ko) * 2015-05-18 2017-08-17 한국생명공학연구원 범용성 개 인플루엔자 바이러스 백신 조성물
JP6868763B2 (ja) * 2016-04-01 2021-05-12 パナソニックIpマネジメント株式会社 インフルエンザウィルスに結合する抗体
US10478488B2 (en) 2017-10-03 2019-11-19 Southwest Research Institute Liposomal flu vaccine formulation
US11129906B1 (en) 2016-12-07 2021-09-28 David Gordon Bermudes Chimeric protein toxins for expression by therapeutic bacteria
US11180535B1 (en) 2016-12-07 2021-11-23 David Gordon Bermudes Saccharide binding, tumor penetration, and cytotoxic antitumor chimeric peptides from therapeutic bacteria
ES2991988T3 (es) 2017-10-30 2024-12-05 Takeda Pharmaceuticals Co Detergentes compatibles con el medio ambiente para la inactivación de virus con envoltura lipídica
RU2757013C2 (ru) * 2017-12-19 2021-10-08 Федеральное государственное бюджетное учреждение "Научно-исследовательский институт гриппа имени А.А. Смородинцева" Министерства здравоохранения Российской Федерации Рекомбинантная противогриппозная вакцина с широким спектром защиты и способ ее получения
CN108287235B (zh) * 2018-02-07 2021-03-09 常州天地人和生物科技有限公司 一种高效、稳定的磁性免疫微球的制备和应用
CN108329379B (zh) * 2018-04-08 2022-01-28 诺华生物科技(武汉)有限责任公司 H7亚型流感病毒h7n9的普通型/嵌合型病毒样颗粒及制备方法、应用和疫苗
CA3107409A1 (en) 2018-07-23 2020-01-30 Japan As Represented By Director General Of National Institute Of Infectious Diseases Composition containing influenza vaccine
CN109097341B (zh) * 2018-08-28 2021-09-24 青岛农业大学 一种同时表达ha和hef的复制缺陷型重组流感病毒
CN111363017B (zh) * 2018-12-25 2022-03-15 中国科学院微生物研究所 A型流感病毒核蛋白s69位突变序列及其突变体与应用
EA202192398A1 (ru) 2019-03-04 2021-11-23 Джэпэн Эз Репризентид Баи Директор Дженерал Оф Нэшнл Инститьют Оф Инфекшес Дизизис Способ приготовления сплит-вакцины против гриппа на основе гемагглютинина
TWI857017B (zh) * 2019-03-04 2024-10-01 國立感染症研究所長代表之日本國 流感ha裂解疫苗之製造方法
CN111134250A (zh) * 2019-12-03 2020-05-12 海南大学 一种草地贪夜蛾幼虫食用人工饲料的配方和制作方法
CN111298098B (zh) * 2020-02-25 2021-10-29 中国科学院微生物研究所 卡泊芬净在制备抑制冠状病毒的产品中的应用
WO2021188787A1 (en) * 2020-03-19 2021-09-23 Renibus Therapeutics, Inc. Method for treatment of coronavirus infection
CN117229370B (zh) * 2022-06-08 2024-11-01 中科南京生命健康高等研究院 H5n6禽流感广谱性疫苗的开发及其应用
WO2024097396A1 (en) * 2022-11-05 2024-05-10 Us Biologic, Inc. Visco-elastic solid formulation for oral delivery of a biologically active agent

Family Cites Families (87)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
ZA836080B (en) * 1982-08-23 1984-04-25 Scripps Clinic Res Broad spectrum influenza antisera
US5182192A (en) 1987-03-27 1993-01-26 The Wistar Institute Monoclonal antibodies against glycolipid antigens, methods of producing these antibodies, and use therefor
US5854037A (en) 1989-08-28 1998-12-29 The Mount Sinai School Of Medicine Of The City University Of New York Recombinant negative strand RNA virus expression systems and vaccines
US6001634A (en) 1989-08-28 1999-12-14 Palese; Peter Recombinant negative strand RNA viruses
WO1996033735A1 (en) 1995-04-27 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US6887699B1 (en) 1990-05-22 2005-05-03 Medimmune Vaccines, Inc. Recombinant negative strand RNA virus expression systems and vaccines
GB9015198D0 (en) 1990-07-10 1990-08-29 Brien Caroline J O Binding substance
FR2664905B1 (fr) 1990-07-18 1994-08-12 Agronomique Inst Nat Rech Baculovirus modifie, son procede d'obtention, et vecteurs d'expression obtenus a partir dudit baculovirus.
US5625126A (en) 1990-08-29 1997-04-29 Genpharm International, Inc. Transgenic non-human animals for producing heterologous antibodies
ATE158021T1 (de) 1990-08-29 1997-09-15 Genpharm Int Produktion und nützung nicht-menschliche transgentiere zur produktion heterologe antikörper
US5661016A (en) 1990-08-29 1997-08-26 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US5633425A (en) 1990-08-29 1997-05-27 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
PT1024191E (pt) 1991-12-02 2008-12-22 Medical Res Council Produção de auto-anticorpos a partir de reportórios de segmentos de anticorpo e exibidos em fagos
JP3037554B2 (ja) 1993-04-20 2000-04-24 寳酒造株式会社 免疫原性人工ポリペプチド
EP0621339B1 (en) 1992-09-17 2001-10-24 Takara Shuzo Co. Ltd. Immunogenic human influenza A virus haemagglutinin polypeptides
US5589174A (en) 1992-09-17 1996-12-31 Takara Shuzo Co., Ltd. Anti-human influenza virus antibody
US6337070B1 (en) 1993-04-29 2002-01-08 Takara Shuzo Co., Ltd. Polypeptides for use in generating anti-human influenza virus antibodies
GB9221654D0 (en) 1992-10-15 1992-11-25 Scotgen Ltd Recombinant human anti-cytomegalovirus antibodies
WO1994016109A1 (en) * 1993-01-15 1994-07-21 Whitehead Institute For Biomedical Research Membrane fusion events and means for altering same
WO1994017826A1 (en) * 1993-02-01 1994-08-18 Smithkline Beecham Corporation Vaccinal polypeptides
US5573916A (en) * 1994-05-19 1996-11-12 Coretech, Inc. Immunogenic constructs comprising b-cell and t-cell epitopes on common carrier
US5622701A (en) 1994-06-14 1997-04-22 Protein Design Labs, Inc. Cross-reacting monoclonal antibodies specific for E- and P-selectin
WO1996034096A1 (en) 1995-04-28 1996-10-31 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5916771A (en) 1996-10-11 1999-06-29 Abgenix, Inc. Production of a multimeric protein by cell fusion method
CA2722378C (en) 1996-12-03 2015-02-03 Amgen Fremont Inc. Human antibodies that bind tnf.alpha.
US6165476A (en) * 1997-07-10 2000-12-26 Beth Israel Deaconess Medical Center Fusion proteins with an immunoglobulin hinge region linker
JP2003528571A (ja) 1999-04-29 2003-09-30 シンジェンタ リミテッド 除草剤抵抗性植物
PL355287A1 (en) * 1999-09-24 2004-04-05 Smithkline Beecham Biologicals S.A. Intranasal influenza virus vaccine
US7521220B2 (en) 1999-11-26 2009-04-21 Crucell Holland B.V. Production of vaccines
ES2319864T3 (es) * 2000-04-28 2009-05-14 St. Jude Children's Research Hospital Sistema de transfeccion de adn para la generacion de virus infecciosos de arn de cadena negativa.
US6632620B1 (en) 2000-06-22 2003-10-14 Andrew N. Makarovskiy Compositions for identification and isolation of stem cells
KR101113432B1 (ko) 2002-02-13 2012-02-29 위스콘신 얼럼나이 리서어치 화운데이션 인플루엔자 바이러스 벡터의 패키징을 위한 신호
US20040091503A1 (en) 2002-08-20 2004-05-13 Genitrix, Llc Lectin compositions and methods for modulating an immune response to an antigen
WO2004067553A2 (en) 2003-01-29 2004-08-12 The Research Foundation Of The State University Of New York Tolerance-induced targeted antibody production
CA2514667C (en) * 2003-01-30 2013-01-08 Chiron Corporation Adjuvanted influenza vaccine
JP4368594B2 (ja) 2003-02-24 2009-11-18 株式会社インシリコサイエンス タンパク質構造予測装置、タンパク質構造予測方法、プログラム、および、記録媒体
KR20060035596A (ko) 2003-05-05 2006-04-26 보이스 톰슨 인스터튜트 포 플랜트 리서치 외래유전자도입 식물로부터 유래된 면역보호성 조성물을제조하기 위한 벡터와 세포
US8592197B2 (en) 2003-07-11 2013-11-26 Novavax, Inc. Functional influenza virus-like particles (VLPs)
ES2372633T3 (es) * 2003-11-04 2012-01-25 The Administrators Of The Tulane Educational Fund Procedimiento de evitar condensación de virus: células inhibiendo la función de la región de iniciación de condensación en los virus arn que tienen proteínas de envoltura fusogénicas de membrana de clase i.
JP4980895B2 (ja) * 2004-05-25 2012-07-18 メディミューン,エルエルシー インフルエンザ赤血球凝集素およびノイラミニダーゼ変異体
US8420102B2 (en) 2006-03-07 2013-04-16 Vaxinnate Corporation Compositions that include hemagglutinin
US7566454B2 (en) * 2005-02-24 2009-07-28 University Of Massachusetts Influenza nucleic acids, polypeptides, and uses thereof
EP1885186B1 (en) 2005-06-01 2015-09-02 California Institute Of Technology Method of targeted gene delivery using viral vectors
JP4758148B2 (ja) 2005-06-14 2011-08-24 泰三 宇田 インフルエンザウイルスのヘマグルチニンに対する抗体酵素
NZ568211A (en) * 2005-11-04 2011-11-25 Novartis Vaccines & Diagnostic Influenza vaccines including combinations of particulate adjuvants and immunopotentiators
PL2251034T3 (pl) 2005-12-02 2018-07-31 Icahn School Of Medicine At Mount Sinai Chimeryczne wirusy prezentujące nienatywne białka powierzchniowe i zastosowania tych wirusów
PT1968632E (pt) * 2005-12-06 2012-07-16 Yeda Res & Dev Vacina da gripe melhorada
US10183986B2 (en) * 2005-12-15 2019-01-22 Industrial Technology Research Institute Trimeric collagen scaffold antibodies
WO2007134327A2 (en) 2006-05-15 2007-11-22 Sea Lane Biotechnologies, Llc. Neutralizing antibodies to influenza viruses
US8148085B2 (en) 2006-05-15 2012-04-03 Sea Lane Biotechnologies, Llc Donor specific antibody libraries
WO2008054540A2 (en) * 2006-05-18 2008-05-08 Pharmexa Inc. Inducing immune responses to influenza virus using polypeptide and nucleic acid compositions
US20100143406A1 (en) 2006-06-30 2010-06-10 Gale Smith Methods of enhancing protein incorporation into virus like particles
US8329162B2 (en) 2006-07-21 2012-12-11 California Institute Of Technology Targeted gene delivery for dendritic cell vaccination
EP2450377A1 (en) 2006-09-07 2012-05-09 Crucell Holland B.V. Human binding molecules capable of neutralizing influenza virus H5N1 and uses thereof
EP4585610A3 (en) 2006-09-11 2025-09-24 Seqirus UK Limited Making influenza virus vaccines without using eggs
WO2008154813A1 (fr) * 2007-06-15 2008-12-24 Xiamen University Anticorps monoclonaux se liant à l'hémagglutinine du virus de la grippe aviaire du sous type h5 et ses utilisations
EP2014279A1 (en) * 2007-06-22 2009-01-14 Pevion Biotech AG Virosomes comprising hemagglutinin derived from an influenza virus produced in a cell line, compositions, methods of manufacturing, use thereof
CA2615372A1 (en) 2007-07-13 2009-01-13 Marc-Andre D'aoust Influenza virus-like particles (vlps) comprising hemagglutinin
WO2009076778A1 (en) 2007-11-27 2009-06-25 Medicago Inc. Recombinant influenza virus-like particles (vlps) produced in transgenic plants expressing hemagglutinin
US20090092635A1 (en) 2007-08-17 2009-04-09 Wyeth Heterologous prime-boost immunization regimen
US9421254B2 (en) * 2007-09-24 2016-08-23 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Immunostimulatory combinations of TLR ligands and methods of use
FR2921387B1 (fr) 2007-09-26 2012-04-20 Sanofi Pasteur Procede de production du virus de la grippe
GB0810305D0 (en) 2008-06-05 2008-07-09 Novartis Ag Influenza vaccination
RU2010127156A (ru) 2007-12-06 2012-01-20 Дана-Фарбер Кэнсер Инститьют, Инк. (Us) Антитела против вируса гриппа и их применение
ITTO20080204A1 (it) 2008-03-17 2009-09-18 Pomona Biotechnologies Llc Anticorpi monoclonali atti a reagire con una pluralita di sottotipi del virus influenzale a
JP2011516423A (ja) 2008-03-28 2011-05-26 シー レーン バイオテクノロジーズ, エルエルシー ウイルス抗原に対する中和分子
GB0905570D0 (en) 2009-03-31 2009-05-13 Novartis Ag Combined vaccines
WO2010003766A2 (en) * 2008-06-17 2010-01-14 Apogenix Gmbh Multimeric tnf receptors
BRPI0914691A2 (pt) 2008-06-25 2015-10-20 Inserm Inst Nat De La Santé Et De La Rech Médicale composto imunoadjuvante, composição, uso de um composto imunoadjuvante, ácido nucléico, vetor recombinante, e, célula hospedeira
AU2009267769B2 (en) 2008-07-08 2015-07-16 Medicago Inc. Soluble recombinant influenza antigens
WO2010117786A1 (en) 2009-03-30 2010-10-14 Mount Sinai School Of Medicine Of New York University Influenza virus vaccines and uses thereof
CA2761648C (en) 2009-05-11 2019-03-12 Crucell Holland B.V. Human binding molecules capable of neutralizing influenza virus h3n2 and uses thereof
US8673314B2 (en) * 2009-05-26 2014-03-18 Mount Sinai School Of Medicine Monoclonal antibodies against influenza virus generated by cyclical administration and uses thereof
HUE039100T2 (hu) 2009-06-24 2018-12-28 Medicago Inc Hemagglutinint tartalmazó kimer influenzavírus-jellegû részecskék
US8828406B2 (en) * 2009-07-30 2014-09-09 Icahn School Of Medicine At Mount Sinai Influenza viruses and uses thereof
JP5463107B2 (ja) 2009-09-14 2014-04-09 独立行政法人国立国際医療研究センター 新型インフルエンザを特異的に鑑別するモノクローナル抗体とそれを利用した免疫検出試薬
JP2013060367A (ja) 2010-01-15 2013-04-04 Osaka Univ 抗インフルエンザ抗体及びインフルエンザ検出用デバイス
US8298820B2 (en) * 2010-01-26 2012-10-30 The Trustees Of The University Of Pennsylvania Influenza nucleic acid molecules and vaccines made therefrom
EP2536425B1 (en) 2010-02-18 2019-06-19 Icahn School of Medicine at Mount Sinai Vaccines for use in the prophylaxis and treatment of influenza virus disease
EP3098236A1 (en) 2010-03-08 2016-11-30 Celltrion, Inc. Human monoclonal antibodies derived from human b cells and having neutralizing activity against influenza a viruses
CN102939103A (zh) 2010-03-30 2013-02-20 西奈山医学院 流感病毒疫苗及其应用
WO2012009790A1 (en) 2010-07-22 2012-01-26 Schrader John W Cross-protective pathogen protection, methods and compositions thereof
EP4241785B1 (en) 2011-09-20 2026-01-28 Icahn School of Medicine at Mount Sinai Influenza virus vaccines and uses thereof
EP3566714A1 (en) 2011-11-28 2019-11-13 Janssen Vaccines & Prevention B.V. Influenza virus vaccines and uses thereof
EP2931747B1 (en) 2012-12-11 2020-06-10 Vib Vzw Anti-influenza antibody
SG11201504728RA (en) 2012-12-18 2015-07-30 Icahn School Med Mount Sinai Influenza virus vaccines and uses thereof

Non-Patent Citations (3)

* Cited by examiner, † Cited by third party
Title
BASLER ET AL., PROC NATL ACAD SCI U S A, vol. 98, no. 5, 2001, pages 2746 - 2751
See also references of EP2536425A4
TOWBIN ET AL., PROC NATL ACAD SCI U S A, vol. 76, no. 9, 1979, pages 4350 - 4354

Cited By (23)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9849172B2 (en) 2009-03-30 2017-12-26 Icahn School Of Medicine At Mount Sinai Influenza virus vaccines and uses thereof
US9175069B2 (en) 2009-05-26 2015-11-03 Icahn School Of Medicine At Mount Sinai Monoclonal antibodies against influenza virus generated by cyclical administration and uses thereof
US9701723B2 (en) 2010-02-18 2017-07-11 Icahn School Of Medicine At Mount Sinai Vaccines for use in the prophylaxis and treatment of influenza virus disease
US10179806B2 (en) 2010-03-30 2019-01-15 Icahn School Of Medicine At Mount Sinai Influenza virus vaccines and uses thereof
US9708373B2 (en) 2010-03-30 2017-07-18 Icahn School Of Medicine At Mount Sinai Influenza virus vaccine and uses thereof
US10131695B2 (en) 2011-09-20 2018-11-20 Icahn School Of Medicine At Mount Sinai Influenza virus vaccines and uses thereof
US9371366B2 (en) 2012-12-18 2016-06-21 Icahn School Of Medicine At Mount Sinai Influenza virus vaccines and uses thereof
US9968670B2 (en) 2012-12-18 2018-05-15 Icahn School Of Medicine At Mount Sinai Influenza virus vaccines and uses thereof
US10583188B2 (en) 2012-12-18 2020-03-10 Icahn School Of Medicine At Mount Sinai Influenza virus vaccines and uses thereof
US10137189B2 (en) 2012-12-18 2018-11-27 Icahn School Of Medicine At Mount Sinai Influenza virus vaccines and uses thereof
US9908930B2 (en) 2013-03-14 2018-03-06 Icahn School Of Medicine At Mount Sinai Antibodies against influenza virus hemagglutinin and uses thereof
US10544207B2 (en) 2013-03-14 2020-01-28 Icahn School Of Medicine At Mount Sinai Antibodies against influenza virus hemagglutinin and uses thereof
US10736956B2 (en) 2015-01-23 2020-08-11 Icahn School Of Medicine At Mount Sinai Influenza virus vaccination regimens
US11266734B2 (en) 2016-06-15 2022-03-08 Icahn School Of Medicine At Mount Sinai Influenza virus hemagglutinin proteins and uses thereof
US11865173B2 (en) 2016-06-15 2024-01-09 Icahn School Of Medicine At Mount Sinai Influenza virus hemagglutinin proteins and uses thereof
US12233123B2 (en) 2016-06-15 2025-02-25 Icahn School Of Medicine At Mount Sinai Influenza virus hemagglutinin proteins and uses thereof
US11254733B2 (en) 2017-04-07 2022-02-22 Icahn School Of Medicine At Mount Sinai Anti-influenza B virus neuraminidase antibodies and uses thereof
US12030928B2 (en) 2017-04-07 2024-07-09 Icahn School Of Medicine At Mount Sinai Anti-influenza B virus neuraminidase antibodies and uses thereof
CN108840911A (zh) * 2018-06-09 2018-11-20 西北农林科技大学 新城疫病毒基质蛋白的抗原表位、抗体、鉴定方法和应用
CN108840911B (zh) * 2018-06-09 2021-03-30 西北农林科技大学 新城疫病毒基质蛋白的抗原表位、抗体、鉴定方法和应用
US12364746B2 (en) 2018-06-21 2025-07-22 Icahn School Of Medicine At Mount Sinai Mosaic influenza virus hemagglutinin polypeptides and uses thereof
US12545718B2 (en) 2019-04-24 2026-02-10 Icahn School Of Medicine At Mount Sinai Anti-influenza B virus neuraminidase antibodies and uses thereof
WO2025106608A3 (en) * 2023-11-15 2025-08-14 Red Queen Therapeutics, Inc. Antiviral structurally stapled influenza peptides and uses thereof

Also Published As

Publication number Publication date
AU2011217903A1 (en) 2012-09-13
EP2536425A4 (en) 2014-11-05
JP2016196472A (ja) 2016-11-24
KR20120132506A (ko) 2012-12-05
BR112012020839A2 (pt) 2017-11-21
JP2018166515A (ja) 2018-11-01
EP2536425A2 (en) 2012-12-26
EP2536425B1 (en) 2019-06-19
CN102939096B (zh) 2016-03-02
US20170114103A9 (en) 2017-04-27
CN102939096A (zh) 2013-02-20
WO2011103453A3 (en) 2011-12-29
JP2013520172A (ja) 2013-06-06
MX2012009581A (es) 2013-01-29
AU2011217903B2 (en) 2017-03-02
CA2790380A1 (en) 2011-08-25
US20130209499A1 (en) 2013-08-15
MX342716B (es) 2016-10-11
US9701723B2 (en) 2017-07-11

Similar Documents

Publication Publication Date Title
EP2536425B1 (en) Vaccines for use in the prophylaxis and treatment of influenza virus disease
US20260048114A1 (en) Influenza virus vaccination regimens
US10179806B2 (en) Influenza virus vaccines and uses thereof
US9849172B2 (en) Influenza virus vaccines and uses thereof
EP4241785B1 (en) Influenza virus vaccines and uses thereof

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 201180019658.1

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 11745345

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2790380

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 2012554060

Country of ref document: JP

Ref document number: MX/A/2012/009581

Country of ref document: MX

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2011217903

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 7899/CHENP/2012

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2011217903

Country of ref document: AU

Date of ref document: 20110218

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20127024205

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2011745345

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 13579845

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112012020839

Country of ref document: BR

REG Reference to national code

Ref country code: BR

Ref legal event code: B01E

Ref document number: 112012020839

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112012020839

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20120820