WO2010060095A1 - Bispecific egfr/igfir binding molecules - Google Patents

Bispecific egfr/igfir binding molecules Download PDF

Info

Publication number
WO2010060095A1
WO2010060095A1 PCT/US2009/065765 US2009065765W WO2010060095A1 WO 2010060095 A1 WO2010060095 A1 WO 2010060095A1 US 2009065765 W US2009065765 W US 2009065765W WO 2010060095 A1 WO2010060095 A1 WO 2010060095A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
amino acid
acid sequence
loop
binding
Prior art date
Application number
PCT/US2009/065765
Other languages
English (en)
French (fr)
Inventor
Stuart Emanuel
Linda Engle
Ray Camphausen
Martin C. Wright
Ginger Chao
Marco Gottardis
Joan Carboni
Original Assignee
Bristol-Myers Squibb Company
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to NZ592782A priority Critical patent/NZ592782A/xx
Priority to JP2011537719A priority patent/JP5823870B2/ja
Priority to AU2009316271A priority patent/AU2009316271A1/en
Priority to EA201100669A priority patent/EA022415B1/ru
Priority to MX2011005257A priority patent/MX2011005257A/es
Priority to BRPI0922613A priority patent/BRPI0922613A2/pt
Priority to CA2744405A priority patent/CA2744405A1/en
Priority to EP09760433.4A priority patent/EP2350126B1/en
Application filed by Bristol-Myers Squibb Company filed Critical Bristol-Myers Squibb Company
Priority to CN200980155318.4A priority patent/CN102439036B/zh
Priority to ES09760433.4T priority patent/ES2555381T3/es
Publication of WO2010060095A1 publication Critical patent/WO2010060095A1/en
Priority to IL212715A priority patent/IL212715A0/en
Priority to TN2011000225A priority patent/TN2011000225A1/fr
Priority to ZA2011/03766A priority patent/ZA201103766B/en

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/39—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin, cold insoluble globulin [CIG]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475—Growth factors; Growth regulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2318/00—Antibody mimetics or scaffolds
    • C07K2318/20—Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto

Definitions

  • the present invention relates to EGFR binding domains and bispecific molecules comprising an EGFR binding domain and a distinct IGFIR binding domain for use in diagnostic, research and therapeutic applications.
  • the invention further relates to cells comprising such proteins, polynucleotide encoding such proteins or fragments thereof, and vectors comprising the polynucleotides encoding the innovative proteins.
  • Exemplary EGFR binding domains and bispecific molecules include antibody-like protein dimers based on the tenth fibronectin type III domain.
  • Receptor tyrosine kinases have a conserved domain structure including an extracellular domain, a transmembrane domain and an intracellular tyrosine kinase domain.
  • the extracellular domain can bind to a ligand, such as to a polypeptide growth factor or to a cell membrane - associated molecule.
  • ligand binding or ligand binding induced dimerization of receptor tyrosine kinases activates the intracellular catalytic tyrosine kinase domain of the receptor and subsequent signal transduction.
  • receptor tyrosine kinases include, but are not limited to ERBB receptors (e.g., EGFR, ERBB2, ERBB3, ERBB4), erythropoietin-producing hepatocellular (EPH) receptors, fibroblast growth factor (FGF) receptors (e.g., FGFRl, FGFR2, FGFR3, FGFR4, FGFR5), platelet-derived growth factor (PDGF) receptors (e.g., PDGFR-A, PDGFR-B), vascular endothelial growth factor (VEGF) receptors (e.g., VEGFR1/FLT1, VEGFR2/FLK1, VEGF3), tyrosine kinase with immunoglobulin-like and EGF-like domains (TIE) receptors , insulin-like growth factor (IGF) receptors (e.g., INS-R, IGFIR, IR-R), Discoidin Domain (DD) receptors , receptor
  • the application provides EGFR binding tenth fibronectin type III domains ( 10 Fn3) having novel sequences.
  • EGFR binding 10 Fn3 having a consensus sequence are also provided.
  • Such EGFR binding 10 Fn3 may be monomeric or may be included as part of a fusion protein.
  • E/I binders encompassed by the invention include bispecific antibodies and dimers of ligand binding scaffold proteins (e.g., tendamistat, affibody, f ⁇ bronectin type III domain, anticalin, tetranectin, and ankyrin).
  • ligand binding scaffold proteins e.g., tendamistat, affibody, f ⁇ bronectin type III domain, anticalin, tetranectin, and ankyrin.
  • the E/I binders may be constructed in any orientation, e.g., from N-terminus to C-terminus either in the E-I arrangement or the I-E arrangement.
  • antibody-like protein dimers comprising an EGFR binding 10 Fn3 covalently or non-covalently linked to an IGFIR binding 10 Fn3.
  • the 10 Fn3 bind their target (EGFR or IGFIR) with a K D of less than 500 nM.
  • Each of the individual 10 Fn3 independently has an amino acid sequence at least 70, 80, 85, 90, 95, 98, or 100% identical to SEQ ID NO: 32, wherein n is an integer from 1-20, o is an integer from 1-20, and p is an integer from 1-40.
  • n is an integer from 8-12
  • o is an integer from 4-8
  • p is an integer from 4-28.
  • n is 10, o is 6, and p is 12.
  • the antibody-like protein dimers comprise IGFIR binding 10 Fn3 covalently linked to EGFR binding 10 Fn3 via a polypeptide linker or a polyethylene glycol moiety.
  • the antibody-like protein dimer comprises an amino acid sequence at least 80, 90, 95, or 100% identical to any one of SEQ ID NOs: 20-31, 53-58, 87-92, 98-105, 118-133, 149-154, 164-169, 179-184, 192-197, 205-210 and 211-216.
  • the E/I binder comprises an amino acid sequence having any one of SEQ ID NOs: 20-31, 53-58, 87-92, 98-105, 118-133, 149-154, 164-169, 179-184, 192-197, 205-210 and 211-216, wherein (i) the EGFR binding 10 Fn3 and/or the IGF-IR binding 10 Fn3 comprises a 10 Fn3 scaffold having from has anywhere from 0 to 20, from 0 to 15, from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, conservative substitutions, deletions or additions relative to the corresponding scaffold amino acids of SEQ ID NO: 1, and/or (ii) the EGFR binding 10 Fn3 has anywhere from 0 to 15, from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0
  • compositions comprising an antibody-like protein dimer as described herein and a pharmaceutically acceptable carrier, wherein the composition is essentially pyrogen free.
  • methods for treating hyperproliferative disorders, such as cancer, in a subject comprising administering to a subject in need thereof a therapeutically effective amount of a pharmaceutically acceptable composition comprising an antibody-like protein dimer as described herein.
  • the application provides a nucleic acid encoding an antibody-like protein dimer as described herein.
  • a vector comprising a nucleic acid encoding an antibody-like dimer as described herein.
  • Suitable vectors include, for example, expression vectors.
  • host cells comprising a nucleic, vector, or expression vector, comprising a nucleic acid encoding an antibody-like protein dimer as described herein.
  • Suitable host cells include prokaryotic and eukaryotic host cells. Exemplary prokaryotic cells are bacterial cells, such as E. coli. Exemplary eukaryotic cells are mammalian cells, such as CHO cells.
  • FIG. 1 SDS-PAGE Analysis of I1-GS10-E2. Samples from the lysis of HMS174(DE3) bacterial cell pellet from which I1-GS10-E2 was expressed and purified by a HisTrap chromatography column were run on a 4-12% NuPAGE minigel and stained by Sypro-Orange and visualized by STORM imager.
  • FIG. 1 A. SEC Analysis of midscale purified I1-GS10-E2. 22 ⁇ g of HisTrap purified I1-GS10-E2 dialyzed into PBS, pH 7.4 was loaded onto a Superdex 200 10/30 SEC Column (GE Healthcare) with a mobile phase of 100 mM NaPO 4 , 100 mM NaSO 4 , 150 mM NaCl, pH 6.8 and measured using A280. I1-GS10-E2 eluted predominantly as a single monomeric species at a molecular weight range of approximately 24.6 kDa vs. globular Gel Filtration standards (BioRad). B. SEC analysis of E2-GS 10-11.
  • FIG. 3 A. Differential Scanning Calorimetry (DSC) of midscale purified I1-GS10-E2 in PBS was performed to determine the T m . A 1 mg/mL solution of II- GS10-E2 was scanned from 5 0 C to 95 0 C at a rate of 1 degree per minute under 3 atm pressure. The data was analyzed versus a control run of the PBS buffer. B. DSC ofE2-GS10-Il.
  • FIG. 4 Inhibition of IGFR activity in H292 cells.
  • Cells were stimulated with 100 ng/mL of IGF-I and lOOng/mL of EGF and treated with either • II, D El, or ⁇ El-GSlO- Il HTPP preparations.
  • Phosphorylation of IGFIR on tyrosine 1131 was determined by ELISA.
  • FIG. 1 Inhibition of EGFR activity in H292 cells.
  • Cells were stimulated with lOOng/mL of IGF-I and lOOng/mL of EGF and treated with either • II, D El, or ⁇ El-GSlO-Il HTPP preparations.
  • Phosphorylation of EGFR on tyrosine 1068 was determined by ELISA.
  • FIG. 6 Inhibition of AKT phosphorylation in H292 cells.
  • Cells were stimulated with lOOng/mL of IGF-I and lOOng/mL of EGF and treated with either • II, a El, or ⁇ El-GSlO-Il HTPP preparations.
  • Phosphorylation of AKT on serine 473 was determined by ELISA.
  • Figure 9 Summarizes IC50 values in cell based functional assays for isolated EGFR mononectins, E/I 10 Fn3-based binders with serine at the C-terminal position without PEG added and E/I 10 Fn3-based binders with cysteine at the C- terminal position conjugated to a 40 kDa branched PEG. Representative data is shown.
  • FIG. 10 Immunoblot analysis of PEGylated E/I 10 Fn3 -based binder with E2 in the N-terminal and C-terminal positions.
  • the E/I 10 Fn3-based binder with E2 at the C-terminal position did not degrade EGFR while the E/I 10 Fn3-based binder with E2 at the N-terminal position did.
  • Both constructs show very weak to no IGFR degradation in this cell line, ⁇ -actin was included to demonstrate equal loading across all lanes. The phosphorylation state of EGFR, ERK and She was also examined.
  • Figure 12 A Preclinical antitumor activity in the H292 human tumor xenograft model. Mean tumor sizes calculated from groups of 8 mice is shown in mg for control animals ( ⁇ ), E3-GS10- Il (w/ PEG) dosed at 100mg/kg (o), E2-GS 10-11 (with PEG) dosed at 100 mg/kg (D), panitumumab dosed at lmg/mouse ( ⁇ ) or O.lmg/mouse (v). The letter a on the x-axis indicates doses of E/I binders administered and the p indicates doses of panitumumab administered.
  • Figure 12B Average weight change is shown for each group over the course of the study. Symbols are as described in Figure 12A legend.
  • FIG. 13 Pharmacodynamic effects in the H292 NSCLC tumor xenograft model. Levels of the indicated analytes were determined in tumor lysates as described in Example 12.
  • FIG. 14 Western blot analysis of MCF7r cells compared to MCF7 parental cells.
  • Figure 15. MCF7 (Panel A) and MCF7r (Panel B) human tumor xenograft studies in nude mice. Mean tumor size is shown for both studies calculated from 8 mice per group.
  • FIG. 1 Colony formation assay with H292 NSCLC cells.
  • FIG. 19 Epitope mapping assay. Location of epitope binding for various EGFR binding antibodies are shown in panel A. A description of the antibodies is provided in Example 18, Table 11. The left column of table 11 provides a number for each anti-EGFR antibody which correlates with the numbered antibodies shown in panel A. Panel B shows an exemplany epitope mapping assay as described in Example 18.
  • FIG. 21 Evaluation of E/I 10 Fn3-based binders for inhibition of AKT phosphorylation in H292 cells as measured by ELISA.
  • Il -GS 10-E5 -pegylated (o) was more potent than Il-pegylated alone ( ⁇ ) or E5-pegylated alone (A) for blocking IGFl -stimulated AKT phosphorylation.
  • FIG. 22 Evaluation of E/I 10 Fn3-based binders for inhibition of cell proliferation in H292 cells.
  • Il-GS10-E5-pegylated (D) was more potent than Il- pegylated alone (A) and E5 -pegylated alone (•) had only weak effects for inhibiting the growth of H292 cells.
  • Assays were carried out in triplicate. Representative data is shown.
  • FIG 23 Evaluation of E/I 10 Fn3-based binders for inhibition of cell proliferation in RH41 cells.
  • Il -GS 10-E5 -pegylated (D) was slightly more potent than Il-pegylated alone (A) and E5-pegylated alone (•) or panitumumab (dashed line) had almost no effect for inhibiting the growth of RH41 cells.
  • Assays were carried out in triplicate. Representative data is shown.
  • Figure 24 Inhibition of ligand stimulated signaling by 10 Fn3-based binders (pegylated).
  • E/I 10 Fn3-based binder I1-GS10-E5 pegylated
  • DiFi Panel A
  • H292 Panel B
  • BxPC3 Panel C
  • Cells were serum starved and treated for 2 hours with 1 ⁇ M 10 Fn3-based binders before stimulation with either EGF, IGFl or a combination of EGF + IGFl.
  • GAPDH was probed to illustrate equal loading in all lanes.
  • Figure 25 Inhibition of ligand stimulated signaling in H292 cells by 10 Fn3- based binders (unpegylated). Effect of E/I 10 Fn3-based binder (E2-GS10-I1) on receptor activation and cell signaling in H292 cells. Cells were serum starved and treated for 2 hours with 1 ⁇ M 10 Fn3-based binders before stimulation with either EGF, IGFl or a combination of EGF + IGFl. GAPDH was probed to illustrate equal loading in all lanes
  • FIG. 26 Competition binding studies with E/I 10 Fn3-based binders.
  • A. The EGFR 10 Fn3-based binder does not compete for binding of EGFR antibodies to EGFR. Initial injection of the EGFR 10 Fn3-based binder shows binding to EGFR on the surface of the chip. A second injection of EGFR 10 Fn3-based binder mixed with an equal amount of cetuximab, panitumumab, or nimotuzumab shows no competition for binding of antibodies to EGFR by the EGFR 10 Fn3-based binder.
  • B. The E/I 10 Fn3 -based binder can bind EGFR and IGF-IR simultaneously.
  • E/I 10 Fn3-based binder shows binding to EGFR immobilized on the chip surface.
  • a second injection of the E/I 10 Fn3-based binder soluble IGF-IR shows binding of sIGF-IR to other end of the immobilized E/I 10 Fn3-based binder.
  • FIG. 27 TGF ⁇ plasma levels 4 hours after last dose of xenograft studies. Plasma samples taken at the end of treatment from the BxPC3 (Panel A), GEO (Panel B) and H441 (Panel C) xenograft studies described in Table 24 were analyzed for circulating levels of TGF ⁇ .
  • FIG. 28 TGF ⁇ and IGFl plasma levels in non tumor bearing nude mice after dosing with I1-GS10-E5 pegylated.
  • Non-tumor bearing mice were given a single dose of I1-GS10-E5 pegylated 10 Fn3-based binder and analyzed for circulating levels of TGF ⁇ (Panel A) and IGFl (Panel B).
  • FIG. 29 H292 xenograft study using E/I 10Fn3 -based binders as compared to panitumumab.
  • H292 xenografts were either untreated ( ⁇ ) or dosed three times a week with 10 Fn3-based binders formulated in PBS with the individual constructs as described in the figure or dosed every three days i.p. with panitumumab at 1 mg/mouse (o) or 0.1 mg/mouse (D).
  • FIG. 30 Pharmaokinectic parameters profile of E2-GS 10-11 pegylated in mice.
  • Figure 31 Comparison of half- life at 100 mg/kg and 10 mg/kg IP, and 10 mg/kg and 64 mg/kg SC in various E/1 10 Fn3-based binders.
  • Figure 33 Measurement of pharmacodynamic endpoints in tumors.
  • tumors were removed 4 hours following the final dose from DiFi xenograft model (panel A) and H292 xenograft model (panel B) and examined for levels of phospho-EGFR, phospho-IGFR, total EGFR and total IGFR. Equal amounts of total protein lysate was loaded into each lane of the gels and blots were also probed with GAPDH to demonstrate equal loading across all lanes.
  • FIG. 34 Sequence of anti-EGFR binder 679F09 (SEQ ID NO: 490). Loop residues which were varied are underlined.
  • FIG. 35 BC loop Sequence Analysis I. Frequency of amino acids at each position in the BC loop from EGFR binding sequences. Image created using WebLogo (Crooks GE, Hon G, Chandonia JM, Brenner SE. WebLogo: A sequence logo generator. Genome Research, 14:1188-1190, 2004).
  • FIG. 37 FG loop (10-aa length) Sequence Analysis I. Frequency of amino acids at each position in the FG loop from EGFR binding sequences with 10-amino acid long FG loops (228 unique 10-amino acid long FG loops analyzed).
  • FIG 38 FG loop (15-aa length) Sequence Analysis I. Frequency of amino acids at each position in the FG loop from EGFR binding sequences with 15- amino acid long FG loops (349 unique 15-amino acid long FG loops analyzed).
  • Figure 39 BC loop Sequence Analysis II. Frequency of amino acids at each position in the BC loop from all "potent" sequences (85 unique BC loop sequences analyzed).
  • FIG 41 FG loop (10-aa length) Sequence Analysis II. Frequency of amino acids at each position in the FG loop from all "potent" sequences with 10- amino acid long FG loops (6 unique 10-amino acid long FG loops analyzed).
  • FIG. 42 FG loop (15-aa length) Sequence Analysis II. Frequency of amino acids at each position in the FG loop from all "potent" sequences with 15- amino acid long FG loops (65 unique 15 -amino acid long FG loops analyzed).
  • Figure 43 Table summarizing various characteristics of E/I 10 Fn3-based binders as described in Example 22.
  • Figure 44 Table summarizing various pharmacokinetic parameters of E/I 10 Fn3-based binders as described in Example 30.
  • Figure 45 Amino acid sequences of E monomers as described in Example 32. The BC, DE and FG loops in each sequence are underlined.
  • Figure 46 Alignment of wild-type core sequence (amino acids 9-94 of SEQ ID NO: 1) with Il core (SEQ ID NO:65), El core (SEQ ID NO:66), E2 core (SEQ ID NO:67), E3 core (SEQ ID NO:68), E4 core (SEQ ID NO: 108), E5 core (SEQ ID NO: 114), E85 core (SEQ ID NO: 141), E90 core (SEQ ID NO: 156), E96 core (SEQ ID NO:171), E105 core (SEQ ID NO: 186), and El 12 core (SEQ ID NO:199).
  • the BC, DE and FG loops in the wild-type sequences are shown in bold and underlined.
  • the amino acid residues actually changed in comparison to wild-type for the I and E cores are shown i bold and underlined.
  • nucleic acid sequences of E and I monomers encode a monomer having an N+10 N-terminal extension, a Ser tail, and a his tag.
  • Figure 48 Nucleic acid sequence of E/I 10 Fn3-based binders. All nucleotide sequences encode an E/I 10 Fn3-based binder having an N+10 N-terminal extension on the first monomer in the construct and a Cys tail and his tag on the second monomer in the construct.
  • GSlO is SEQ ID NO: 11
  • GSGCGS8 is SEQ ID NO: 218
  • GSGC is SEQ ID NO: 489.
  • antibody-like protein refers to a non-immunoglobulin protein having an "immunoglobulin-like fold", i.e., comprises about 80-150 amino acid residues that are structurally organized into a set of beta or beta- like strands, forming beta sheets, where the beta or beta-like strands are connected by intervening loop portions.
  • the beta sheets form the stable core of the antibody-like protein, while creating two "faces" composed of the loops that connect the beta or beta-like strands. As described herein, these loops can be varied to create customized ligand binding sites, and such variations can be generated without disrupting the overall stability of the protein.
  • an antibody-like protein is a "fibronectin-based scaffold protein", by which is meant a polypeptide based on a fibronectin type III domain (Fn3).
  • an antibody-like protein is based on a tenth fibronectin type III domain ( 10 Fn3).
  • polypeptide By a “polypeptide” is meant any sequence of two or more amino acids, regardless of length, post-translation modification, or function. "Polypeptide,” “peptide,” and “protein” are used interchangeably herein.
  • Percent (%) amino acid sequence identity herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in a selected sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared.
  • % amino acid sequence identity values are obtained as described below by using the sequence comparison computer program ALIGN-2.
  • the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc. has been filed with user documentation in the U.S. Copyright Office, Washington D. C, 20559, where it is registered under U.S. Copyright Registration No. TXU510087, and is publicly available through Genentech, Inc., South San Francisco, Calif.
  • the ALIGN-2 program should be compiled for use on a UNIX operating system, preferably digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
  • the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows: 100 times the fraction X/Y where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A.
  • the term "therapeutically effective amount” refers to an amount of a drug effective to treat a disease or disorder in a mammal.
  • the therapeutically effective amount of the drug may reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the disorder.
  • the drug may prevent growth and/or kill existing cancer cells, it may be cytostatic and/or cytotoxic.
  • efficacy in vivo can, for example, be measured by assessing the time to disease progression (TTP) and/or determining the response rates (RR).
  • the half-life of an amino acid sequence or compound can generally be defined as the time taken for the serum concentration of the polypeptide to be reduced by 50% in vivo due to, e.g., degradation of the sequence or compound and/or clearance or sequestration of the sequence or compound by natural mechanisms.
  • the half-life can be determined in any manner known in the art, such as by pharmacokinetic analysis. See e.g., M Gibaldi & D Perron "Pharmacokinetics", published by Marcel Dekker, 2nd Rev. edition (1982).
  • E/I binder refers to a bispecific molecule that comprises an EGFR binding domain and a distinct IGFIR binding domain. The two domains may be covalently or non-covalently linked.
  • An exemplary E/I binder is an antibody-like dimer comprising an EGFR binding 10 Fn3 and an IGFIR binding 10 Fn3, i.e., an E/I 10 Fn3 based binder.
  • the epidermal growth factor receptor (EGFR) and insulin-like growth factor receptor (IFGR) play key roles in the tumorigenesis of several types of human cancer. Inhibition of either receptor effectively reduces tumor growth in preclinical models as well as clinically. Blocking the EGFR pathway induces switching to the IGFR pathway to drive growth with in vitro tumor models. Therefore, blocking both receptors simultaneously may achieve superior efficacy to blocking either pathway alone by overcoming pathway switching.
  • the activity of an E/I binder is synergistic in comparison to the monomeric components of the E/I binder.
  • E/I binders bispecific molecules that bind EGFR and IGFIR, referred to herein as "E/I binders”. Applicants have discovered that such bispecific molecules inhibit proliferation of a cancer model cell line with greater potency than the corresponding, monospecific binders (see e.g., Example 9 and Figure 8).
  • E/I binders will be useful in numerous therapeutic applications, especially in the treatment of cancer. In addition to therapeutic applications, E/I binders may be used in any circumstance where it is desirable to detect EGFR and/or IGFIR.
  • E/I binders have an EGFR binding domain and a distinct IGFIR binding domain. Typical binding domains include antibodies; therefore, bispecific antibodies may be generated to function as E/I binders.
  • Bispecific antibodies comprising complementary pairs of V H and V L regions are known in the art. These bispecific antibodies comprise two pairs of V H and V L , each V H/L pair binding to a single antigen, (see e.g., Hu et al., Cancer Res. 1996 56:3055-306; Neri et al., J. MoI. Biol. 1995 246:367-373; Atwell et al., MoI. Immunol. 1996 33:1301-1312; and Carter et al., Protein Sci. 1997 6:781-788).
  • An exemplary bispecific antibody is a diabody, i.e., a small antibody fragment with two antigen-binding sites, which fragments comprise a heavy-chain variable domain connected to a light-chain variable domain in the same polypeptide chain (Hollinger et al., Proc. Natl. Acad. Sci. USA 1993 90: 6444-6448).
  • E/I binders also encompass dimers of ligand binding scaffold proteins.
  • Scaffold proteins are well described in the literature and include, e.g., tendamistat, affibody, fibroncectin type III domain, anticalin, tetranectin, and ankyrin. Additional scaffold proteins that may be used to generate E/I binders are reviewed in Binz et al., Nature Biotech 23:1257-1268 (2005). Scaffold proteins are based on a rigid core structure or 'framework' that is important in determining and stabilizing the three-dimensional structure. In between the fixed or conserved residues of the scaffold lie variable regions such as loops, surfaces or cavities that can be randomized to alter ligand binding. A large diversity of amino acids is provided in the variable regions between the fixed scaffold residues to provide specific binding to a target molecule.
  • Fn3 fibronectin type III domain
  • Fibronectin is a large protein which plays essential roles in the formation of extracellular matrix and cell-cell interactions; it consists of many repeats of three types (types I, II, and III) of small domains.
  • Fn3 is small, monomeric, soluble, and stable. It lacks disulfide bonds and, therefore, is stable under reducing conditions. The overall structure of Fn3 resembles the immunoglobulin fold.
  • Fn3 domains comprise, in order from N- terminus to C-terminus, a beta or beta-like strand, A; a loop, AB; a beta or beta-like strand, B; a loop, BC; a beta or beta-like strand, C; a loop, CD; a beta or beta-like strand, D; a loop, DE; a beta or beta-like strand, E; a loop, EF; a beta or beta-like strand, F; a loop, FG; and a beta or beta-like strand, G.
  • the seven antiparallel ⁇ - strands are arranged as two beta sheets that form a stable core, while creating two "faces" composed of the loops that connect the beta or beta-like strands.
  • Loops AB, CD, and EF are located at one face and loops BC, DE, and FG are located on the opposing face. Any or all of loops AB, BC, CD, DE, EF and FG may participate in ligand binding.
  • There are at least 15 different modules of Fn3 and while the sequence homology between the molecules is low, they all share a high similarity in tertiary structure.
  • AdnectinsTM (Adnexus, a Bristol-Myers Squibb R&D Company) are ligand binding scaffold proteins based on the tenth fibronectin type III domain, i.e., the tenth module of Fn3, ( 10 Fn3).
  • the amino acid sequence of a naturally occurring human 10 Fn3 is set forth in SEQ ID NO: 1.
  • the AB loop corresponds to residues 15-16
  • the BC loop corresponds to residues 21-30
  • the CD loop corresponds to residues 39-45
  • the DE loop corresponds to residues 51-56
  • the EF loop corresponds to residues 60-66
  • the FG loop corresponds to residues 76-87.
  • beta strand A corresponds to residues 9-14
  • beta strand B corresponds to residues 17-20
  • beta strand C corresponds to residues 31-38
  • beta strand D corresponds to residues 46-50
  • beta strand E corresponds to residues 57-59
  • beta strand F corresponds to residues 67-75
  • beta strand G corresponds to residues 88-94.
  • the strands are connected to each other through the corresponding loop, e.g., strands A and B are connected via loop AB in the formation strand A, loop AB, strand B, etc.
  • Residues involved in forming the hydrophobic core include the amino acids corresponding to the following amino acids of SEQ ID NO: 1 : L8, VlO, A13, L18, 120, W22, Y32, 134, Y36, F48, V50, A57, 159, L62, Y68, 170, V72, A74, 188, 190 and Y92, wherein the core amino acid residues are represented by the single letter amino acid code followed by the position at which they are located within SEQ ID NO: 1. See e.g., Dickinson et al., J. MoI. Biol. 236: 1079-1092 (1994).
  • amino acid residues corresponding to residues 21-30, 51-56, and 76-87 of SEQ ID NO: 1 define the BC, DE and FG loops, respectively.
  • a desired target such as IGF-IR or EGFR.
  • residues corresponding to amino acids 23-30, 52-55 and 77- 86 of SEQ ID NO: 1 were modified to produce high affinity 10 Fn3 binders (see Figure 46.
  • the BC loop may be defined by amino acids corresponding to residues 23-30 of SEQ ID NO: 1
  • the DE loop may be defined by amino acids corresponding to residues 52-55 of SEQ ID NO: 1
  • the FG loop may be defined by amino acids corresponding to residues 77-86 of SEQ ID NO: 1.
  • 10 Fn3 are structurally and functionally analogous to antibodies, specifically the variable region of an antibody. While 10 Fn3 domains may be described as "antibody mimics" or “antibody- like proteins", they do offer a number of advantages over conventional antibodies. In particular, they exhibit better folding and thermostability properties as compared to antibodies, and they lack disulphide bonds, which are known to impede or prevent proper folding under certain conditions. Exemplary E/I 10 Fn3 based binders are predominantly monomeric with Tm' s averaging ⁇ 50 0 C.
  • the BC, DE, and FG loops of 10 Fn3 are analogous to the complementary determining regions (CDRs) from immunoglobulins. Alteration of the amino acid sequence in these loop regions changes the binding specificity of 10 Fn3.
  • the protein sequences outside of the CDR-like loops are analogous to the framework regions from immunoglobulins and play a role in the structural conformation of the 10 Fn3. Alterations in the framework-like regions of 10 Fn3 are permissible to the extent that the structural conformation is not so altered as to disrupt ligand binding.
  • Antibody-like proteins based on the 10 Fn3 scaffold can be defined generally by the sequence:
  • VSDVPRDLEVV AATPTSLLI(X) n YYRITYGETGGNSPVQEFTV(X) o ATISGLKP GVDYTITVYAV(X) P ISINYRT SEQ ID NO: 32
  • n is an integer from 1- 20
  • o is an integer from 1-20
  • p is an integer from 1-40.
  • the BC, DE, and FG loops are represented by (X) n , (X) 0 , and (X) p , respectively.
  • 10 Fn3 generally begin with the amino acid residue corresponding to number 1 of SEQ ID NO: 1.
  • domains with amino acid deletions are also encompassed by the invention.
  • amino acid residues corresponding to the first eight amino acids of SEQ ID NO: 1 are deleted.
  • Additional sequences may also be added to the N- or C-terminus. For example, an additional MG sequence may be placed at the N-terminus of 10 Fn3. The M will usually be cleaved off, leaving a G at the N-terminus.
  • sequences may be placed at the C-terminus of the 10 Fn3 domain, e.g., EIDKPSQ (SEQ ID NO: 9), EIDKPCQ (SEQ ID NO: 10), EGSGS (SEQ ID NO: 96) or EGSGC (SEQ ID NO: 97).
  • the non-ligand binding sequences of 10 Fn3, i.e., the " 10 Fn3 scaffold” may be altered provided that the 10 Fn3 retains ligand binding function and/or structural stability.
  • one or more of Asp 7, GIu 9, and Asp 23 are replaced by another amino acid, such as, for example, a non-negatively charged amino acid residue (e.g., Asn, Lys, etc.).
  • a non-negatively charged amino acid residue e.g., Asn, Lys, etc.
  • These mutations have been reported to have the effect of promoting greater stability of the mutant 10 Fn3 at neutral pH as compared to the wild-type form (See, PCT Publication No. WO 02/04523).
  • a variety of additional alterations in the 10 Fn3 scaffold that are either beneficial or neutral have been disclosed. See, for example, Batori et al., Protein Eng. 2002 15(12): 1015-20; Koide et al., Biochemistry 2001 40(34): 10326-33.
  • the 10 Fn3 scaffold may be modified by one or more conservative substitutions. As many as 5%, 10%, 20% or even 30% or more of the amino acids in the 10 Fn3 scaffold may be altered by a conservative substitution without substantially altering the affinity of the 10 Fn3 for a ligand.
  • the scaffold modification preferably reduces the binding affinity of the 10 Fn3 binder for a ligand by less than 100-fold, 50-fold, 25-fold, 10-fold, 5-fold, or 2-fold. It may be that such changes will alter the immunogenicity of the 10 Fn3 in vivo, and where the immunogenicity is decreased, such changes will be desirable.
  • conservative substitutions are residues that are physically or functionally similar to the corresponding reference residues.
  • a conservative substitution and its reference residue have similar size, shape, electric charge, chemical properties including the ability to form covalent or hydrogen bonds, or the like.
  • Preferred conservative substitutions are those fulfilling the criteria defined for an accepted point mutation in Dayhoff et al., Atlas of Protein Sequence and Structure 5:345-352 (1978 & Supp.).
  • an EGFR binding 10 Fn3 may be provided as part of a fusion protein or multimer.
  • an EGFR binding 10 Fn3 may be covalently or non-covalently linked to at least a second 10 Fn3 binding domain.
  • the second 10 Fn3 binding domain may bind to EGFR or to a different target.
  • an EGFR binding 10 Fn3 may be covalently or non-covalently linked to an IGF-IR binding 10 Fn3.
  • the EGFR binding 10 Fn3 proteins described herein bind to EGFR with a K D of less than 500 nM, 100 nM, 50 nM, 10 nM, 1 nM, 500 pM, 100 pM. 100 pM, 50 pM or 10 pM.
  • the BC loop of the EGFR binding 10 Fn3 proteins correspond to amino acids 23-30 of SEQ ID NO: 1
  • the DE loop of the EGFR binding 10 Fn3 proteins correspond to amino acids 52-55 of SEQ ID NO: 1
  • the FG loop of the EGFR binding 10 Fn3 proteins correspond to amino acids 77-86 of SEQ ID NO: 1.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop having a YQ at the positions corresponding to amino acids 29 and 30 of SEQ ID NO: 1.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop having a YQ at the positions corresponding to amino acids 29 and 30 of SEQ ID NO: 1 and an FG loop that is fifteen amino acids in length, e.g., an FG loop that is extended in length by five amino acids due to an insertion of five amino acids between residues corresponding to amino acids 77-86 of SEQ ID NO: 1.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop having a YQ at the positions corresponding to amino acids 29 and 30 of SEQ ID NO: 1 and a DE loop having a V, I, L, M or A residue at the position corresponding to amino acid 54 of SEQ ID NO: 1.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop having a YQ at the positions corresponding to amino acids 29 and 30 of SEQ ID NO: 1, a DE loop having a V, I, L, M or A residue at the position corresponding to amino acid 54 of SEQ ID NO: 1, and an FG loop that is fifteen amino acids in length, e.g., an FG loop that is extended in length by five amino acids due to an insertion of five amino acids between residues corresponding to amino acids 77-86 of SEQ ID NO: 1.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop having a YQ at the positions corresponding to amino acids 29 and 30 of SEQ ID NO: 1 and an FG loop comprising a D or N at the position corresponding to amino acid 77 of SEQ ID NO: 1.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop having a YQ at the positions corresponding to amino acids 29 and 30 of SEQ ID NO: 1 and an FG loop (i) that is fifteen amino acids in length, e.g., an FG loop that is extended in length by five amino acids due to an insertion of five amino acids between residues corresponding to amino acids 77-86 of SEQ ID NO: 1 and (ii) comprises a D or N at the position corresponding to amino acid 77 of SEQ ID NO: 1.
  • the invention provides an EGFR binding 10 Fn3 comprising a DE loop comprising a V, I, L, M or A residue at the position corresponding to amino acid 54 of SEQ ID NO: 1 and an FG loop comprising a D or N at the position corresponding to amino acid 77 of SEQ ID NO: 1.
  • the invention provides an EGFR binding 10 Fn3 comprising a DE loop comprising a V, I, L, M or A residue at the position corresponding to amino acid 54 of SEQ ID NO: 1 and an FG loop (i) that is fifteen amino acids in length, e.g., an FG loop that is extended in length by five amino acids due to an insertion of five amino acids between residues corresponding to amino acids 77-86 of SEQ ID NO: 1 and (ii) comprises a D or N at the position corresponding to amino acid 77 of SEQ ID NO: 1.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop having a YQ at the positions corresponding to amino acids 29 and 30 of SEQ ID NO: 1, a DE loop comprising a V, I, L, M or A residue at the position corresponding to amino acid 54 of SEQ ID NO: 1, and an FG loop comprising a D or N at the position corresponding to amino acid 77 of SEQ ID NO: 1.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop having a YQ at the positions corresponding to amino acids 29 and 30 of SEQ ID NO: 1, a DE loop comprising a V, I, L, M or A residue at the position corresponding to amino acid 54 of SEQ ID NO: 1, and an FG loop (i) that is fifteen amino acids in length, e.g., an FG loop that is extended in length by five amino acids due to an insertion of five amino acids between residues corresponding to amino acids 77-86 of SEQ ID NO: 1 and (ii) comprises a D or N at the position corresponding to amino acid 77 of SEQ ID NO: 1.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop comprising the amino acid sequence XXXXXXYQ, a DE loop comprising the amino acid sequence XX(V/I/L/M/A)X, and an FG loop comprising the amino acid sequence (D/N)X n , wherein X is any amino acid and n is 9-14 amino acids. In an exemplary embodiment, n is 14 amino acids.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop corresponding to amino acids 23-30 of SEQ ID NO: 1 comprising the amino acid sequence XXXXXYQ, a DE loop corresponding to amino acids 52-55 of SEQ ID NO: 1 comprising the amino acid sequence XX(V/I/L/M/A)X, and an FG loop corresponding to amino acids 77-86 of SEQ ID NO: 1 comprising the amino acid sequence (D/N)X n , wherein X is any amino acid and n is 9-14 amino acids. In an exemplary embodiment, n is 14 amino acids.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop comprising the amino acid sequence XXXXXXYQ, a DE loop comprising the amino acid sequence XX(V/I/L/M/A)X, and an FG loop comprising an amino acid sequence selected from: i.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop comprising the amino acid sequence XXXXXXYQ, a DE loop comprising the amino acid sequence (GZYZH)(DZMZG)(VZLZI)X, and an FG loop comprising an amino acid sequence
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop comprising the amino acid sequence XXXXXXYQ, a DE loop comprising the amino acid sequence (GZYZH)(DZMZG)(VZLZI)X, and an FG loop comprising an amino acid sequence D(YZFZW)(YZFZK)(NZDZP)(PZHZL)(AZTZV)(TZDZS)(HZYZG)(EZPZV)(YZH)(TZKZI)(YZF )(H/N/Q)(T/Q/E)(T/S/I), wherein X is any amino acid.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop comprising the amino acid sequence XXXXXXYQ, a DE loop comprising the amino acid sequence XX(V/I/L/M/A)X, and an FG loop comprising an amino acid sequence selected from: i. DY(AZY)GKPYXEY (SEQ ID NO: 473); ii. DY(A/Y)Y(K/R/Q/T)PYXEY (SEQ ID NO: 474); iii. (DZN)Y(AZY)(YZF)(KZRZQZT)EYXE(YZH) (SEQ ID NO: 475); iv.
  • DYY(H/Y)X(R/K)X(E/T)YX (SEQ ID NO: 476); v. DYY(H/Y)(K/H/Q)(R/K)T(E/T)Y(G/P) (SEQ ID NO : 477); vi. (D/N)MMHV(E/D)YXEY (SEQ ID NO: 478); vii. DYMHXXYXEY (SEQ ID NO: 479); and viii. D(M/Y)YHX(K/Pv)X(V/I/L/M)YG (SEQ ID NO: 480); wherein X is any amino acid.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop comprising the amino acid sequence XXXXXXYQ, a DE loop comprising the amino acid sequence XX(V/I/L/M/A)X, and an FG loop comprising an amino acid sequence selected from: i. D(Y/F)(Y/F)NPXTHEYXYXXX (SEQ ID NO : 481 ); ii. D(Y/F)(Y/F)D(P/L)X(T/S)HXYXYXXX (SEQ ID NO: 482); and iii. D(Y/F)(K/R)PHXDGPH(T/I)YXE(S/Y) (SEQ ID NO: 483); wherein X is any amino acid.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop comprising the amino acid sequence XXXXXXYQ, a DE loop comprising the amino acid sequence XX(V/I/L/M/A)X, and an FG loop comprising the amino acid sequence
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop comprising the amino acid sequence XXXXXXYQ, a DE loop comprising the amino acid sequence XX(VZIZLZMZA)X, and an FG loop comprising the amino acid sequence
  • the DE loop of the EGFR binding 10 Fn3 may comprise the sequence (G ⁇ 7H)(D/M/G)(V/L/I)X.
  • the invention provides an EGFR binding 10 Fn3 comprising an FG loop comprising an amino acid sequence selected from: i. D(Y/F)(Y/F)NPXTHEYXYXXX (SEQ ID NO : 481 ); ii. D(Y/F)(Y/F)D(P/L)X(T/S)HXYXYXXX (SEQ ID NO: 482); and iii. D(Y/F)(K/R)PHXDGPH(T/I)YXE(S/Y) (SEQ ID NO: 483); wherein X is any amino acid.
  • the EGFR binding 10 Fn3 comprises any of the consensus sequences provided above, with the proviso that the EGFR binding 10 Fn3 does not comprise one or more of the following sequences: i.
  • VSDVPRDLEVVAATPTSLLISWQVPRPMYQRYYRITYGETGGNSPVQ EFTVPGGVRTATISGLKPGVDYTITVYAVTDYMHSEYRQYPISINYRTEIDKP CQ (SEQ ID NO: 486).
  • an EGFR binding 10 Fn3 comprising one of the consensus sequences provided above has at least 40%, 50%, 60%, 70%, 75%, or 80% identity to SEQ ID NO: 1.
  • the overall structure of an EGFR binding 10 Fn3 comprising one of the consensus sequences provided above resembles the immunoglobulin fold.
  • an EGFR binding 10 Fn3 comprising one of the consensus sequences provided above further comprises the core amino acid residues of the scaffold.
  • an EGFR binding 10 Fn3 comprising one of the consensus sequences provided above has at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to any one of SEQ ID NOs: 5-8, 52, 66-68, 106-108, 112-114, 140-142, 155-157, 170-172, 182, 185-187, 198-200, or 219-327.
  • an EGFR binding 10 Fn3 comprising one of the consensus sequences provided above has at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identity to the amino acid sequence of amino acid residues corresponding to E9 of SEQ ID NO: 1 through T94 of SEQ ID NO: 1 of any one of SEQ ID NOs: 5-8, 52, 66-68, 106-108, 112-114, 140-142, 155- 157, 170-172, 182, 185-187, 198-200, or 219-327.
  • the EGFR binding 10 Fn3 comprising one of the consensus sequences provided above comprises a 10 Fn3 scaffold having from has anywhere from 0 to 20, from 0 to 15, from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, conservative substitutions, deletions or additions relative to the scaffold amino acids residues of SEQ ID NO: 1.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 23- 30, a DE loop having the amino acid sequence set forth in amino acids 52-55, and an FG loop having the amino acid sequence set forth in amino acids 77-86 of any one of SEQ ID NOs: 219-327.
  • the invention provides an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30, a DE loop having the amino acid sequence set forth in amino acids 51-56, and an FG loop having the amino acid sequence set forth in amino acids 76-87 of any one of SEQ ID NOs: 219-327.
  • the invention provides an EGFR binding 10 Fn3 comprising an amino acid sequence at least 60%, 75%, 80%, 85%, 90%, 95%, or 98% identical to any one of SEQ ID NOs: 219-327.
  • an antibody-like protein comprising a tenth fibronectin type III domain ( 10 Fn3) that binds EGFR with a K D of less than 500 nM and comprises a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 5, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 5, and an FG loop having the amino acid sequence set forth in amino acids 76-92 of SEQ ID NO: 5.
  • 10 Fn3 tenth fibronectin type III domain that binds EGFR with a K D of less than 500 nM and comprises a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 5, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 5, and an FG loop having the amino acid sequence set forth in amino acids 76-92 of SEQ ID NO: 5.
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence XgDSGRGSYQXh (SEQ ID NO: 40), a DE loop having the amino acid sequence X 1 GPVHX, (SEQ ID NO: 42), and an FG loop having the amino acid sequence X k DHKPHADGPHT YHEXi (SEQ ID NO: 44); wherein X is any amino acid and g, h, i, j, k, and 1 are integers independently selected from 0 to 5.
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence SWDSGRGSYQ (SEQ ID NO: 39), a DE loop having the amino acid sequence PGPVHT (SEQ ID NO: 41), and an FG loop having the amino acid sequence TDHKPHADGPHTYHESP (SEQ ID NO: 43).
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, or 100% identical to SEQ ID NOs: 5 or 6.
  • an antibody-like protein comprising a tenth fibronectin type III domain ( 10 Fn3) that binds EGFR with a K D of less than 500 nM and comprises a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 7, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 7, and an FG loop having the amino acid sequence set forth in amino acids 76-87 of SEQ ID NO: 7.
  • 10 Fn3 tenth fibronectin type III domain that binds EGFR with a K D of less than 500 nM and comprises a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 7, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 7, and an FG loop having the amino acid sequence set forth in amino acids 76-87 of SEQ ID NO: 7.
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence X m VAGAEDYQX n (SEQ ID NO: 34), a DE loop having the amino acid sequence X 0 HDLVXp (SEQ ID NO: 36), and an FG loop having the amino acid sequence X q DMMHVEYTEHX r (SEQ ID NO: 38); wherein X is any amino acid and m, n, o, p, q, and r are integers independently selected from 0 to 5.
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence SWVAGAEDYQ (SEQ ID NO: 33), a DE loop having the amino acid sequence PHDLVT (SEQ ID NO: 35), and an FG loop having the amino acid sequence TDMMHVEYTEHP (SEQ ID NO: 37).
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, or 100% identical to SEQ ID NO: 7 or 8.
  • an antibody-like protein comprising a tenth fibronectin type III domain ( 10 Fn3) that binds EGFR with a K D of less than 500 nM and comprises a BC loop having the amino acid sequence set forth in amino acids 23-30 of SEQ ID NO: 82, a DE loop having the amino acid sequence set forth in amino acids 51-55 of SEQ ID NO: 82, and an FG loop having the amino acid sequence set forth in amino acids 76-86 of SEQ ID NO: 82.
  • 10 Fn3 tenth fibronectin type III domain
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence X S LPGKLRYQX, (SEQ ID NO: 60), a DE loop having the amino acid sequence X U HDLRX W (SEQ ID NO: 62), and an FG loop having the amino acid sequence X y NMMHVEYSEYX z (SEQ ID NO: 64); wherein X is any amino acid and s, t, u, w, y and z are integers independently selected from 0 to 5.
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence LPGKLRYQ (resdiues 3-13 of SEQ ID NO: 59), a DE loop having the amino acid sequence PHDLR (residues 1-5 of SEQ ID NO: 61), and an FG loop having the amino acid sequence TNMMHVEYSEY (residues 1-11 of SEQ ID NO: 63).
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, or 100% identical to SEQ ID NO: 52 or 82.
  • an antibody-like protein comprising a tenth fibronectin type III domain ( 10 Fn3) that binds EGFR with a K D of less than 500 nM and comprises a BC loop having the amino acid sequence set forth in amino acids 23-30 of SEQ ID NO: 106, a DE loop having the amino acid sequence set forth in amino acids 51-55 of SEQ ID NO: 106, and an FG loop having the amino acid sequence set forth in amino acids 76-86 of SEQ ID NO: 106.
  • 10 Fn3 tenth fibronectin type III domain
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence X 8 HERDGSRQX h (SEQ ID NO: 134), a DE loop having the amino acid sequence X 1 GGVRX, (SEQ ID NO: 135), and an FG loop having the amino acid sequence X k DYFNPTTHEYIYQTTXi(SEQ ID NO: 136); wherein X is any amino acid and g, h, i, j, k and 1 are integers independently selected from 0 to 5.
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence S WHERDGSRQ (SEQ ID NO: 109), a DE loop having the amino acid sequence PGGVRT (SEQ ID NO: 110), and an FG loop having the amino acid sequence TD YFNPTTHE YI YQTTP (SEQ ID NO: 111).
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, or 100% identical to any one of SEQ ID NOs: 106-108.
  • an antibody-like protein comprising a tenth fibronectin type III domain ( 10 Fn3) that binds EGFR with a K D of less than 500 nM and comprises a BC loop having the amino acid sequence set forth in amino acids 23-30 of SEQ ID NO: 112, a DE loop having the amino acid sequence set forth in amino acids 51-55 of SEQ ID NO: 112, and an FG loop having the amino acid sequence set forth in amino acids 76-86 of SEQ ID NO: 112.
  • a tenth fibronectin type III domain 10 Fn3 that binds EGFR with a K D of less than 500 nM and comprises a BC loop having the amino acid sequence set forth in amino acids 23-30 of SEQ ID NO: 112, a DE loop having the amino acid sequence set forth in amino acids 51-55 of SEQ ID NO: 112, and an FG loop having the amino acid sequence set forth in amino acids 76-86 of SEQ ID NO: 112.
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence XgWAPVDRYQXh (SEQ ID NO: 137), a DE loop having the amino acid sequence X 1 RDVYX, (SEQ ID NO: 138), and an FG loop having the amino acid sequence X k DYKPHADGPHTYHESXi (SEQ ID NO: 139); wherein X is any amino acid and g, h, i, j, k and 1 are integers independently selected from 0 to 5.
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence SWW APVDRYQ (SEQ ID NO: 115), a DE loop having the amino acid sequence PRDVYT (SEQ ID NO: 116), and an FG loop having the amino acid sequence TDYKPHADGPHTYHESP (SEQ ID NO: 117).
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, or 100% identical to any one of SEQ ID NOs: 112-114.
  • an antibody-like protein comprising a tenth fibronectin type III domain ( 10 Fn3) that binds EGFR with a K D of less than 500 nM and comprises a BC loop having the amino acid sequence set forth in amino acids 13-22 of SEQ ID NO: 141, a DE loop having the amino acid sequence set forth in amino acids 43-48 of SEQ ID NO: 141, and an FG loop having the amino acid sequence set forth in amino acids 68-84 of SEQ ID NO: 141.
  • 10 Fn3 tenth fibronectin type III domain
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence XgTQGSTHYQXh (SEQ ID NO: 146), a DE loop having the amino acid sequence X 1 GMVYX, (SEQ ID NO: 147), and an FG loop having the amino acid sequence X k DYFDRSTHEYKYRTTXi (SEQ ID NO: 148); wherein X is any amino acid and g, h, i, j, k and 1 are integers independently selected from 0 to 5.
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence S WTQGSTHYQ (SEQ ID NO: 143), a DE loop having the amino acid sequence PGMVYT (SEQ ID NO: 144), and an FG loop having the amino acid sequence TDYFDRSTHEYKYRTTP (SEQ ID NO: 145).
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, or 100% identical to any one of SEQ ID NOs: 140-142.
  • an antibody-like protein comprising a tenth fibronectin type III domain ( 10 Fn3) that binds EGFR with a K D of less than 500 nM and comprises a BC loop having the amino acid sequence set forth in amino acids 13-22 of SEQ ID NO: 156, a DE loop having the amino acid sequence set forth in amino acids 43-48 of SEQ ID NO: 156, and an FG loop having the amino acid sequence set forth in amino acids 68-84 of SEQ ID NO: 156.
  • 10 Fn3 tenth fibronectin type III domain
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence X g YWEGLPYQX h (SEQ ID NO: 161), a DE loop having the amino acid sequence X 1 RDVNX, (SEQ ID NO: 162), and an FG loop having the amino acid sequence X k DWYNPDTHEYIYHTIXi (SEQ ID NO: 163); wherein X is any amino acid and g, h, i, j, k and 1 are integers independently selected from 0 to 5.
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence S WYWEGLPYQ (SEQ ID NO: 158), a DE loop having the amino acid sequence PRDVNT (SEQ ID NO: 159), and an FG loop having the amino acid sequence TDWYNPDTHEYIYHTIP (SEQ ID NO: 160).
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, or 100% identical to any one of SEQ ID NOs: 155-157.
  • an antibody-like protein comprising a tenth fibronectin type III domain ( 10 Fn3) that binds EGFR with a K D of less than 500 nM and comprises a BC loop having the amino acid sequence set forth in amino acids 13-22 of SEQ ID NO: 171, a DE loop having the amino acid sequence set forth in amino acids 43-48 of SEQ ID NO: 171, and an FG loop having the amino acid sequence set forth in amino acids 68-84 of SEQ ID NO: 171.
  • 10 Fn3 tenth fibronectin type III domain that binds EGFR with a K D of less than 500 nM and comprises a BC loop having the amino acid sequence set forth in amino acids 13-22 of SEQ ID NO: 171, a DE loop having the amino acid sequence set forth in amino acids 43-48 of SEQ ID NO: 171, and an FG loop having the amino acid sequence set forth in amino acids 68-84 of SEQ ID NO: 171.
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence X g ASNRGTYQX h (SEQ ID NO: 176), a DE loop having the amino acid sequence X 1 GGVSX, (SEQ ID NO: 177), and an FG loop having the amino acid sequence X k DAFNPTTHEYNYFTTXi (SEQ ID NO: 178); wherein X is any amino acid and g, h, i, j, k and 1 are integers independently selected from 0 to 5.
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence SWASNRGTYQ (SEQ ID NO: 173), a DE loop having the amino acid sequence PGGVST (SEQ ID NO: 174), and an FG loop having the amino acid sequence TDAFNPTTHEYNYFTTP (SEQ ID NO: 175).
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, or 100% identical to any one of SEQ ID NOs: 170-172.
  • an antibody-like protein comprising a tenth fibronectin type III domain ( 10 Fn3) that binds EGFR with a K D of less than 500 nM and comprises a BC loop having the amino acid sequence set forth in amino acids 13-22 of SEQ ID NO: 186, a DE loop having the amino acid sequence set forth in amino acids 43-48 of SEQ ID NO: 186, and an FG loop having the amino acid sequence set forth in amino acids 68-84 of SEQ ID NO: 186.
  • 10 Fn3 tenth fibronectin type III domain
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence XgDAPTSRYQXh (SEQ ID NO: 190), a DE loop having the amino acid sequence X 1 GGLSX, (SEQ ID NO: 191), and an FG loop having the amino acid sequence X k DYKPHADGPHTYHESXi (SEQ ID NO: 139); wherein X is any amino acid and g, h, i, j, k and 1 are integers independently selected from 0 to 5.
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence SWD APTSRYQ (SEQ ID NO: 188), a DE loop having the amino acid sequence PGGLST (SEQ ID NO: 189), and an FG loop having the amino acid sequence TDYKPHADGPHTYHESP (SEQ ID NO: 117).
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, or 100% identical to any one of SEQ ID NOs: 185-187.
  • an antibody-like protein comprising a tenth fibronectin type III domain ( 10 Fn3) that binds EGFR with a K D of less than 500 nM and comprises a BC loop having the amino acid sequence set forth in amino acids 13-22 of SEQ ID NO: 199, a DE loop having the amino acid sequence set forth in amino acids 43-48 of SEQ ID NO: 199, and an FG loop having the amino acid sequence set forth in amino acids 68-84 of SEQ ID NO: 199.
  • 10 Fn3 tenth fibronectin type III domain
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence XgDAGAVTYQXh (SEQ ID NO: 203), a DE loop having the amino acid sequence X 1 GGVRX, (SEQ ID NO: 135), and an FG loop having the amino acid sequence X k DYKPHADGPHTYHEYXi (SEQ ID NO: 204); wherein X is any amino acid and g, h, i, j, k and 1 are integers independently selected from 0 to 5.
  • the EGFR binding 10 Fn3 comprises a BC loop having the amino acid sequence S WDAGAVTYQ (SEQ ID NO: 201), a DE loop having the amino acid sequence PGGVRT (SEQ ID NO: 110), and an FG loop having the amino acid sequence TDYKPHADGPHTYHEYP (SEQ ID NO: 202).
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, or 100% identical to any one of SEQ ID NOs: 198-200.
  • an EGFR binding 10 Fn3 domain is covalently or non-covalently linked to an EGF-IR binding 10 Fn3 domain.
  • the IGF-IR binding 10 Fn3 may comrpise a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 3, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 3, and an FG loop having the amino acid sequence set forth in amino acids 76-83 of SEQ ID NO: 3.
  • the IGF-IR binding 10 Fn3 comprises a BC loop having the amino acid sequence X a S ARLKV AX b (SEQ ID NO: 46), a DE loop having the amino acid sequence X c KNVYX d (SEQ ID NO: 48), and an FG loop having the amino acid sequence X e RFRDYQXf (SEQ ID NO: 50), wherein X is any amino acid and a, b, c, d, e, f, g, h, i, j, k, and 1 are integers independently selected from 0 to 5, or wherein a is 2 and b-f are 1, or wherein a-f are zero.
  • the IGF-IR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, 99, or 100% identical to SEQ ID NO: 3.
  • the IGF-IR binding 10 Fn3 comprises a 10 Fn3 scaffold having from has anywhere from 0 to 20, from 0 to 15, from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, conservative substitutions, deletions or additions relative to the scaffold amino acid residues of SEQ ID NO: 1.
  • the IGF-IR binding 10 Fn3 has anywhere from 0 to 15, from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, conservative substitutions, deletions or additions relative to the corresponding loop sequences of SEQ ID NO: 3.
  • an antibody-like protein multimer comprises at least one EGFR binding 10 Fn3 covalently or non-covalently linked to at least one IGFIR binding 10 Fn3.
  • the E/I binders described herein may be constructed as a single polypeptide chain wherein the E and I subunits may be in either orientation, e.g., from N-terminus to C-terminus, in the E-I orientation or in the I-E orientation.
  • the disclosure relates, in part, to the surprising discovery that multiple 10 Fn3 joined via a polypeptide linker correctly fold independently of each other, retain high affinity binding, and that each of the domains retains its functional properties (see e.g., Examples 5-10). Additionally, these E/I 10 Fn3 based binders demonstrate desirable biophysical properties such as low aggregation and high melting temperature (T m ) (see e.g., Example 4).
  • T m low aggregation and high melting temperature
  • the Examples characterize a variety of E/I 10 Fn3 based binders.
  • An exemplary IGFIR binding 10 Fn3 is set forth in SEQ ID NO: 4.
  • Exemplary EGFR binding 10 Fn3 are set forth in SEQ ID NOs: 6, 8, 52, 107, 113, 140, 155, 170, 185 and 198.
  • an E/I binder comprises an EGFR binding 10 Fn3 and an IGFIR binding 10 Fn3, independently having an amino acid sequence at least 40, 50, 60, 70, or 80% identical to the human 10 Fn3 domain, shown in SEQ ID NO: 1. Much of the variability will generally occur in one or more of the loops.
  • an E/I binder comprises an EGFR binding 10 Fn3 and an IGFIR binding 10 Fn3, independently having an amino acid sequence at least 70, 80, 85, 90, 95, 98, or 100% identical to SEQ ID NO: 32, wherein n is an integer from 1-20, o is an integer from 1-20, and p is an integer from 1-40. In some embodiments, n is an integer from 8-12, o is an integer from 4-8, and p is an integer from 4-28. In some embodiments, n is 10, o is 6, and p is 12.
  • the disclosure provides multimers of 10 Fn3 having at least one loop selected from loop BC, DE, and FG with an altered amino acid sequence relative to the sequence of the corresponding loop of the human 10 Fn3.
  • altered is meant one or more amino acid sequence alterations relative to a template sequence (corresponding human fibronectin domain) and includes amino acid additions, deletions, and substitutions. Altering an amino acid sequence may be accomplished through intentional, blind, or spontaneous sequence variation, generally of a nucleic acid coding sequence, and may occur by any technique, for example, PCR, error-prone PCR, or chemical DNA synthesis. In some embodiments, an amino acid sequence is altered by substituting with or adding naturally occurring amino acids.
  • one or more loops selected from BC, DE, and FG may be extended or shortened in length relative to the corresponding human fibronectin loop.
  • the FG loop of the human 10 Fn3 is 12 residues long, whereas the corresponding loop in antibody heavy chains ranges from 4-28 residues.
  • the length of the FG loop of 10 Fn3 may be altered in length as well as in sequence to obtain the greatest possible flexibility and affinity in antigen binding.
  • the altered BC loop has up to 10 amino acid substitutions, up to 9 amino acid deletions, up to 10 amino acid insertions, or a combination of substitutions and deletions or insertions.
  • the altered DE loop has up to 6 amino acid substitutions, up to 5 amino acid deletions, up to 14 amino acid insertions or a combination of substitutions and deletions or insertions.
  • the FG loop has up to 12 amino acid substitutions, up to 11 amino acid deletions, up to 28 amino acid insertions or a combination of substitutions and deletions or insertions.
  • Naturally occurring 10 Fn3 comprises an "arginine-glycine-aspartic acid" (RGD) integrin-binding motif in the FG loop.
  • RGD arginine-glycine-aspartic acid
  • Preferred multimers of 10 Fn3 lack an RGD integrin-binding motif.
  • an E/I binder is an antibody-like protein dimer comprising a) an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 5, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 5, and an FG loop having the amino acid sequence set forth in amino acids 76-92 of SEQ ID NO: 5; covalently or non-covalently linked to b) an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 3, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 3, and an FG loop having the amino acid sequence set forth in amino acids 76-83 of SEQ ID NO: 3.
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, 99, or 100% identical to SEQ ID NO: 5.
  • the IGFIR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, 99, or 100% identical to SEQ ID NO: 3.
  • the E/I binder comprises an amino acid sequence at least 80, 85, 90, 95, 98, 99, or 100% identical to SEQ ID NOs: 20, 21, 23, 24, 90, 92, 101 or 103.
  • an E/I binder is an antibody-like protein dimer comprising a) an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 7, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 7, and an FG loop having the amino acid sequence set forth in amino acids 76-87 of SEQ ID NO: 7; covalently or non-covalently linked to b) an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 3, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 3, and an FG loop having the amino acid sequence set forth in amino acids 76-83 of SEQ ID NO: 3.
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 7.
  • the IGFIR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 3.
  • the E/I binder comprises an amino acid sequence at least 80, 85, 90, 95, 98, or 100% identical to SEQ ID NOs: 26, 27, 29, 30, 89, 91, 100 or 102.
  • an E/I binder is an antibody-like protein dimer comprising a) an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 82, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 82, and an FG loop having the amino acid sequence set forth in amino acids 76-87 of SEQ ID NO: 82; covalently or non-covalently linked to b) an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 3, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 3, and an FG loop having the amino acid sequence set forth in amino acids 76-83 of SEQ ID NO: 3.
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 82.
  • the IGFIR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 3.
  • the E/I binder comprises an amino acid sequence at least 80, 85, 90, 95, 98, or 100% identical to SEQ ID NOs: 53, 54, 87, 88, 98, 99, 104 or 105.
  • an E/I binder is an antibody-like protein dimer comprising a) an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 106, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 106, and an FG loop having the amino acid sequence set forth in amino acids 76-92 of SEQ ID NO: 106; covalently or non-covalently linked to b) an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 3, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 3, and an FG loop having the amino acid sequence set forth in amino acids 76-83 of SEQ ID NO: 3.
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 106.
  • the IGFIR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 3.
  • the E/I binder comprises an amino acid sequence at least 80, 85, 90, 95, 98, or 100% identical to SEQ ID NOs: 118-125.
  • an E/I binder is an antibody-like protein dimer comprising a) an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 112, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 112, and an FG loop having the amino acid sequence set forth in amino acids 76-92 of SEQ ID NO: 112; covalently or non-covalently linked to b) an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 3, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 3, and an FG loop having the amino acid sequence set forth in amino acids 76-83 of SEQ ID NO: 3.
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 112.
  • the IGFIR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 3.
  • the E/I binder comprises an amino acid sequence at least 80, 85, 90, 95, 98, or 100% identical to SEQ ID NOs: 126-133.
  • an E/I binder is an antibody-like protein dimer comprising a) an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 13-22 of SEQ ID NO: 141, a DE loop having the amino acid sequence set forth in amino acids 43-48 of SEQ ID NO: 141, and an FG loop having the amino acid sequence set forth in amino acids 68-84 of SEQ ID NO: 141; covalently or non-covalently linked to b) an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 3, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 3, and an FG loop having the amino acid sequence set forth in amino acids 76-83 of SEQ ID NO: 3.
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 140, 141, 142 or 300.
  • the IGFIR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 3.
  • the E/I binder comprises an amino acid sequence at least 80, 85, 90, 95, 98, or 100% identical to SEQ ID NOs: 149-154.
  • an E/I binder is an antibody-like protein dimer comprising a) an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 13-22 of SEQ ID NO: 156, a DE loop having the amino acid sequence set forth in amino acids 43-48 of SEQ ID NO: 156, and an FG loop having the amino acid sequence set forth in amino acids 68-84 of SEQ ID NO: 156; covalently or non-covalently linked to b) an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 3, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 3, and an FG loop having the amino acid sequence set forth in amino acids 76-83 of SEQ ID NO: 3.
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 155, 156, 157 or 305.
  • the IGFIR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 3.
  • the E/I binder comprises an amino acid sequence at least 80, 85, 90, 95, 98, or 100% identical to SEQ ID NOs: 158-166.
  • an E/I binder is an antibody-like protein dimer comprising a) an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 13-22 of SEQ ID NO: 171, a DE loop having the amino acid sequence set forth in amino acids 43-48 of SEQ ID NO: 171, and an FG loop having the amino acid sequence set forth in amino acids 68-84 of SEQ ID NO: 171; covalently or non-covalently linked to b) an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 3, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 3, and an FG loop having the amino acid sequence set forth in amino acids 76-83 of SEQ ID NO: 3.
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 170, 171, 172 or 311.
  • the IGFIR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 3.
  • the E/I binder comprises an amino acid sequence at least 80, 85, 90, 95, 98, or 100% identical to SEQ ID NOs: 179-184.
  • an E/I binder is an antibody-like protein dimer comprising a) an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 13-22 of SEQ ID NO: 186, a DE loop having the amino acid sequence set forth in amino acids 43-48 of SEQ ID NO: 186, and an FG loop having the amino acid sequence set forth in amino acids 68-84 of SEQ ID NO: 186; covalently or non-covalently linked to b) an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 3, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 3, and an FG loop having the amino acid sequence set forth in amino acids 76-83 of SEQ ID NO: 3.
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 185, 186, 187 or 320.
  • the IGFIR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 3.
  • the E/I binder comprises an amino acid sequence at least 80, 85, 90, 95, 98, or 100% identical to SEQ ID NOs: 192-197.
  • an E/I binder is an antibody-like protein dimer comprising a) an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 13-22 of SEQ ID NO: 199, a DE loop having the amino acid sequence set forth in amino acids 43-48 of SEQ ID NO: 199, and an FG loop having the amino acid sequence set forth in amino acids 68-84 of SEQ ID NO: 199; covalently or non-covalently linked to b) an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 21-30 of SEQ ID NO: 3, a DE loop having the amino acid sequence set forth in amino acids 51-56 of SEQ ID NO: 3, and an FG loop having the amino acid sequence set forth in amino acids 76-83 of SEQ ID NO: 3.
  • the EGFR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 198, 199, 200 or 327.
  • the IGFIR binding 10 Fn3 has an amino acid sequence at least 80, 90, 95, 98, or 100% identical to SEQ ID NO: 3.
  • the E/I binder comprises an amino acid sequence at least 80, 85, 90, 95, 98, or 100% identical to SEQ ID NOs: 205-210.
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence X a S ARLKV AX b (SEQ ID NO: 46), a DE loop having the amino acid sequence X c KNVYX d (SEQ ID NO: 48), and an FG loop having the amino acid sequence X e RFRDYQX f (SEQ ID NO: 50) ; covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence XgDSGRGSYQXh (SEQ ID NO: 40), a DE loop having the amino acid sequence X 1 GP VHX, (SEQ ID NO: 42), and an FG loop having the amino acid sequence X k DHKPHADGPHTYHEXi (SEQ ID NO: 44); wherein X is any amino acid and a, b, c, d, e, f, g
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence S WS ARLKV AR (SEQ ID NO: 45), a DE loop having the amino acid sequence PKNVYT (SEQ ID NO: 47), and an FG loop having the amino acid sequence TRFRDYQP (SEQ ID NO: 49); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence SWDSGRGSYQ (SEQ ID NO: 39), a DE loop having the amino acid sequence PGPVHT (SEQ ID NO: 41), and an FG loop having the amino acid sequence TDHKPHADGPHTYHESP (SEQ ID NO: 43).
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence X a SARLKVAX b (SEQ ID NO: 46), a DE loop having the amino acid sequence X 0 KNVYX d (SEQ ID NO: 48), and an FG loop having the amino acid sequence X e RFRDYQX f (SEQ ID NO: 50); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence X m VAGAEDYQX n (SEQ ID NO: 34), a DE loop having the amino acid sequence X 0 HDLVX p (SEQ ID NO: 36), and an FG loop having the amino acid sequence X q DMMHVEYTEHX r (SEQ ID NO: 38); wherein X is any amino acid and a, b, c, d, e, f, m,
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence S WSARLKVAR (SEQ ID NO: 45), a DE loop having the amino acid sequence PKNVYT (SEQ ID NO: 47), and an FG loop having the amino acid sequence TRFRDYQP (SEQ ID NO: 49); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence SWVAGAEDYQ (SEQ ID NO: 33), a DE loop having the amino acid sequence PHDLVT (SEQ ID NO: 35), and an FG loop having the amino acid sequence TDMMHVEYTEHP (SEQ ID NO: 37).
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence X a SARLKVAX b (SEQ ID NO: 46), a DE loop having the amino acid sequence X c KNVYX d (SEQ ID NO: 48), and an FG loop having the amino acid sequence X e RFRDYQX f (SEQ ID NO: 50); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence XsLPGKLRYQX, (SEQ ID NO: 60), a DE loop having the amino acid sequence X U HDLRX W (SEQ ID NO: 62), and an FG loop having the amino acid sequence X y NMMHVEYSEYX z (SEQ ID NO: 64); wherein X is any amino acid and a, b, c, d, e, f, s, t
  • a and s are 2; b-f, u, w, y and z are 1; and t is zero. In some embodiments, a-f, s-u, w, y and z are zero.
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence S WSARLKVAR (SEQ ID NO: 45), a DE loop having the amino acid sequence PKNVYT (SEQ ID NO: 47), and an FG loop having the amino acid sequence TRFRDYQP (SEQ ID NO: 49); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence SWLPGKLRYQ (SEQ ID NO: 59), a DE loop having the amino acid sequence PHDLRT (SEQ ID NO: 61), and an FG loop having the amino acid sequence TNMMHVEYSEYP (SEQ ID NO: 63).
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence X a SARLKVAX b (SEQ ID NO: 46), a DE loop having the amino acid sequence X c KNVYX d (SEQ ID NO: 48), and an FG loop having the amino acid sequence X e RFRDYQX f (SEQ ID NO: 50); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence XgHERDGSRQXh (SEQ ID NO: 134), a DE loop having the amino acid sequence X 1 GGVRX, (SEQ ID NO: 135), and an FG loop having the amino acid sequence X k DYFNPTTHEYIYQTTXi (SEQ ID NO: 136); wherein X is any amino acid and a, b, c, d, e, f,
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence S WSARLKVAR (SEQ ID NO: 45), a DE loop having the amino acid sequence PKNVYT (SEQ ID NO: 47), and an FG loop having the amino acid sequence TRFRDYQP (SEQ ID NO: 49); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence SWHERDGSRQ (SEQ ID NO: 109), a DE loop having the amino acid sequence PGGVRT (SEQ ID NO: 110), and an FG loop having the amino acid sequence TDYFNPTTHEYIYQTTP (SEQ ID NO: 111).
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence X a SARLKVAX b (SEQ ID NO: 46), a DE loop having the amino acid sequence X 0 KNVYX d (SEQ ID NO: 48), and an FG loop having the amino acid sequence X e RFRDYQX f (SEQ ID NO: 50); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence XgWAPVDRYQXh (SEQ ID NO: 137), a DE loop having the amino acid sequence X 1 RDVYX, (SEQ ID NO: 138), and an FG loop having the amino acid sequence XkDYKPHADGPHTYHESXi (SEQ ID NO: 139); wherein X is any amino acid and a, b, c, d, e, f, g
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence S WSARLKVAR (SEQ ID NO: 45), a DE loop having the amino acid sequence PKNVYT (SEQ ID NO: 47), and an FG loop having the amino acid sequence TRFRDYQP (SEQ ID NO: 49); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence SWWAPVDRYQ (SEQ ID NO: 115), a DE loop having the amino acid sequence PRDVYT (SEQ ID NO: 116), and an FG loop having the amino acid sequence TDYKPHADGPHTYHESP (SEQ ID NO: 117).
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence X a SARLKVAX b (SEQ ID NO: 46), a DE loop having the amino acid sequence X c KNVYX d (SEQ ID NO: 48), and an FG loop having the amino acid sequence X e RFRDYQX f (SEQ ID NO: 50); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence XgTQGSTHYQXh (SEQ ID NO: 146), a DE loop having the amino acid sequence X 1 GMVYX, (SEQ ID NO: 147), and an FG loop having the amino acid sequence X k DYFDRSTHEYKYRTTXi (SEQ ID NO: 148); wherein X is any amino acid and a, b, c, d, e, f
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence S WSARLKVAR (SEQ ID NO: 45), a DE loop having the amino acid sequence PKNVYT (SEQ ID NO: 47), and an FG loop having the amino acid sequence TRFRDYQP (SEQ ID NO: 49); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence SWTQGSTHYQ (SEQ ID NO: 143), a DE loop having the amino acid sequence PGMVYT (SEQ ID NO: 144), and an FG loop having the amino acid sequence TDYFDRSTHEYKYRTTP (SEQ ID NO: 145).
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence X a SARLKVAX b (SEQ ID NO: 46), a DE loop having the amino acid sequence X c KNVYX d (SEQ ID NO: 48), and an FG loop having the amino acid sequence X e RFRDYQX f (SEQ ID NO: 50); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence XgYWEGLPYQXh (SEQ ID NO: 161), a DE loop having the amino acid sequence X 1 RDVNX, (SEQ ID NO: 162), and an FG loop having the amino acid sequence X k DWYNPDTHEYIYHTIXi (SEQ ID NO: 163); wherein X is any amino acid and a, b, c, d, e, f
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence S WSARLKVAR (SEQ ID NO: 45), a DE loop having the amino acid sequence PKNVYT (SEQ ID NO: 47), and an FG loop having the amino acid sequence TRFRDYQP (SEQ ID NO: 49); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence SWYWEGLPYQ (SEQ ID NO: 158), a DE loop having the amino acid sequence PRDVNT (SEQ ID NO: 159), and an FG loop having the amino acid sequence TDWYNPDTHEYIYHTIP (SEQ ID NO: 160).
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence X a SARLKVAX b (SEQ ID NO: 46), a DE loop having the amino acid sequence X 0 KNVYX d (SEQ ID NO: 48), and an FG loop having the amino acid sequence X e RFRDYQX f (SEQ ID NO: 50); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence XgASNRGTYQXh (SEQ ID NO: 176), a DE loop having the amino acid sequence X 1 GGVSX, (SEQ ID NO: 177), and an FG loop having the amino acid sequence X k DAFNPTTHEYNYFTTXi (SEQ ID NO: 178); wherein X is any amino acid and a, b, c, d, e, f, g
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence S WSARLKVAR (SEQ ID NO: 45), a DE loop having the amino acid sequence PKNVYT (SEQ ID NO: 47), and an FG loop having the amino acid sequence TRFRDYQP (SEQ ID NO: 49); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence SWASNRGTYQ (SEQ ID NO: 173), a DE loop having the amino acid sequence PGGVST (SEQ ID NO: 174), and an FG loop having the amino acid sequence TDAFNPTTHEYNYFTTP (SEQ ID NO: 175).
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence X a SARLKVAX b (SEQ ID NO: 46), a DE loop having the amino acid sequence X c KNVYX d (SEQ ID NO: 48), and an FG loop having the amino acid sequence X e RFRDYQX f (SEQ ID NO: 50); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence XgDAPTSRYQXh (SEQ ID NO: 190), a DE loop having the amino acid sequence X 1 GGLSX, (SEQ ID NO: 191), and an FG loop having the amino acid sequence XkDYKPHADGPHTYHESXi (SEQ ID NO: 139); wherein X is any amino acid and a, b, c, d, e, f, g,
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence S WSARLKVAR (SEQ ID NO: 45), a DE loop having the amino acid sequence PKNVYT (SEQ ID NO: 47), and an FG loop having the amino acid sequence TRFRDYQP (SEQ ID NO: 49); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence SWDAPTSRYQ (SEQ ID NO: 188), a DE loop having the amino acid sequence PGGLST (SEQ ID NO: 189), and an FG loop having the amino acid sequence TDYKPHADGPHTYHESP (SEQ ID NO: 117).
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence X a SARLKVAX b (SEQ ID NO: 46), a DE loop having the amino acid sequence X c KNVYX d (SEQ ID NO: 48), and an FG loop having the amino acid sequence X e RFRDYQX f (SEQ ID NO: 50); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence XgDAGAVTYQXh (SEQ ID NO: 203), a DE loop having the amino acid sequence X 1 GGVRX, (SEQ ID NO: 135), and an FG loop having the amino acid sequence X k DYKPHADGPHTYHEYXi (SEQ ID NO: 204); wherein X is any amino acid and a, b, c, d, e, f,
  • an E/I binder is an antibody-like protein dimer comprising an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence S WSARLKVAR (SEQ ID NO: 45), a DE loop having the amino acid sequence PKNVYT (SEQ ID NO: 47), and an FG loop having the amino acid sequence TRFRDYQP (SEQ ID NO: 49); covalently or non-covalently linked to an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence SWDAGAVTYQ (SEQ ID NO: 201), a DE loop having the amino acid sequence PGGVRT (SEQ ID NO: 110), and an FG loop having the amino acid sequence TDYKPHADGPHTYHEYP (SEQ ID NO: 202).
  • an E/I binder is an antibody-like protein dimer comprising a) an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 23-29 of SEQ ID NO: 3, a DE loop having the amino acid sequence set forth in amino acids 52-55 of SEQ ID NO: 3, and an FG loop having the amino acid sequence set forth in amino acids 77-82 of SEQ ID NO: 3; covalently or non-covalently linked to b) an EGFR binding 10 Fn3 comprising a BC, DE and FG loop as set forth in any one of SEQ ID NOs: 219-327 (see e.g., Figure 45 wherein the BC, DE and FG loop sequences for each EGFR binding 10 Fn3 are underlined).
  • an E/I binder is an antibody-like protein dimer comprising a) an IGFIR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids 23-29 of SEQ ID NO: 3, a DE loop having the amino acid sequence set forth in amino acids 52-55 of SEQ ID NO: 3, and an FG loop having the amino acid sequence set forth in amino acids 77-82 of SEQ ID NO: 3; covalently or non-covalently linked to b) an EGFR binding 10 Fn3 comprising a BC loop having the amino acid sequence set forth in amino acids corresponding to amino acid residues 23-30 of SEQ ID NO: 1 of any one of SEQ ID NOs: 5-8, 52, 66-68, 106-108, 112-114, 140-142, 155-157, 170-172, 182, 185-187, 198-200, or 219-327, a DE loop having the amino acid sequence set forth in amino acids corresponding to amino acid residues 52-55 of SEQ ID NO:
  • the EGFR binding 10 Fn3 of the antibody- like protein dimer comprises an amino acid sequence at least 80, 90, 95, or 100% identical to the amino acid sequence of amino acid residues corresponding to E9 of SEQ ID NO: 1 through T94 of SEQ ID NO: 1 of any one of SEQ ID NOs: 5-8, 52, 66-68, 106-108, 112-114, 140-142, 155-157, 170-172, 182, 185-187, 198-200, or 219-327.
  • the IGFIR binding 10 Fn3 of the antibody-like protein dimer has an amino acid sequence at least 80, 90, 95, 98, 99, or 100% identical to the amino acid sequence of amino acid residues corresponding to E9 of SEQ ID NO: 1 through T94 of SEQ ID NO: 1 of SEQ ID NO: 3.
  • the E/I binder comprises an amino acid sequence at least 80, 85, 90, 95, 98, 99, or 100% identical to any one of SEQ ID NOs: 20-31, 53-58, 87-92, 98-
  • X as defined herein is a naturally occurring amino acid.
  • the E binders, or the E and/or I monomers of the E/I binders described herein may contain a Ser to Cys amino acid substitution at a position corresponding to serine 62 or serine 91 of SEQ ID NO: 1.
  • the disclosure provides short peptide sequences that mediate EGFR binding.
  • sequences include the amino acid residues that correspond to the BC, DE, and FG loops from SEQ ID NOs: 5, 7, 82,
  • sequences include the amino acid residues that correspond to the BC, DE, and FG loops from SEQ ID NOs: 219-327.
  • the peptides bind to their respective ligand with a dissociation constant (K D ) of less than 50OnM, 10OnM, 5OnM, 5nM or less.
  • K D dissociation constant
  • Such sequences may mediate ligand binding in an isolated form or when inserted into a particular protein structure, such as an immunoglobulin or immunoglobulin- like domain.
  • an antibody-like protein dimer comprises a polypeptide having the structure A-B-C, wherein A is a polypeptide comprising, consisting essentially of, or consisting of a 10 Fn3 domain that binds to EGFR, B is a polypeptide linker, and C is a polypeptide comprising, consisting essentially of, or consisting of a 10 Fn3 domain that binds to IGF-IR.
  • a antibody-like protein dimer comprises a polypeptide having the structure A-B-C, wherein A is a polypeptide comprising, consisting essentially of, or consisting of a 10 Fn3 domain that binds to IGF-IR, B is a polypeptide linker, and C is a polypeptide comprising, consisting essentially of, or consisting of a 10 Fn3 domain that binds to EGFR.
  • antibody-like protein dimers having the structure A-B- C are polypeptides comprising (i) a polypeptide having an amino acid sequence set forth in any one of SEQ ID NOs: 20-31, 53-58, 87-92, 98-105, 118-133, 149-154, 164-169, 179-184, 192-197, 205-210 and 211-216, or (ii) a polypeptide comprising an amino acid sequence at least 85%, 90%, 95%, 97%, 98%, or 99% identical to any one of the amino acid sequences set forth in SEQ ID NOs: 20-31, 53-58, 87-92, 98- 105, 118-133, 149-154, 164-169, 179-184, 192-197, 205-210 and 211-216.
  • the A or C region is a polypeptide comprising a 10 Fn3 domain that binds to EGFR; wherein the 10 Fn3 domain has the structure from N-terminus to C-terminus: beta strand A, loop AB, beta strand B, loop BC, beta strand C, loop CD, beta strand D, loop DE, beta strand E, loop EF, beta strand F, loop FG, beta strand G; wherein: (i) the BC loop has the amino acid sequence of SEQ ID NO: 33 or 34, the DE loop has the amino acid sequence of SEQ ID NO: 35 or 36, and the FG loop has the amino acid sequence of SEQ ID NO: 37 or 38, (ii) the BC loop has the amino acid sequence of SEQ ID NO: 39 or 40, the DE loop has the amino acid sequence of SEQ ID NO: 41 or 42, and the FG loop has the amino acid sequence of SEQ ID NO: 43 or 44, (iii) the BC loop has the amino acid sequence of SEQ ID NO: 59
  • the 10 Fn3 domain that binds to EGFR preferably folds into a structure wherein the 7 beta strands are distributed between two beta sheets that pack against each other forming a stable core and wherein the beta strands are connected by the six loops which are solvent exposed.
  • the 10 Fn3 domain is from 80-150 amino acids in length.
  • the A or C region is a 10 Fn3 domain that binds to EGFR with a K D of less than 100 nM having a sequence selected from the group consisting of SEQ ID NO: 83-85 and 466-472 as set forth below:
  • the BC, DE and FG loops have a fixed sequence as shown in bold, or a sequence at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to the sequences shown in bold, the AB loop is represented by X n I, the CD is represented by X n 2, and EF loop is represented by X n 3, and the beta strands A-G are underlined.
  • X represents any amino acid and the subscript following the X represents an integer of the number of amino acids.
  • nl may be anywhere from 1-15, 2-15, 1-10, 2-10, 1-8, 2-8, 1-5, 2-5, 1-4, 2-4, 1-3, 2-3, or 1-2 amino acids; n2 and n3 may each independently be anywhere from 2-20, 2- 15, 2-10, 2-8, 5-20, 5-15, 5-10, 5-8, 6-20, 6-15, 6-10, 6-8, 2-7, 5-7, or 6-7 amino acids; and al-a6 may each independently comprise from 0-10, 0-5, 1-10, 1-5, or 2-5 amino acids. In preferred embodiments, nl is 2 amino acids, n2 is 7 amino acids, n3 is 7 amino acids, and al-a6 is 0 amino acids.
  • the sequences of the beta strands may have anywhere from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, deletions or additions across all 7 scaffold regions relative to the corresponding amino acids shown in SEQ ID NO: 1.
  • the sequences of the beta strands may have anywhere from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 conservative substitutions across all 7 scaffold regions relative to the corresponding amino acids shown in SEQ ID NO: 1.
  • the core amino acid residues are fixed and any substitutions, conservative substitutions, deletions or additions occur at residues other than the core amino acid residues.
  • the EGFR binder is represented by one of the following amino acid sequences:
  • the sequence of the BC, DE and FG loops have a fixed sequence as shown in bold, or a sequence at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to the sequences shown in bold, and the remaining sequence which is underlined (e.g., the sequence of the 7 beta strands and the AB, CD and EF loops) has anywhere from 0 to 20, from 0 to 15, from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, conservative substitutions, deletions or additions relative to the corresponding amino acids shown in SEQ ID NO: 66-68, 108, 114, 141, 156, 171, 186 and 199.
  • the core amino acid residues are fixed and any substitutions, conservative substitutions, deletions or additions occur at residues other than the core amino acid residues.
  • the 10 Fn3 domain that binds to EGFR may optionally comprise an N-terminal extension of from 1-20, 1- 15, 1-10, 1-8, 1-5, 1-4, 1-3, 1-2, or 1 amino acids in length.
  • N-terminal extensions include (represented by the single letter amino acid code) M, MG, G, MGVSDVPRDL (SEQ ID NO: 69), GVSDVPRDL (SEQ ID NO: 70), and VSDVPRDL (SEQ ID NO: 71), or N-terminal truncations of any one of SEQ ID NOs: 69, 70, or 71.
  • the 10 Fn3 domain that binds to EGFR may optionally comprise a C-terminal tail.
  • C-terminal tails include polypeptides that are from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, 1-2, or 1 amino acids in length.
  • Specific examples of C-terminal tails include EIDKPSQ (SEQ ID NO: 9), EIDKPCQ (SEQ ID NO: 10), and EIDK (SEQ ID NO: 78).
  • suitable C-terminal tails may be a C-terminally truncated fragment of SEQ ID NOs: 9, 10 or 78, including, for example, one of the following amino acid sequences (represented by the single letter amino acid code): E, EI, EID, EIDKP (SEQ ID NO: 79), EIDKPS (SEQ ID NO: 80), or EIDKPC (SEQ ID NO: 81).
  • Other suitable C- terminal tails include, for example, ES, EC, EGS, EGC, EGSGS (SEQ ID NO: 96), EGSGC (SEQ ID NO: 97), or EIEK (SEQ ID NO: 217).
  • the 10 Fn3 domain that binds to EGFR comprises both an N-terminal extension and a C-terminal tail.
  • the A region comprises an N-terminal extension beginning with GIy or Met-Gly and a C-terminal extension that does not contain a cysteine residue and the B region comprises an N-terminal extension that does not start with a Met and a C-terminal extension that comprises a cysteine residue.
  • 10 Fn3 domains that bind to EGFR are polypeptides comprising (i) a polypeptide having an amino acid sequence set forth in any one of SEQ ID NOs: 5-8, 52, 66-68, 82-85, 106-108, 112-114, 140-142, 155-157, 170-172, 185-187, 198-200, and 219-327, or (ii) a polypeptide comprising an amino acid sequence at least 85%, 90%, 95%, 97%, 98%, or 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs: 5-8, 52, 66-68, 82-85, 106-108, 112- 114, 140-142, 155-157, 170-172, 185-187, 198-200, and 219-327.
  • the A or C region is a polypeptide comprising a 10 Fn3 domain that binds to IGF-IR, wherein the 10 Fn3 domain has the structure from N-terminus to C-terminus: beta strand A, loop AB, beta strand B, loop BC, beta strand C, loop CD, beta strand D, loop DE, beta strand E, loop EF, beta strand F, loop FG, beta strand G, wherein the BC loop has the amino acid sequence of SEQ ID NO: 45 or 46, the DE loop has the amino acid sequence of SEQ ID NO: 47 or 48, and the FG loop has the amino acid sequence of SEQ ID NO: 49 or 50, wherein the 10 Fn3 domain folds into an antibody heavy chain variable region-like structure, and wherein the polypeptide binds to IGF-IR with a K D of less than 100 nM.
  • the 10 Fn3 domain that binds to IGF-IR preferably folds into a structure wherein the 7 beta strands are distributed between two beta sheets that pack against each other forming a stable core and wherein the beta strands are connected by the six loops which are solvent exposed.
  • the 10 Fn3 domain is from 80-150 amino acids in length.
  • the A or C region is a 10 Fn3 domain that binds to IGF-IR with a K D of less than 100 nM having the sequence set forth below:
  • the BC, DE and FG loops have a fixed sequence as shown in bold, or a sequence at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to the sequences shown in bold, the AB loop is represented by X nl , the CD loop is represented by X n2 , and the EF loop is represented by X n3 , and the beta strands A-G are underlined.
  • X represents any amino acid and the subscript following the X represents an integer of the number of amino acids.
  • nl may be anywhere from 1-15, 2-15, 1-10, 2-10, 1-8, 2-8, 1-5, 2-5, 1-4, 2-4, 1-3, 2-3, or 1-2 amino acids; n2 and n3 may each independently be anywhere from 2-20, 2-15, 2-10, 2-8, 5-20, 5-15, 5-10, 5-8, 6-20, 6-15, 6-10, 6-8, 2-7, 5-7, or 6-7 amino acids; and al-a6 may each independently comprise from 0-10, 0-5, 1-10, 1-5, or 2-5 amino acids. In preferred embodiments, nl is 2 amino acids, n2 is 7 amino acids, n3 is 7 amino acids, and al-a6 is 0 amino acids.
  • the sequences of the beta strands may have anywhere from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, deletions or additions across all 7 scaffold regions relative to the corresponding amino acids shown in SEQ ID NO: 1.
  • the sequences of the beta strands may have anywhere from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 conservative substitutions across all 7 scaffold regions relative to the corresponding amino acids shown in SEQ ID NO: 1.
  • the core amino acid residues are fixed and any substitutions, conservative substitutions, deletions or additions occur at residues other than the core amino acid residues.
  • the IGF-IR binder is represented by the following amino acid sequence:
  • the sequence of the BC, DE and FG loops have a fixed sequence as shown in bold, or a sequence at least 75%, 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to the sequences shown in bold, and the remaining sequence which is underlined (e.g., the sequence of the 7 beta strands and the AB, CD and EF loops) has anywhere from 0 to 20, from 0 to 15, from 0 to 10, from 0 to 8, from 0 to 6, from 0 to 5, from 0 to 4, from 0 to 3, from 0 to 2, or from 0 to 1 substitutions, conservative substitutions, deletions or additions relative to the corresponding amino acids shown in SEQ ID NO: 65.
  • the core amino acid residues are fixed and any substitutions, conservative substitutions, deletions or additions occur at residues other than the core amino acid residues.
  • the 10 Fn3 domain that binds to IGF-IR may optionally comprise an N-terminal extension of from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, 1-2, or 1 amino acids in length.
  • N-terminal extensions include (represented by the single letter amino acid code) M, MG, G, MGVSDVPRDL (SEQ ID NO: 69), GVSDVPRDL (SEQ ID NO: 70), and VSDVPRDL (SEQ ID NO: 71), or N-terminal truncations of any one of SEQ ID NOs: 69, 70, or 71.
  • the 10 Fn3 domain that binds to IGF-IR may optionally comprise a C-terminal tail.
  • C-terminal tails include polypeptides that are from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, 1-2, or 1 amino acids in length.
  • Specific examples of C-terminal tails include EIDKPSQ (SEQ ID NO: 9), EIDKPCQ (SEQ ID NO: 10), and EIDK (SEQ ID NO: 78).
  • suitable C-terminal tails may be a C-terminally truncated fragment of SEQ ID NOs: 9, 10 or 78, including, for example, one of the following amino acid sequences (represented by the single letter amino acid code): E, EI, EID, EIDKP (SEQ ID NO: 79), EIDKPS (SEQ ID NO: 80), or EIDKPC (SEQ ID NO: 81).
  • Other suitable C- terminal tails include, for example, ES, EC, EGS, EGC, EGSGS (SEQ ID NO: 96), EGSGC (SEQ ID NO: 97), or EIEK (SEQ ID NO: 217).
  • the 10 Fn3 domain that binds to IGF-IR comprises both an N-terminal extension and a C-terminal tail.
  • the A region comprises an N-terminal extension beginning with GIy or Met-Gly and a C-terminal extension that does not contain a cysteine residue and the B region comprises an N-terminal extension that does not start with a Met and a C-terminal extension that comprises a cysteine residue.
  • 10 Fn3 domains that bind to IGF-IR are polypeptides comprising (i) a polypeptide having an amino acid sequence set forth in any one of SEQ ID NOs: 3, 4, 65 or 86, or (ii) a polypeptide comprising an amino acid sequence at least 85%, 90%, 95%, 97%, 98%, or 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs: 3, 4, 65 or 86.
  • the B region is a linker as described further herein.
  • the B region is a polypeptide linker.
  • Exemplary polypeptide linkers include polypeptides having from 1-20, 1-15, 1-10, 1-8, 1-5, 1-4, 1-3, or 1-2 amino acids. Specific examples of suitable polypeptide linkers are described further herein and include, for example, linkers having a sequence selected from the group consisting of SEQ ID NOs: 11-19, 51, 93-95 and 218.
  • the linker may be a C-terminal tail polypeptide as described herein, an N-terminal extension polypeptide as described herein, or a combination thereof.
  • an antibody-like protein dimer comprises a polypeptide having the structure Xi-A-X 2 -B-X 3 -C-X 4 , wherein Xi is an optional N-terminal extension, A is a 10 Fn3 domain that binds to EGFR, X 2 is an optional C-terminal tail, B is a polypeptide linker, X 3 is an optional N-terminal extension, C is a 10 Fn3 domain that binds to IGF-IR, and X 4 is an optional C-terminal tail.
  • an antibody-like protein dimer comprises a polypeptide having the structure Xi-A-X 2 -B-X 3 -C-X 4 , wherein Xi is an optional N-terminal extension, A is a 10 Fn3 domain that binds to IGF-IR, X 2 is an optional C-terminal tail, B is a polypeptide linker, X 3 is an optional N-terminal extension, C is a 10 Fn3 domain that binds to EGFR, and X 4 is an optional C-terminal tail. Specific examples of suitable N-terminal extensions and C-terminal tails are described above.
  • one or more of X 1 , X 2 , B, X3 or X 4 may comprise an amino acid residue suitable for pegylation, such as a cysteine or lysine residue.
  • X 4 comprises at least one amino acid suitable for pegylation, such as a cysteine or lysine residue. Specific examples of suitable polypeptide linkers are described further below.
  • antibody-like protein dimers having the structure Xi-A-X 2 -B-X 3 -C-X 4 are polypeptides comprising (i) a polypeptide having the amino acid sequence set forth in any one of SEQ ID NOs: 20-31, 53-58, 87-92, 98-105, 118-133, 149-154, 164-169, 179-184, 192-197, 205-210 and 211- 216, or (ii) a polypeptide comprising an amino acid sequence at least 85%, 90%, 95%, 97%, 98%, or 99% identical to the amino acid sequence set forth in any one of SEQ ID NOs: 20-31, 53-58, 87-92, 98-105, 118-133, 149-154, 164-169, 179-184, 192-197, 205-210 and 211-216.
  • the binding affinities of the first and second 10 Fn3 domains of an antibody-like protein dimer may be similar to each other, e.g., binding affinities within 100-fold, 30-fold, 10-fold, 3-fold, 1-fold, 0.3-fold or 0.1 -fold, of each other, or binding affinities within 0.1 -fold to 10-fold, within 0.3-fold to 10-fold, within 0.1- fold to 3 -fold, within 0.3-fold to 3 -fold, within 0.1 -fold to 1-fold, within 0.3-fold to 1-fold, within 1-fold to 10-fold, within 3-fold to 10-fold, within 3-fold to 30-fold, or within 1-fold to 3-fold of each other.
  • Conjugation e.g., binding affinities within 100-fold, 30-fold, 10-fold, 3-fold, 1-fold, 0.3-fold or 0.1 -fold, of each other, or binding affinities within 0.1 -fold to 10-fold, within 0.3-fold to 10-fold, within 0.1- fold to 3 -fold, within
  • Multimers of antibody-like proteins may be covalently or non-covalently linked.
  • an EGFR binding 10 Fn3 may be directly or indirectly linked to an IGFIR binding 10 Fn3 via a polypeptide linker.
  • Suitable linkers for joining Fn3 are those which allow the separate domains to fold independently of each other forming a three dimensional structure that permits high affinity binding to a target molecule.
  • linker is a glycine-serine based linker. These linkers comprise glycine and serine residues and may be between 8 and 50, 10 and 30, and 10 and 20 amino acids in length.
  • linkers having an amino acid sequence GSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGSGS (SEQ ID NO: 11), GSGSGSGSGSGS (SEQ ID NO: 13), GGGGS GGGGS GGGGS (SEQ ID NO: 14), GGGGS GGGGS GGGGS GGGGS (SEQ ID NO: 15), GGGGS GGGGS GGGGS GGGGS (SEQ ID NO: 16), or GGGGSGGGGSGGGSG (SEQ ID NO: 17).
  • the linker is a glycine-proline based linker. These linkers comprise glycine and proline residues and may be between 3 and 30, 10 and 30, and 3 and 20 amino acids in length.
  • the linker is a proline-alanine based linker. These linkers comprise proline and alanine residues and may be between 3 and 30, 10 and 30, 3 and 20 and 6 and 18 amino acids in length. Examples of such linkers include SEQ ID NOs: 93, 94 and 95. It is contemplated, that the optimal linker length and amino acid composition may be determined by routine experimentation by methods well known in the art.
  • multimers of antibody-like proteins are linked via a polypeptide linker having a protease site that is cleavable by a protease in the blood or target tissue.
  • a polypeptide linker having a protease site that is cleavable by a protease in the blood or target tissue.
  • Such embodiments can be used to release two or more therapeutic proteins for better delivery or therapeutic properties or more efficient production compared to separately producing such proteins.
  • Additional linkers or spacers e.g., SEQ ID NOs: 9 and 10, may be introduced at the C-terminus of a Fn3 domain between the Fn3 domain and the polypeptide linker. Additional linkers or spacers may be introduced at the N- terminus of a Fn3 domain between the Fn3 domain and the polypeptide linker.
  • multimers of antibody-like proteins may be directly or indirectly linked via a polymeric linker.
  • Polymeric linkers can be used to optimally vary the distance between each protein moiety to create a protein with one or more of the following characteristics: 1) reduced or increased steric hindrance of binding of one or more protein domain when binding to a protein of interest, 2) increased protein stability or solubility, 3) decreased protein aggregation, and 4) increased overall avidity or affinity of the protein.
  • multimers of antibody-like proteins are linked via a biocompatible polymer such as a polymeric sugar.
  • the polymeric sugar can include an enzymatic cleavage site that is cleavable by an enzyme in the blood or target tissue.
  • Such embodiments can be used to release two or more therapeutic proteins for better delivery or therapeutic properties or more efficient production compared to separately producing such proteins
  • multimers of antibody-like proteins are linked via a polyoxyalkylene, in particular a polyethylene glycol (PEG) moiety.
  • Antibody-like proteins may comprise a cysteine containing linker, such as the linker set forth in SEQ ID NO: 10, 81, 97 or 218.
  • PEG may be conjugated to the cysteine moiety in the linker sequence and may operably link the two domains.
  • the disclosure provides E binders and E/I binders further comprising a pharmacokinetic (PK) moiety.
  • the E/I binder is a multimer of antibody-like proteins, in particular, a dimer of an EGFR binding 10 Fn3 and an IGFIR binding 10 Fn3.
  • Improved pharmacokinetics may be assessed according to the perceived therapeutic need. Often it is desirable to increase bioavailability and/or increase the time between doses, possibly by increasing the time that a protein remains available in the serum after dosing. In some instances, it is desirable to improve the continuity of the serum concentration of the protein over time (e.g., decrease the difference in serum concentration of the protein shortly after administration and shortly before the next administration).
  • E binders and E/I binders may be attached to a moiety that reduces the clearance rate of the polypeptide in a mammal (e.g., mouse, rat, or human) by greater than three-fold relative to the unmodified polypeptide.
  • Other measures of improved pharmacokinetics may include serum half-life, which is often divided into an alpha phase and a beta phase. Either or both phases may be improved significantly by addition of an appropriate moiety.
  • Moieties that tend to slow clearance of a protein from the blood include polyoxyalkylene moieties (e.g., polyethylene glycol); sugars (e.g., sialic acid); and well-tolerated protein moieties (e.g., Fc, Fc fragments, transferrin, or serum albumin).
  • polyoxyalkylene moieties e.g., polyethylene glycol
  • sugars e.g., sialic acid
  • well-tolerated protein moieties e.g., Fc, Fc fragments, transferrin, or serum albumin.
  • the PK moiety is a serum albumin binding protein such as those described in U.S. Publication Nos. 2007/0178082 and 2007/0269422.
  • the PK moiety is a serum immunoglobulin binding protein such as those described in U.S. Publication No. 2007/0178082.
  • the PK moiety is polyethylene glycol (PEG).
  • the serum clearance rate of a PK-modified antibody-like protein multimer may be decreased by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or even 90%, relative to the clearance rate of the unmodified E/I binders.
  • the PK-modified multimer may have a half- life (ti/ 2 ) which is enhanced relative to the half- life of the unmodified multimer.
  • the half-life of PK- binding polypeptide may be enhanced by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 400% or 500%, or even by 1000% relative to the half- life of the unmodified multimer.
  • the multimer half-life is determined in vitro, such as in a buffered saline solution or in serum. In other embodiments, the multimer half- life is an in vivo half life, such as the half- life of the multimer in the serum or other bodily fluid of an animal.
  • a PK moiety is linked to an antibody-like protein multimer via at least one disulfide bond, a peptide bond, a polypeptide, a polymeric sugar, or a polyethylene glycol moiety.
  • exemplary polypeptide linkers include PSTSTST (SEQ ID NO: 12), EIDKPSQ (SEQ ID NO: 9), and GS linkers, such as GSGSGSGSGS (SEQ ID NO: 13) and multimers thereof. Binding/Screening
  • E binders and E/I binders in particular, antibody- like protein multimers such as a dimer of an EGFR binding 10 Fn3 and an IGFIR binding 10 Fn3. Binding to EGFR or IGFIR may be assessed in terms of equilibrium constants (e.g., dissociation, K D ) and in terms of kinetic constants (e.g., on rate constant, k on and off rate constant, k o ff). In some embodiments, an antibody-like protein monomer or multimer will bind to EGFR with a K D of less than 50OnM, 10OnM, 5OnM, 5nM or less.
  • K D dissociation
  • an antibody-like protein multimer will bind to IGFIR with a K D of less than 50OnM, 10OnM, 5OnM, 5nM or less. Higher K D values may be tolerated where the k o ff is sufficiently low or the k on is sufficiently high.
  • E binders and E/I binders may bind to any part of EGFR, including the extracellular domain of a EGFR, in particular the ligand binding domain of EGFR. Binding of E binders and E/I binders to EGFR may disrupt the interaction of EGFR with one or more ligands, including TGF-alpha and EGF, and/or disrupt receptor dimerization. In some embodiments, E binders and E/I binders compete with an anti-EGFR antibody for binding to EGFR.
  • the anti-EGFR antibody may be selected from any known anti-EGFR antibody including panitumumab (Amgen), nimotuzumab (YM Biosciences), zalutumumab (Genmab), EMD72000 (Merck KGaA), and cetuximab (ImClone Systems).
  • panitumumab Amgen
  • nimotuzumab YM Biosciences
  • zalutumumab Genmab
  • EMD72000 Merck KGaA
  • cetuximab ImClone Systems
  • E binders and E/I binders inhibit downstream signaling of EGFR.
  • EGFR ligand binding leads to homo- or heterodimeric receptor dimerization with EGFR or another HER family member. Dimerization promotes receptor autophosphorylation, which in turn leads to the activation of several signaling pathways.
  • E/I binders may bind to any part of IGFIR, including the extracellular domain of a IGFIR, in particular the ligand binding domain of IGFIR. Binding of E/I binders to IGFIR may disrupt the interaction of IGFIR with one or more ligands, e.g., IGF-I and IGF-II; and/or disrupt assembly of receptor heterotetramers. In some embodiments, E/I binders compete with an anti-IGFIR antibody for binding to IGFIR. The anti-IGFIR antibody may be selected from any known anti-IGFIR antibody. In some embodiments, E/I binders inhibit downstream signaling of IGFIR.
  • the IGF-I receptor is composed of two types of subunits: an alpha subunit (a 130- 135 kDa protein that is entirely extracellular and functions in ligand binding) and a beta subunit (a 95 -kDa transmembrane protein, with transmembrane and cytoplasmic domains).
  • IGFIR is initially synthesized as a single chain proreceptor polypeptide that is processed by glycosylation, proteolytic cleavage, and covalent bonding to assemble into a mature 460-kDa heterotetramer comprising two alpha- subunits and two beta-subunits.
  • the beta subunit(s) possesses ligand-activated tyrosine kinase activity.
  • EGFR and IGFIR receptor signaling independently activates the MAPK pathway, including the phosphorylation of MEK.
  • Another activated pathway is the phosphatidylinositol 3-kinase (PI3K) pathway, including phosphorylation of AKT.
  • PI3K phosphatidylinositol 3-kinase
  • Receptor signaling is transduced to the nucleus, resulting in the activation of various transcription factors.
  • Screening assays may be designed to identify and characterize E binders and E/I binders. Binding assays, such as surface plasmon resonance and ELISA, and assays that detect activated signaling pathways are well-known in the art, see e.g., Example 5. Various antibodies, including many that are commercially available, have been produced which specifically bind to phosphorylated, activated isoforms of EGFR and IGFIR, see e.g., Examples 6 and 7. Downstream signaling events may also be used as an indicator of receptor inhibition, such as by measuring levels of AKT phosphorylation, see e.g., Example 8. Cell proliferation assays are also a useful method for characterizing the ability of candidate E/I binders to bind and inhibit EGFR and IGFIR signaling, see e.g., Example 9. Polymer conjugation
  • Conjugation to a biocompatible polymer may be used to link antibody-like protein multimers and/or to improve the pharmacokinetics of the proteins.
  • the identity, size and structure of the polymer is selected so as to improve the circulation half-life of the multimer or decrease the antigenicity of the multimer without an unacceptable decrease in activity.
  • polymers useful in the invention include, but are not limited to, poly(alkylene glycols) such as polyethylene glycol (PEG).
  • PEG polyethylene glycol
  • the polymer is not limited to a particular structure and can be linear (e.g., alkoxy PEG or bifunctional PEG), or non-linear such as branched, forked, multi-armed (e.g., PEGs attached to a polyol core), and dendritic.
  • PEG and other water-soluble polymers are activated with a suitable activating group appropriate for coupling to a desired site on the polypeptide.
  • a polymeric reagent will possess a reactive group for reaction with the polypeptide.
  • Representative polymeric reagents and methods for conjugating these polymers to an active moiety are well-known in the art and further described in Zalipsky, S., et al., "Use of Functionalized Poly(Ethylene Glycols) for Modification of Polypeptides" in Polyethylene Glycol Chemistry: Biotechnical and Biomedical Applications, J. M. Harris, Plenus Press, New York (1992), and in Zalipsky (1995) Advanced Drug Reviews 16: 157-182.
  • the weight-average molecular weight of the polymer is from about 100 Daltons to about 150,000 Daltons.
  • Exemplary weight-average molecular weights for the biocompatible polymer include about 20,000 Daltons, about 40,000 Daltons, about 60,000 Daltons and about 80,000 Daltons.
  • Branched versions of the biocompatible polymer having a total molecular weight of any of the foregoing can also be used.
  • the polymer is PEG.
  • PEG is a well-known, water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Kara, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161).
  • the term "PEG” is used broadly to encompass any polyethylene glycol molecule, without regard to size or to modification at an end of the PEG, and can be represented by the formula: X-O(CH 2 CH 2 OV I CH 2 CH 2 OH, where n is 20 to 2300 and X is H or a terminal modification, e.g., a Ci_ 4 alkyl.
  • PEG can contain further chemical groups which are necessary for binding reactions, which result from the chemical synthesis of the molecule; or which act as a spacer for optimal distance of parts of the molecule.
  • a PEG can consist of one or more PEG side- chains which are linked together. PEGs with more than one PEG chain are called multiarmed or branched PEGs. Branched PEG are described in, for example, European Published Application No. 473084A and U.S. Patent No. 5,932,462.
  • the hydroxyl end groups of the polymer molecule must be provided in activated form, i.e. with reactive functional groups.
  • Suitably activated polymer molecules are commercially available, e.g. from Nektar Therapeutics, Inc., Huntsville, Ala., USA; PoIyMASC Pharmaceuticals pic, UK; or SunBio Corporation, Anyang City, South Korea.
  • the polymer molecules can be activated by conventional methods known in the art, e.g. as disclosed in WO 90/13540.
  • activated PEG polymers include the following linear PEGs: NHS-PEG, SPA-PEG, SSPA-PEG, SBA-PEG, SS-PEG, SSA-PEG, SC-PEG, SG-PEG, SCM-PEG, NOR- PEG, BTC-PEG, EPOX-PEG, NCO-PEG, NPC-PEG, CDI-PEG, ALD-PEG, TRES- PEG, VS-PEG, OPSS-PEG, IODO-PEG, and MAL-PEG, and branched PEGs, such as PEG2-NHS, PEG2-MAL, and those disclosed in U.S. Pat. No. 5,932,462 and U.S. Pat. No. 5,643,575, both of which are incorporated herein by reference.
  • cysteine residues are native to the protein, whereas in other embodiments, one or more cysteine residues are engineered into the protein. Mutations may be introduced into a protein coding sequence to generate cysteine residues. This might be achieved, for example, by mutating one or more amino acid residues to cysteine.
  • Preferred amino acids for mutating to a cysteine residue include serine, threonine, alanine and other hydrophilic residues.
  • the residue to be mutated to cysteine is a surface- exposed residue.
  • Algorithms are well-known in the art for predicting surface accessibility of residues based on primary sequence or a protein.
  • surface residues may be predicted by comparing the amino acid sequences of binding polypeptides, given that the crystal structure of the framework based on which binding polypeptides are designed and evolved has been solved (see Himanen et al, Nature. (2001) 20-27;414(6866):933-8) and thus the surface-exposed residues identified.
  • cysteine residues are introduced into antibody- like protein multimers at or near the N- and/or C-terminus, or within loop regions.
  • Pegylation of cysteine residues may be carried out using, for example, PEG- maleiminde, PEG-vinylsulfone, PEG-iodoacetamide, or PEG-orthopyridyl disulfide.
  • the pegylated antibody-like protein multimer comprises a PEG molecule covalently attached to the alpha amino group of the N- terminal amino acid.
  • Site specific N-terminal reductive amination is described in Pepinsky et al, (2001) JPET, 297,1059, and U.S. Patent No. 5,824,784.
  • the use of a PEG-aldehyde for the reductive amination of a protein utilizing other available nucleophilic amino groups is described in U.S. Patent No. 4,002,531, in Wieder et al., (1979) J. Biol. Chem. 254,12579, and in Chamow et al., (1994) Bioconjugate Chem. 5, 133.
  • pegylated antibody-like protein multimer comprises one or more PEG molecules covalently attached to a linker, which in turn is attached to the alpha amino group of the amino acid residue at the N-terminus of the binding polypeptide.
  • an antibody-like protein multimer is pegylated at the C-terminus.
  • a protein may be pegylated at the C-terminus by the introduction of C- terminal azido-methionine and the subsequent conjugation of a methyl-PEG- triarylphosphine compound via the Staudinger reaction. This C-terminal conjugation method is described in Cazalis et al., C-Terminal Site-Specific PEGylation of a Truncated Thrombomodulin Mutant with Retention of Full Bioactivity, Bioconjug Chem. 2004;15(5):1005-1009.
  • the pegylated antibody-like protein multimers will preferably retain at least about 25%, 50%, 60%, 70%, 80%, 85%, 90%, 95% or 100% of the biological activity associated with the unmodified protein.
  • biological activity refers to its ability to bind to EGFR and IGFIR, as assessed by K D , k on or k o ff.
  • the pegylated antibody-like protein multimer shows an increase in binding to EGFR and/or IGFIR relative to unpegylated protein. Deimmunization of binding polypeptides
  • E binders and E/I binders in particular, antibody-like protein multimers, such as a dimer of an EGFR binding 10 Fn3 and an IGFIR binding 10 Fn3, may be altered to eliminate one or more B- or T-cell epitopes.
  • a protein, or a multimer of proteins may be deimmunized to render it non- immunogenic, or less immunogenic, to a given species. Deimmunization can be achieved through structural alterations to the protein. Any deimmunization technique known to those skilled in the art can be employed, see e.g., WO 00/34317, the disclosure of which is incorporated herein in its entirety.
  • the sequences of the E binders and E/I binders can be analyzed for the presence of MHC class II binding motifs. For example, a comparison may be made with databases of MHC-binding motifs such as, for example by searching the "motifs" database on the worldwide web at sitewehil.wehi.edu.au.
  • MHC class II binding peptides may be identified using computational threading methods such as those devised by Altuvia et al. (J. MoI. Biol. 249 244-250 (1995)) whereby consecutive overlapping peptides from the polypeptide are testing for their binding energies to MHC class II proteins.
  • Computational binding prediction algorithms include iTopeTM, Tepitope, SYFPEITHI, EpiMatrix (EpiVax), and MHCpred.
  • iTopeTM Tepitope
  • SYFPEITHI EpiMatrix
  • EpiVax EpiMatrix
  • MHCpred MHCpred
  • these epitopes are then eliminated by alteration of one or more amino acids, as required to eliminate the T-cell epitope.
  • alteration of one or more amino acids within the T-cell epitope itself This could involve altering an amino acid adjacent the epitope in terms of the primary structure of the protein or one which is not adjacent in the primary structure but is adjacent in the secondary structure of the molecule.
  • the usual alteration contemplated will be amino acid substitution, but it is possible that in certain circumstances amino acid addition or deletion will be appropriate.
  • the deimmunized sequence may be analyzed again to ensure that new T-cell epitopes have not been created and, if they have, the epitope(s) can be deleted.
  • T-cell epitopes identified computationally need to be removed.
  • a person skilled in the art will appreciate the significance of the "strength" or rather potential immunogenicity of particular epitopes.
  • the various computational methods generate scores for potential epitopes.
  • a person skilled in the art will recognize that only the high scoring epitopes may need to be removed.
  • a skilled person will also recognize that there is a balance between removing potential epitopes and maintaining binding affinity of the protein. Therefore, one strategy is to sequentially introduce substitutions into the protein and then test for antigen binding and immunogenicity.
  • the deimmunized protein is less immunogenic (or rather, elicits a reduced HAMA response) than the original protein in a human subject.
  • Assays to determine immunogenicity are well within the knowledge of the skilled person. Art-recognized methods of determining immune response can be performed to monitor a HAMA response in a particular subject or during clinical trials. Subjects administered deimmunized protein can be given an immunogenicity assessment at the beginning and throughout the administration of said therapy. The HAMA response is measured, for example, by detecting antibodies to the deimmunized protein in serum samples from the subject using a method known to one in the art, including surface plasmon resonance technology (BIAcore) and/or solid-phase ELISA analysis. Alternatively, in vitro assays designed to measure a T- cell activation event are also indicative of immunogenicity. Additional Modifications
  • E binders and E/I binders in particular, antibody- like protein multimers such as a dimer of an EGFR binding 10 Fn3 and an IGFIR binding 10 Fn3, may further comprise post-translational modifications.
  • exemplary post-translational protein modification include phosphorylation, acetylation, methylation, ADP-ribosylation, ubiquitination, glycosylation, carbonylation, sumoylation, biotinylation or addition of a polypeptide side chain or of a hydrophobic group.
  • the modified E binders and E/I binders may contain non-amino acid elements, such as lipids, poly- or mono-saccharide, and phosphates.
  • a preferred form of glycosylation is sialylation, which conjugates one or more sialic acid moieties to the polypeptide.
  • Sialic acid moieties improve solubility and serum half-life while also reducing the possible immunogenicity of the protein. See, e.g., Raju et al. Biochemistry. 2001 JuI 31;40(30):8868-76. Effects of such non-amino acid elements on the functionality of an E binder or E/I binder may be tested for its antagonizing role in EGFR and IGFIR signaling function.
  • E binders and E/I binders are modified to enhance antigen-dependent cell-mediated cytotoxicity (ADCC) and/or complement dependent cytotoxicity (CDC).
  • ADCC antigen-dependent cell-mediated cytotoxicity
  • CDC complement dependent cytotoxicity
  • the E/I binder is a dimer of an EGFR binding 10 Fn3 and an IGFIR binding 10 Fn3, further comprising an Fc region.
  • the Fc region is a variant that enhances ADCC or CDC.
  • the Fc region variant may comprise a human Fc region sequence (e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g., a substitution) at one or more amino acid positions, including positions 256, 290, 298, 312, 326, 330, 333, 334, 360, 378 or 430, wherein the numbering of the residues in the Fc region is that of the EU index as in Kabat.
  • a human Fc region sequence e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region
  • an amino acid modification e.g., a substitution
  • nucleic acid sequences encoding any of the proteins described herein.
  • nucleic acid sequences encoding any of the proteins described herein.
  • a nucleic acid sequence encoding a protein described herein may be modified slightly in sequence and yet still encode its respective gene product.
  • nucleic acids encoding the E/I binders described herein include nucleic acids having SEQ ID NOs: 442-465 or nucleic acids having a sequence at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 442-465.
  • Isolated nucleic acids which differ from the nucleic acids as set forth in SEQ ID NOs: 442-465 due to degeneracy in the genetic code are also within the scope of the invention.
  • E/I binders comprising an I monomer encoded by a nucleotide sequence at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 328 and/or E/I binders comprising an E monomer encoded by a nucleotide sequence at 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 329-441 or 495. Also provided are E binders encoded by a nucleotide sequence at 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to any one of SEQ ID NOs: 329-441 or 495. In certain embodiments, the nucleotide sequences encoding the E/I binders, an E monomer, or an I monomer do not contain a sequence encoding a 6XHis tag (SEQ ID NO: 487).
  • Nucleic acids encoding any of the various proteins or polypeptides disclosed herein may be synthesized chemically. Codon usage may be selected so as to improve expression in a cell. Such codon usage will depend on the cell type selected. Specialized codon usage patterns have been developed for E. coli and other bacteria, as well as mammalian cells, plant cells, yeast cells and insect cells. See for example: Mayf ⁇ eld et al, Proc Natl Acad Sci U S A. 2003 100(2):438-42; Sinclair et al. Protein Expr Purif. 2002 (l):96-105; Connell ND. Curr Opin Biotechnol. 2001 (5):446-9; Makrides et al. Microbiol Rev. 1996 60(3):512-38; and Sharp et al. Yeast. 1991 7(7):657-78.
  • Such regulatory elements include a transcriptional promoter, an optional operator sequence to control transcription, a sequence encoding suitable mRNA ribosomal binding sites, and sequences that control the termination of transcription and translation.
  • a transcriptional promoter an optional operator sequence to control transcription
  • a sequence encoding suitable mRNA ribosomal binding sites and sequences that control the termination of transcription and translation.
  • the ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants are additionally incorporated.
  • Suitable regulatory elements are well-known in the art.
  • the proteins described herein may be produced as a fusion protein with a heterologous polypeptide, which is preferably a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide.
  • the heterologous signal sequence selected preferably is one that is recognized and processed (i.e., cleaved by a signal peptidase) by the host cell.
  • the signal sequence is substituted by a prokaryotic signal sequence selected, for example, from the group of the alkaline phosphatase, penicillinase, lpp, or heat- stable enterotoxin II leaders.
  • the native signal sequence may be substituted by, e.g., the yeast invertase leader, a factor leader (including Saccharomyces and Kluyveromyces alpha-factor leaders), or acid phosphatase leader, the C. albicans glucoamylase leader, or the signal described in PCT Publication No. WO 90/13646.
  • yeast invertase leader a factor leader (including Saccharomyces and Kluyveromyces alpha-factor leaders), or acid phosphatase leader, the C. albicans glucoamylase leader, or the signal described in PCT Publication No. WO 90/13646.
  • mammalian signal sequences as well as viral secretory leaders for example, the herpes simplex gD signal, are available.
  • the DNA for such precursor regions may be ligated in reading frame to DNA encoding the protein.
  • Expression vectors used in eukaryotic host cells will also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5' and, occasionally 3', untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding the multivalent antibody.
  • One useful transcription termination component is the bovine growth hormone polyadenylation region. See PCT Publication No. WO 94/11026 and the expression vector disclosed therein.
  • the recombinant DNA can also include any type of protein tag sequence that may be useful for purifying the protein.
  • protein tags include but are not limited to a histidine tag, a FLAG tag, a myc tag, an HA tag, or a GST tag.
  • Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts can be found in Cloning Vectors: A Laboratory Manual, (Elsevier, New York, 1985), the relevant disclosure of which is hereby incorporated by reference.
  • the expression construct is introduced into the host cell using a method appropriate to the host cell, as will be apparent to one of skill in the art.
  • a variety of methods for introducing nucleic acids into host cells are known in the art, including, but not limited to, electroporation; transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment; lipofection; and infection (where the vector is an infectious agent).
  • Suitable host cells include prokaryotes, yeast, mammalian cells, or bacterial cells.
  • Suitable bacteria include gram negative or gram positive organisms, for example, E. coli or Bacillus spp. Yeast, preferably from the Saccharomyces species, such as S. cerevisiae, may also be used for production of polypeptides.
  • Various mammalian or insect cell culture systems can also be employed to express recombinant proteins. Baculo virus systems for production of heterologous proteins in insect cells are reviewed by Luckow and Summers, (Bio/Technology, 6:47, 1988).
  • vertebrate cells such as for glycosylation
  • tissue culture tissue culture
  • suitable mammalian host cell lines include endothelial cells, COS-7 monkey kidney cells, CV-I, L cells, C 127, 3T3, Chinese hamster ovary (CHO), human embryonic kidney cells, HeLa, 293, 293T, and BHK cell lines.
  • endothelial cells COS-7 monkey kidney cells
  • CV-I endothelial cells
  • L cells L cells
  • Chinese hamster ovary (CHO) human embryonic kidney cells
  • HeLa HeLa, 293, 293T
  • BHK cell lines the small size of the protein multimers described herein would make E. coli the preferred method for expression.
  • Host cells are transformed with the herein-described expression or cloning vectors for protein production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
  • the host cells used to produce the proteins of this invention may be cultured in a variety of media.
  • Commercially available media such as Ham's FlO (Sigma), Minimal Essential Medium ((MEM), Sigma), RPMI- 1640 (Sigma), and Dulbecco's Modified Eagle's Medium ((DMEM), Sigma) are suitable for culturing the host cells.
  • any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as GENTAMYCINTM drug), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.
  • the culture conditions such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
  • Proteins disclosed herein can also be produced using cell-translation systems.
  • the nucleic acids encoding the proteins must be modified to allow in vitro transcription to produce mRNA and to allow cell-free translation of the mRNA in the particular cell-free system being utilized.
  • Exemplary eukaryotic cell-free translation systems include, for example, mammalian or yeast cell-free translation systems
  • exemplary prokaryotic cell-free translation systems include, for example, bacterial cell-free translation systems.
  • Proteins disclosed herein can also be produced by chemical synthesis (e.g., by the methods described in Solid Phase Peptide Synthesis, 2nd ed., 1984, The Pierce Chemical Co., Rockford, IL). Modifications to the protein can also be produced by chemical synthesis.
  • the proteins disclosed herein can be purified by isolation/purification methods for proteins generally known in the field of protein chemistry.
  • Non- limiting examples include extraction, recrystallization, salting out (e.g., with ammonium sulfate or sodium sulfate), centrifugation, dialysis, ultrafiltration, adsorption chromatography, ion exchange chromatography, hydrophobic chromatography, normal phase chromatography, reversed-phase chromatography, gel filtration, gel permeation chromatography, affinity chromatography, electrophoresis, countercurrent distribution or any combinations of these.
  • proteins may be exchanged into different buffers and/or concentrated by any of a variety of methods known to the art, including, but not limited to, filtration and dialysis.
  • the purified proteins are preferably at least 85% pure, more preferably at least 95% pure, and most preferably at least 98% pure. Regardless of the exact numerical value of the purity, the proteins are sufficiently pure for use as a pharmaceutical product.
  • the E binders described herein can be detectably labeled and used to contact cells expressing EGFR for imaging or diagnostic applications.
  • the E/I binders described herein can be detectably labeled and used to contact cells expressing EGFR and/or IGFIR for imaging or diagnostic applications. Any method known in the art for conjugating a protein to the detectable moiety may be employed, including those methods described by Hunter, et al., Nature 144:945 (1962); David, et al., Biochemistry 13:1014 (1974); Pain, et al., J. Immunol. Meth. 40:219 (1981); and Nygren, J. Histochem. and Cytochem. 30:407 (1982).
  • the E binders and E/I binders described herein are further attached to a label that is able to be detected (e.g., the label can be a radioisotope, fluorescent compound, enzyme or enzyme co-factor).
  • the label may be a radioactive agent, such as: radioactive heavy metals such as iron chelates, radioactive chelates of gadolinium or manganese, positron emitters of oxygen, nitrogen, iron, carbon, or gallium, 43 K, 52 Fe, 57 Co, 67 Cu, 67 Ga, 68 Ga, 123 I, 125 I, 131 I, 132 I, or 99 Tc.
  • An E binder or E/I binder affixed to such a moiety may be used as an imaging agent and is administered in an amount effective for diagnostic use in a mammal such as a human and the localization and accumulation of the imaging agent is then detected.
  • the localization and accumulation of the imaging agent may be detected by radioscintigraphy, nuclear magnetic resonance imaging, computed tomography or positron emission tomography.
  • the amount of radioisotope to be administered is dependent upon the radioisotope.
  • Those having ordinary skill in the art can readily formulate the amount of the imaging agent to be administered based upon the specific activity and energy of a given radionuclide used as the active moiety.
  • E binders and E/I binders also are useful as affinity purification agents.
  • the proteins are immobilized on a suitable support, such a Sephadex resin or filter paper, using methods well known in the art.
  • the proteins can be employed in any known assay method, such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays (Zola, Monoclonal Antibodies: A Manual of Techniques, pp. 147-158 (CRC Press, Inc., 1987)).
  • E binders are useful in methods for detecting EGFR in a sample.
  • E/I binders also are useful in methods for detecting EGFR and/or IGFIR in a sample.
  • the sample will often by a biological sample, such as a biopsy, and particularly a biopsy of a tumor, a suspected tumor.
  • the sample may be from a human or other mammal.
  • the E binder or E/I binder may be labeled with a labeling moiety, such as a radioactive moiety, a fluorescent moiety, a chromogenic moiety, a chemiluminescent moiety, or a hapten moiety; and may be immobilized on a solid support.
  • Detection may be carried out using any technique known in the art, such as, for example, radiography, immunological assay, fluorescence detection, mass spectroscopy, or surface plasmon resonance.
  • Therapeutic/in vivo uses
  • the E binders described herein are also useful in methods for treating conditions which respond to an inhibition of EGFR biological activity.
  • the E/I binders described herein are also useful in methods for treating conditions which respond to an inhibition of EGFR and/or IGFIR biological activity.
  • EGFR and IGFIR are involved either directly or indirectly in the signal transduction pathways of various cell activities, including proliferation, adhesion and migration, as well as differentiation.
  • the application provides methods for treating a subject afflicted with a hyperproliferative disorder with a therapeutically effective amount of an E binder or an E/I binder.
  • E binders and E/I binders are useful for the treatment and/or prophylaxis of tumors and/or tumor metastases.
  • the E/I binder is an antibody-like protein multimer such as a dimer of an EGFR binding 10 Fn3 and an IGFIR binding 10 Fn3.
  • compositions comprising E binders or E/I binders are administered to a subject afflicted with a tumor, including but not limited to, a brain tumor, tumor of the urogenital tract, tumor of the lymphatic system, stomach tumor, laryngeal tumor, monocytic leukemia, lung adenocarcinoma, small-cell lung carcinoma, pancreatic cancer, glioblastoma and breast carcinoma; or a cancerous disease, including but not limited to, squamous cell carcinoma, bladder cancer, stomach cancer, liver cancer, kidney cancer, colorectal cancer, breast cancer, head cancer, neck cancer, oesophageal cancer, gynecological cancer, thyroid cancer, lymphoma, chronic leukemia and acute leukemia.
  • a tumor including but not limited to, a brain tumor, tumor of the urogenital tract, tumor of the lymphatic system, stomach tumor, laryngeal tumor, monocytic leukemia, lung adenocarcinoma, small-cell
  • An E binder or an E/I binder can be administered alone or in combination with one or more additional therapies such as chemotherapy radiotherapy, immunotherapy, surgical intervention, or any combination of these. Long-term therapy is equally possible as is adjuvant therapy in the context of other treatment strategies, as described herein. Techniques and dosages for administration vary depending on the type of specific polypeptide and the specific condition being treated but can be readily determined by the skilled artisan. Additional Agents That May be Used with E/I Binders
  • E binder or E/I binders and an additional therapeutic agent, such as a cytotoxic agent.
  • an E binder or E/I binder is linked to a cytotoxic agent.
  • Such embodiments can be prepared by in vitro or in vivo methods as appropriate. In vitro methods include conjugation chemistry well know in the art, such as conjugation to cysteine and lysine residues.
  • a linking group or reactive group is used. Suitable linking groups are well known in the art and include disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups and esterase labile groups.
  • Cytotoxic agents can also be linked to E binders or E/I binders through an intermediary carrier molecule such as serum albumin
  • Exemplary cytotoxic agents that may be linked to E binders or E/I binders include maytansinoids, taxanes, analogs of CC- 1065, bacterial toxin, plant toxin, ricin, abrin, a ribonuclease (RNase), DNase I, a protease, Staphylococcal enterotoxin-A, pokeweed antiviral protein, gelonin, diphtherin toxin, Pseudomonas exotoxin, Pseudomonas endotoxin, Ranpimase (Rap), Rap (N69Q), methotrexate, daunorubicin, doxorubicin, vincristine, vinblastine, melphalan, mitomycin C, chlorambucil, and calicheamicin.
  • E binders or E/I binders are co-administered, or administered sequentially, with one or more additional therapeutic agents.
  • Suitable therapeutic agents include, but are not limited to, cytotoxic or cytostatic agents, such as cancer therapeutic agents.
  • Cancer therapeutic agents are those agents that seek to kill or limit the growth of cancer cells while having minimal effects on the patient. Thus, such agents may exploit any difference in cancer cell properties (e.g., metabolism, vascularization or cell-surface antigen presentation) from healthy host cells.
  • Therapeutic agents that can be combined with E/I binders for improved anti-cancer efficacy include diverse agents used in oncology practice (Reference: Cancer, Principles & Practice of Oncology, DeVita, V. T., Hellman, S., Rosenberg, S.
  • doxorubicin such as doxorubicin, epirubicin, cyclophosphamide, trastuzumab, capecitabine, tamoxifen, toremifene, letrozole, anastrozole, fulvestrant, exemestane, goserelin, oxaliplatin, carboplatin, cisplatin, dexamethasone, antide, bevacizumab, 5-fluorouracil, leucovorin, levamisole, irinotecan, etoposide, topotecan, gemcitabine, vinorelbine, estramustine, mitoxantrone, abarelix, zoledronate, streptozocin, rituximab, idarubicin, busulfan, chlorambucil, fludarabine, imatinib, cytarabine, ibritumom
  • the present application provides methods for treating conditions which respond to an inhibition of EGFR and/or IGFIR biological activity.
  • Techniques and dosages for administration vary depending on the type of specific polypeptide and the specific condition being treated but can be readily determined by the skilled artisan.
  • regulatory agencies require that a protein reagent to be used as a therapeutic is formulated so as to have acceptably low levels of pyrogens.
  • therapeutic formulations will generally be distinguished from other formulations in that they are substantially pyrogen free, or at least contain no more than acceptable levels of pyrogen as determined by the appropriate regulatory agency (e.g., FDA).
  • the E binders and E/I binders are are pharmaceutically acceptable to a mammal, in particular a human.
  • a "pharmaceutically acceptable" polypeptide refers to a polypeptide that is administered to an animal without significant adverse medical consequences.
  • Examples of pharmaceutically acceptable E binders and E/I binders include 10 Fn3 domains that lack the integrin-binding domain (RGD) and 10 Fn3 domains that are essentially endotoxin free or have very low endotoxin levels.
  • compositions may be administered with a pharmaceutically acceptable diluent, carrier, or excipient, in unit dosage form. Administration may be parenteral (e.g., intravenous, subcutaneous), oral, or topical, as non-limiting examples.
  • parenteral e.g., intravenous, subcutaneous
  • oral e.g., oral, or topical
  • any gene therapy technique using nucleic acids encoding E binders or E/I binders may be employed, such as naked DNA delivery, recombinant genes and vectors, cell-based delivery, including ex vivo manipulation of patients' cells, and the like.
  • the composition can be in the form of a pill, tablet, capsule, liquid, or sustained release tablet for oral administration; a liquid for intravenous, subcutaneous or parenteral administration; or a gel, lotion, ointment, cream, or a polymer or other sustained release vehicle for local administration.
  • Methods well known in the art for making formulations are found, for example, in "Remington: The Science and Practice of Pharmacy” (20th ed., ed. A.R. Gennaro AR., 2000, Lippincott Williams & Wilkins, Philadelphia, PA).
  • Formulations for parenteral administration may, for example, contain excipients, sterile water, saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, or hydrogenated napthalenes.
  • Biocompatible, biodegradable lactide polymer, lactide/glycolide copolymer, or polyoxyethylene-polyoxypropylene copolymers may be used to control the release of the compounds.
  • Nanoparticulate formulations e.g., biodegradable nanoparticles, solid lipid nanoparticles, liposomes
  • parenteral delivery systems include ethylene-vinyl acetate copolymer particles, osmotic pumps, implantable infusion systems, and liposomes.
  • concentration of the compound in the formulation varies depending upon a number of factors, including the dosage of the drug to be administered, and the route of administration.
  • the polypeptide may be optionally administered as a pharmaceutically acceptable salt, such as non-toxic acid addition salts or metal complexes that are commonly used in the pharmaceutical industry.
  • acid addition salts include organic acids such as acetic, lactic, pamoic, maleic, citric, malic, ascorbic, succinic, benzoic, palmitic, suberic, salicylic, tartaric, methanesulfonic, toluenesulfonic, or trifluoroacetic acids or the like; polymeric acids such as tannic acid, carboxymethyl cellulose, or the like; and inorganic acid such as hydrochloric acid, hydrobromic acid, sulfuric acid phosphoric acid, or the like.
  • Metal complexes include zinc, iron, and the like.
  • the polypeptide is formulated in the presence of sodium acetate to increase thermal stability.
  • Formulations for oral use include tablets containing the active ingredient(s) in a mixture with non-toxic pharmaceutically acceptable excipients.
  • excipients may be, for example, inert diluents or fillers (e.g., sucrose and sorbitol), lubricating agents, glidants, and anti-adhesives (e.g., magnesium stearate, zinc stearate, stearic acid, silicas, hydrogenated vegetable oils, or talc).
  • Formulations for oral use may also be provided as chewable tablets, or as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium.
  • a therapeutically effective dose refers to a dose that produces the therapeutic effects for which it is administered.
  • the exact dose will depend on the disorder to be treated, and may be ascertained by one skilled in the art using known techniques.
  • the E binder or E/I binder is administered at about 0.01 ⁇ g/kg to about 50 mg/kg per day, preferably 0.01 mg/kg to about 30 mg/kg per day, most preferably 0.1 mg/kg to about 20 mg/kg per day.
  • the polypeptide may be given daily (e.g., once, twice, three times, or four times daily) or less frequently (e.g., once every other day, once or twice weekly, or monthly).
  • adjustments for age as well as the body weight, general health, sex, diet, time of administration, drug interaction, and the severity of the disease may be necessary, and will be ascertainable with routine experimentation by those skilled in the art.
  • Example 1 In Cell Western Assay to Screen for EGFR Activity
  • Cells were seeded into poly-D-lysine coated 96-well microtiter plates (Becton Dickinson, Franklin Lakes, NJ) at 24,000 cells/well for A431 epidermoid carcinoma or FaDu head & neck carcinoma cells and allowed to adhere overnight. Cells were washed once and then incubated for 24 hours in serum free media. Serial dilutions of the 10 Fn3-based binders were next applied to the cells and incubated for 2-3 hours prior to stimulation with 100 ng/ml EGF for 10 minutes. Following stimulation, cells were fixed for 20 minutes in PBS containing 3.7% formaldehyde and then permeabilized in PBS containing 0.1% triton-X-100 for 15 minutes.
  • E/I binders were produced by covalently linking an EGFR-binding 10 ⁇ Fn3 to an IGFIR-binding 10 Fn3 using a glycine-serine linker, thereby generating 10 Fn3 dimers, wherein each 10 Fn3 domain binds to a different target.
  • the IGFIR-binding 10 Fn3 (II) was previously described as SEQ ID NO: 226 in PCT Publication No. WO 2008/066752.
  • Two novel EGFR-binding 10 Fn3 (E2 and El) were identified by screening an RNA-protein fusion library, as described in PCT Publication No. WO 2008/066752, for binders to EGFR-Fc (R&D Systems, Minneapolis, MN).
  • E2-GS 10-11 SEQ ID NO: 25
  • El-GSlO-Il SEQ ID NO: 31
  • Il -GS 10-El SEQ ID NO: 28
  • I1-GS10-E2 SEQ ID NO: 22
  • Examples 32 also describes a variety of E monomers having the sequences set forth in Figure 45 and including a His tag at the C-terminus.
  • the various 10 Fn3-based binders were purified using a high throughput protein production process (HTPP). Selected binders were cloned into the pET9d vector in order to generate HiS 6 tag (SEQ ID NO: 487) fusions.
  • DNA was transformed into E. coli HMS174(DE3), and cells were inoculated in 5 ml LB medium containing 50 ⁇ g/mL kanamycin in a 24-well format and grown at 37 0 C overnight. Fresh 5 ml LB medium (50 ⁇ g/mL kanamycin) cultures were prepared for inducible expression by aspirating 200 ⁇ l from the overnight culture and dispensing it into the appropriate well.
  • the cultures were grown at 37 0 C until A 60O 0.6-0.9. After induction with 1 mM isopropyl- ⁇ -thiogalactoside (IPTG), the culture was grown for another 6 hours at 30 0 C and harvested by centrifugation for 10 minutes at 3220 x g at 4 0 C. Cell pellets were frozen at 80 0 C.
  • IPTG isopropyl- ⁇ -thiogalactoside
  • Cell pellets (in 24-well format) were lysed by resuspension in 450 ⁇ l of Lysis buffer (50 mM NaH 2 PO 4 , 0.5 M NaCl, Ix CompleteTM Protease Inhibitor Cocktail- EDTA free (Roche), 1 mM PMSF, 10 mM CHAPS, 40 mM imidazole, 1 mg/ml lysozyme, 30 ug/ml DNAse, 2 ⁇ g/ml aprotonin, pH 8.0) and shaken at room temperature for 1 hour.
  • Lysis buffer 50 mM NaH 2 PO 4 , 0.5 M NaCl, Ix CompleteTM Protease Inhibitor Cocktail- EDTA free (Roche), 1 mM PMSF, 10 mM CHAPS, 40 mM imidazole, 1 mg/ml lysozyme, 30 ug/ml DNAse, 2 ⁇ g/ml aprotonin, pH 8.0
  • Lysates were clarified and re-racked into a 96-well format by transfer into a 96-well Whatman GF/D Unifilter fitted with a 96-well, 650 ⁇ l catch plate and centrifuged for 5 minutes at 200 x g.
  • the clarified lysates were transferred to a 96-well Ni-Chelating Plate that had been equilibrated with equilibration buffer (50 mM NaH 2 PO 4 , 0.5 M NaCl,10 mM CHAPS, 40 mM imidazole, pH 8.0) and incubated for 5 minutes. Unbound material was removed by vacuum.
  • equilibration buffer 50 mM NaH 2 PO 4 , 0.5 M NaCl,10 mM CHAPS, 40 mM imidazole, pH 8.0
  • the resin was washed 2 x 0.3 ml/well with Wash buffer #1 (50 mM NaH 2 PO 4 , 0.5 M NaCl, 5 mM CHAPS, 40 mM imidazole, pH 8.0) with each wash removed by vacuum.
  • Wash buffer #1 50 mM NaH 2 PO 4 , 0.5 M NaCl, 5 mM CHAPS, 40 mM imidazole, pH 8.0
  • the resin was washed with 3 x 0.3 ml/well with PBS with each wash step removed by vacuum.
  • PBS + 20 mM EDTA 50 ⁇ l Elution buffer
  • Protein was eluted by applying an additional 100 ⁇ l of Elution buffer to each well.
  • the plate(s) were centrifuged for 5 minutes at 200 x g and eluted protein collected in 96- well catch plates containing 5 ⁇ l of 0.5 M MgCl 2 affixed to the bottom of the Ni- plates. Eluted protein was quantified using a BCA Protein assay with SEQ ID NO: 2 as the protein standard.
  • FIG. 1 depicts an exemplary SDS-PAGE analysis from one of the E/I 10 Fn3-based binders.
  • IPTG isopropyl- ⁇ -thiogalactoside
  • the culture was grown for another 6 hours at 30 0 C.
  • expression was carried out at 18 0 C after initial growth at 37 0 C using autoinduction media ("ONE" medium, EMD Biosciences, San Diego, CA).
  • Cell pellets were harvested by centrifugation for 30 minutes at >10,000 x g at 4 0 C and frozen at 80 0 C.
  • the cell pellet was resuspended in 25 mL of lysis buffer (20 mM NaH 2 PO 4 , 0.5 M NaCl, Ix CompleteTM Protease Inhibitor Cocktail-EDTA free (Roche), pH 7.4) using an Ultra- turrax homgenizer on ice.
  • Cell lysis was achieved by high pressure homogenization ( >18,000psi) using a Model M-110S Microfluidizer (Microfluidics). The soluble fraction was separated by centrifugation for 30 minutes at 23,300 x g at 4 0 C. The supernatant was clarified via 0.45 ⁇ m filter. The clarified lysate was loaded onto a HisTrap column (GE) pre-equilibrated with 20 mM NaH 2 PO 4 , 0.5 M NaCl, pH 7.4.
  • GE HisTrap column
  • the column was then washed with 25 column volumes of 20 mM NaH 2 PO 4 , 0.5 M NaCl, pH 7.4, followed by 20 column volumes of 20 mM NaH 2 PO 4 , 0.5 M NaCl, 25 mM imidazole, pH 7.4, and then 35 column volumes of 20 mM NaH 2 PO 4 , 0.5 M NaCl, 40 mM imidazole, pH 7.4.
  • Protein was eluted with 15 column volumes of 20 mM NaH 2 PO 4 , 0.5 M NaCl, 500 mM imidazole, pH 7.4, fractions pooled based on absorbance at A 28 o and dialyzed against Ix PBS, 50 mM Tris, 150 mM NaCl, pH 8.5 or 50 mM NaOAc, 150 mM NaCl, pH4.5. Any precipitate was removed by filtering at 0.22 ⁇ m .
  • Multi-valent fibronectin based scaffold proteins can be pegylated with various sizes and types of PEG.
  • the protein is typically modified near the C-terminus by a single point mutation of an amino acid, typically a serine, to a cysteine.
  • PEGylation of the protein at the single cysteine residue is accomplished through conjugation with various maleimide-derivatized PEG forms by combining the derivitized-PEG reagent with the protein solution and incubating.
  • Progress and confirmation of the PEGylation conjugation reaction can be confirmed by SDS-PAGE and/or SE-HPLC methods that separate the non-PEGylated protein from the PEGylated protein.
  • the construct E2-GS 10-11 (SEQ ID NO: 25) was pegylated by replacing a serine that was at position 221 with a cysteine.
  • the resulting construct, SEQ ID NO: 56 was then conjugated with a maleimide-derivatized 40 kDa branched PEG (NOF America Corporation, White Plains, NY).
  • the derivatized PEG reagent was mixed with the protein construct in solution and incubated at pH 7.40 at Room temperature until the reaction was complete, typically 30 minutes or overnight at 4 0 C.
  • the pH was lowered to pH 4.5 or pH 5.0 by dialysis or rapid desalting using size exclusion column chromotography into in 50 NaOAc, 150 mM NaCl buffer.
  • the mixture of products and excess reactants from the PEGylation reaction were then loaded onto a cation exchange chromotography column at the lowered pH and eluted with a 150 mM to 1 M NaCl gradient. Studies to confirm the pegylation were also conducted as described in the paragraph above.
  • the conjugations can be performed with the His tagged or the His-Tag free versions of the protein.
  • E/I 10 Fn3-based binders Two of the E/I 10 Fn3-based binders, E2-GS10-Il-cys (with his) (SEQ ID NO: 56) and E3-GS10-Il-Cys (with his) (SEQ ID NO: 53), were pegylated using an alternative procedure. Five ml of an inoculum culture of BL21(DE3) E.
  • coli cells containing a T7 ploymerase driven pET29 plasmid encoding either E2-GS10-Il-cys (with his) or E3-GS10-Il-Cys (with his), were generated from a single plated colony and used to inoculate 1 liter of auto-induction media ("ONE" medium, EMD Biosciences, San Diego, CA) containing 50 ⁇ g/mL kanamycin. Expression was carried out at 18 0 C after initial growth at 37 0 C and harvested by centrifugation for 10 minutes at -10,000 x g at 4 0 C. Cell pellets were frozen at 80 0 C.
  • the cell pellet was resuspended in 10 mL of lysis buffer (20 mM NaH 2 PO 4 , 0.5 M NaCl, 5 mM Immidazole, pH 7.4) and mechanically lysed using an Avestin homgenizer. The soluble fraction was separated by centrifugation for 15 minutes at 23,300 x g at 4 0 C. The supernatant was decanted and the pellet was solubilized in Lysis buffer (above) supplemented with 4 M to 6 M guanidine hydrochloride (GdnHCl).
  • Solubilized protein was then purified on a suitably sized NiNTA column (Qiagen, Inc.) pre-equilibrated with the GdnHCL supplemented Lysis Buffer. The column was then washed with 5 to 10 column volumes of the same buffer, followed by elution with the same buffer supplemented with 300 mM Immidazole. The fractions eluted off the column containing the protein of interest were diluted to 2-3 mgs/mL protein and then combined with a 1.2-1.5 molar excess of solid NEM-PEG (40 kDa branched or other). The mixture was allowed to react at room temperature for 30 minutes or until the reaction was complete.
  • NiNTA column Qiagen, Inc.
  • the entire reaction volume was then placed into a dialysis bag (5,000 Da Molecular Weight cutoff) and the mixture was subjected to a dialysis refolding process.
  • this process may consist of two 10-16 hour 500:1 (buffer: dialysate) dialysis exchanges against 5OmM NaOAc, 150 mm NaCl, pH 4.5.
  • the dialysate from this procedure contains properly folded, PEGylated materials plus excess reactants.
  • the mixture of products and excess reactants from the PEGylation reaction were clarified via centrifugation or filtration prior to loading them onto a cation exchange chromotography column (SP Sepharose or Resource S, GE Healthcare).
  • SP Sepharose or Resource S GE Healthcare
  • Standard size exclusion chromatography was performed on the proteins purified from the HTPP and the midscale processes (0.1 to 1 ⁇ g of protein for HTPP and 10-50 ug for midscale).
  • Gel filtration standards Bio-Rad Laboratories, Hercules, CA were used for molecular weight calibration.
  • FIG. 2 depicts exemplary SEC profiles for E/I 10 Fn3-based binders (I1-GS10-E2 in Figure 2A and E2-GS 10-11 in Figure 2B).
  • HPLC elution was split at approximately to 1 : 1 ratio and half sent to UV detector and the other half to mass spectrometer.
  • Mass spectrometer had the following instrument settings: capillary voltage 3.5 KV, cone voltage 40, source temperature 80 0 C, desolvation temperature 250 0 C, desolvation gas flow 450 and multi channel photo detector voltage 2200.
  • Raw spectra were deconvoluted with MaxEnl (Waters Corporation).
  • the molecular weight of I1-GS10-E2 (SEQ ID NO: 22) as measured by LC- MS is 24,445 Dalton, which is within 1 Dalton from the molecular weight calculated from the amino acid composition. This indicates that the protein has the correct amino acid composition and the N terminal methionine is processed. There is no other post translational modification on the protein.
  • DSC Differential Scanning Calorimetry
  • the T m of E2-GS10- Il was determined to be 50.72 0 C and the T m of E2-GS 10-11 (without Peg) was determined to be 56.82 0 C (see Figure 3B).
  • anti-human IgG was immobilized on flow cells 1 and 2 of a CM5 chip following the manufacturer's recommendations (GE Healthcare, Piscataway, NJ).
  • EGFR-Fc 50 nM was injected at 5 uL for 2 minutes on flow cell 2 (Fc2).
  • Two 30 second injections of 3 M MgCt ⁇ were used for regeneration of the bound EGFR-Fc from the anti-human IgG surface.
  • Protein A was diluted to 80 ug/mL in acetate pH 4.5 and immobilized to ⁇ 3000 RU on flow cells 3 and 4 of a CM5 chip surface.
  • Approximately 1300 RU of IGFlR-Fc was captured on Fc 4.
  • Two 30 second injections of 50 mM glycine pH 1.5 were used to regenerate the surface between samples.
  • the EGFR 10 Fn3 -based binders were evaluated for specificity in a similar format using anti-human IgG to capture HER2-Fc.
  • the 10 Fn3-based binders did not show any discernible binding to captured HER2-Fc under conditions where robust binding was seen for EGFR-Fc.
  • E/I 10 Fn3-based binders to inhibit phosphorylation of IGFlR on tyrosine 1131 was determined using an H292 cell in vitro assay. Briefly, 65 X 10 3 H292 cells were plated in 96- well microplates (Biocoat Poly-D-Lysine coated 96-well plate, cat#356640, Becton Dickinson, Franklin Lakes, NJ) in RPMI- 1640 culture medium containing 10 mM Hepes pH 7.4 and 10% fetal bovine serum. Cells were allowed to adhere for 24 hours at 37 0 C, 5% CO 2 .
  • E/I 10 Fn3-based binders to inhibit phosphorylation of the EGFR on tyrosine 1068 was determined using an H292 cell in vitro assay.
  • the assay was carried out as described in Example 6, except that cells were stimulated with 100 ng/ml of EGF (cat#236-EG-200, R & D Systems, Minneapolis, MN) and a phospho-EGFR ELISA was performed (cat#7240, Cell Signaling, Beverly, MA). The manufacturer's procedure was followed to carry out the ELISA.
  • pegylated E2-GS 10-11 and I1-GS10-E2 inhibition of pEGFR was shown at 32 nM and 47 nM, respectively. Similar data is shown in Figure 11 for the pegylated E/I binders E2-GS 10-11, and II- GS10-E2.
  • E/I 10 Fn3-based binders to inhibit phosphorylation of AKT on serine 473 was determined using an H292 cell in vitro assay.
  • the assay was carried out as described in Example 6, except that cells were simultaneously stimulated with both EGF and IGFl as described above and lysates were analyzed with a phospho- AKT ELISA (cat#7160, Cell Signaling, Beverly, MA). The manufacturer's procedure was followed to carry out the ELISA.
  • E/I binders demonstrated ability to inhibit EGF and IGFl -stimulated phosphorylation of AKT with an IC50 in the range of 0.1 nM to 26 nM, including several pegylated E/I binders that were tested.
  • E/I 10 Fn3 -based binders were evaluated for antiproliferative activity in the H292 non-small cell lung carcinoma cell line, which depends on EGFR signaling for growth, or the RH41 Ewing sarcoma cell line, which depends on IGFlR signaling for growth. Antiproliferative activity of binders was assessed in monolayer cultures by staining cellular DNA with the CyQuantNF fluorescent stain (cat#C35006, Invitrogen, Carlsbad, CA).
  • 2 X 10 3 H292 or 5 X 10 3 RH41 cells were plated into 96-well microplates (View Plates 96F cat#6005225, Perkin-Elmer, Waltham, MA) in RPMI- 1640 culture medium containing 10 mM Hepes pH 7.4 and 10% fetal bovine serum and allowed to adhere for 24 hours at 37 0 C, 5% CO 2 .
  • Cells were maintained as exponentially growing monolayers and remained in logarithmic growth phase during the period of the assay without reaching confluence during the course of the assay. Twenty-four hours after plating, serial dilutions of midscale material was added and cells were incubated for an additional 72 hours.
  • the E/I binders El-GSlO-Il, Il -GS 10-El, E2-GS 10-11 and I1-GS10-E2 were tested in an EGF ligand binding cell-based competition assay in A431 cells and compared to EGFR 10 Fn3-based binders El and E2 (midscale material).
  • A431 cells were plated at 15000 cells/well in 96-well plates in DMEM + 10% FBS and incubated 48 hours. Cells were washed with starvation media (DMEM + 0.1% BSA) and incubated in starvation media for 1 hour.
  • Starvation media was removed and replaced with 10 Fn3 -based binders that were diluted in starvation media and cells were pre-incubated for 30 minutes at 37 0 C to allow proteins to bind to EGF receptors on cell surfaces.
  • 10 nM final concentration of Europium (Eu)-labeled EGF (Perkin Elmer, Boston, MA) diluted in starvation media was added to pre-incubated cells and plates were incubated for 3 hours at 4 0 C in the dark. Plates were washed twice with cold PBS and 50 ul/well of Enhancement solution (Perkin Elmer, Boston, MA) was added to plates and incubated 1 hour at 37 0 C. Plates were read on the Flexstation II (Molecular Devices). The data was plotted with Softmax plus software and IC50 values, i.e., the concentration of 10 Fn3- based binders required to inhibit 50% of the Eu-EGF ligand from binding to the EGF receptor on the cell surfaces, were calculated.
  • Target effects of the various E/I 10 Fn3 -based binders were evaluated in DiFi colon carcinoma cells by immunob lotting. Cells were seeded at 4 x 10 5 cells in each 25 cm 2 flask and incubated overnight at 37 0 C in 5% CO 2 . The next day, treatments were initiated and cells were further incubated for various times from 1.5 to 120 hours.
  • HNTG HNTG
  • HNTG Hepes, 150 mM NaCl, 0.5% triton- X-IOO, 8% glycerol, 2 mM Na 3 VO 4 , 1.5 mM MgCl 2 , 1 mM EDTA containing the protease inhibitors AEBSF, aprotinin, leupeptin, bestatin, pepstatin-A and E64) and total protein was quantified with the BCA protein assay (Pierce, Waltham, MA).
  • Example 12 Evaluation of Certain E/I 10 Fn3-Based Binders on H292 Tumor Xenografts Grown In Nude Mice
  • the pegylated E/I binders E2-GS 10-11 and E3-GS 10-11 as well as the monoclonal antibody panitumumab were evaluated in an H292 tumor xenograft model.
  • panitumumab was obtained as the marketed drug and E/I binders were purified as described above.
  • In vitro activity of all E/I binders was validated prior to administration in animals by testing functionality of each end in the EGF-stimulated pEGFR and the IGFl -stimulated pIGFR assay in H292 cells.
  • E/I binders were diluted in phosphate buffered saline (PBS) at the beginning of the experiment and stored at 2-4 0 C for the duration of each study. Both compounds were administered i.p. in a total volume of 500 ⁇ l/inj/mouse and were equilibrated to room temperature prior to administration.
  • PBS phosphate buffered saline
  • mice and tumor propagation Female athymic (nude) mice 5-6 weeks of age were obtained from Harlan Sprague-Dawley Co. (Indianapolis, IN), and were quarantined for approximately 3 weeks prior to their use for tumor propagation or drug efficacy testing. The animals were provided food and water ad libitum. Animal care was performed in keeping with AAALAC and Bristol-Myers Squibb guidelines. Tumors were propagated by subcutaneous (s.c.) implantation in nude mice. Tumor passages occurred approximately every two to four weeks.
  • Antitumor activity was evaluated in terms of % tumor growth inhibition (TGI) where a %TGI of >50% was considered active.
  • %TGI value was calculated at various time points beginning after 1.5 tumor volume doubling times and sustained over a time period of 3 tumor volume doubling times (TVDT) where possible.
  • TVDT median time (days) for control tumors to reach target size - median time (days) for control tumors to reach half the target size.
  • the definition of a cured mouse was one whose tumor was undetectable, or ⁇ 35 mg, when assessed more than 10 TVDTs post-treatment.
  • Treatment groups typically 8 mice) with more than one death attributable to drug toxicity were considered to have had excessively toxic treatments and their data were not used in the evaluation of antitumor activity.
  • the maximum tolerated dose is defined as the dose level immediately below which excessive toxicity (i.e. more than one death) occurred. Treated mice dying prior to having their tumors reach target size were considered to have died from drug toxicity.
  • Statistical evaluations of data were performed using Gehan's generalized Wilcoxon test (Gehan, EA, A Generalized Wilcoxon Test for Comparing Arbitrarily Slightly-Censored Samples, Biometrika 52:203-223, 1965).
  • Tumors were harvested from untreated or drug treated mice and snap frozen in liquid nitrogen. Samples were weighed and homogenized in 10 ⁇ l of lysis buffer (50 mM Hepes, 150 mM NaCl, 0.5% triton-X-100, 8% glycerol, 2 mM Na 3 VO 4 , 1.5 mM MgCl 2 , ImM EDTA containing one complete mini protease inhibitor tablet Sigma #S8820 per 15 ml buffer and phosphatase inhibitor cocktail Sigma #P5726) for each mg of tissue.
  • lysis buffer 50 mM Hepes, 150 mM NaCl, 0.5% triton-X-100, 8% glycerol, 2 mM Na 3 VO 4 , 1.5 mM MgCl 2 , ImM EDTA containing one complete mini protease inhibitor tablet Sigma #S8820 per 15 ml buffer and phosphatase inhibitor cocktail Sigma #P5726
  • Tissues were minced in a 100 mm petri dish with two scalpels, transferred to Falcon#2059 polypropylene round bottom tubes and macerated with a hand held homogenizer for 30 seconds. Homogenate was transferred to 1.5 ml eppendorf tubes and centrifuged at 15000 x g for 2 minutes in a micro fuge. Clarified supernatant was transferred to a new tube and total protein concentration was determined with the Pierce BCA protein assay (Pierce Biotechnology). Samples were analyzed by immunoblotting or on a Meso scale MSD Sector Imager 6000 multi spot assay system as recommended by the manufacturer (Meso Scale Discovery, Gaithersburg, MD).
  • the pegylated E/I binders E2-GS 10-11 and E3-GS 10-11 were tested in an H292 NSCLC in athymic mice. Tumors were implanted subcutaneously with 1 mm H292 tumor fragments in the hind flank and allowed to establish to a size of 50-150 mg prior to initiation of treatment on Day 6 post-tumor implant.
  • the pegylated E/I binders were administered i.p. at a dose of 100 mg/kg on a TIWX3 schedule to assess antitumor activity. Panitumumab was obtained as marketed drug and administered i.p.
  • a treatment regimen was considered active if it produced a statistically significant %TGI value of >50%; q3dx5;6, compound was administered every three days for five doses starting on the sixth day after tumor implant; TIWx3;6, compound was administered three times a week for three weeks starting on the sixth day after tumor implant, p values were calculated on Day 20 relative to the control group in a two tailed paired analysis with 8 measurements per group.
  • Example 13 Selection and Characterization of MCF7 Cells Resistant to IGFlR Inhibitor
  • MCF7 cells (American Type Culture Collection, Cat No. HTB-22, Manassas, VA) were cultured in RPMI medium containing 10 mM hepes and 10% FBS at 37 0 C in the presence of 5% CO 2 .
  • the small molecule IGFlR inhibitor BMS-754807 was added to the culture medium and the concentration increased at stepwise increments over a period of 10 months until the cells exhibited continued proliferation in the presence of 200 mM BMS-754807.
  • the resistant cells were designated MCF7r and the IC50 for BMS-754807 was 1239 nM compared to 120 nM for the parental MCF7 cells as measured in a proliferation assay carried out as previously described (Carboni et al, Cancer Res.
  • MCF7r cells were passaged in complete medium for an additional 20 or 60 days to remove all traces of residual BMS-754807.
  • Analysis of the MCF7r cells by immunoblotting revealed that EGFR was significantly overexpressed in the resistant cells compared to the parental MCF7 cells ( Figure 14).
  • MCF7 and MCF7r cells were serum starved and then stimulated with EGF for 7 minutes, phosphorylated EGFR could not be detected in the parental MCF7 cells (probably due to low levels of EGFR) but was strongly visible in MCF7r cells.
  • MCF7r cells were scaled up in T75 flasks and isolated by centrifugation. Viable cell numbers were measured by trypan blue exclusion with a Vi-CELL XR (Beckman Coulter, Fullerton, CA), resuspended in PBS to 5 x 10 6 viable cells/ml and implanted subcutaneously in the hind flank of athymic mice in a volume of 0.2 ml. For MCF7 and MCF7r tumor growth, all mice were supplemented with 0.25 mg 90 day release pellets of 17- ⁇ -estradiol (Innovative Research of America, Sarasota, FL, Cat. No. NE-121).
  • Tumors were propagated until they reached a median size of 500-1000 mg when they were excised and 1 mm 3 fragments were reimplanted in the hind flank of new athymic mice.
  • Tumors were adapted for solid tumor growth by serial trocar passage in mice through at least four rounds of growth during which tumor volume doubling time and take rate were monitored for each passage. Growth characteristics were observed to determine if the xenografts exhibited acceptable properties to serve as a reliable, reproducible model.
  • the MCF7r tumor type demonstrated an acceptable take rate and doubling time and therefore satisfied the criteria for use as a xenograft model.
  • the MCF7 parental tumor model had been previously established using the same techniques.
  • Vehicle was phosphate buffered saline.
  • %TGI value was calculated at three points as the average inhibition of Day 20, 24 and Day 27.
  • a treatment regimen was considered active if it produced a statistically significant %TGI value of >50%; q3dx5;13, compound was administered every three days for six doses starting on the thirteenth day after tumor implant, p values were calculated on Day 24 relative to the control group in a two tailed paired analysis with 8 measurements per group.
  • GEO tumors were established by implanting 1 mm tumor fragments subcutaneously in the hind flank of athymic mice and allowing them to reach a size of 50-150 mg prior to initiation of treatment on Day 18 post-tumor implant.
  • Cetuximab was administered ip at 0.25 mg/mouse on a Q3DX5 schedule (doses administered on Day 18, 21, 24, 27, 30).
  • the IGFR kinase inhibitor BMS-754807 was administered at 25 mg/kg on a QDX21 schedule.
  • Mean tumor sizes calculated from groups of 8 mice are shown in Figure 16. Cetuximab was active at 0.25 mg/mouse with a %TGI value of 67%.
  • BMS-754807 was active with a %TGI of 80% and the combination of the two was considerably more active then either agent alone with a %TGI of 94% (Table 8). All treatment groups were statistically different from the control group on Day 26 (Table 8).
  • H292 cells were implanted subcutaneously in the hind flank of athymic mice as 1 mm fragments and allowed to establish to a size of 50-150 mg prior to initiation of treatment on Day 12 post-tumor implant.
  • Cetuximab was administered ip at 0.1 mg/mouse on a Q3DX5 schedule.
  • MAB391 is an antibody to IGFlR (R&D Systems, Minneapolis, MN, Cat. No. MAB391) and was administered at a dose of 40 mg/kg on a BIWX3 schedule.
  • Mean tumor sizes calculated from groups of 8 mice are shown in Figure 17.
  • Cetuximab was active at 0.1 mg/mouse with a %TGI value of 95.1% and MAB391 was inactive at 40 mg/kg with a %TGI value of 10.5% (Table 9). Mice dosed with the combination of cetuximab and MAB391 exhibited a %TGI value of 109.2% indicating tumor regression in the combination group (Table 9). After dosing ceased, tumors regrew in the cetuximab treated group more rapidly than in the group treated with the combination of cetuximab and MAB391 ( Figure 17). Table 9. Results of the H292 human NSCLC tumor xenograft study.
  • Vehicle for cetuximab and MAB391 was phosphate buffered saline. Abbreviations used are as described in Table 6 and 8.
  • test compounds were seeded into 24-well plates (Becton- Dickinson, Franklin Lakes, NJ, Cat. No. 351143) in complete medium and allowed to adhere overnight. The next day medium was removed and replaced with medium containing 2% FBS. Test compound was diluted into medium containing 2% FBS and added to cells in serial dilutions. Cells were incubated at 37 0 C for 14 days. After 14 days, media was discarded and wells rinsed once with 2 ml PBS. Cells were stained with 0.5 ml Coomassie Stain Solution (Bio-Rad, Hercules, CA, Cat. No. 161-0436) for 20 min.
  • An epitope mapping assay was developed utilizing commercially available antibodies where the binding site on the EGFR extracellular domain is roughly known according to various literature reports.
  • the antibodies used in this assay are listed in Table 11 and Figure 19A depicts how antibodies were localized to approximate binding domains on EGFR .
  • the assay is a variation of the In Cell Western assay previously described and assesses the ability of EGFR 10 Fn3-based binders preincubated with A431 or other cells expressing EGFR to block binding of the detection antibodies from the panel listed in Table 11.
  • the assay was carried out as follows: A431 cells in log phase growth were harvested by trypsinization and seeded in a 96 well plate at 24,000 cells/well in a total volume of 100 ⁇ l/well.
  • Secondary antibodies are the same ones used in the In Cell Western assay and were appropriate for the species of antibody being detected. These secondary antibodies were diluted (1 :800) in Odyssey Blocker+0.2% Tween-20 and added in a volume of 50 ⁇ l per well along with TOPRO3 (Invitrogen, Carlsbad, CA, cat#T3605) diluted at (1 :3000) to counterstain cells for normalization. Cells were incubated on bench for 1 hour at room temp. Secondary antibody was dumped out and each well washed 4X with 200 ⁇ l of PBS+0.1% Tween-20 for 5 minutes at room temp. Plates were imaged on a Licor instrument at 160 ⁇ m resolution, medium quality, focus offset of 3mm, intensity of 5.
  • This assay was also carried out with the marketed drug antibodies cetuximab, panitumumab and nimotuzumab to determine if the EGFR 10 Fn3 -based binders were interfering with their binding to EGFR on A431 cells. Representative results are shown in Figure 19B. Table 11. Commercially available antibodies to the extracellular domain of EGFR.
  • the kinetics of I monomers binding to the target was measured using BIAcore 2000 or 3000 biosensors (Pharmacia Biosensor).
  • a capture assay was developed utilizing an IGF-IR-Fc fusion.
  • a similar reagent had been described by Forbes et al. (Forbes et al. 2002, European J. Biochemistry, 269, 961-968).
  • the extracellular domain of human IGF-IR (aa 1-932) was cloned into a mammalian expression vector containing the hinge and constant regions of human IgGl.
  • Transient transfection of the plasmid produced a fusion protein, IGF-IR-Fc which was subsequently purified by Protein A chromatography and captured on Protein A immobilized on Biasensor CM5 chips by amine coupling.
  • the kinetic analysis involved the capture of IGF-IR-Fc on Protein A followed by injection of the fibronectin-based scaffold protein in solution and regeneration of the Protein A surface by glycine pH 2.0. Sensorgrams were obtained at each concentration and were evaluated using a program Biaevaluation, BIA Evaluation 2.0 (BIAcore), to determine the rate constants k a (k on ) and kj (k off )
  • the dissociation constant, K D was calculated from the ratio of rate constants k o ff/k on .
  • a concentration series (2 uM to 0 uM) of purified fibronectin-based scaffold protein was evaluated for binding to protein A captured human IGF-IR-Fc fusion protein.
  • IR human insulin receptor
  • VEGF-R2-Fc recombinant human insulin receptor-R2-Fc
  • CM5 Biasensor chip by amine group linkage following standard procedures recommended by Biacore (Uppsala, Sweden).
  • 60 ug/mL of IR diluted in acetate 4.5 was coupled/immobilized to a level of 8300 RU and 11.9 ug/mL of VEGF-R2-Fc diluted in acetate 5.0 was immobilized to a level of 9700 RU on flow cells 2 and 3.
  • a blank reference surface was prepared on FC 1. Specific binding to either IR or VEGF-R2-Fc was calculated by subtracting the binding observed to the blank reference flow cell 1.
  • Fibronectin-based scaffold proteins were diluted to 10 uM in HBS-EP (10 mM Hepes, 150 mM NaCl, 3 mM EDTA, 0.05% Surfactant P20) and injected at 20 uL/min for 3 minutes over the flow cells at 25 0 C and dissociation was observed over 10 mins.
  • HBS-EP 10 mM Hepes, 150 mM NaCl, 3 mM EDTA, 0.05% Surfactant P20
  • the human breast adenocarcinoma MCF-7 (ATCC, Manassas, VA) was plated in 24 well plates at a concentration of 50,000 cells per well in RPMI 1640 (Invitrogen, Carlsbad, CA) containing 10% fetal bovine serum (Hyclone, Logan, UT). The following day, cells were washed in binding buffer consisting of RPMI 1640 containing 0.1% BSA (Sigma, St. Louis, MO), and then pre -incubated for 30 minutes on ice in 200 ⁇ L binding buffer containing IGF-IR competitor.
  • RPMI 1640 Invitrogen, Carlsbad, CA
  • BSA Sigma, St. Louis, MO
  • Fibronectin-based scaffold proteins fused to Fc were evaluated for their ability to inhibit IGF-IR phosphorylation in Rh41 human rhabdomyosarcoma cells.
  • a Western Blot was employed to assess the ability of the I monomer to inhibit IGF- IR phosphorylation in Rh41 human rhabdomyosarcoma cells.
  • Cells were stimulated with IGF-I, IGF-II, insulin ligands (50ng/ml), or no stimulation (NS) and then treated with various concentrations of the I monomer.
  • Membranes were probed with phospho-specif ⁇ c antibodies.
  • Rh41 human Rhabdomyosarcoma and H929 human Multiple Myeloma
  • Rh41 cells were plated at a density of 3500 cells/well in 96-well microtiter plates and 24 hours later they were exposed to a range of I monomer concentrations. After 72 hours incubation at 37°C, cells were pulsed with 4 ⁇ Ci/ml [ 3 H] thymidine (Amersham Pharmacia Biotech, UK) for 3 hours, trypsinized, harvested onto UniFilter-96, GF/B plates (PerkinElmer, Boston, MA) and scintillation was measured on a TopCount NXT (Packard, CT). Results are expressed as an IC50, which is the drug concentration required to inhibit cell proliferation by 50% to that of untreated control cells Data represents the average of triplicate wells with standard deviations shown.
  • Example 20 Additional Characteristics of Monospecific and Bispecific EGFR and IGF-IR 10 Fn3-based binders
  • 10 Fn3-based binders that bound either EGFR or IGF-IR were identified using the biochemical selection technique of mRNA display in which a protein is covalently attached to its coding nucleic acid sequences.
  • 10 Fn3-based proteins- mRNA fusion populations that bound either IGF-IR or EGFR when the receptors were presented at concentrations from 1 to 10 nM were cloned into E. coli and expressed as 10 Fn3-based proteins.
  • a subset of target binders that blocked EGFR or IGF-IR signaling and had suitable biophysical properties were identified (Table 13). These initial clones were optimized for target binding affinity and cellular potency with additional mRNA selection at increasingly lower target concentrations and selection for lower dissociation rate constants.
  • IC50 values obtained during the selection procedures ranged from 9 to 304 nM, illustrating the opportunity for choosing molecules from a wide range of potency values for the construction of bi- specific 10 Fn3-based binders.
  • EGFR 10 Fn3-based binders were tested by In-CeIl Western screening assays for the blockade of phosphorylation of EGFR and ERK, a downstream signaling molecule of EGFR activation (methods similar to Example 1). Analogous studies were performed on optimized IGF-IR binders.
  • Optimized EGFR- binding clones (E3, El, and E2) inhibited EGFR phosphorylation on Y 1068 and downstream phosphorylation of ERK on Y204 of p42/p44 in vitro with IC50 values ranging from 9 to 40 nM, potencies that were more than 100-fold higher than the parental EGFR clone (Table 13, methods similar to Example 1).
  • IGF-IR Il bound to IGF-IR with a K D value of 0.11 nM and inhibited IGF-I- stimulated IGF-IR phosphorylation with an IC50 of 0.2 nM (Table 13, methods similar to Example 6).
  • the optimized IGF-IR and EGFR single-domain 10 Fn3-based binders were >95% monomeric based on size exclusion chromatography, had melting temperatures >56°C (Table 13, methods similar to Example 4), and exhibited minimal immunogenic potential as predicted from EpiMatrix ( ⁇ 7 for five out of six loops), a matrix-based algorithm for T-cell epitope mapping (De Groot AS, Moise L (2007) Prediction of immunogenicity for therapeutic proteins: state of the art.
  • the 10 Fn3-based binders El, E2, and E3 were selected for further development, and had EGFR binding constants in the range of 0.7 to 10 nM as determined from Biacore assay (Table 13, methods similar to Example 5). EGFR-binding of these 10 Fn3-based binders was competitive for EGF binding to EGFR (Table 13) as measured by a displacement assay using Europium labeled EGF (methods similar to Example 10). Similarly, IGF-I binding to IGF-IR was inhibited by Il (Table 13, methods similar to Example 19). Biophysical Characterization of Bi-Specif ⁇ c 10 ⁇ Fn3 -based binders.
  • T m values of selected E/I 10 Fn3-based binders ranged from 49-58 0 C and their SEC profiles indicated the protein was >90% monomer (Table 14, methods similar to Example 4).
  • Monospecific 10 Fn3-based binders and E/I 10 Fn3-based binders showed comparable binding affinities, although T m values decreased slightly when the single domain 10 Fn3-based binders were linked together (Tables 13 and 14).
  • E/I 10 Fn3-based binders were PEGylated with a 40 kDa branched PEG (methods similar to Example 3).
  • PEGylation of E/I 10 Fn3-based binders resulted in a 10- to 20-fold reduction of binding affinity relative to the un- PEGylated constructs due to decreased association rate constants but did not decrease T m . Furthermore, PEGylation did not markedly reduce inhibition of EGFR/IGF-IR phosphorylation in cells.
  • the PEGylated E-I orientation (wherein the EGFR binder is at the N terminus, and IGFlR is at the C terminus) exhibited slightly lower IC 50 values for the inhibition of EGFR and IGF-IR phosphorylation by ELISA compared to the I-E orientation. While minor differences in the K D values and biological activity were found between PEGylated E-I orientation, vs the I-E orientation, there were no consistent trends.
  • Phosphorylation levels of EGFR and IGF-IR in H292 cells were determined by Enzyme-linked immunosorbent assay
  • T m measurements are from thermal scanning flurometry.
  • K D values are from Biacore binding assays using recombinant EGFR or IGF-IR domains adsorbed on the chip.
  • In-CeIl Western assays (ICW) were conducted to determine the ability of El-Tandems to inhibit the phosphorylation of EGFR or ERK in A431 cells.
  • Enzyme-linked immunosorbent assays ELISA
  • Pegylated E/I 10 Fn3 -based binders were analyzed for their binding affinities to EGFR from mouse, rat and monkey using surface plasmon resonance (BIAcore) analysis (methods identical to Example 5).
  • Mouse EGFR was purchased from R&D systems (Minneapolis, MN)
  • rat EGFR was produced in house
  • monkey EGFR was purchased from KEMP (Frederick, MD)
  • Figure 43 summarizes various characteristics of additional E/I 10 Fn3-based binders.
  • the pegylated E/I 10 Fn3 -based binders were tested to determine inhibition of EGF induced EGFR and ERK phosphorylation in A431, using methods as previously described in Example 1. Results demonstrated that the pegylated E/I 1 0 Fn3-based binders inhibited EGF induced EGFR phosphorylation with IC50's ranging from 12 nM -297 nM and phosphorylation of ERK with IC50's ranging from 12 nM -295 nM ( Figure 43, columns a and b).
  • the pegylated E/I 10 Fn3-based binders were tested to determine if they could induce degradation of EGFR and IGFR in Difi cells as shown in columns e and f of Table 16.
  • Cells were treated with IuM of pegylated E/I 10 Fn3-based binders and harvested at time points starting at 7 hrs and ending at 120 hrs and levels of EGFR and IGFlR were determine by Western blot analysis.
  • the strength of degradation was scored as either (+) indicating the tandem degraded that receptor but the degrdation was not sustained and receptor expression reappeared during the time course or (++) which indicates the tandem degraded the receptor and sustained that degradation throughout the time course.
  • the binding affinity of the pegylated E/I 10 Fn3-based binders for EGFR and IGFlR was assessed by surface Plasmon resonance (BIAcore) analysis as previously described in Example 5. Results demonstrated that the pegylated E/I 10 Fn3-based binders bound to EGFR with affinities ranging between 3.35 nM- 57.9 nM and bound to IGFlR with affinities ranging between 0.37 nM- 2.43 nM ( Figure 43, columns g and h).
  • the pegylated E/I 10 Fn3-based binders were tested to determine their potency for blocking EGF binding to EGFR on the surface of A431 cells using methods previously described in Example 10.
  • the the pegylated E/I 10 Fn3-based binders blocked EGF binding to A431 cells with IC50's ranging from 19.5 nM to 238nM ( Figure 43, column i).
  • the pegylated E/I 10 Fn3-based binders were assessed for their ability to inhibit colony formation of H292 cells using methods described in Example 17. As shown in Figure 43, column j, the pegylated E/I 10 Fn3-based binders inhibited colony formation with IC50 values ranging from 1 nM - 560 nM and three of the four pegylated E/I 10 Fn3 -based binders tested were 23-140 fold more potent than the anti-EGFR monoclonal antibody panitumumab. The fourth pegylated E/I 10 Fn3- based binders was 4 fold less potent than panitumuab.
  • the pegylated Il monomer was only marginally active in inhibiting colony formation in H292 with an IC50 >15uM and this is expected since H292 cell growth is predominantly driven by EGFR signaling and not IGFlR signaling.
  • the melting temperature was assessed for pegylated E/I 10 Fn3-based binders by DSC (as previously described in Example 4) or thermal dye melt methodology.
  • thermal dye melt assessment the pegylated E/I 10 Fn3-based binders were diluted to 0.2 mg/mL in 5OmM NaAc buffer pH 4.5. Each sample was spiked with IuL of the 20Ox Sypro Orange in DMSO buffer for a final concentration of 0.5% dye.
  • SEC Size exclusion chromatography
  • I1-GS10-E5 pegylated was constructed without the 6HIS tag (SEQ ID NO: 487) and also with various alterations to the linker region.
  • a global change was made to all the constructs wherein the C-terminal tail of the first monomer had a single point change of the aspartic acid to glutamic acid (D to an E).
  • D to an E aspartic acid to glutamic acid
  • S to C serine residues mutated to cysteines
  • Example 7 Methods for measuring inhibition of pEGFR are described in Example 7, pIGFR in Example 6, pERK in Example 1, Tm in Example 4, EGFR and IGFR KD in Example 5. Detailed analysis of the binding kinetics were also carried out on these clones and are presented in Tables 18 and 19 (using methods similar to those described in Example 5).
  • Example 24 Inhibition of shared downstream signaling pathways of EGFR and IGFR
  • Example 25 Inhibition of cell proliferation by 10 Fn3-based binders and comparator antibody
  • H292 and RH41 cell proliferation experiments were conducted as described in Example 9.
  • the EGFR monospecific 10 Fn3-based binder E5-pegylated inhibited proliferation of H292 cells with an IC50 value of 0.016 ⁇ M.
  • the IGFR monospecific 10 Fn3-based binder Il-pegylated had an IC50 value of >8.4 ⁇ M while the E/I 10 Fn3-based binder I1-GS10-E5 pegylated was slightly more potent with an IC50 value of 0.006 ⁇ M ( Figure 22).
  • the H292 cell line is of lung cancer origin and sensitive to inhibition of IGFR and EGFR ((Akashi Y, et al.
  • RH41 is a pediatric rhabdomyosarcoma cell line that is known to be driven predominantly by IGFR signaling ((Huang F, et al. (2009). The mechanisms of differential sensitivity to an insulin-like growth factor- 1 receptor inhibitor (BMS-536924) and rationale for combining with EGFR/HER2 inhibitors. Cancer Res. 69:161-170)) and thus not sensitive to EGFR blockade.
  • Example 26 Inhibition of receptor activation and downstream signaling in vitro by pegylated and non-pegylated 10 Fn3-based binders
  • DiFi, H292 or BxPC3 cells were serum- starved, exposed to 1 ⁇ M or 0.1 ⁇ M E5 pegylated, Il pegylated, or I1-GS10-E5 pegylated, or vehicle control for 2 hours, then stimulated with either EGF, IGF-I, or EGF + IGF-I for 10 min.
  • Cells were cultured in vitro, serum starved overnight and then exposed to 10 Fn3- based binders for 2 hours prior to stimulation with 100ng/ml of EGF or IGF.
  • Cell lysates were prepared in lysis buffer (1% Triton X-IOO, 5% glycerol, 0.15 M NaCl, 20 mM Tris-HCl pH 7.6, Complete Protease Inhibitor Cocktail Tablets [Roche, Indianapolis, IN] and Phosphatase Inhibitor Cocktail 2 [Sigma- Aldrich Corp.]).
  • Lysates (30 ⁇ g) were resolved by SDS-PAGE, transferred to membranes, and immunoblotted with antibodies to phospho-EGFR and total EGFR (Santa Cruz Biotechnology, Carlsbad, CA), phospho-AKT (Ser 473), phospho-p44/42 MAPK (Thr202/Tyr204) (Cell Signaling Technology, Beverly, MA), or total actin (Chemicon International, Temecula, CA) in Odyssey Blocking Buffer with 0.1% Tween 20 (LI-COR Biosciences, Lincoln, NE). Membranes were incubated with the appropriate secondary antibodies. Protein visualization was performed using a LI- COR Biosciences Odyssey infrared imaging system.
  • I1-GS10-E5 pegylated blocks IGF-stimulated IGFR phosphorylation more than Il pegylated (monospeciific IGFR binder) by itself.
  • IGF-stimulation cross activates the EGFR only when EGFR is blocked.
  • I1-GS10-E5 pegylated inhibited EGF-stimulated pAKT in DiFi; increased pAKT in EGF-stimulated H292 and in BxPC3 EGF did not activate pAKT.
  • I1-GS10-E5 pegylated inhibited IGF-stimulated pIGFR more than the individual E5 pegylated and Il pegylated by themselves.
  • I1-GS10-E5 pegylated had very little if any effect on EGF-stimulated pERK in DiFi, H292 or BxPC3. IGF-stimulation did not induce pERK in any cell line examined.
  • H292 cells were serum-starved, exposed to 1 ⁇ M unPEGylated monospecific EGFR binder E2, IGFR binder II, or E2-GS 10-11, or vehicle control for 1 hour, then stimulated with either EGF, IGF-I, or EGF + IGF-I for 10 min.
  • the basal levels of phosphorylated EGFR, IGFR, and AKT were nearly undetectable after serum deprivation (Figure 25). Stimulation with EGF induced EGFR phosphorylation, but did not transactivate IGFR. EGFR phosphorylation was blocked by the E2, and E2-GS 10-11, but not II.
  • EGF stimulation only slightly increased AKT phosphorylation, but IGF-I or EGF + IGF-I strongly induced phosphorylation of AKT that was suppressed to basal levels by both Il and E2- GSlO-Il.
  • the combination of IGF-I and EGF induced AKT phosphorylation more than either growth factor alone.
  • E2 partially reduced pAKT induced by the combination of EGF and IGF-I.
  • Il showed the most dramatic reduction in pAKT, suggesting that stimulation with EGF + IGF-I led to strong AKT phosphorylation through the IGFR pathway.
  • EGFR-Fc (3 ⁇ g/mL in Na-acetate pH 5.0) was immobilized on the Biacore CM5 chip surface using standard EDC/NHS amide coupling chemistry to a surface density of 300 RU.
  • EGFR antibodies were obtained as a marketed drug and competition between monospecific EGFR binder E2 and antibodies for binding to EGFR-Fc was assessed by binding 450 nM E2 (30 ⁇ L/min, 200s contact time), immediately followed by 450 nM E2 alone, or a mixture of 450 nM E2 plus 450 nM cetuximab, panitumumab, or nimotuzumab (30 ⁇ L/min, 200 sec contact time).
  • the surface was successfully regenerated between cycles using two 10 sec pulses of 50 mM NaOH at a flow rate of 30 ⁇ L/min.
  • Initial injection of E2 shows binding to EGFR on the surface of the chip.
  • a second injection of E2 mixed with an equal amount of cetuximab, panitumumab, or nimotuzumab shows no competition for binding of antibodies to EGFR by E2 (Figure 26A).
  • BiAcore Surface plasmon resonance analysis was utilized to demonstrate simultaneous engagement of captured EGFR-Fc and solution phase IGFlR by E/I 10 Fn3-based binders.
  • Recombinant human EGFR-Fc (aa 1-645 of the extracellular domain of human EGFR fused to human Fc) was purchased from R&D systems (Minneapolis, MN).
  • Recombinant IGFlR (aa 1-932 of human IGFlR propeptide, proteolytically cleaved and disulfide linked) was purchased from R&D systems (Minneapolis, MN).
  • anti-human IgG was immobilized on flow cells 1 and 2 of a CM5 chip following the manufacturer's recommendations (GE Healthcare, Piscataway, NJ).
  • EGFR-Fc 50 nM was captured on flow cell 2 at lOuL/min for 2 minutes. Binding of E/I 10 Fn3-based binders to EGFR-Fc was achieved by injecting 10 Fn3-based protein samples (10OnM) over both flow cells at lOuL/min for 2 minutes. Simultaneous engagement of EGFR-Fc and IGFlR was probed by subsequently injecting IGFlR (0,10OnM) over both flow cells at 30uL/min for 2 minutes.
  • E2-GS 10-11 pegylated to HER family receptors was assessed by Biacore as described in Example 5.
  • HER-2-Fc, HER-3-Fc and HER-4- Fc R&D Systems
  • E2-GS 10-11 pegylated did not show any discernible binding to other HER family members under conditions where robust binding was seen for EGFR-Fc (HER-I) (Table 20).
  • Table 20 Binding affinity of E2-GS 10-11 pegylated to extracellular domains of HER family of receptors.
  • TGF ⁇ and ml GFl were measured in mouse plasma at the end of xenograft studies or in non tumor bearing mice at various times following treatment.
  • Blood was obtained by terminal cardiac puncture into tubes containing EDTA as an anticoagulant.
  • Plasma was prepared by centrifuging blood at 1300 xg for 10 minutes at 4 degrees C and removing the clarified supernatant to a separate tube.
  • TGF ⁇ levels were measured in 0.1ml of plasma, ml GFl levels were measured in 0.02 ml plasma with an ELISA assay as recommended by manufacturer (R&D Systems, Minneapolis, MN).
  • TGF ⁇ Plasma levels of TGF ⁇ were increased in mice treated with I1-GS10-E5 pegylated or the monospecific EGFR binder E5 pegylated but not cetuximab (Figure 27 A-C).
  • the TGF ⁇ could be secreted from the human tumor or may represent endogenous mouse TGF ⁇ . Due to the high homology between human and mouse TGF ⁇ (93% amino acid identity) the ELISA may cross react with mouse TGF ⁇ . Furthermore, human TGF ⁇ secreted by the implanted tumor can bind to the mouse EGFR.
  • I1-GS10-E5 pegylated and E5 pegylated can bind both human and mouse EGFR, all host and tumor EGFR binding sites are blocked by these 10 Fn3-based binders while cetuximab does not bind mouse EGFR.
  • these 10 Fn3-based binders cause increases in endogenouse mouse TGF ⁇ and if the ELISA cross reacts with mouse TGF ⁇ , non- tumor bearing nude mice were dosed with I1-GS10-E5 pegylated at 100mg/kg and plasma samples were taken at 4, 24, 48, 72 hours post dose. Increases in mouse TGF ⁇ were in fact observed that persisted out past 72 hours (Figure 28A).
  • E/I 10 Fn3-based binders were evaluated in a head-to-head H292 NSCLC study (methods described in Example 12) at a lower dose than previously used so that differences in relative activity could be ascertained.
  • panitumumab and all E/I 10 Fn3 -based binders evaluated in this study were active by a tumor growth inhibition (TGI) endpoint.
  • TGI tumor growth inhibition
  • E4-GS 10-11 pegylated, I1-GS10-E5 pegylated, I1-GS10-E4 pegylated and panitumumab all caused tumor regression (Table 21, TGI values greater than 100%) while E2-GS 10-11 pegylated, I1-GS10-E85 pegylated and Il -GS 10-El 05 pegylated caused tumor growth inhibition (Table 21, TGI values up to 100%). Differences in activity were statistically significant when compared to the control group.
  • a treatment regimen was considered active if it produced a statistically significant %TGI value of >50%; q3dx5;6, compound was administered every three days for six doses starting on the sixth day after tumor implant; 6 on/1 off; 6, compound was administered once a day for 6 days then no treatment for 1 day and this regimen started on the sixth day after tumor implant, p values were calculated on Day 20 relative to the control group in a two tailed paired analysis with 8 measurements per group.
  • H292 is a non- small cell lung carcinoma (NSCLC) and is described in more detail Example 12; MCF7r breast carcinoma is described in Example 14; and GEO colon carcinoma is described in Example 15.
  • NSCLC non- small cell lung carcinoma
  • MCF7r breast carcinoma is described in Example 14;
  • GEO colon carcinoma is described in Example 15.
  • the DiFi human colon carcinoma expresses high levels of activated EGFR and also expresses IGFR;
  • RH41 is a pediatric rhabdomyosarcoma cell line that is known to be driven predominantly by IGFR signaling (Huang F, et al.
  • panitumumab was not active at either dose, the E2- pegylated construct was not active while the E/I 10 Fn3-based binders and the II- pegylated construct were all active.
  • Figure 32 shows antitumor efficacy in the RH41 model for a representative construct E2-GS 10-11 pegylated (data also shown in Table 23).
  • panitumumab regressed tumors at the lmg/mouse dose and was active at the 0. lmg/mouse dose but among the E/I 10 Fn3 -based binders only the I1-GS10-E5 pegylated E/I 10 Fn3 -construct was active.
  • Il pegylated was not active while the E5 pegylated, (E5 pegylated + 11 pegylated) and the I1-GS10-E5 pegylated clones were all active and exhibited similar activity meaning that all of the antitumor activity likely comes from inhibition of EGFR and blocking the IGFR pathway did not provide any enhancement.
  • Cetuximab regressed tumors at the lmg/mouse dose and was not active at the 0. lmg/mouse dose.
  • BMS-754807 was also not active showing that blocking the IGFR pathway with a small molecule inhibitor did not result in efficacy in this model.
  • %TGI value was calculated at two points as the average inhibition on Day 19 and 23 for H292, Day 39 and 41 for DiFi, Day 34 and 37 for RH41 for groups 1-6 and Day 35, 36 and 39 for groups 7-10, Day 18 and 20 for Cal27.
  • a treatment regimen was considered active if it produced a statistically significant %TGI value of >50%; ⁇ > q3dx5;6, compound was administered every three days for six doses starting on the sixth day after tumor implant; TIWX3;6, compound was administered three times a week for 3 weeks and this regimen started on the sixth day after tumor implant, p values were calculated relative to the control group in a two tailed paired analysis with 8 measurements per group on Day 23 for H292, Day 39 for DiFi, Day 37 for RH41 for groups 1-6 and Day 39 for groups 7-10 and Day 20 for Cal27.
  • a treatment regimen was considered active if it produced a statistically significant %TGI value of >50%; q3dx5;6, compound was administered every three days for six doses starting on the sixth day after tumor implant; TIWX3;6, compound was administered three times a week for 3 weeks and this regimen started on the sixth day after tumor implant, p values were calculated relative to the control group in a two tailed paired analysis with 8 measurements per group on Day 26 for MCF7r, Day 27 for BxPC3, Day 29 for GEO and Dayl7 for H441.
  • Example 30 Pharmacokinetic profile of various E/I 10 Fn3-based binders in mice
  • GSlO-Il were assessed in mice via intraperitoneal injection.
  • Three nude mice per dose group were dosed with E2-GS 10-11, formulated in PBS, at 10 and 100 mg/kg, ip and plasma samples were collected in citrate phosphate dextrose solution at pre dosing, 0.5, 2, 4, 8, 12, 24, 48, 72, 96, 144, and 168 hours post dosing.
  • Plasma samples were assessed for pegylated E2-GS 10-11 Fn3-based binder levels using a quantitative electrochemiluminescence (ECL) assay developed to detect and quantitate the pegylated E/I 10 Fn3-based binder in plasma samples.
  • ECL electrochemiluminescence
  • a mouse monoclonal antibody with specificity toward the EGFR binding region was adsorbed to Meso Scale Discovery plates overnight at 4 0 C to allow capture of the pegylated E/I 10 Fn3-based binder in the plasma samples.
  • the plasma samples were added to the plates and incubated at 22°C for 1 h.
  • the captured pegylated E/I 10 Fn3- based binder was detected by a rabbit polyclonal antibody specific to the scaffold region of the E/I 10 Fn3 -based binder, mixed with a goat anti-rabbit antibody linked with a SULFO-TAG. Following a wash to remove unbound SULFO-TAG reagent, a read buffer was added and ECL detection was used.
  • the level of pegylated E2- GSlO-Il in plasma samples was calculated based on comparison to a 4-parameter fit of a standard curve of the pegylated E2-GS 10-11 Fn3 -based binder.
  • mice administered 10 or 100 mg/kg interperitoneally (ip) of pegylated E2- GSlO-Il resulted in peak levels of approximately 200 and 1700 ⁇ g/mL, respectively, indicating dose-proportional pharmacokinetics (Figure 30).
  • Pharmacokinetic parameters for Figure 30 were calculated in a similar fashion to those described in the paragraph below (note that "T 1/2" is interchangeable with "HL_lambda_z”and AUC is interchangeable with "AUCINF_obs”.
  • the half-life of pegylated E2-GS10-I1 in mice was 15.75 ⁇ 1.52 h ( Figure 30). Based on these pharmacokinetic parameters, administration of 100 mg/kg three times weekly (TIW) in human tumor xenograft studies was able to maintain drug levels 10- to 100-fold higher than the in vitro IC50 value.
  • mice were administered 10 or 100 mg/kg interperitoneally (ip) and, for the pegylated I1-GS10-E5, 10 or 64 mg/kg sub- cutaneously (sc), plasma was collected and analyzed as described above to measure the levels of pegylated E/I 10 Fn3 -based binders.
  • the pharmacokinetic parameters ofthese various E/I 10 Fn3-based binders were obtained by non-compartmental analysis of plasma (serum) concentration vs. time data. WinNonlin software (version 5.1, Pharsight Corp.
  • Samples were taken from the H292 and the DiFi xenograft models described in Table 22 at the end of the study and processed as outlined under Measurement of pharmacodynamic endpoints in tumors in Example 12 for analysis of total levels of EGFR and IGFR protein and phosphorylated EGFR and IGFR.
  • Target effects of II- GS 10-E5 -pegylated and panitumumab were evaluated by immunob lotting as described in Example 11.
  • levels of total EGFR, pEGFR and total IGFR were lower in Il -GS 10-E5 -pegylated treated tumors than in untreated tumors at the end of the DiFi xenograft model.
  • the 10 Fn3-based binder 679F09 (as described in PCT WO 2009/102421) ( Figure 34) was identified as a binder to EGFR ectodomain-Fc fusion protein (R&D Systems). Binding activity was selected using a bead coated with EGFR-Fc and 10 Fn3-based binders coupled to their nucleic acid coding sequence (see e.g., Xu et al., Directed Evolution of High- Affinity Antibody Mimics Using MRNA Display, Chem. Biol. 9: 933-942 (2002)). More potent variants of the parental EGFR binder 679F09 having alterations to the amino acid sequences in the BC, DE and FG loops were also identified.
  • BC loop "YQ" in positions 7-8 (i.e., corresponding to positions 29 and 30 of SEQ ID NO: 1)
  • BC loop XXXXXXYQ (same as Motif #1), wherein X is any amino acid
  • Sequence Motifs #1 and #2 evaluate each residue position within a loop separately.
  • the 10 Fn3-based binders were subjected to further analysis.
  • the loop sequences were aligned using ClustalW (Thompson JD et al. CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position- specific gap penalties and weight matrix choice. N ' ucleic Acids Research 22: 4673- 4680, 1994). From this alignment, families of sequences were grouped using manual inspection. For the BC and DE loops, sequence patterns similar to Sequence Motifs #1 and #2 were observed. However, additional sequence motifs could be defined for the 10 and 15 amino acid long FG loops.
  • an IC50 is calculated by fitting the data for % inhibition at various concentrations. However, given that only a single data point is available for each binder, it is inappropriate to use this single data point to calculate an IC50. Therefore, the percent inhibition of EGFR signaling at a single concentration point was used as an approximation of the potency of the binder. Although a binder may show 75% inhibition at a concentration of 100 nM, increasing the concentration will allow the clone to show 100% inhibition at a higher concentration. The % inhibition is inversely related to the IC50; i.e., the higher the % inhibition, the lower the IC50 and the more potent the binder.
  • a binder showed 75% inhibition at a concentration of 100 nM, we considered this to be a "potent" binder for the purposes of Sequence Analysis II.
  • the binders which showed less than 75% inhibition at 100 nM concentration for the most part still bind to EGFR and still have an effect on EGFR signaling.
  • the anti-EGFR monoclonal antibody Nimotuzumab (Friedlander E et al. ErbB-directed immunotherapy: antibodies in current practice and promising new agents. Immunol Lett 116: 126— 140, 2008) is currently under development as a therapeutic, but it shows ⁇ 5% inhibition at a 100 nM concentration in the EGFR phosphorylation assay (data not shown).
  • the sequences of all "potent" binders assayed and their % inhibition of EGFR phosphorylation at 100 nM concentration is shown in Figure 45.
  • the total number of unique 10 Fn3-based binders that showed >75% inhibition at 100 nM concentration was 111.
  • the sequences first were analyzed by the frequency of amino acids at each position in the loops ( Figures 39- 42). Since these binders are a subset of all the binders selected for high affinity binding to EGFR during Profusion, they also follow Sequence Motif #1 (see above). All “potent” sequences analyzed follow the FG loop sequence pattern ("D/N" in position 1). Of all unique “potent” sequences analyzed, 93% follow the pattern for the BC loop ("YQ" in positions 7-8), and 98% follow the pattern for the DE loop (aliphatic residue ("V/I/L/M/A”) in position 3). All “potent” sequences analyzed follow at least two of the three patterns of Sequence Motif #1.
  • 15 -amino acid FG loop length also appears to be highly represented in the most "potent" binders. While 15-amino acid long FG loops represent only 55% of all binders selected for high affinity binding to EGFR (Sequence Analysis I), 15-amino acid FG loops represent 86% of the binders with >50% inhibition of EGFR phosphorylation at 100 nM concentration, and 91% of the binders with >75% inhibition (“potent" binders in Sequence Analysis II). Therefore, the longer 15-amino acid FG loop appears to be a sequence pattern associated with greater potency.
  • sequence analysis of the "potent" binders with 15-amino acid FG loops also further illuminated which residue positions were most conserved, allowing Sequence Motif #5 to be defined.
  • An "X" in this sequence motif denotes positions where there are no three dominant amino acids.
  • EGFR binders that were analyzed are progeny of the parent 679F09 and constitute a sequence "family," i.e. they are all related in sequence according to the aforementioned sequence motifs.
  • Various members of the 679F09 family of binders can tolerate a T51I scaffold mutation and retain binding activity. Therefore, a T51I scaffold mutation could be combined with any of the aforementioned sequence motifs to also yield a binder with high affinity binding to EGFR.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Zoology (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Toxicology (AREA)
  • Biomedical Technology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Endocrinology (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Medicinal Preparation (AREA)
  • Nitrogen And Oxygen Or Sulfur-Condensed Heterocyclic Ring Systems (AREA)
PCT/US2009/065765 2008-11-24 2009-11-24 Bispecific egfr/igfir binding molecules WO2010060095A1 (en)

Priority Applications (13)

Application Number Priority Date Filing Date Title
CA2744405A CA2744405A1 (en) 2008-11-24 2009-11-24 Bispecific egfr/igfir binding molecules
AU2009316271A AU2009316271A1 (en) 2008-11-24 2009-11-24 Bispecific EGFR/IGFIR binding molecules
EA201100669A EA022415B1 (ru) 2008-11-24 2009-11-24 Биспецифичные молекулы, связывающие egfr/igfir
MX2011005257A MX2011005257A (es) 2008-11-24 2009-11-24 Moleculas biespecificas de union a receptor de factor de crecimiento epidermial/receptor i de factor de crecimiento tipo insulina (egfr/igfir).
BRPI0922613A BRPI0922613A2 (pt) 2008-11-24 2009-11-24 moléculas biespecíficas de ligação a egfr/igfir
NZ592782A NZ592782A (en) 2008-11-24 2009-11-24 Bispecific egfr/igfir binding molecules
EP09760433.4A EP2350126B1 (en) 2008-11-24 2009-11-24 Bispecific egfr/igfir binding molecules
JP2011537719A JP5823870B2 (ja) 2008-11-24 2009-11-24 二重特異性ｅｇｆｒ／ｉｇｆｉｒ結合分子
CN200980155318.4A CN102439036B (zh) 2008-11-24 2009-11-24 双特异性egfr/igfir结合分子
ES09760433.4T ES2555381T3 (es) 2008-11-24 2009-11-24 Moléculas biespecíficas de unión a EGFR/IGFIR
IL212715A IL212715A0 (en) 2008-11-24 2011-05-05 Bispecific egfr/igfir binding molecules
TN2011000225A TN2011000225A1 (en) 2008-11-24 2011-05-06 Bispecific egfr/igfir binding molecules
ZA2011/03766A ZA201103766B (en) 2008-11-24 2011-05-23 Bispecific egfr/igfir binding molecules

Applications Claiming Priority (10)

Application Number Priority Date Filing Date Title
US20016408P 2008-11-24 2008-11-24
US61/200,164 2008-11-24
US20028208P 2008-11-26 2008-11-26
US61/200,282 2008-11-26
US21296609P 2009-04-17 2009-04-17
US61/212,966 2009-04-17
US17827909P 2009-05-14 2009-05-14
US61/178,279 2009-05-14
US22733009P 2009-07-21 2009-07-21
US61/227,330 2009-07-21

Publications (1)

Publication Number Publication Date
WO2010060095A1 true WO2010060095A1 (en) 2010-05-27

Family

ID=41667546

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2009/065765 WO2010060095A1 (en) 2008-11-24 2009-11-24 Bispecific egfr/igfir binding molecules

Country Status (21)

Country Link
US (5) US8343501B2 (ja)
EP (2) EP3029064A1 (ja)
JP (2) JP5823870B2 (ja)
KR (1) KR20110098922A (ja)
CN (1) CN102439036B (ja)
AR (1) AR074399A1 (ja)
AU (1) AU2009316271A1 (ja)
BR (1) BRPI0922613A2 (ja)
CA (1) CA2744405A1 (ja)
CL (1) CL2011001214A1 (ja)
CO (1) CO6382161A2 (ja)
EA (1) EA022415B1 (ja)
ES (1) ES2555381T3 (ja)
IL (1) IL212715A0 (ja)
MX (1) MX2011005257A (ja)
NZ (2) NZ601693A (ja)
PE (1) PE20110587A1 (ja)
TN (1) TN2011000225A1 (ja)
TW (1) TWI496582B (ja)
WO (1) WO2010060095A1 (ja)
ZA (1) ZA201103766B (ja)

Cited By (38)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US8067201B2 (en) 2009-04-17 2011-11-29 Bristol-Myers Squibb Company Methods for protein refolding
WO2011150133A3 (en) * 2010-05-26 2012-03-08 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
US8221765B2 (en) 2008-05-22 2012-07-17 Bristol-Myers Squibb Company Multivalent fibronectin based scaffold domain proteins
WO2012016245A3 (en) * 2010-07-30 2012-08-09 Novartis Ag Fibronectin cradle molecules and libraries thereof
WO2012158678A1 (en) 2011-05-17 2012-11-22 Bristol-Myers Squibb Company Methods for maintaining pegylation of polypeptides
WO2012158739A1 (en) 2011-05-17 2012-11-22 Bristol-Myers Squibb Company Improved methods for the selection of binding proteins
WO2013049275A1 (en) 2011-09-27 2013-04-04 Janssen Biotech, Inc. Fibronectin type iii repeat based protein scaffolds with alternative binding surfaces
US8470332B2 (en) 2006-11-22 2013-06-25 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including IGF-IR
US8569227B2 (en) 2010-04-30 2013-10-29 Janssen Biotech, Inc. Stabilized fibronectin domain compositions, methods and uses
US8633297B2 (en) 2007-10-31 2014-01-21 Medimmune, Llc Protein scaffolds
JP2014515595A (ja) * 2011-03-04 2014-07-03 シャイアー ヒューマン ジェネティック セラピーズ インコーポレイテッド ポリペプチド組成物用ペプチドリンカーおよびその使用方法
US8853154B2 (en) 2012-09-13 2014-10-07 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US8927693B2 (en) 2010-02-18 2015-01-06 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind IL-23
US8969289B2 (en) 2010-05-03 2015-03-03 Bristol-Myers Squibb Company Serum albumin binding molecules
US9017655B2 (en) 2008-11-24 2015-04-28 Bristol-Myers Squibb Company Bispecific EGFR/IGFIR binding molecules
US9139825B2 (en) 2009-10-30 2015-09-22 Novartis Ag Universal fibronectin type III bottom-side binding domain libraries
US9200059B2 (en) 2008-10-31 2015-12-01 Janssen Biotech, Inc. Fibronectin type III domain based scaffold compositions, methods and uses
EP2951206A2 (en) * 2013-02-01 2015-12-09 Bristol-Myers Squibb Company Fibronectin based scaffold proteins
US9212231B2 (en) 2010-04-13 2015-12-15 Medimmune, Llc TRAIL R2-specific multimeric scaffolds
US9234028B2 (en) 2008-02-14 2016-01-12 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind EGFR
US9296810B2 (en) 2008-05-02 2016-03-29 Novartis Ag Fibronectin-based binding molecules and uses thereof
JP2016053087A (ja) * 2010-07-06 2016-04-14 ノバルティス アーゲー ノロウイルスに由来する免疫原性組成物および方法
US9328157B2 (en) 2003-12-05 2016-05-03 Bristol-Myers Squibb Company Inhibitors of type 2 vascular endothelial growth factor receptors
US9416170B2 (en) 2011-10-31 2016-08-16 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US9469676B2 (en) 2011-04-13 2016-10-18 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
US9932568B2 (en) 2011-03-04 2018-04-03 Shire Human Genetic Therapies, Inc. Peptide linkers for polypeptide compositions and methods for using same
US10065987B2 (en) 2013-02-12 2018-09-04 Bristol-Myers Squibb Company High pH protein refolding methods
US10442851B2 (en) 2014-03-20 2019-10-15 Bristol-Myers Squibb Company Serum albumin-binding fibronectin type III domains
US10766946B2 (en) 2015-09-23 2020-09-08 Bristol-Myers Squibb Company Fast-off rate serum albumin binding fibronectin type III domains
US10787498B2 (en) 2013-02-06 2020-09-29 Bristol-Myers Squibb Company Fibronectin type III domain proteins with enhanced solubility
EP3638300A4 (en) * 2017-06-16 2021-06-23 Protelica, Inc. FIBRONECTIN-BINDING CHEMICAL ANTIGEN RECEPTORS AND METHODS OF USE
US11299534B2 (en) 2016-12-14 2022-04-12 Janssen Biotech, Inc. CD8A-binding fibronectin type III domains
US11345739B2 (en) 2016-12-14 2022-05-31 Janssen Biotech, Inc CD137 binding fibronectin type III domains
US11447539B2 (en) 2016-12-14 2022-09-20 Janssen Biotech, Inc. PD-L1 binding fibronectin type III domains
US11555062B2 (en) 2011-10-11 2023-01-17 Viela Bio, Inc. Methods of administering a composition comprising a Tn3 scaffold and a CD40L-specific monomer
US11628222B2 (en) 2019-10-14 2023-04-18 Aro Biotherapeutics Company CD71 binding fibronectin type III domains
US11781138B2 (en) 2019-10-14 2023-10-10 Aro Biotherapeutics Company FN3 domain-siRNA conjugates and uses thereof
US12037379B2 (en) 2021-04-14 2024-07-16 Aro Biotherapeutics Company CD71 binding fibronectin type III domains

Families Citing this family (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013177187A2 (en) 2012-05-22 2013-11-28 Massachusetts Institute Of Technology Synergistic tumor treatment with extended-pk il-2 and therapeutic agents
TW201843172A (zh) * 2012-06-25 2018-12-16 美商再生元醫藥公司 抗－ｅｇｆｒ抗體及其用途
US9695228B2 (en) * 2012-11-21 2017-07-04 Janssen Biotech, Inc. EGFR and c-Met fibronectin type III domain binding molecules
CN105899226B (zh) 2013-10-14 2020-05-12 詹森生物科技公司 半胱氨酸工程化iii型纤连蛋白域结合分子
KR20160113268A (ko) * 2014-01-28 2016-09-28 베이징 한미 파마슈티컬 컴퍼니 리미티드 이기능 융합단백질,이의 제조방법 및 용도
US20170216403A1 (en) 2014-08-12 2017-08-03 Massachusetts Institute Of Technology Synergistic tumor treatment with il-2, a therapeutic antibody, and an immune checkpoint blocker
JP6800141B2 (ja) 2014-08-12 2020-12-16 マサチューセッツ インスティテュート オブ テクノロジー Ｉｌ−２およびインテグリン結合性ｆｃ融合タンパク質による相乗的な腫瘍処置
EP3702367B1 (en) 2014-11-25 2024-05-15 Bristol-Myers Squibb Company Novel pd-l1 binding polypeptides for imaging
JP6701217B2 (ja) 2014-11-25 2020-05-27 ブリストル−マイヤーズ スクイブ カンパニーＢｒｉｓｔｏｌ−Ｍｙｅｒｓ Ｓｑｕｉｂｂ Ｃｏｍｐａｎｙ 生物学的製剤の１８ｆ−放射性標識方法および組成物
KR102670705B1 (ko) * 2015-01-02 2024-05-31 다케다 파머수티컬 컴패니 리미티드 혈장 칼리크레인 및 인자 xii에 대한 이중특이성 항체
US10913802B2 (en) 2015-07-21 2021-02-09 Dyax Corp. Monoclonal antibody inhibitor of factor XIIA
CN109562195A (zh) 2016-06-01 2019-04-02 百时美施贵宝公司 用pd-l1结合多肽进行pet成像
US10994033B2 (en) 2016-06-01 2021-05-04 Bristol-Myers Squibb Company Imaging methods using 18F-radiolabeled biologics
MA45412A (fr) 2016-06-21 2021-05-26 Janssen Biotech Inc Molécules de liaison au domaine de fibronectine de type iii modifiées par la cystéine
EP3568150A4 (en) 2017-01-10 2020-12-02 Xcella Biosciences, Inc. POLYTHERAPY FOR TUMOR TREATMENT WITH INTEGRIN-BOUND FC FUSION PROTEIN AND IMMUNE MODULATOR
US10350266B2 (en) 2017-01-10 2019-07-16 Nodus Therapeutics, Inc. Method of treating cancer with a multiple integrin binding Fc fusion protein
WO2019036605A2 (en) 2017-08-17 2019-02-21 Massachusetts Institute Of Technology MULTIPLE SPECIFICITY BINDING AGENTS OF CXC CHEMOKINES AND USES THEREOF
KR101943081B1 (ko) 2017-08-31 2019-01-29 (주)케어젠 주름 개선 활성을 나타내는 펩타이드 및 이의 용도
WO2020018715A1 (en) 2018-07-17 2020-01-23 Massachusetts Institute Of Technology Soluble multimeric immunoglobulin-scaffold based fusion proteins and uses thereof
KR20210068478A (ko) 2018-09-28 2021-06-09 메사추세츠 인스티튜트 오브 테크놀로지 콜라겐-국재화된 면역조정성 분자 및 그의 방법
US20220064326A1 (en) * 2019-01-11 2022-03-03 The University Of North Carolina At Chapel Hill Highly modular biepitopic and bispecific car-t cells for cancer immunotherapy
KR101959020B1 (ko) * 2019-01-14 2019-03-18 (주)케어젠 주름 개선 활성을 나타내는 펩타이드 및 이의 용도
US11235032B2 (en) 2019-01-23 2022-02-01 Massachusetts Institute Of Technology Combination immunotherapy dosing regimen for immune checkpoint blockade
EP4126923A2 (en) 2020-03-31 2023-02-08 Repertoire Immune Medicines, Inc. Barcodable exchangeable peptide-mhc multimer libraries
WO2022087154A1 (en) 2020-10-20 2022-04-28 Repertoire Immune Medicines, Inc. Mhc class ii peptide multimers and uses thereof
WO2023196995A1 (en) 2022-04-07 2023-10-12 Repertoire Immune Medicines, Inc. T cell receptor multimers and uses thereof

Citations (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4002531A (en) 1976-01-22 1977-01-11 Pierce Chemical Company Modifying enzymes with polyethylene glycol and product produced thereby
USRE30985E (en) 1978-01-01 1982-06-29 Serum-free cell culture media
US4560655A (en) 1982-12-16 1985-12-24 Immunex Corporation Serum-free cell culture medium and process for making same
WO1987000195A1 (en) 1985-06-28 1987-01-15 Celltech Limited Animal cell culture
US4657866A (en) 1982-12-21 1987-04-14 Sudhir Kumar Serum-free, synthetic, completely chemically defined tissue culture media
US4767704A (en) 1983-10-07 1988-08-30 Columbia University In The City Of New York Protein-free culture medium
WO1990003430A1 (en) 1988-09-23 1990-04-05 Cetus Corporation Cell culture medium for enhanced cell growth, culture longevity and product expression
US4927762A (en) 1986-04-01 1990-05-22 Cell Enterprises, Inc. Cell culture medium with antioxidant
WO1990013540A1 (en) 1989-04-19 1990-11-15 Enzon, Inc. Active carbonates of polyalkylene oxides for modification of polypeptides
WO1990013646A1 (fr) 1989-04-28 1990-11-15 Transgene S.A. Application de nouveaux fragments d'adn en tant que sequence codant pour un peptide signal pour la secretion de proteines matures par des levures recombinantes, cassettes d'expression, levures transformees et procede de preparation de proteines correspondant
EP0473084A2 (en) 1990-08-28 1992-03-04 Sumitomo Pharmaceuticals Company, Limited Polyethylene glycol derivatives, their modified peptides, methods for producing them and use of the modified peptides
US5122469A (en) 1990-10-03 1992-06-16 Genentech, Inc. Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins
WO1994001451A2 (en) 1992-07-13 1994-01-20 Bionebraska, Inc. Method for modification of recombinant polypeptides
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
US5824784A (en) 1994-10-12 1998-10-20 Amgen Inc. N-terminally chemically modified protein compositions and methods
WO1998056915A2 (en) 1997-06-12 1998-12-17 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
WO2000034787A1 (en) 1998-12-10 2000-06-15 The University Of Nottingham Cancer detection method and reagents
WO2001064942A1 (en) 2000-02-29 2001-09-07 Phylos, Inc. Protein scaffolds for antibody mimics and other binding proteins
WO2002004523A2 (en) 2000-07-11 2002-01-17 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US20020044921A1 (en) 2000-09-29 2002-04-18 Seoju Lee Pegylated interleukin-10
WO2002032925A2 (en) 2000-10-16 2002-04-25 Phylos, Inc. Protein scaffolds for antibody mimics and other binding proteins
WO2002081497A2 (en) 2001-04-04 2002-10-17 University Of Rochester αξβ3 INTEGRIN-BINDING POLYPEPTIDE MONOBODIES AND THEIR USE
US20030186385A1 (en) 2000-11-17 2003-10-02 Shohei Koide Method of identifying polypeptide monobodies which bind to target proteins and use thereof
US20070178082A1 (en) 2002-11-08 2007-08-02 Ablynx N.V. Stabilized single domain antibodies
US20070269422A1 (en) 2006-05-17 2007-11-22 Ablynx N.V. Serum albumin binding proteins with long half-lives
WO2008031098A1 (en) 2006-09-09 2008-03-13 The University Of Chicago Binary amino acid libraries for fibronectin type iii polypeptide monobodies
WO2008066752A2 (en) 2006-11-22 2008-06-05 Adnexus, A Bristol-Myers Squibb R & D Company Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including igf-ir
WO2008097497A2 (en) 2007-02-02 2008-08-14 Adnexus, A Bristol-Myers Squibb R & D Company Vegf pathway blockade

Family Cites Families (120)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
US6018030A (en) 1986-11-04 2000-01-25 Protein Polymer Technologies, Inc. Peptides comprising repetitive units of amino acids and DNA sequences encoding the same
US5641648A (en) 1986-11-04 1997-06-24 Protein Polymer Technologies, Inc. Methods for preparing synthetic repetitive DNA
US5514581A (en) 1986-11-04 1996-05-07 Protein Polymer Technologies, Inc. Functional recombinantly prepared synthetic protein polymer
US5770697A (en) 1986-11-04 1998-06-23 Protein Polymer Technologies, Inc. Peptides comprising repetitive units of amino acids and DNA sequences encoding the same
US4863457A (en) 1986-11-24 1989-09-05 Lee David A Drug delivery device
US4997652A (en) 1987-12-22 1991-03-05 Visionex Biodegradable ocular implants
US5164188A (en) 1989-11-22 1992-11-17 Visionex, Inc. Biodegradable ocular implants
AU8498091A (en) 1990-08-02 1992-03-02 Regents Of The University Of Colorado, The Systematic polypeptide evolution by reverse translation
KR0185215B1 (ko) 1990-11-30 1999-05-01 요시다 쇼오지 서방성 안구삽입용 약제
US5773574A (en) 1990-12-03 1998-06-30 The Scripps Research Institute Polypeptides for promoting cell attachment
US5235041A (en) 1990-12-28 1993-08-10 Protein Polymer Technologies, Inc. Purification of structurally ordered recombinant protein polymers
US5792742A (en) 1991-06-14 1998-08-11 New York University Fibrin-binding peptide fragments of fibronectin
AU2313392A (en) 1991-08-01 1993-03-02 University Research Corporation Systematic polypeptide evolution by reverse translation
WO1994017097A1 (en) 1993-01-19 1994-08-04 Regents Of The University Of Minnesota Synthetic fibronectin fragments as inhibitors of retroviral infections
EP0654256B1 (en) 1993-02-26 2000-08-02 Santen Pharmaceutical Co., Ltd. Biodegradable sclera plug
US5643575A (en) 1993-10-27 1997-07-01 Enzon, Inc. Non-antigenic branched polymer conjugates
AU8124694A (en) 1993-10-29 1995-05-22 Affymax Technologies N.V. In vitro peptide and antibody display libraries
US5443505A (en) 1993-11-15 1995-08-22 Oculex Pharmaceuticals, Inc. Biocompatible ocular implants
US5516522A (en) 1994-03-14 1996-05-14 Board Of Supervisors Of Louisiana State University Biodegradable porous device for long-term drug delivery with constant rate release and method of making the same
US5559000A (en) 1995-01-18 1996-09-24 The Scripps Research Institute Encoded reaction cassette
US5869079A (en) 1995-06-02 1999-02-09 Oculex Pharmaceuticals, Inc. Formulation for controlled release of drugs by combining hydrophilic and hydrophobic agents
US6369116B1 (en) 1995-06-02 2002-04-09 Oculex Pharmaceuticals, Inc. Composition and method for treating glaucoma
DE19646372C1 (de) 1995-11-11 1997-06-19 Evotec Biosystems Gmbh Genotyp und Phänotyp koppelnde Verbindung
GB9618960D0 (en) 1996-09-11 1996-10-23 Medical Science Sys Inc Proteases
US5922676A (en) 1996-09-20 1999-07-13 The Burnham Institute Methods of inhibiting cancer by using superfibronectin
WO1998016636A1 (fr) 1996-10-17 1998-04-23 Mitsubishi Chemical Corporation Molecule permettant d'homologuer un genotype et un phenotype, et utilisation de celle-ci
US6348333B1 (en) 1997-01-17 2002-02-19 Toa Gosei Co., Ltd. VEGF-binding KDR polypeptide
US6261804B1 (en) 1997-01-21 2001-07-17 The General Hospital Corporation Selection of proteins using RNA-protein fusions
WO1998031700A1 (en) 1997-01-21 1998-07-23 The General Hospital Corporation Selection of proteins using rna-protein fusions
AU7266898A (en) * 1997-04-30 1998-11-24 Enzon, Inc. Single-chain antigen-binding proteins capable of glycosylation, production and uses thereof
US6159722A (en) 1997-12-03 2000-12-12 Boehringer Mannheim Gmbh Chimeric serine proteases
IL138668A0 (en) 1998-04-03 2001-10-31 Phylos Inc Addressable protein arrays
US20030045681A1 (en) 1998-05-11 2003-03-06 Anthony J. Zelano Specific binding molecules for scintigraphy, conjugates containing them and therapeutic method for treatment of angiogenesis
JP4108827B2 (ja) 1998-05-28 2008-06-25 大日本印刷株式会社 無機質系化粧板
CA2342967A1 (en) 1998-12-08 2000-06-15 Biovation Limited Modifying protein immunogenicity
CA2351346C (en) 1998-12-10 2015-09-01 Phylos, Inc. Protein scaffolds for antibody mimics and other binding proteins
US7115396B2 (en) 1998-12-10 2006-10-03 Compound Therapeutics, Inc. Protein scaffolds for antibody mimics and other binding proteins
DE60011612T2 (de) 1999-04-28 2005-07-07 Board of Regents, The University of Texas System, Austin Zusammensetzungen und Verfahren zur Krebsbehandlung durch die selektive Hemmung von VEGF
ATE360706T1 (de) 1999-07-27 2007-05-15 Adnexus Therapeutics Inc Peptidakzeptor ligationsverfahren
US6399857B1 (en) 1999-09-22 2002-06-04 Paradigm Genetics, Inc. Modified nucleotide sequence encoding a LexA DNA binding domain optimized for arabidopsis species
AU4445601A (en) 2000-03-31 2001-10-08 Centre National De La Recherche Scientifique-Cnrs Peptides blocking vascular endothelial growth factor (vegf)-mediated angiogenesis, polynucleotides encoding said peptides and methods of use thereof
JP2004515219A (ja) 2000-06-15 2004-05-27 ボード・オブ・リージェンツ，ザ・ユニヴァーシティ・オヴ・テキサス・システム 調節可能な触媒活性な核酸
DK1339438T3 (da) 2000-11-29 2006-02-13 Allergan Inc Forebyggelse af transplantatafvisning i ojet
US6509027B2 (en) 2001-02-12 2003-01-21 Supergen, Inc. Injectable pharmaceutical composition comprising coated particles of camptothecin
WO2002088171A2 (en) 2001-04-26 2002-11-07 Avidia Research Institute Combinatorial libraries of monomer domains
US20030004561A1 (en) 2001-06-28 2003-01-02 Steve Bigus Peeling sheath for self-expanding stent
WO2003022858A2 (de) 2001-09-11 2003-03-20 Nascacell Gmbh Verfahren zum screenen von inhibitoren für die protein-protein-wechselwirkung sowie ribozyme hierzu
US20080193445A1 (en) * 2002-01-18 2008-08-14 Liliane Goetsch Novel anti-IGF-IR antibodies and uses thereof
EP1478339B9 (en) 2002-02-22 2009-08-19 Schering Corporation Pharmaceutical formulations of antineoplastic agents, in particular temozolomide, processes of making and using the same
CA2478169C (en) 2002-03-04 2013-04-16 Imclone Systems Incorporated Human antibodies specific to kdr and uses thereof
AU2003243436A1 (en) 2002-06-06 2003-12-22 Shohei Koide Reconstituted polypeptides
US7053701B2 (en) 2003-11-04 2006-05-30 Vice Michael W Power amplifier output stage with multiple power states and improved efficiency
CN1926344B (zh) 2003-11-17 2011-11-30 远程接合技术公司 固定器和其他组件
US20080220049A1 (en) 2003-12-05 2008-09-11 Adnexus, A Bristol-Myers Squibb R&D Company Compositions and methods for intraocular delivery of fibronectin scaffold domain proteins
JP5006651B2 (ja) * 2003-12-05 2012-08-22 ブリストル−マイヤーズ スクウィブ カンパニー ２型血管内皮増殖因子受容体の阻害剤
US20060182783A1 (en) 2004-04-30 2006-08-17 Allergan, Inc. Sustained release intraocular drug delivery systems
US20050244469A1 (en) 2004-04-30 2005-11-03 Allergan, Inc. Extended therapeutic effect ocular implant treatments
US20070059336A1 (en) 2004-04-30 2007-03-15 Allergan, Inc. Anti-angiogenic sustained release intraocular implants and related methods
WO2005110374A1 (en) 2004-04-30 2005-11-24 Allergan, Inc. Intraocular drug delivery systems containing a therapeutic component, a cyclodextrin, and a polymeric component
WO2006020258A2 (en) 2004-07-17 2006-02-23 Imclone Systems Incorporated Novel tetravalent bispecific antibody
US7597884B2 (en) * 2004-08-09 2009-10-06 Alios Biopharma, Inc. Hyperglycosylated polypeptide variants and methods of use
BRPI0516308A2 (pt) 2004-10-04 2010-06-15 Qlt Usa Inc composição fluida, métodos de tratamento de uma doença ou disfunção, métodos de liberação local ou sistêmica de um agente biológico, implantes, método de formação de um implante, kit de agente biológico e usos de uma composição fluida
MX2007006557A (es) 2004-12-02 2007-06-15 Schering Corp Metodos para utilizar intratecalmente una formulacion de temozolomida en el tratamiento de canceres.
EP1853309A4 (en) 2005-02-23 2008-10-22 Merrimack Pharmaceuticals Inc BISPECIFIC BINDER FOR MODULATING BIOLOGICAL ACTIVITY
FR2888850B1 (fr) 2005-07-22 2013-01-11 Pf Medicament Nouveaux anticorps anti-igf-ir et leurs applications
US7612181B2 (en) * 2005-08-19 2009-11-03 Abbott Laboratories Dual variable domain immunoglobulin and uses thereof
US7887273B2 (en) 2005-09-15 2011-02-15 Newfrey Llc Blind rivet and method
US20070072933A1 (en) 2005-09-26 2007-03-29 Peyman Gholam A Delivery of an ocular agent
WO2007044688A1 (en) * 2005-10-07 2007-04-19 The Regents Of The University Of California Nucleic acids encoding modified cytochrome p450 enzymes and methods of use thereof
CA2602577C (en) 2005-10-18 2015-03-31 Allergan, Inc. Ocular therapy using glucocorticoid derivatives selectively penetrating posterior segment tissues
US20070099879A1 (en) 2005-10-31 2007-05-03 Wisconsin Alumni Research Foundation (Warf) Method of using calcitriol for treating intraocular diseases associated with angiogenesis
WO2007054120A1 (de) 2005-11-09 2007-05-18 Bayer Schering Pharma Aktiengesellschaft Identifizierung und charakterisierung von funktionsblockierenden anti-ed-b-fibronektin antikörpern
KR20180030264A (ko) * 2005-11-23 2018-03-21 악셀레론 파마 인코포레이티드 액티빈-ａｃｔｒⅱａ 길항제 및 골 성장을 촉진하기 위한 이들의 용도
BRPI0707446A2 (pt) 2006-02-02 2011-05-03 Allergan Inc composições e métodos para o tratamento de doença oftálmica
KR20080097188A (ko) * 2006-02-24 2008-11-04 키에시 파르마슈티시 엣스. 피. 에이. 항아밀로이드 면역성성분, 그 제조방법 및 용도
WO2007121894A2 (en) * 2006-04-21 2007-11-01 Transgene S.A. Hpv-18-based papillomavirus vaccine
ES2613957T3 (es) 2006-08-04 2017-05-29 Medimmune Limited Anticuerpos contra ERBB2
CA2666507A1 (en) * 2006-10-16 2008-04-24 The Arizona Board Of Regents, A Body Corporate Of The State Of Arizona A Cting For And On Behalf Of Arizona State University Synthetic antibodies
US8476243B2 (en) * 2006-12-29 2013-07-02 Transderm, Inc. Methods and compositions for treating keratin hyperproliferative disorders
CA2679548C (en) 2007-03-02 2015-01-27 Amgen Inc. Methods and compositions for treating tumor diseases
US11078262B2 (en) 2007-04-30 2021-08-03 Allergan, Inc. High viscosity macromolecular compositions for treating ocular conditions
JP5591691B2 (ja) 2007-05-22 2014-09-17 アムジエン・インコーポレーテツド 生物活性を有する融合タンパク質を作製するための組成物及び方法
EP2222846B1 (en) 2007-08-10 2017-05-03 Protelix, Inc. Universal fibronectin type iii binding-domain libraries
US8680019B2 (en) 2007-08-10 2014-03-25 Protelica, Inc. Universal fibronectin Type III binding-domain libraries
US8470966B2 (en) 2007-08-10 2013-06-25 Protelica, Inc. Universal fibronectin type III binding-domain libraries
JP2010538972A (ja) 2007-08-20 2010-12-16 ブリストル−マイヤーズ スクイブ カンパニー 転移性癌の処置のためのｖｅｇｆｒ−２阻害剤の使用
EA201000343A1 (ru) 2007-10-04 2011-10-31 Займодженетикс, Инк. ЧЛЕН СЕМЕЙСТВА B7, zB7H6 И РОДСТВЕННЫЕ КОМПОЗИЦИИ И СПОСОБЫ
CN101932720A (zh) 2007-10-31 2010-12-29 米迪缪尼有限公司 蛋白质支架
WO2009073115A1 (en) 2007-11-28 2009-06-11 Bristol-Myers Squibb Company Combination vegfr2 therapy with mtor inhibitors
JP2011507529A (ja) 2007-12-19 2011-03-10 セントコア・オーソ・バイオテツク・インコーポレーテツド Ｍ１３ファージのｐＩＸへの融合を介する代替の足場タンパク質融合ファージ提示
JP2011507543A (ja) 2007-12-27 2011-03-10 ノバルティス アーゲー 改善されたフィブロネクチンベースの結合分子およびそれらの使用
WO2009102421A2 (en) 2008-02-14 2009-08-20 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind egfr
CN102076713B (zh) 2008-05-02 2015-03-25 诺华股份有限公司 改进的基于纤连蛋白的结合分子及其用途
EP2291399B1 (en) * 2008-05-22 2014-06-25 Bristol-Myers Squibb Company Multivalent fibronectin based scaffold domain proteins
DK2356269T3 (en) 2008-10-31 2016-08-15 Janssen Biotech Inc FIBRONECTIN TYPE III DOMAIN-BASED SCAFFOLD COMPOSITIONS, PROCEDURES AND APPLICATIONS
US8415291B2 (en) 2008-10-31 2013-04-09 Centocor Ortho Biotech Inc. Anti-TNF alpha fibronectin type III domain based scaffold compositions, methods and uses
TWI496582B (zh) 2008-11-24 2015-08-21 必治妥美雅史谷比公司 雙重專一性之ｅｇｆｒ／ｉｇｆｉｒ結合分子
EA201100943A1 (ru) 2008-12-16 2012-05-30 Новартис Аг Системы дрожжевого дисплея
WO2010093771A1 (en) 2009-02-11 2010-08-19 Bristol-Myers Squibb Company Combination vegfr2 therapy with temozolomide
WO2010093627A2 (en) 2009-02-12 2010-08-19 Centocor Ortho Biotech Inc. Fibronectin type iii domain based scaffold compositions, methods and uses
US8067201B2 (en) * 2009-04-17 2011-11-29 Bristol-Myers Squibb Company Methods for protein refolding
WO2011020033A2 (en) 2009-08-13 2011-02-17 Massachusetts Institute Of Technology Engineered proteins including mutant fibronectin domains
ES2860453T3 (es) 2009-10-30 2021-10-05 Novartis Ag Bibliotecas universales del dominio de unión del lado inferior de la fibronectina de tipo III
WO2011051466A1 (en) 2009-11-02 2011-05-05 Novartis Ag Anti-idiotypic fibronectin-based binding molecules and uses thereof
US20110123545A1 (en) 2009-11-24 2011-05-26 Bristol-Myers Squibb Company Combination of vegfr2 and igf1r inhibitors for the treatment of proliferative diseases
WO2011092233A1 (en) 2010-01-29 2011-08-04 Novartis Ag Yeast mating to produce high-affinity combinations of fibronectin-based binders
CA2788972A1 (en) 2010-02-12 2011-08-18 University Of Rochester Antigenic mimics of discontinuous epitopes of pathogen recognized by broadly neutralizing antibodies
JP2013520426A (ja) 2010-02-18 2013-06-06 ブリストル−マイヤーズ スクイブ カンパニー Ｉｌ−２３に結合する、フィブロネクチンをベースとする足場ドメインタンパク質
SG10201505470QA (en) 2010-04-13 2015-08-28 Medimmune Llc Trail r2-specific multimeric scaffolds
CN105175532B (zh) 2010-04-13 2023-01-17 百时美施贵宝公司 结合pcsk9的基于纤连蛋白的支架域蛋白质
WO2011137319A2 (en) 2010-04-30 2011-11-03 Centocor Ortho Biotech Inc. Stabilized fibronectin domain compositions, methods and uses
TW201138808A (en) 2010-05-03 2011-11-16 Bristol Myers Squibb Co Serum albumin binding molecules
EP2576615B1 (en) 2010-05-26 2016-03-30 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
SG187225A1 (en) 2010-07-30 2013-02-28 Novartis Ag Fibronectin cradle molecules and libraries thereof
JP2014504587A (ja) 2010-12-22 2014-02-24 ブリストル−マイヤーズ スクイブ カンパニー Ｉｌ−２３に結合するフィブロネクチンをベースとするスカフォールドドメインタンパク質
ES2942455T3 (es) 2011-04-13 2023-06-01 Bristol Myers Squibb Co Proteínas de fusión Fc que comprenden enlazadores o disposiciones nuevos
EP2710382B1 (en) 2011-05-17 2017-10-18 Bristol-Myers Squibb Company Improved methods for the selection of binding proteins
US20140187488A1 (en) 2011-05-17 2014-07-03 Bristol-Myers Squibb Company Methods for maintaining pegylation of polypeptides
EP3540100B8 (en) 2011-09-27 2022-11-02 Janssen Biotech, Inc. Fibronectin type iii repeat based protein scaffolds with alternative binding surfaces

Patent Citations (29)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4002531A (en) 1976-01-22 1977-01-11 Pierce Chemical Company Modifying enzymes with polyethylene glycol and product produced thereby
USRE30985E (en) 1978-01-01 1982-06-29 Serum-free cell culture media
US4560655A (en) 1982-12-16 1985-12-24 Immunex Corporation Serum-free cell culture medium and process for making same
US4657866A (en) 1982-12-21 1987-04-14 Sudhir Kumar Serum-free, synthetic, completely chemically defined tissue culture media
US4767704A (en) 1983-10-07 1988-08-30 Columbia University In The City Of New York Protein-free culture medium
WO1987000195A1 (en) 1985-06-28 1987-01-15 Celltech Limited Animal cell culture
US4927762A (en) 1986-04-01 1990-05-22 Cell Enterprises, Inc. Cell culture medium with antioxidant
WO1990003430A1 (en) 1988-09-23 1990-04-05 Cetus Corporation Cell culture medium for enhanced cell growth, culture longevity and product expression
WO1990013540A1 (en) 1989-04-19 1990-11-15 Enzon, Inc. Active carbonates of polyalkylene oxides for modification of polypeptides
WO1990013646A1 (fr) 1989-04-28 1990-11-15 Transgene S.A. Application de nouveaux fragments d'adn en tant que sequence codant pour un peptide signal pour la secretion de proteines matures par des levures recombinantes, cassettes d'expression, levures transformees et procede de preparation de proteines correspondant
EP0473084A2 (en) 1990-08-28 1992-03-04 Sumitomo Pharmaceuticals Company, Limited Polyethylene glycol derivatives, their modified peptides, methods for producing them and use of the modified peptides
US5122469A (en) 1990-10-03 1992-06-16 Genentech, Inc. Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins
WO1994001451A2 (en) 1992-07-13 1994-01-20 Bionebraska, Inc. Method for modification of recombinant polypeptides
WO1994011026A2 (en) 1992-11-13 1994-05-26 Idec Pharmaceuticals Corporation Therapeutic application of chimeric and radiolabeled antibodies to human b lymphocyte restricted differentiation antigen for treatment of b cell lymphoma
US5824784A (en) 1994-10-12 1998-10-20 Amgen Inc. N-terminally chemically modified protein compositions and methods
US5932462A (en) 1995-01-10 1999-08-03 Shearwater Polymers, Inc. Multiarmed, monofunctional, polymer for coupling to molecules and surfaces
WO1998056915A2 (en) 1997-06-12 1998-12-17 Research Corporation Technologies, Inc. Artificial antibody polypeptides
WO2000034787A1 (en) 1998-12-10 2000-06-15 The University Of Nottingham Cancer detection method and reagents
WO2001064942A1 (en) 2000-02-29 2001-09-07 Phylos, Inc. Protein scaffolds for antibody mimics and other binding proteins
WO2002004523A2 (en) 2000-07-11 2002-01-17 Research Corporation Technologies, Inc. Artificial antibody polypeptides
US20020044921A1 (en) 2000-09-29 2002-04-18 Seoju Lee Pegylated interleukin-10
WO2002032925A2 (en) 2000-10-16 2002-04-25 Phylos, Inc. Protein scaffolds for antibody mimics and other binding proteins
US20030186385A1 (en) 2000-11-17 2003-10-02 Shohei Koide Method of identifying polypeptide monobodies which bind to target proteins and use thereof
WO2002081497A2 (en) 2001-04-04 2002-10-17 University Of Rochester αξβ3 INTEGRIN-BINDING POLYPEPTIDE MONOBODIES AND THEIR USE
US20070178082A1 (en) 2002-11-08 2007-08-02 Ablynx N.V. Stabilized single domain antibodies
US20070269422A1 (en) 2006-05-17 2007-11-22 Ablynx N.V. Serum albumin binding proteins with long half-lives
WO2008031098A1 (en) 2006-09-09 2008-03-13 The University Of Chicago Binary amino acid libraries for fibronectin type iii polypeptide monobodies
WO2008066752A2 (en) 2006-11-22 2008-06-05 Adnexus, A Bristol-Myers Squibb R & D Company Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including igf-ir
WO2008097497A2 (en) 2007-02-02 2008-08-14 Adnexus, A Bristol-Myers Squibb R & D Company Vegf pathway blockade

Non-Patent Citations (35)

* Cited by examiner, † Cited by third party
Title
"Remington: The Science and Practice of Pharmacy", 2000, LIPPINCOTT WILLIAMS & WILKINS
ALTUVIA ET AL., J. MOL. BIOL., vol. 249, 1995, pages 244 - 250
ATWELL ET AL., MOL. IMMUNOL., vol. 33, 1996, pages 1301 - 1312
BARNES ET AL., ANAL. BIOCHEM., vol. 102, 1980, pages 255
BATORI ET AL., PROTEIN ENG., vol. 15, no. 12, 2002, pages 1015 - 20
BINZ ET AL., NATURE BIOTECH, vol. 23, 2005, pages 1257 - 1268
CARTER ET AL., PROTEIN SCI., vol. 6, 1997, pages 781 - 788
CAZALIS ET AL.: "C-Terminal Site-Specific PEGylation of a Truncated Thrombomodulin Mutant with Retention of Full Bioactivity", BIOCONJUG CHEM., vol. 15, no. 5, 2004, pages 1005 - 1009
CHAMOW ET AL., BIOCONJUGATE CHEM., vol. 5, 1994, pages 133
CROOKS GE; HON G; CHANDONIA JM; BRENNER SE: "WebLogo: A sequence logo generator", GENOME RESEARCH, vol. 14, 2004, pages 1188 - 1190
DAVID ET AL., BIOCHEMISTRY, vol. 13, 1974, pages 1014
DAYHOFF ET AL.: "Atlas of Protein Sequence and Structure", vol. 5, 1978, pages: 345 - 352
DEVITA, V. T.; HELLMAN, S.; ROSENBERG, S. A.: "Cancer, Principles & Practice of Oncology", 2001, LIPPINCOTT-RAVEN
DICKINSON ET AL., J. MOL. BIOL., vol. 236, 1994, pages 1079 - 1092
EMANUEL STUART L ET AL: "Functional activity of a bispecific Adnectin inhibitor to EGFR and IGFR", PROCEEDINGS OF THE ANNUAL MEETING OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH; 100TH ANNUAL MEETING OF THE AMERICAN-ASSOCIATION-FOR-CANCER-RESEARCH; DENVER, CA, USA; APRIL 18 20090401 NEW YORK, NY, US, vol. 50, 1 April 2009 (2009-04-01), pages 680, XP008119390, ISSN: 0197-016X *
HAM ET AL., METH. ENZ., vol. 58, 1979, pages 44
HIMANEN ET AL., NATURE, vol. 20-27, no. 414, 2001, pages 933 - 8
HOLLINGER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 6444 - 6448
HU ET AL., CANCER RES., vol. 56, 1996, pages 3055 - 306
HUANG FEI ET AL: "The mechanisms of differential sensitivity to an insulin-like growth factor-1 receptor inhibitor (BMS-536924) and rationale for combining with EGFR/HER2 inhibitors.", CANCER RESEARCH, vol. 69, no. 1, 1 January 2009 (2009-01-01), pages 161 - 170, XP002570082, ISSN: 1538-7445 *
HUNTER ET AL., NATURE, vol. 144, 1962, pages 945
KOIDE ET AL., BIOCHEMISTRY, vol. 200140, no. 34, pages 10326 - 33
LU D ET AL: "Simultaneous blockade of both the epidermal growth factor receptor and the insulin-like growth factor receptor signaling pathways in cancer cells with a fully human recombinant bispecific antibody", 23 January 2004, JOURNAL OF BIOLOGICAL CHEMISTRY, AMERICAN SOCIETY FOR BIOCHEMISTRY AND MOLECULAR BIOLOGY, INC, US, PAGE(S) 2856 - 2865, ISSN: 0021-9258, XP002316541 *
M GIBALDI; D PERRON: "Pharmacokinetics", 1982, MARCEL DEKKER
NERI ET AL., J. MOL. BIOL., vol. 246, 1995, pages 367 - 373
NYGREN, J. HISTOCHEM. AND CYTOCHEM., vol. 30, 1982, pages 407
PAIN ET AL., J. IMMUNOL. METH., vol. 40, 1981, pages 219
PEPINSKY ET AL., JPET, vol. 297, 2001, pages 1059
RAJU ET AL., BIOCHEMISTRY, vol. 40, no. 30, 31 July 2001 (2001-07-31), pages 8868 - 76
SANDLER; KARO: "Polymer Synthesis", vol. 3, ACADEMIC PRESS, pages: 138 - 161
WIEDER ET AL., J. BIOL. CHEM., vol. 254, 1979, pages 12579
XU ET AL., CHEMISTRY & BIOLOGY, vol. 9, 2002, pages 933 - 942
ZALIPSKY, ADVANCED DRUG REVIEWS, vol. 16, 1995, pages 157 - 182
ZALIPSKY, S. ET AL.: "Polyethylene Glycol Chemistry: Biotechnical and Biomedical Applications", 1992, PLENUS PRESS, article "Use of Functionalized Poly(Ethylene Glycols) for Modification of Polypeptides"
ZOLA: "Monoclonal Antibodies: A Manual of Techniques", 1987, CRC PRESS, INC., pages: 147 - 158

Cited By (104)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US9862758B2 (en) 2003-12-05 2018-01-09 Bristol-Myers Quibb Company Inhibitors of type 2 vascular endothelial growth factor receptors
US9328157B2 (en) 2003-12-05 2016-05-03 Bristol-Myers Squibb Company Inhibitors of type 2 vascular endothelial growth factor receptors
US10995131B2 (en) 2003-12-05 2021-05-04 Bristol-Myers Squibb Company Libraries of modified fibronectin type III tenth domain-containing polypeptides
US11149077B2 (en) 2006-11-22 2021-10-19 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including IGF-IR
US10221232B2 (en) 2006-11-22 2019-03-05 Bristol-Myers Squibb Company Methods of treating cancer by administering IGF-IR binding molecules
US8470332B2 (en) 2006-11-22 2013-06-25 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins for tyrosine kinases receptors, including IGF-IR
US8633297B2 (en) 2007-10-31 2014-01-21 Medimmune, Llc Protein scaffolds
US9176129B2 (en) 2007-10-31 2015-11-03 Medimmune, Llc Protein scaffolds
US10781247B2 (en) 2008-02-14 2020-09-22 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind EGFR
US9234028B2 (en) 2008-02-14 2016-01-12 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind EGFR
US9920108B2 (en) 2008-02-14 2018-03-20 Bristol-Myers Squibb Company Targeted therapeutics based on engineered proteins that bind EGFR
US9296810B2 (en) 2008-05-02 2016-03-29 Novartis Ag Fibronectin-based binding molecules and uses thereof
US10774130B2 (en) 2008-05-22 2020-09-15 Bristol-Myers Squibb Company Method of treating cancer by administering multivalent fibronectin based scaffold domain proteins
US8728483B2 (en) 2008-05-22 2014-05-20 Bristol-Myers Squibb Company Multivalent fibronectin based scaffold domain proteins
US8221765B2 (en) 2008-05-22 2012-07-17 Bristol-Myers Squibb Company Multivalent fibronectin based scaffold domain proteins
US9902762B2 (en) 2008-05-22 2018-02-27 Bristol-Myers Squibb Company Multivalent fibronectin based scaffold domain proteins
US9200059B2 (en) 2008-10-31 2015-12-01 Janssen Biotech, Inc. Fibronectin type III domain based scaffold compositions, methods and uses
US11479880B2 (en) 2008-10-31 2022-10-25 Janssen Biotech, Inc. Fibronectin type III domain based scaffold compositions, methods and uses
US10654913B2 (en) 2008-10-31 2020-05-19 Janssen Biotech, Inc. Fibronectin type III domain based scaffold compositions, methods and uses
US10040842B2 (en) 2008-10-31 2018-08-07 Janssen Biotech, Inc. Fibronectin type III domain based scaffold compositions, methods and uses
US10954286B2 (en) 2008-11-24 2021-03-23 Bristol-Myers Squibb Company Bispecific EGFR/IGFIR binding molecules
US9017655B2 (en) 2008-11-24 2015-04-28 Bristol-Myers Squibb Company Bispecific EGFR/IGFIR binding molecules
US10183987B2 (en) 2008-11-24 2019-01-22 Bristol-Myers Squibb Company Polynucleotides encoding bispecific EGFR/IGF-IR binding molecules
US9771411B2 (en) 2008-11-24 2017-09-26 Bristol-Myers Squibb Company Method of treating cancer by administering EGFR and EGFR/IGFIR binding molecules
US8067201B2 (en) 2009-04-17 2011-11-29 Bristol-Myers Squibb Company Methods for protein refolding
US9139825B2 (en) 2009-10-30 2015-09-22 Novartis Ag Universal fibronectin type III bottom-side binding domain libraries
US10253313B2 (en) 2009-10-30 2019-04-09 Novartis Ag Universal fibronectin type III bottom-side binding domain libraries
US8927693B2 (en) 2010-02-18 2015-01-06 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind IL-23
US9714281B2 (en) 2010-02-18 2017-07-25 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind IL-23
US9212231B2 (en) 2010-04-13 2015-12-15 Medimmune, Llc TRAIL R2-specific multimeric scaffolds
US8569227B2 (en) 2010-04-30 2013-10-29 Janssen Biotech, Inc. Stabilized fibronectin domain compositions, methods and uses
US9982253B2 (en) 2010-04-30 2018-05-29 Janssen Biotech, Inc. Stabilized fibronectin domain compositions, methods and uses
US9234029B2 (en) 2010-04-30 2016-01-12 Janssen Biotech, Inc. Stabilized fibronectin domain compositions, methods and uses
US10934572B2 (en) 2010-05-03 2021-03-02 Bristol-Myers Squibb Company Serum albumin binding molecules
US9540424B2 (en) 2010-05-03 2017-01-10 Bristol-Myers Squibb Company Serum albumin binding molecules
US10221438B2 (en) 2010-05-03 2019-03-05 Bristol-Myers Squibb Company Serum albumin binding molecules
US8969289B2 (en) 2010-05-03 2015-03-03 Bristol-Myers Squibb Company Serum albumin binding molecules
WO2011150133A3 (en) * 2010-05-26 2012-03-08 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
EP3091028A1 (en) * 2010-05-26 2016-11-09 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
US11161893B2 (en) 2010-05-26 2021-11-02 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
US10273286B2 (en) 2010-05-26 2019-04-30 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
US9562089B2 (en) 2010-05-26 2017-02-07 Bristol-Myers Squibb Company Fibronectin based scaffold proteins having improved stability
US10065994B2 (en) 2010-07-06 2018-09-04 Novartis Ag Norovirus derived immunogenic compositions and methods
JP2016053087A (ja) * 2010-07-06 2016-04-14 ノバルティス アーゲー ノロウイルスに由来する免疫原性組成物および方法
US9512199B2 (en) 2010-07-30 2016-12-06 Novartis Ag Fibronectin cradle molecules and libraries thereof
JP2016192973A (ja) * 2010-07-30 2016-11-17 ノバルティス アーゲー フィブロネクチンクレードル分子及びそのライブラリ
EP3222631A3 (en) * 2010-07-30 2017-11-22 Novartis AG Fibronectin cradle molecules and libraries thereof
EP3248987A1 (en) * 2010-07-30 2017-11-29 Novartis AG Fibronectin cradle molecules and libraries thereof
JP2013539362A (ja) * 2010-07-30 2013-10-24 ノバルティス アーゲー フィブロネクチンクレードル分子及びそのライブラリ
WO2012016245A3 (en) * 2010-07-30 2012-08-09 Novartis Ag Fibronectin cradle molecules and libraries thereof
US9932568B2 (en) 2011-03-04 2018-04-03 Shire Human Genetic Therapies, Inc. Peptide linkers for polypeptide compositions and methods for using same
JP2014515595A (ja) * 2011-03-04 2014-07-03 シャイアー ヒューマン ジェネティック セラピーズ インコーポレイテッド ポリペプチド組成物用ペプチドリンカーおよびその使用方法
JP2016187358A (ja) * 2011-03-04 2016-11-04 シャイアー ヒューマン ジェネティック セラピーズ インコーポレイテッド ポリペプチド組成物用ペプチドリンカーおよびその使用方法
US9469676B2 (en) 2011-04-13 2016-10-18 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
US10214579B2 (en) 2011-04-13 2019-02-26 Bristol-Myers Squibb Company Fc fusion proteins comprising novel linkers or arrangements
US11913137B2 (en) 2011-05-17 2024-02-27 Bristol-Myers Squibb Company Methods for the selection of binding proteins
WO2012158739A1 (en) 2011-05-17 2012-11-22 Bristol-Myers Squibb Company Improved methods for the selection of binding proteins
US9347058B2 (en) 2011-05-17 2016-05-24 Bristol-Myers Squibb Company Methods for the selection of binding proteins
US10150962B2 (en) 2011-05-17 2018-12-11 Bristol-Myers Squibb Company Methods for the selection of binding proteins
US11060085B2 (en) 2011-05-17 2021-07-13 Bristol-Myers Squibb Company Methods for the selection of binding proteins
EP3318880A1 (en) 2011-05-17 2018-05-09 Bristol-Myers Squibb Company Improved methods for the selection of binding proteins
EP2709669A1 (en) * 2011-05-17 2014-03-26 Bristol-Myers Squibb Company Methods for maintaining pegylation of polypeptides
WO2012158678A1 (en) 2011-05-17 2012-11-22 Bristol-Myers Squibb Company Methods for maintaining pegylation of polypeptides
US10898538B2 (en) 2011-05-17 2021-01-26 Bristol-Myers Squibb Company Methods for maintaining pegylation of polypeptides
WO2013049275A1 (en) 2011-09-27 2013-04-04 Janssen Biotech, Inc. Fibronectin type iii repeat based protein scaffolds with alternative binding surfaces
EP4151785A1 (en) 2011-09-27 2023-03-22 Janssen Biotech, Inc. Fibronectin type iii repeat based protein scaffolds with alternative binding surfaces
US9897612B2 (en) 2011-09-27 2018-02-20 Janssen Biotech, Inc. Fibronectin type III repeat based protein scaffolds with alternative binding surfaces
EP3540100A1 (en) 2011-09-27 2019-09-18 Janssen Biotech, Inc. Fibronectin tyoe iii repeat based protein scaffolds with alternative binding surfaces
US9200273B2 (en) 2011-09-27 2015-12-01 Janssen Biotech, Inc. Fibronectin type III repeat based protein scaffolds with alternative binding surfaces
US10571472B2 (en) 2011-09-27 2020-02-25 Janssen Biotech, Inc. Fibronectin type III repeat based protein scaffolds with alternative binding surfaces
US11555062B2 (en) 2011-10-11 2023-01-17 Viela Bio, Inc. Methods of administering a composition comprising a Tn3 scaffold and a CD40L-specific monomer
US10464995B2 (en) 2011-10-31 2019-11-05 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US9416170B2 (en) 2011-10-31 2016-08-16 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US9765132B2 (en) 2011-10-31 2017-09-19 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US11279751B2 (en) 2011-10-31 2022-03-22 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US11408093B2 (en) 2011-10-31 2022-08-09 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US9522951B2 (en) 2011-10-31 2016-12-20 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US10604556B2 (en) 2011-10-31 2020-03-31 Bristol-Myers Squibb Company Fibronectin binding domains with reduced immunogenicity
US10245302B2 (en) 2012-09-13 2019-04-02 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US8933199B2 (en) 2012-09-13 2015-01-13 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US8853154B2 (en) 2012-09-13 2014-10-07 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US8993265B2 (en) 2012-09-13 2015-03-31 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US10406212B2 (en) 2012-09-13 2019-09-10 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US9662373B2 (en) 2012-09-13 2017-05-30 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US11813315B2 (en) 2012-09-13 2023-11-14 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
US9493546B2 (en) 2012-09-13 2016-11-15 Bristol-Myers Squibb Company Fibronectin based scaffold domain proteins that bind to myostatin
EP2951206A2 (en) * 2013-02-01 2015-12-09 Bristol-Myers Squibb Company Fibronectin based scaffold proteins
US11447538B2 (en) 2013-02-01 2022-09-20 Bristol-Myers Squibb Company Fibronectin based scaffold proteins
US10787498B2 (en) 2013-02-06 2020-09-29 Bristol-Myers Squibb Company Fibronectin type III domain proteins with enhanced solubility
US11512124B2 (en) 2013-02-06 2022-11-29 Bristol-Myers Squibb Company Fibronectin type III domain proteins with enhanced solubility
US10065987B2 (en) 2013-02-12 2018-09-04 Bristol-Myers Squibb Company High pH protein refolding methods
US11345722B2 (en) 2013-02-12 2022-05-31 Bristol-Myers Squibb Company High pH protein refolding methods
US11203630B2 (en) 2014-03-20 2021-12-21 Bristol-Myers Squibb Company Serum albumin-binding fibronectin type III domains
US10442851B2 (en) 2014-03-20 2019-10-15 Bristol-Myers Squibb Company Serum albumin-binding fibronectin type III domains
US10766946B2 (en) 2015-09-23 2020-09-08 Bristol-Myers Squibb Company Fast-off rate serum albumin binding fibronectin type III domains
US11434275B2 (en) 2015-09-23 2022-09-06 Bristol-Myers Squibb Company Fast-off rate serum albumin binding fibronectin type III domains
US11345739B2 (en) 2016-12-14 2022-05-31 Janssen Biotech, Inc CD137 binding fibronectin type III domains
US11299534B2 (en) 2016-12-14 2022-04-12 Janssen Biotech, Inc. CD8A-binding fibronectin type III domains
US11447539B2 (en) 2016-12-14 2022-09-20 Janssen Biotech, Inc. PD-L1 binding fibronectin type III domains
US11932680B2 (en) 2016-12-14 2024-03-19 Janssen Biotech, Inc. CD8A-binding fibronectin type III domains
EP3638300A4 (en) * 2017-06-16 2021-06-23 Protelica, Inc. FIBRONECTIN-BINDING CHEMICAL ANTIGEN RECEPTORS AND METHODS OF USE
US11628222B2 (en) 2019-10-14 2023-04-18 Aro Biotherapeutics Company CD71 binding fibronectin type III domains
US11781138B2 (en) 2019-10-14 2023-10-10 Aro Biotherapeutics Company FN3 domain-siRNA conjugates and uses thereof
US12037379B2 (en) 2021-04-14 2024-07-16 Aro Biotherapeutics Company CD71 binding fibronectin type III domains

Also Published As

Publication number Publication date
NZ592782A (en) 2012-09-28
US20130157948A1 (en) 2013-06-20
EP2350126A1 (en) 2011-08-03
EP2350126B1 (en) 2015-11-04
JP2016000731A (ja) 2016-01-07
CA2744405A1 (en) 2010-05-27
JP2012509900A (ja) 2012-04-26
MX2011005257A (es) 2011-05-31
CL2011001214A1 (es) 2011-09-16
US20190153069A1 (en) 2019-05-23
US20180037631A1 (en) 2018-02-08
PE20110587A1 (es) 2011-08-31
CN102439036A (zh) 2012-05-02
US20100179094A1 (en) 2010-07-15
US10183987B2 (en) 2019-01-22
US8343501B2 (en) 2013-01-01
EP3029064A1 (en) 2016-06-08
TWI496582B (zh) 2015-08-21
IL212715A0 (en) 2011-07-31
AR074399A1 (es) 2011-01-12
CN102439036B (zh) 2015-07-08
TN2011000225A1 (en) 2012-12-17
US20150259398A1 (en) 2015-09-17
JP5823870B2 (ja) 2015-11-25
ZA201103766B (en) 2012-10-31
AU2009316271A1 (en) 2010-05-27
NZ601693A (en) 2014-02-28
ES2555381T3 (es) 2015-12-30
EA201100669A1 (ru) 2012-05-30
CO6382161A2 (es) 2012-02-15
US10954286B2 (en) 2021-03-23
BRPI0922613A2 (pt) 2019-09-24
EA022415B1 (ru) 2015-12-30
US9771411B2 (en) 2017-09-26
KR20110098922A (ko) 2011-09-02
US9017655B2 (en) 2015-04-28
TW201026332A (en) 2010-07-16

Similar Documents

Publication Publication Date Title
US10954286B2 (en) Bispecific EGFR/IGFIR binding molecules
US20210017252A1 (en) Multivalent fibronectin based scaffold domain proteins
US9920108B2 (en) Targeted therapeutics based on engineered proteins that bind EGFR
AU2013202605A1 (en) Bispecific egfr/igfir binding molecules

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200980155318.4

Country of ref document: CN

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09760433

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 212715

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 3435/DELNP/2011

Country of ref document: IN

WWE Wipo information: entry into national phase

Ref document number: 592782

Country of ref document: NZ

Ref document number: 2009316271

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: MX/A/2011/005257

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 2744405

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 001073-2011

Country of ref document: PE

Ref document number: 201100669

Country of ref document: EA

WWE Wipo information: entry into national phase

Ref document number: 2011001214

Country of ref document: CL

Ref document number: 2011537719

Country of ref document: JP

Ref document number: 11064214

Country of ref document: CO

Ref document number: 2009760433

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2009316271

Country of ref document: AU

Date of ref document: 20091124

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: DZP2011000422

Country of ref document: DZ

ENP Entry into the national phase

Ref document number: 20117014484

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: PI0922613

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20110524