WO2009141330A1 - Verfahren zur herstellung von l-aminosäuren - Google Patents

Verfahren zur herstellung von l-aminosäuren Download PDF

Info

Publication number
WO2009141330A1
WO2009141330A1 PCT/EP2009/056046 EP2009056046W WO2009141330A1 WO 2009141330 A1 WO2009141330 A1 WO 2009141330A1 EP 2009056046 W EP2009056046 W EP 2009056046W WO 2009141330 A1 WO2009141330 A1 WO 2009141330A1
Authority
WO
WIPO (PCT)
Prior art keywords
amino acid
seq
acid sequence
amtr
lysine
Prior art date
Application number
PCT/EP2009/056046
Other languages
English (en)
French (fr)
Inventor
Nadja Jessberger
Andreas Burkovski
Brigitte Bathe
Alexander Reth
Original Assignee
Evonik Degussa Gmbh
Friedrich-Alexander Universität Erlangen-Nürnberg
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Evonik Degussa Gmbh, Friedrich-Alexander Universität Erlangen-Nürnberg filed Critical Evonik Degussa Gmbh
Priority to BRPI0913067-5A priority Critical patent/BRPI0913067A2/pt
Priority to EP09749820.8A priority patent/EP2276845B1/de
Priority to DK09749820.8T priority patent/DK2276845T3/da
Publication of WO2009141330A1 publication Critical patent/WO2009141330A1/de

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/74—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora
    • C12N15/77—Vectors or expression systems specially adapted for prokaryotic hosts other than E. coli, e.g. Lactobacillus, Micromonospora for Corynebacterium; for Brevibacterium
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
    • C07K14/34—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Corynebacterium (G)
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P13/00—Preparation of nitrogen-containing organic compounds
    • C12P13/04—Alpha- or beta- amino acids
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
    • C12P13/00—Preparation of nitrogen-containing organic compounds
    • C12P13/04—Alpha- or beta- amino acids
    • C12P13/08—Lysine; Diaminopimelic acid; Threonine; Valine

Definitions

  • the invention relates to a process for the preparation of L-amino acids using coryneform bacteria in which the AmtR regulator has been attenuated.
  • L-amino acids are used in human medicine, in the pharmaceutical industry, in the food industry and especially in animal nutrition.
  • L-amino acids such as L-lysine
  • Process improvements may include fermentation measures such as stirring and oxygen supply, or nutrient media composition, such as sugar concentration during fermentation, or product form processing by, for example, ion exchange chromatography or the intrinsic performance characteristics of the microorganism itself.
  • AEC lysine analog S- (2-aminoethyl) -L-cysteine
  • Corynebacterium glutamicum biology, genetics and biotechnology summaries are described in the "Handbook of Corynebacterium glutamicum” (Eds .: L. Eggeling and M. Bott, CRC Press, Taylor & Francis, 2005) in the Journal of Biotechnolgy's Special Edition (Chief Editor: A. Pühler) entitled “A New Era in Corynebacterium glutamicum Biotechnology” (Journal of Biotechnolgy 104 / 1-3, (2003)) and in the book by T. Scheper (Managing Editor) "Microbial Production of L-Amino Acids "(Advances in Biochemical Engineering / Biotechnology 79, Springer Verlag, Berlin, Germany, 2003) to find.
  • the nucleotide sequence of the genome of Corynebacterium glutamicum ATCC13032 is described in Ikeda and Nakagawa (Applied Microbiology and Biotechnology 62, 99-109 (2003)), in EP 1 108 790 and in Kalinowski et al. (Journal of Biotechnolgy 104 (1-3), (2003)).
  • the nucleotide sequence of the genome of Corynebacterium glutamicum R is described in Yukawa et al. (Microbiology 153 (4): 1042-1058 (2007)).
  • nucleotide sequence of the genome of Corynebacterium efficiens is described in Nishio et al (Genome Research., 13 (7), 1572-1579 (2003)).
  • the nucleotide sequences of the genome of Corynebacterium glutamicum and Corynebacterium efficiens are also in the National Library of Biotechnology Information (NCBI) database of the National Library of Medicine (Bethesda, MD, USA), in the DNA Data Bank of Japan (DDBJ, Mishima, Japan ) or in the nucleotide sequence database of European Molecular Biology Laboratories (EMBL, Heidelberg, Germany and Cambridge, UK, respectively).
  • NCBI National Library of Biotechnology Information
  • C. glutamicum is able to utilize various sources of nitrogen, including ammonium, L-glutamic acid, glutamine and urea. Depending on the concentration and type of nitrogen source available, certain enzymes and transport systems are synthesized or activated. For energetic reasons, a strict regulation (“nitrogen control”) is necessary. The regulation of gene expression and global signal transduction in the nitrogen metabolism of C. glutamicum has been studied in detail by several authors.
  • the expression of nitrogen-regulated genes in C. glutamicum is regulated by the global repressor AmtR.
  • AmtR represses, with good nitrogen supply, the expression of the genes of the amt-soxA-ocd operon, the gltBD operon, the amtB-glnK glnD operon as well as the genes glnA and crnT (Jacoby et al., Molecular Microbiology 37: 964 -977 (2000); Beckers et al., Microbiology, 147: 2961-2170 (2001); Nolden et al., FEMS Microbiological Letters 201: 91-98 (2001)).
  • EP 1 460 128 reports the effect of deletion of the amtR gene in a ⁇ argR strain on the production of various amino acids.
  • the invention relates to a recombinant, L-
  • Amino acid-secreting, coryneform bacterium in which the amtR gene encoding an AmtR regulator whose amino acid sequence at least 85% or at least 90%, preferably at least 95%, more preferably at least 98% or at least 99% and most preferably identical to the amino acid sequence of SEQ ID NO: 2 and comprising, in essence, a length of 222 amino acids attenuated by one or more of the measures selected from the group a. Substitution of the nucleobase guanine at position 7 of the promoter region of the amtR gene according to SEQ ID NO: 5 by thymine,
  • nucleobases from position 40 to 45 preferably deletion of all nucleobases from position 40 to 45, the promoter region of the amtR gene according to SEQ ID NO: 5
  • f Deletion of one or more of the nucleobases between position 72 and 78 of the promoter region of the amtR gene according to SEQ ID NO: 5, G. Substitution of one or more of the nucleobases
  • Amino acid sequence against another proteinogenic L-amino acid preferably L-glutamic acid or L-glutamic acid.
  • Aspartic acid more preferably L-glutamic acid, j.
  • Amino acid sequence against an amino acid selected from the group consisting of L-glutamic acid, L-aspartic acid, L-isoleucine, L-histidine, L-tryptophan and L-phenylalanine, preferably L-tryptophan,
  • L-proline amino acid selected from the group L-proline, glycine, L-methionine, L-glutamic acid and L-aspartic acid, preferably L-aspartic acid, t.
  • L-lysine at position 63 of the amino acid sequence against an amino acid selected from the group L-alanine, L-glutamic acid, L-aspartic acid, L-asparagine, L-tyrosine and L-tryptophan, preferably L-asparagine.
  • Coryneform bacteria are used for the production of the bacteria according to the invention.
  • the genus Corynebacterium is preferred.
  • Within the genus Corynebacterium strains are preferred which are based on the following types:
  • Corynebacterium efficiens such as the type strain DSM44549,
  • Corynebacterium glutamicum such as the type strain ATCC13032 or the strain R, and
  • Corynebacterium ammoniagenes such as strain ATCC6871,
  • Corynebacterium glutamicum Some representatives of the species Corynebacterium glutamicum are also known in the art under other names. These include, for example: Corynebacterium acetoacidophilum ATCC13870,
  • Corynebacterium efficiens have also been referred to in the art as Corynebacterium thermoaminogenes, such as strain FERM BP-1539.
  • the strains of coryneform bacteria used for the attenuation measures are preferred already the ability to enrich the desired L-amino acid (s) in the cell or excrete in the surrounding nutrient medium and accumulate there.
  • the term “produce” is also used below
  • Attenuation strains used coryneformer bacteria the ability> (at least) 0.25 g / l,> 0.5 g / l,> 1.0 g / l,> 1.5 g / l, ⁇ 2.0 g / l, ⁇ 4 g / l or ⁇ 10 g / l of the desired compound in ⁇ (maximum) 120 hours, ⁇ 96 hours, ⁇ 48 hours, ⁇ 36 hours, ⁇ 24 hours or ⁇ 12 hours in the cell or in the nutrient medium to accumulate.
  • the parent strains are preferably strains which have been produced by mutagenesis and selection, by recombinant DNA techniques or by a combination of both methods.
  • a bacterium according to the invention also by first in a wild strain, such as in the type strain ATCC13032 or in the strain ATCC14067, the amtR gene using the
  • Actions of the invention attenuates and then by appropriate further genetic measures, the bacterium causes to produce the desired (s) L-amino acid (s).
  • L-amino acids includes the proteinogenic amino acids, as well as L-ornithine and L-homoserine. Proteinogenic L-amino acids are understood as meaning the L-amino acids which occur in natural proteins, ie in proteins of microorganisms, plants, animals and humans.
  • Proteinogenic amino acids include L-aspartic acid, L-asparagine, L-threonine, L-serine, L-glutamic acid, L-glutamine, L-glycine, L-alanine, L-cysteine, L-valine, L-methionine, L Isoleucine, L-leucine, L-tyrosine, L-phenylalanine, L-histidine, L-lysine, L-tryptophan, L-arginine, L-proline and optionally L-selenocysteine and L-lysine.
  • L-amino acids L-lysine L-glutamic acid, L-glutamine, L-arginine, L-proline and L-ornithine. Particularly preferred is L-lysine.
  • amino acids or L-amino acids are mentioned below, the term also includes their salts, for example the lysine monohydrochloride or lysine sulfate in the case of the amino acid L-lysine.
  • Known representatives of strains of coryneform bacteria producing L-lysine are, for example:
  • Corynebacterium glutamicum AHP-3 Ferm BP-7382
  • Ferm BP-7382 Ferm BP-7382
  • ATCC American Type Culture Collection
  • DSM German Collection of Microorganisms and Cell Cultures
  • Strains designated "NRRL” may be obtained from the Agricultural Research Service Patent Culture Collection (ARS, Peoria, Illinois, U.S.A.) Strains designated “FERM” may be obtained from the National Institute of Advanced Industrial Science and Technology (AIST Tsukuba Central 6th , 1-1-1 Higashi, Tsukuba Ibaraki, Japan).
  • Coryneform bacteria producing L-lysine typically have a "feed back" resistant aspartate kinase Aspartate kinases (LysC) are considered to be less susceptible to inhibition by mixtures of Lysine and threonine or mixtures of AEC (aminoethylcysteine) and threonine or lysine alone or AEC alone.
  • the genes or alleles coding for these aspartate kinases, which are desensitized in comparison with the wild type, are also referred to as lysC FBR alleles.
  • the prior art describes numerous lysC FBR alleles encoding aspartate kinase variants which have amino acid changes compared to the wild-type protein.
  • the coding region of the wild-type lysC gene of Corynebacterium glutamicum ATCC13032 corresponding to accession number AX756575 of the NCBI database is shown in SEQ ID NO: 7 and the polypeptide encoded by this gene in SEQ ID NO: 8 shown.
  • the amino acid sequence of the wild-type Aspartatkinase varies slightly in different wild-type strains of Corynebacterium glutamicum.
  • the aspartate kinase of the wild-type strain Corynebacterium glutamicum ATCC14067 at position 317 contains alanine.
  • the wild-type aspartate kinase of strain ATCC 13032 contains serine at this position as shown in SEQ ID NO: 8.
  • Coryneform bacteria producing L-lysine used in the practice of the invention preferably have a lysC allele encoding an aspartate kinase variant having the amino acid sequence of SEQ ID NO: 13, one or more of the amino acid substitutions selected from the group consisting of:
  • LysC A279T exchange of L-alanine at position 279 of the encoded aspartate kinase protein according to SEQ ID NO: 13 for L-threonine; see US 5,688,671 and accession numbers E06825, E06826, E08178 and 174588 to 174597),
  • LysC A279V replacement of L-alanine at position 279 of the encoded aspartate kinase protein according to SEQ ID NO: 13 against L-valine, see JP 6-261766 and accession number E08179
  • LysC L297Q replacement of L-leucine at position 297 of the encoded aspartate kinase protein according to SEQ ID NO: 13 against L-glutamine; see DE 102006026328,
  • LysC S301F replacement of L-serine at position 301 of the encoded aspartate kinase protein according to SEQ ID NO: 13 against L-phenylalanine, see US Pat. No. 6,844,176 and accession number E08180),
  • LysC S301Y replacement of L-serine at position 301 of the encoded aspartate kinase protein according to SEQ ID NO: 13 against L-tyrosine, see Kalinowski et al (Molecular and General Genetics 224, 317-324 (1990)) and accession number X57226)
  • LysC T308I replacement of L-threonine at position 308 of the encoded aspartate kinase protein according to SEQ ID NO: 13 against L-isoleucine, see JP 6-261766 and accession number E08181)
  • LysC T311I replacement of L-threonine at position 311 of the encoded aspartate kinase protein according to SEQ ID NO: 13 by L-isoleucine, see WO 00/63388 and US Pat. No. 6,893,848),
  • LysC R320G replacement of L-arginine at position 320 of the encoded aspartate kinase protein according to SEQ ID NO: 13 against glycine, see Jetten et al (Applied Microbiology and Biotechnology 43, 76-82 (995)) and accession number L27125),
  • LysC G345D replacement of glycine at position 345 of the encoded aspartate kinase protein according to SEQ ID NO: 13 against L-aspartic acid, see Jetten et al (Applied Microbiology and Biotechnology 43, 76-82 (995)) and accession number L16848),
  • LysC T380I exchange of L-threonine at position 380 of the encoded aspartate kinase protein according to SEQ ID NO: 13 for L-isoleucine, see WO 01/49854 and accession number AX192358)
  • LysC S381F replacement of L-serine at position 381 of the encoded aspartate kinase protein according to SEQ ID NO: 13 against L-phenylalanine, see EP 0435132
  • lysC FBR allele lysC T311I exchange of threonine at position 311 of the encoded aspartate kinase protein according to SEQ ID NO: 13 for isoleucine
  • a lysC FBR allele containing at least one substitution selected from the group A279T replacement of alanine at position 279 of the encoded aspartate kinase protein according to SEQ ID NO: 13 against threonine
  • S381F replacement of serine at position 381 of the encoded aspartate kinase protein according to SEQ ID NO: 13 against phenylalanine
  • S317A optionally replacing the serine at position 317 with alanine
  • the strain DSM 16833 (WO 06/063660) has a lysC FBR allele which codes for an aspartate kinase protein which contains the amino acid exchange T311I.
  • Strain NRRL B-11474 (US 4,275,157) has a lysC FBR allele encoding an aspartate kinase protein containing amino acid replacement S381F.
  • Lysine production has been shown to overexpress the lysC FBR alleles.
  • the L-lysine-producing bacteria of the genus Corynebacterium used for the purposes of the invention which preferably also contain a polynucleotide which codes for a lysine-insensitive aspartate kinase variant, have one or more of the features selected from the group:
  • dapA gene overexpressed polynucleotide (dapA gene) encoding a dihydrodipicolinate synthase (DapA, EC no.
  • ddh gene overexpressed polynucleotide (ddh gene) coding for a meso-diaminopimelate dehydrogenase (Ddh, EC No. 1.4.1.16), d) overexpressed polynucleotide, (lysA gene) encoding a diaminopimelate decarboxylase (LysA, EC No. 4.1.1.20),
  • polynucleotide coding for a polypeptide with L-lysine export activity (LysE, lysine efflux permease),
  • h overexpressed polynucleotide (dapB gene) encoding a dihydrodipicolinate synthase (DapB, EC No. 1.3.1.26).
  • DapB dihydrodipicolinate synthase
  • the genes of bacteria described in the prior art can be used.
  • the endogenous genes or polynucleotides of the genus Corynebacterium particularly preferably those of the species Corynebacterium glutamicum, Corynebacterium efficiens and Corynebacterium ammoniagenes and most preferably those of the species Corynebacterium glutamicum are used.
  • Endogenous genes or polynucleotides are understood as meaning the open reading frame (ORF), genes or alleles or their polynucleotides present in the population of a species.
  • the dapA gene of Corynebacterium glutamicum strain ATCC13032 is described for example in EP 0 197 335.
  • the mutations MC20 and MA16 of the dapA promoter as described in US 6,861,246, can be used.
  • the asd gene of Corynebacterium glutamicum strain ATCC 21529 is described, for example, in US Pat. No. 6,927,046.
  • the lysA gene of Corynebacterium glutamicum ATCC13869 (Brevibacterium lactofermentum) is described, for example, in US 6,090,597.
  • the ddh gene is described, for example, in Ishino et al. (Agricultural and Biological Chemistry 52 (11), 2903-2909 (1988)).
  • the aat gene of Corynebacterium glutamicum ATCC13032 is described, for example, in Kalinowski et al (Journal of Biotechnology 104 (1-3), 5-25 (2003), see also accession number NC 006958). It is referred to there as the aspB gene.
  • a coding for an aspartate aminotransferase gene is referred to as aspC.
  • Marienhagen et al Journal of Bacteriology 187 (22), 7693-7646 (2005) refer to the aat gene as the aspT gene.
  • the lysE gene of Corynebacterium glutamicum R127 is described, for example, in US Pat. No. 6,858,406. In the same way, the lysE gene of strain ATCC13032 used in US Pat. No. 6,861,246 can be used.
  • the pyc gene of Corynebacterium glutamicum of strain ATCC 13032 is described, for example, in WO 99/18228 and WO 00/39305. Furthermore, alleles of the pyc gene can be used, as described, for example, in US Pat. No. 6,965,021.
  • the pyruvate carboxylases described in this patent have one or more of the amino acid substitutions selected from the group: Pyc E153D (exchange of L-glutamic acid at position 153 for L-aspartic acid), Pyc A182S (replacement of L-alanine at position 182 for L-aspartic acid).
  • Amino acid exchange Pyc P458S replacement of L-proline at position 458 against L-serine contains.
  • Overexpression is generally understood to mean an increase in the intracellular concentration or activity of a ribonucleic acid, a protein (polypeptide) or an enzyme compared to the parent strain (parent strain) or wild-type strain.
  • a parent strain is the strain on which the overexpression was performed.
  • the increase in concentration or activity can be achieved, for example, by increasing the copy number of the corresponding polynucleotides chromosomally or extrachromosomally by at least one copy.
  • a widely used method for increasing the copy number consists of incorporating the corresponding polynucleotide into a vector, preferably a plasmid, which is replicated by a coryneform bacterium.
  • a vector preferably a plasmid, which is replicated by a coryneform bacterium.
  • transposons, insertion elements (IS elements) or phages can be used as vectors.
  • Is elements insertion elements
  • phages can be used as vectors.
  • a wealth of suitable vectors is described in the prior art.
  • Another common method of achieving overexpression is the chromosomal method
  • Gene amplification In this method, at least one additional copy of the polynucleotide of interest is inserted into the chromosome of a coryneform bacterium.
  • Such amplification methods are described, for example, in WO 03/014330 or WO 03/040373.
  • Another method for achieving overexpression is to link the corresponding gene or allele in a functional manner (operably linked) with a promoter or an expression cassette.
  • Suitable promoters for Corynebacterium glutamicum are described for example in FIG. 1 of the review article by Patek et al. (Journal of Biotechnology 104 (1-3), 311-323 (2003)).
  • the variants of the dapA promoter described by Vasicova et al Journal of Bacteriology 181, 6188-6191 (1999)
  • the promoter A25 can likewise be used.
  • the gap promoter of Corynebacterium glutamicum EP 06007373
  • promoters T3, T7, SP6, M13, lac, tac, and trc described in Amann and Brosius become.
  • a promoter may be inserted upstream of the subject gene, typically at a distance of about 1-500 nucleobases from the start codon.
  • the activity or concentration of the corresponding polypeptide is generally increased by at least 10%, 25%, 50%, 75%, 100%, 150%, 200%, 300%, 400% or 500%, maximum 1000% or 2000% based on the activity or concentration of the polypeptide in the strain prior to the measure leading to overexpression.
  • L-lysine L-valine or L-isoleucine, preferably L-lysine, one or more of the genes selected from the group
  • a gene pgi coding for the glucose-6-phosphate isomerase (Pgi, EC No. 5.3.1.9), such as, for example, the pgi gene of Corynebacterium glutamicum described in US Pat. Nos. 6,586,214 and 6,465,238,
  • these measures can also be carried out in addition to the use of lysC FBR alleles and / or the overexpression of one or more genes selected from the group dapA, dapB, asd, ddh, lysA, aat, lysE and pyc.
  • the term "attenuation” in this context describes the reduction or elimination of the intracellular activity of one or more enzymes (proteins) in a microorganism which are encoded by the corresponding DNA, for example by using a weak promoter or by using a gene or allele, which codes for a corresponding enzyme with a low activity or inactivates the corresponding gene or enzyme (protein) and optionally combines these measures.
  • Attenuation may also be favored by one or more of the amino acid substitutions selected from the group a) exchange of AIa at position 225 for VaI, Leu or He VaI, b) exchanging GIy at position 255 for Ser or Thr, preferably Ser, c) replacing Asn at position 282 for GIn, and d) replacing Cys at position 283 for another amino acid, preferably Ser, wherein following exchanges selected from group e) exchange at position 282, f) simultaneous exchange at positions 225 and 283, and g) simultaneous exchange at positions 255 and 283, are preferred.
  • the concentration of a protein can be determined by 1- and 2-dimensional protein gel separation and subsequent optical identification of the protein concentration with appropriate evaluation software in the gel.
  • a common method for preparing the protein gels in coryneform bacteria and for identifying the proteins is that described by Hermann et al. (Electrophoresis, 22: 1712-23 (2001)).
  • the Protein concentration can also be assessed by Western blot hybridization with an antibody specific for the protein to be detected (Sambrook et al., Molecular cloning: a laboratory manual, 2 nd Ed., CoId Spring Harbor Laboratory Press, ColD Spring Harbor, NY, 1989), and subsequently Optical evaluation with appropriate software for concentration determination (Lohaus and Meyer (1998) Biospektrum 5: 32-39, Lottspeich, Angewandte Chemie 38: 2476-2492 (1999)) are determined.
  • the activity can be determined by means of a suitable enzyme assay.
  • the AmtR regulator which is also referred to below as the AmtR polypeptide or transcriptional regulator AmtR, is a polypeptide with the activity of a transcriptional regulator which, in the presence of an excess of nitrogen in the cell, represses the expression of the genes of the nitrogen metabolism. Nitrogen deficiency causes derepression.
  • the degree of adenylation of the signal transduction protein GInK in the cytoplasm of the coryneform bacterium also provides information on whether the cell is deficient in nitrogen or in excess of nitrogen. Nitrogen deficiency is present when in the cell ⁇ 80%, preferably ⁇ 90%, ⁇ particularly preferably 95% of the signal transduction protein in adenylierter form.
  • the amino acid sequence of the AmtR regulator of coryneform bacteria is at least 85% or at least 90%, preferably at least 95%, more preferably at least 98% or at least 99% identical to the amino acid sequence of SEQ ID NO: 2 and comprises or possesses essentially a length of 222 amino acids, with a length of 222 amino acids being preferred.
  • an example of an AmtR regulator that is at least 98% identical to the amino acid sequence of SEQ ID NO: 2 is that of strain ATCC14067. It is listed in SEQ ID NO: 21.
  • the AmtR regulator comprises or has the amino acid sequence of SEQ ID NO: 2.
  • the amino acid sequence of SEQ ID NO: 2 or 21 contains a maximum of 3, preferably a maximum of 2, more preferably a maximum of one conservative amino acid substitution (e ). Conservative amino acid changes do not substantially alter the activity of the AmtR repressor.
  • substantially a length of 222 amino acids in this context takes into account the fact that by insertion or deletion of one (1) or more, a maximum of 10, 9, 8, 7, 6, 5, 4, 3 or 2, Amino acids within the polypeptide or at the N- or C-terminal end of the polypeptide, the length of the encoded polypeptide varies slightly in different species or strains of L-amino acid-diffusing coryneform bacteria, for example the AmtR regulator of Corynebacterium efficiens (See SEQ ID NO: 11) in this case is 223 amino acids The different length of the AmtR regulator is due to insertion of the amino acid L-glutamic acid between position 151 and 153 of SEQ ID NO: 2.
  • amino acids of the amino acid sequence of the AmtR regulator of Corynebacterium efficiens are assigned to the amino acids of the amino acid sequence of the AmtR regulator of Corynebacterium glutamicum (AmtR CgIu).
  • Alignment programs such as the ClustalW (Thompson et al., Nucleic Acids Research 25 (24), 4876-82 (1997)) or MAFFT program (Katoh et al., 1997) may also be used for the assignment of the individual amino acids of different AmtR regulators al., Nucleic Acid Res., 30: 3059-3066 (2002)).
  • the individual amino acids of a polypeptide can thereby, despite formally different lengths of the amino acid sequences, be unambiguously assigned to one another.
  • the aromatic L-amino acids are called conservative exchanges when L-phenylalanine, L-tryptophan and L-tyrosine are interchanged.
  • the hydrophobic L-amino acids are called conservative exchanges when L-leucine, L-isoleucine and L-valine are exchanged.
  • the polar amino acids are called conservative exchanges when L-glutamine and L-asparagine are exchanged.
  • the basic amino acids are called conservative substitutions when L-arginine, L-lysine and L-
  • Histidine be exchanged for each other.
  • the acidic L-amino acids are called conservative exchanges when L-aspartic acid and L-glutamic acid are exchanged.
  • the hydroxyl-containing amino acids are called conservative substitutions when L-serine and L-threonine are interchanged.
  • the activity can be through
  • Nucleotide sequence of SEQ ID NO: 14 can be measured.
  • the nucleotide sequences are shown in Table 1 of Beckers et al. (Molecular Microbiology 58 (2), 580-595 (2005)).
  • SEQ ID NO: 1 represents the nucleotide sequence of the coding region of the amtR gene of the type strain of Corynebacterium glutamicum (wild-type gene), that is, ATCC13032, as reported in the National Center for Biotechnology Information (NCBI) database.
  • SEQ ID NOs: 2 and 4 show the amino acid sequence of the encoded polypeptide.
  • SEQ ID NOs: 2 and 4 contain L-arginine at position 34, L-threonine at position 87 and L-proline at position 203. It is known that by endogenous enzymes, so-called aminopeptidases, the terminal methionine can be removed during protein synthesis.
  • aminopeptidases aminopeptidases
  • SEQ ID NO: 10 the nucleotide sequence of the coding region of the amtR gene of Corynebacterium efficiens strain YS-314 is reproduced in accordance with the data of the National Center for Biotechnology Information (NCBI) database.
  • SEQ ID NO: 11 shows the amino acid sequence of the encoded polypeptide.
  • SEQ ID NO: 20 represents the nucleotide sequence of the coding region of the amtR gene of Corynebacterium glutamicum ATCC14067. The sequence was determined by the applicant.
  • SEQ ID NO: 21 shows the amino acid sequence of the encoded polypeptide.
  • the amino acid sequence of SEQ ID NO: 21 contains at position 34 L-histidine, at position 87 L-isoleucine and at position 203 L-serine.
  • the nucleotide sequence of the genome of Corynebacterium glutamicum was determined by various groups.
  • the Kalinowski et al. (Journal of Biotechnology 104 (1-3), 5-25 (2003)) from the University of Bielefeld (Germany) certain sequence of strain ATCC13032 is available under accession number NC_006985.
  • the amtR gene is assigned there the designation cgO986 and includes the region from position 923864-924532 of the complementary strand.
  • strain ATCC13032 determined by Ikeda and Nakagawa (Applied Microbiology 62 (2-3), 99-109 (2003)) of Kitasato University (Japan) is available under accession number NC 003450.
  • the amtR gene is assigned the name NCglO828 there.
  • the nucleotide sequence of the genome of Corynebacterium efficiens was described by Nishio et al. (Genome Research 2003 13 (7), 1572-1579 (2003)) by the company Ajinomoto (Japan). It is available under accession number NC 004369.
  • the amtR gene is assigned the designation COG1309K and comprises the region of position 1002436-1003107 of the complementary strand.
  • the AmtR regulator belongs to the TetR family of transcriptional regulators and is like the others Members of this family have a typical helix-turn-helix motif at the DNA binding site (Ramos et al., Microbiology and Molecular Biology Reviews 69 (2): 326-356 (2003); Jacoby et al., Molecular Microbiology 37 (4 ): 964-977 (2000)).
  • (methyl) ammonium uptake system also referred to as the "(methyl) ammonium uptake system.”
  • Beckers et al. (Molecular Microbiology 58 (2), 580-595 (2005)) designate the amt gene as the amtA gene, which has NCBI accession number NCgll521. It has been shown by Jakoby et al that expression of the amt gene is repressed by binding the AmtR regulator to binding motifs of double-stranded DNA having the nucleotide sequence 5'-ATCTATAGAACGATAG-3 'and 5'-ATCTATAGGCGGATAG-3'.
  • Attenuation includes reducing the intracellular concentration or activity of one or more polypeptides (enzymes) or enzymes in a microorganism encoded by the corresponding DNA as compared to the parent strain
  • the attenuation can be achieved by reducing the expression of a polypeptide, for example by using a weak promoter, or by using an allele which codes for a polypeptide having a lower activity and optionally inactivating these actions ,
  • the promoter region of the amtR gene is shown in SEQ ID NO: 5.
  • the nucleotide sequence of SEQ ID NO: 5 is contained in SEQ ID NO: 3.
  • Position 1 of SEQ ID NO: 5 corresponds to position 911 of SEQ ID NO: 3.
  • Position 90 of SEQ ID NO: 5 corresponds to position 1000 of SEQ ID NO: 3.
  • one or more of the modifications of the promoter region of the amtR gene is selected from group a. Substitution of the nucleobase guanine at position 7 of the promoter region of the amtR gene according to SEQ ID NO: 5 by thymine,
  • nucleobases from position 40 to 45 preferably deletion of all Nucleobases from position 40 to 45, the promoter region of the amtR gene according to SEQ ID NO: 5
  • f Deletion of one or more of the nucleobases between position 72 and 78 of the promoter region of the amtR gene according to SEQ ID NO: 5
  • g Substitution of a plurality of the nucleobases adenine or guanine between position 72 and 78 of the promoter region of the amtR gene according to SEQ ID NO: 5 against thymine or cytosine,
  • the expression of the AmtR regulator is further reduced by replacing the ATG start codon at position 1 to 3 of the coding region of the amtR gene against a GTG or TTG start codon.
  • the intracellular concentration of the AmtR regulator will be> 0% to ⁇ 75%,> 0% to ⁇ 50%,> 0% to ⁇ 25%,> 0% to ⁇ 5%, > 0% to ⁇ 1%, or to> 0.1% to ⁇ 75%,> 0.1% to ⁇ 50%,> 0.1% to ⁇ 25%,> 0.1% to ⁇ 5%, > 0.1% to ⁇ 1%, or to> 1% to ⁇ 75%,> 1% to ⁇ 50%,> 1% to ⁇ 25%,> 1% to ⁇ 5%, or to> 5% to ⁇ 75%,> 5% to ⁇ 50%, ⁇ 5% to ⁇ 25% of the concentration in the parent strain or parent strain decreased.
  • Replacement of the glycine at position 3 of the amino acid sequence preferably the amino acid sequence according to SEQ ID NO: 2, SEQ ID NO: 21 or SEQ ID NO: 11, against another proteinogenic L-amino acid, preferably L-glutamic acid or L-aspartic acid, very particularly preferably L-glutamic acid, b.
  • L-isoleucine at position 24 of the amino acid sequence preferably the amino acid sequence according to SEQ ID NO: 2, SEQ ID NO: 21 or SEQ ID NO: 11, against an amino acid selected from the group L-asparagine, L-glutamine, L-glutamic acid and L-aspartic acid, preferably L-aspartic acid, c.
  • Exchange of L-leucine at position 31 of the amino acid sequence preferably the amino acid sequence according to SEQ ID NO: 2, SEQ ID NO: 21 or SEQ ID NO: 11, against an amino acid selected from the group L-asparagine, L-glutamine, L-glutamic acid and L-aspartic acid, preferably L-aspartic acid, c.
  • Amino acid sequence preferably the amino acid sequence according to SEQ ID NO: 2, SEQ ID NO: 21 or SEQ ID NO: 11, against an amino acid selected from the group L-proline, L-asparagine, L-glutamine, L-phenylalanine, L-tyrosine , L-tryptophan, L-glutamic acid and L-aspartic acid, preferably L-proline, d.
  • L-proline L-asparagine, L-glutamine, L-phenylalanine, L-tyrosine , L-tryptophan, L-glutamic acid and L-aspartic acid, preferably L-proline, d.
  • Replacement of the L-phenylalanine at position 32 of the amino acid sequence preferably the amino acid sequence according to SEQ ID NO: 2, SEQ ID NO: 21 or SEQ ID NO: 11, against an amino acid selected from the group
  • Glycine L-glutamic acid, L-aspartic acid, L-proline and L-cysteine, preferably L-proline,
  • Amino acid sequence preferably the amino acid sequence according to SEQ ID NO: 2, SEQ ID NO: 21 or SEQ ID NO: II, against an amino acid selected from the group consisting of L-phenylalanine, L-isoleucine, L-tryptophan, L-tyrosine, L-histidine , L-glutamic acid and L-aspartic acid, preferably L-histidine,
  • Amino acid sequence preferably the amino acid sequence according to SEQ ID NO: 2, SEQ ID NO: 21 or SEQ ID NO: II, against an amino acid selected from the group L-proline, L-phenylalanine, L-tryptophan, L-lysine, L-arginine , L-glutamic acid and L-aspartic acid, preferably L-phenylalanine,
  • L-tyrosine at position 57 of the amino acid sequence preferably the amino acid sequence according to SEQ ID NO: 2, SEQ ID NO: 21 or SEQ ID NO: II, against an amino acid selected from the group L-proline, glycine, L-methionine, L-glutamic acid and L-aspartic acid, preferably L-aspartic acid, 1.
  • replacement of L-tyrosine at position 58 of the amino acid sequence preferably the amino acid sequence according to SEQ ID NO: 2, SEQ ID NO: 21 or SEQ ID NO: II
  • Amino acid sequence preferably the amino acid sequence according to SEQ ID NO: 2, SEQ ID NO: 21 or SEQ ID NO: II, against an amino acid selected from the group consisting of L-proline, L-methionine and L-cysteine, preferably L-proline, m.
  • Amino acid sequence preferably the amino acid sequence according to SEQ ID NO: 2 or SEQ ID NO: 11, against an amino acid selected from the group L-lysine, L-aspartic acid, L-isoleucine, L-proline and glycine, preferably L-proline, and n Replacement of L-lysine at position 63 of the
  • Amino acid sequence preferably the amino acid sequence according to SEQ ID NO: 2, SEQ ID NO: 21 or SEQ ID NO: 11, against an amino acid selected from the group L-alanine, L-glutamic acid, L-aspartic acid, L-asparagine, L-tyrosine and L-tryptophan, preferably L-asparagine
  • the activity of the AmtR regulator becomes> 0% to ⁇ 75%,> 0% to ⁇ 50%,> 0% to ⁇ 25%,> 0% to ⁇ 5%,> 0% to ⁇ 1 %, or> 0.1% to ⁇ 75%,> 0.1% to ⁇ 50%,> 0.1% to ⁇ 25%,> 0.1% to ⁇ 5%,> 0.1% to ⁇ 1%, or> 1% to ⁇ 75%,> 1% to ⁇ 50%,> 1% to ⁇ 25%,> 1% to ⁇ 5% or to> 5% to ⁇ 75%,> 5% to ⁇ 50%,> 5% to ⁇ 25% of the activity of the wild-type AmtR regulator, preferably reduced with the amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 11.
  • the invention it is possible according to the invention to lower or adjust the expression of the variants of the invention according to the AmtR regulator by using known, weak promoters.
  • these include, inter alia, the promoters seqP-RBS_01 to seqP-RBS_07, which are disclosed in the journal Research Disclosure under the number 512057 (December 2006 edition) and the variants of the dapA promoter described by M. Patek, preferably the variants C7, C13 , Ol, C2, J2, B31, C5 and B6 (M. Patek in the "Handbook of Corynebacterium glutamicum” (Lothar Eggeling and Michael Bott (editors), CRC Press, Taylor and Francis Group, Boca Raton, FL, USA, 2005)).
  • the attenuation of the amtR gene can be determined by various methods.
  • the concentration is detectable by means of 1- and 2-dimensional protein gel separation and subsequent determination of the protein concentration in the gel.
  • a common method for preparing the protein gels in coryneform bacteria and for identifying the proteins is that described by Hermann et al. (Electrophoresis, 22: 1712-23 (2001))
  • the protein concentration can be further determined by Western blot hybridization with an antibody specific for the protein to be detected (Sambrook et al., Molecular cloning: a laboratory manual, 2 nd Ed., CoId Spring Harbor Laboratory Press, ColD Spring Harbor, NY, 1989) and subsequent optical evaluation with appropriate software for concentration determination (Lohaus and Meyer (1998) Biospektrum 5: 32-39; Lottspeich (1999) Angewandte Chemie 111: 2630-2647).
  • the activity of the AmtR regulator as DNA-binding protein can be measured by retardation gel electrophoresis (Wilson et al. (2001) Journal of Bacteriology 183: 2151-2155).
  • DNA band shift assay This assay is also referred to as "DNA band shift assay.”
  • DNA-binding proteins the effect of DNA-binding proteins on the expression of the genes they control can also be demonstrated by various well-described methods of the reporter gene assay (Sambrook et al., Molecular cloning: a laboratory manual 2 nd Ed Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989)...
  • the invention also provides an isolated polynucleotide comprising the promoter region or consisting essentially of the promoter region of the amtR gene according to SEQ ID NO: 5, which has one or more of the modifications according to the invention.
  • the promoter region of the amtR gene according to the invention preferably comprises ⁇ (maximum) 5000, ⁇ 4000, ⁇ 3000, ⁇ 2000, ⁇ 1000, ⁇ 750, ⁇ 500, ⁇ 250, or ⁇ 100 nucleobases or base pairs of nucleotide sequences that naturally flank the promoter region according to the invention upstream and downstream.
  • the invention furthermore relates to an isolated polynucleotide comprising the coding region or essentially consisting of the coding region of the amtR gene which codes for a polypeptide having the amino acid sequence according to SEQ ID NO: 2 or 21, wherein instead of the ATG start codon a GTG or TTG start codon is used.
  • the subject of the invention is an isolated polynucleotide coding for an AmtR regulator whose
  • Amino acids preferably has a length of 222 amino acids, comprises or has and one (1) or more, preferably not more than 3, more preferably at most 2 of the amino acid substitutions according to the invention, that is the amino acid substitutions at the positions 3, 24, 31, 32, 36, 42nd , 50, 53, 54, 55, 57, 58, 59 and 63.
  • amino acid sequence of SEQ ID NO: 2 and which contains one (1) or more, preferably no more than 3, particularly preferably no more than 2, amino acid substitutions according to the invention
  • the amino acid sequence further contains at most 3, preferably at most 2, most preferably at most (one) conservative amino acid substitution (s).
  • an isolated polynucleotide encoding an AmtR regulator comprising or having the amino acid sequence of SEQ ID NO: 11 and having one (1) or more, preferably no more than 3, more preferably no more than 2 amino acid changes of the invention the amino acid substitutions at positions 3, 24, 31, 32, 36, 42, 50, 53, 54, 55, 57, 58, 59 and 63 has.
  • the amino acid sequence further contains at most 3, preferably at most 2, most preferably at most (one) conservative amino acid substitution (s).
  • an isolated polynucleotide which codes for an AmtR regulator which comprises or has the amino acid sequence of SEQ ID NO: 21 and which has one (1) or more, preferably no more than 3, particularly preferably no more than 2, of the compounds according to the invention
  • amino acid exchanges that is, the amino acid substitutions at the positions 3, 24, 31, 32, 36, 42, 50, 53, 54, 55, 57, 58, 59 and 63, has.
  • amino acid sequence preferably contains at most (one) conservative amino acid substitution (s).
  • an isolated polynucleotide coding for an AmtR regulator having the amino acid sequence of SEQ ID NO: 2, wherein the glycine at position 3 against another proteinogenic amino acid, preferably L-glutamic acid or L-aspartic acid, particularly preferably L- Glutamic acid is exchanged.
  • the amino acid sequence of the variant of the AmtR polypeptide which contains L-glutamic acid at position 3 is shown in SEQ ID NO: 6 and 8.
  • Particularly preferred is further an isolated polynucleotide coding for an AmtR regulator having the amino acid sequence of SEQ ID NO: 2, wherein the glycine at position 36 against another proteinogenic
  • Amino acid preferably L-histidine, L-glutamic acid or L-histidine Aspartic acid, most preferably L-aspartic acid, is replaced.
  • the invention furthermore relates to an isolated polynucleotide which comprises or has the nucleotide sequence according to SEQ ID NO: 5 or 7.
  • the invention finally relates to an isolated polynucleotide encoding at least part of the amino acid sequence of the AmtR polypeptide which comprises ⁇ (at least) 5,> 10,> 20,> 40,> 80 or> 100 amino acids and which contains at least one
  • Amino acid exchange in AmtR polypeptide contains, wherein leading to the amino acid exchange of the invention mutation in the polynucleotide of nucleotide sequences with a length of ⁇ (maximum) 5000, ⁇ 4000, ⁇ 3000, ⁇ 2000, ⁇ 1000, ⁇ 750, ⁇ 500, ⁇ 250, or ⁇ 100 nucleobases or base pairs are flanked upstream and downstream, which occurs naturally in coryneform bacteria.
  • a polynucleotide having the nucleotide sequence from position 500 to 1510 of SEQ ID NO: 8 contains a part of the coding region of the amtR gene which codes for an amino acid sequence with a length of 170 amino acids, wherein the amino acid substitution according to the invention at position 3 of AmtR Polypeptide, and a nucleotide sequence of at least 500 nucleobases in length upstream and downstream of the amino acid exchange-leading mutation naturally occurring in Corynebacterium glutamicum.
  • the invention also relates to vectors which contain the polynucleotides according to the invention.
  • the invention also relates to cells of microorganisms, in particular of bacteria, preferably of the genus Corynebacterium and Escherichia, particularly preferably of the species Corynebacterium glutamicum and Escherichia coli, which contain the said polynucleotides or Vectors contained or produced using said polynucleotides or vectors.
  • any primer pairs can be selected from the nucleotide sequence located upstream and downstream of the coding region and the complementary nucleotide sequence
  • the nucleotide sequence of the polynucleotide is then determined. This can be determined, for example, by the chain termination method of Sanger et al. (Proceedings of the National Academys of Sciences, U.S.A., 74, 5463-5467 (1977)) with those of Zimmermann et al. (Nucleic Acids Research 18, 1067 (1990)).
  • the polypeptide encoded by this nucleotide sequence can then be analyzed for amino acid sequence.
  • the nucleotide sequence is transformed into a program for translating DNA sequence into an amino acid sequence entered.
  • Suitable programs include, for example, the patent program available from patent offices, such as the United States Patent Office (USPTO), or the Translate Tool available on the ExPASy Proteomics Server on the World Wide Web (Gasteiger et al., Nucleic Acids Research 31, 3784-3788 (2003)).
  • Suitable methods for in vitro mutagenesis include Miller's Hydroxylamine treatment (Miller, JH: A Short Course in Bacterial Genetics, A Laboratory Manual and Handbook for Escherichia coli and Related Bacteria, CoId Spring Harbor Laboratory Press, CoId Spring Harbor , 1992) or the use of a
  • DNA polymerase Polymerase chain reaction using a DNA polymerase, which has a high error rate.
  • a DNA polymerase is, for example, Mutazyme DNA Polymerase (GeneMorph PCR Mutagenesis Kit, No. 600550) from Stratagene (LaJo IIa, CA). Further, mutagenic oligonucleotides as described in T.A. Brown (Genetic Engineering for Beginners, Spektrum Akademischer Verlag, Heidelberg, 1993) and R.M. Horton (PCR-Mediated Recombination and Mutagenesis, Molecular Biotechnology 3, 93-99 (1995)) can be used. The of
  • the polynucleotides prepared in this way can be used to produce recombinant strains of the genus Corynebacterium, preferably Corynebacterium glutamicum, which contain the variants of the AmtR regulator according to the invention and / or contain the modifications according to the invention in the promoter region of the amtR gene and which are compared to the starting or Parent strain to a greater extent release L-amino acids in the surrounding medium and / or accumulate in the cell interior.
  • Corynebacterium preferably Corynebacterium glutamicum
  • a common method for incorporating mutations into genes of bacteria of the genus Corynebacterium, in particular of the species Corynebacterium glutamicum, is that of
  • Allele exchange also known as "gene replacement.”
  • a DNA fragment containing the mutation of interest is transferred to the desired strain and the mutation is converted into the desired strain by at least two recombination events or "crossover" events Chromosome of the desired strain incorporated or replaced in the relevant strain sequence of a gene against the mutated sequence.
  • the DNA fragment containing the mutation of interest in this method is typically present in a vector, in particular a plasmid, which is preferably unrestricted or limited by the strain to be mutated, i. H. under selected culture conditions.
  • a bacterium of the genus Escherichia preferably the species Escherichia coli is generally used.
  • plasmid vectors examples include those of Shufer et al. (Gene 145, 69-73 (1994)) described pK * mob and pK * mobsacB vectors, such as pKl ⁇ mobsacB, and the vectors described in WO 02/070685 and WO 03/014362. These are replicative in Escherichia coli but not in Corynebacterium.
  • Particularly suitable vectors are those which contain a conditionally negatively dominant gene such as the sacB gene (levansucrase gene) of, for example, Bacillus or the galK gene (galactose kinase gene) of, for example, Escherichia coli.
  • a conditionally negatively dominant gene is understood as meaning a gene which, under certain conditions, is disadvantageous, for example toxic to the host, but none under other conditions negative impact on the gene host.
  • Nakamura et al. (US Pat. No. 6,303,383) describe a temperature-sensitive plasmid for Corynebacterium that can only replicate at temperatures below 31 ° C. It can also be used for the measures of the invention.
  • the vector is then introduced by conjugation, for example, by the method of Schwarzfer (Journal of Bacteriology 172, 1663-1666 (1990)) or transformation, for example, by the method of Dunican and Shivnan (Bio / Technology 7, 1067-1070 (1989)) in the Corynebacterium transferred.
  • the transfer of the DNA can also be achieved by ballistic methods (eg particle bombardment).
  • Target gene is the gene in which the desired exchange is to take place.
  • Schwarzer and Pühler (Bio / Technology 9, 84-87 (1991)) used this method to introduce a lysA allele carrying a deletion and a lysA allele carrying an insertion into the chromosome of C Incorporate glutamicum instead of the wild type gene.
  • this method was used to incorporate various mutations from the isolated alleles or polynucleotides into the chromosome of C. glutamicum.
  • a polynucleotide or DNA fragment can be used which comprises at least the nucleotide sequence from position 958 to 1058 of SEQ ID NO: 8.
  • This DNA fragment contains the mutation of the invention and upstream and downstream thereof a nucleotide sequence of at least 50 nucleobases in length each.
  • DNA fragments which have upstream and downstream of the mutation a nucleotide sequence of at least about 100 each, more preferably at least about 250 nucleobases, and most preferably at least about 500 nucleobases each.
  • the maximum length of the nucleotide sequence upstream and downstream of the mutation is generally about 500, about 750, about 1000, about 1500, about 2000, about 3000, about 4000 or 5000 nucleobases. Accordingly, the total length of the polynucleotide used for allele exchange is a maximum of about 1000, a maximum of about 1500, a maximum of about 2000, a maximum of about 3000, a maximum of about 4000, a maximum of about 6000, a maximum of about 8000 or 10000 nucleobases.
  • the bacteria of the genus Corynebacterium produced according to the invention can be used continuously - as described, for example, in WO 05/021772 - or discontinuously in the batch process (batch cultivation or batch process) or in the fed batch (feed process) or repeated fed batch process (repetitive feed process) the production of the desired L-amino acids are cultivated.
  • a general summary of known cultivation methods is given in the textbook by Chmiel (Bioprocessing Technique 1. Introduction to the
  • the culture medium or fermentation medium to be used must suitably satisfy the requirements of the respective strains. Descriptions of culture media of various microorganisms are contained in the Manual of Methods for General Bacteriology, of the American Society for Bacteriology (Washington, DC, USA, 1981). The terms culture medium and
  • Fermentation medium or medium are mutually exchangeable.
  • sugars and carbohydrates such as glucose, sucrose, lactose, fructose, maltose, molasses, sucrose-containing solutions from sugar beet or sugar cane production, starch, starch hydrolyzate and cellulose, oils and fats such as soybean oil, sunflower oil, peanut oil and coconut fat, Fatty acids such as palmitic acid, stearic acid and linoleic acid, alcohols such as glycerol, methanol and ethanol and organic acids such as acetic acid or lactic acid.
  • sugars and carbohydrates such as glucose, sucrose, lactose, fructose, maltose, molasses, sucrose-containing solutions from sugar beet or sugar cane production, starch, starch hydrolyzate and cellulose, oils and fats such as soybean oil, sunflower oil, peanut oil and coconut fat, Fatty acids such as palmitic acid, stearic acid and linoleic acid, alcohols such as glycerol, methanol and ethanol and organic
  • organic nitrogen-containing compounds such as peptones, yeast extract, meat extract, malt extract, corn steep liquor, soybean meal and urea or inorganic compounds such as ammonium sulfate, ammonium chloride, ammonium phosphate, ammonium carbonate and ammonium nitrate may be used.
  • the nitrogen sources can be used singly or as a mixture.
  • phosphorus source can phosphoric acid
  • the culture medium must further contain salts, for example, in the form of chlorides or sulfates of metals such as sodium, potassium, magnesium, calcium and iron, such as magnesium sulfate or ferric sulfate, necessary for growth.
  • salts for example, in the form of chlorides or sulfates of metals such as sodium, potassium, magnesium, calcium and iron, such as magnesium sulfate or ferric sulfate, necessary for growth.
  • essential growth substances such as amino acids such as homoserine and vitamins such as thiamine, biotin or pantothenic acid in addition to the above substances can be used.
  • the said feedstocks may be added to the culture in the form of a one-time batch or fed in a suitable manner during the cultivation.
  • pH control of the culture basic compounds such as sodium hydroxide, potassium hydroxide, ammonia or ammonia water or acidic compounds such as phosphoric acid or sulfuric acid are suitably used.
  • the pH is generally adjusted to a value of 6.0 to 8.5, preferably 6.5 to 8.
  • antifoams such as, for example, fatty acid polyglycol esters, can be used.
  • suitable, selectively acting substances such as antibiotics, may be added to the medium.
  • Oxygen-containing gas mixtures such as air in the culture registered.
  • the use of liquids enriched with hydrogen peroxide is also possible.
  • the fermentation at elevated pressure, for example at an overpressure of 0.03 to 0.2 MPa, driven.
  • the temperature of the culture is usually from 20 0 C to 45 ° C and preferably at 25 ° C to 40 0 C, more preferably at 30 ° to 37 ° C.
  • the cultivation is continued until a maximum of the desired L-amino acid, has formed. This goal will normally be within 10
  • the analysis of L-amino acids to determine the concentration at one or more times in the course of the fermentation can be carried out by separating the L-amino acids by ion exchange chromatography, preferably cation exchange chromatography followed by post-column derivatization using ninhydrin, as described by Spackman et al.
  • Detection is photometric (absorption, fluorescence).
  • the invention accordingly also provides a process for the preparation of L-amino acids, preferably L-amino acids.
  • Lysine L-glutamic acid, L-glutamine, L-arginine, L-proline and L-ornithine, more preferably L-lysine, characterized in that one carries out the following steps: a) fermentation of the coryneform bacteria according to the invention, preferably of the genus Corynebacterium, particularly preferably of the species Corynebacterium glutamicum, in a suitable nutrient medium, and
  • a fermentation broth is understood as meaning a fermentation medium or nutrient medium in which a microorganism has been cultivated for a certain time and at a certain temperature.
  • the fermentation medium or the media used during the fermentation contains / contain all substances or components which ensure an increase of the microorganism and a formation of the desired L-amino acid.
  • the resulting fermentation broth contains accordingly
  • the components of the fermentation medium or of the starting materials not consumed by the fermentation such as, for example, vitamins such as biotin or salts such as magnesium sulfate.
  • the organic by-products include substances which are produced by the microorganisms used in the fermentation in addition to the respective L-amino acid and optionally excreted. These include sugars such as trehalose.
  • the fermentation broth is removed from the culture vessel or fermentation vessel, optionally collected, and used to provide an L-amino acid-containing product in liquid or solid form.
  • the term "recovery of the L-amino acid-containing product" is used for this purpose.
  • the L-amino acid-containing fermentation broth itself represents the product obtained.
  • the partial (> 0% to ⁇ 80%) to complete (100%) or almost complete ( ⁇ 80% to ⁇ 100%) removal of the water (measure a)) is also referred to as drying.
  • a group of L-lysine containing products comprises concentrated, aqueous, alkaline solutions of purified L-lysine (EP-B-0534865).
  • Another group as described, for example, in US Pat. Nos. 6,340,486 and 6,465,025, comprises aqueous, acidic, biomass-containing Concentrates of L-lysine-containing fermentation broths.
  • the most common group of solid products comprises powdered or crystalline forms of purified or pure L-lysine, which is typically in the form of a salt such as L-lysine monohydrochloride.
  • Another group of solid product forms is described for example in EP-B-0533039.
  • the product form described therein contains, in addition to L-lysine, the major part of the starting materials used during the fermentative production and not consumed and optionally the biomass of the microorganism used with a proportion of> 0% - 100%.
  • Fermentation broths described In the process described there, the biomass is separated from the fermentation broth and discarded.
  • a base such as sodium, potassium or ammonium hydroxide, a pH between 9 to 11 is set.
  • the mineral components are separated from the broth after concentration and cooling by crystallization and either used as fertilizer or discarded.
  • the biomass may be wholly or partially separated by separation methods such as e.g. centrifugation, filtration, decantation, or a combination thereof, from the fermentation broth or left completely in it.
  • separation methods such as e.g. centrifugation, filtration, decantation, or a combination thereof, from the fermentation broth or left completely in it.
  • the biomass or the biomass-containing fermentation broth is inactivated during a suitable process step, for example by thermal treatment (heating) or by acid addition.
  • the biomass is completely or almost completely removed so that no (0%) or at most 30%, at most 20%, at most 10%, at most 5%, at most 1% or at most 0.1% biomass remains in the product produced.
  • the biomass is not removed or only in minor proportions, so that all (100%) or more than 70%, 80%, 90%, 95%, 99% or 99.9% biomass remains in the product produced. Accordingly, in a method according to the invention, the biomass is removed in proportions of ⁇ 0% to ⁇ 100%.
  • the fermentation broth obtained after the fermentation can be adjusted to an acidic pH before or after complete or partial removal of the biomass with an inorganic acid such as hydrochloric acid, sulfuric acid or phosphoric acid or organic acid such as propionic acid (GB 1,439,728 or EP 1,331,220 ). It is also possible the fermentation broth with the completely contained
  • the broth may also be stabilized by the addition of sodium bisulfite (NaHSO 3 , GB 1,439,728) or another salt, for example, ammonium, alkali or alkaline earth salt of the sulfurous acid.
  • NaHSO 3 sodium bisulfite
  • another salt for example, ammonium, alkali or alkaline earth salt of the sulfurous acid.
  • organic or inorganic solids are partially or completely removed.
  • the organic by-products dissolved in the fermentation broth and the dissolved non-consumed constituents of the fermentation medium (starting materials) remain at least partially (> 0%), preferably at least 25%, more preferably at least 50% and most preferably at least 75% in the product.
  • these also remain complete (100%) or nearly complete, that is> 95% or> 98% or greater than 99%, in the product. Does a product contain at least part of the ingredients in this sense?
  • Fermentation broth this is also described by the term "product based on fermentation broth”.
  • the broth is removed by known methods, e.g. by means of a rotary evaporator, thin-film evaporator, falling film evaporator
  • Reverse osmosis or by nanofiltration water extracted or thickened or concentrated can then be worked up by freeze-drying, spray-drying, spray granulation or other methods, for example in the circulating fluidized bed according to PCT / EP2004 / 006655, into free-flowing products, in particular a finely divided powder or preferably coarse-grained granules.
  • a desired product is isolated from the resulting granules by sieving or dust separation.
  • the fermentation broth directly d. H. without prior concentration by spray drying or spray granulation to dry.
  • free-flowing refers to powders which flow out freely from a series of glass outlet vessels with outlet openings of different sizes at least from the vessel with the opening 5 mm (mm) (Klein: Soaps, Oils, Fats, Wachse 94, 12 (1968)).
  • finely divided is meant a powder with a predominant proportion (> 50%) of a particle size of 20 to 200 ⁇ m in diameter.
  • coarse-grained is meant a product having a predominant proportion (> 50%) of a particle size of 200 to 2000 ⁇ m in diameter.
  • the particle size determination can be carried out using methods of laser diffraction spectrometry.
  • the corresponding methods are in the textbook for
  • the free-flowing, finely divided powder can in turn be converted by suitable compacting or granulating process into a coarse-grained, free-flowing, storable and substantially dust-free product.
  • dust-free means that the product contains only small amounts ( ⁇ 5%) of particle sizes smaller than 100 ⁇ m in diameter.
  • storable means a product which can be stored for at least one (1) year or more, preferably at least 1.5 years or longer, more preferably two (2) years or more, in a dry and cool environment
  • a further subject matter of the invention is a process, which is described in its basic features in DE 102006016158, and in which the fermentation broth obtained using the microorganisms according to the invention, from which the Biomass is optionally separated completely or partially, is further processed by carrying out a process comprising at least the following steps:
  • a) lowers the pH to 4.0 to 5.2, in particular 4.9 to 5.1, by addition of sulfuric acid, and a molar sulfate / L-lysine ratio of 0.85 to 1.2, preferably 0.9 to 1.0, more preferably> 0.9 to ⁇ 0.95, in the Broth sets, optionally by adding a further or more sulfate-containing compound (s) and
  • step a) where appropriate, prior to step a) one or both of the following measures is / are carried out:
  • a salt of the sulfurous acid preferably alkali metal hydrogen sulfite, particularly preferably sodium hydrogen sulfite in a concentration of 0.01 to 0.5 wt .-%, preferably 0.1 to 0.3 wt .-%, particularly preferred 0.1 to 0.2 wt .-% based on the fermentation broth added.
  • Ammonium sulphate and / or ammonium hydrogen sulphate or corresponding mixtures of ammonia and sulfuric acid and sulfuric acid themselves may be mentioned as preferred sulphate-containing compounds in the sense of the abovementioned process steps.
  • the molar sulfide / L-lysine ratio V is calculated according to the
  • the advantage of granulation or compaction is the use of customary organic or inorganic Excipients, or carriers such as starch, gelatin, cellulose derivatives or similar substances, such as are commonly used in food or feed processing as binders, gelling agents or thickeners, or of other materials such as silicas, silicates (EP0743016A) stearates.
  • oils mineral oils vegetable oils or mixtures of vegetable oils can be used. Examples of such oils are soybean oil, olive oil, soya oil / lecithin mixtures.
  • silicone oils, polyethylene glycols or hydroxyethyl cellulose are suitable.
  • the treatment of the surfaces with the oils mentioned achieves an increased abrasion resistance of the product and a reduction in the dust content.
  • the content of oil in the product is 0.02 to 2.0 wt .-%, preferably 0.02 to 1.0 wt .-%, and most preferably 0.2 to 1.0 wt .-% based on the Total amount of feed additive.
  • the proportion of dust d. H. Particles with a particle size ⁇ 100 microns is preferably> 0 to 1 wt .-%, more preferably at most 0.5 wt .-%.
  • the product can also be applied to a known and customary in feed processing organic or inorganic carrier such as silicas, silicates, shot, brans, flours, sugars or others and / or mixed with conventional thickening or binding agents and stabilized , Application examples and processes for this purpose are described in the literature (Die Mühle + Mischfuttertechnik 132 (1995) 49, page 817).
  • the product can also be produced by coating processes ("coating") with film formers
  • film formers For example, metal carbonates, silicas, silicates, alginates, stearates, starches, gums and cellulose ethers, as described in DE-C-4100920, be brought into a state in which it is stable to digestion by animal stomachs in particular the stomach of ruminants.
  • the L-lysine may be added during the process in the form of a concentrate or optionally a substantially pure substance or its salt in liquid or solid form. These can be added individually or as mixtures to the obtained or concentrated fermentation broth, or also during the drying or granulation process.
  • the invention further relates to a process for the preparation of a solid lysine-containing product, as described in its basic features in US 20050220933, and which comprises the processing of the fermentation broth obtained using the microorganisms according to the invention in the following steps:
  • step b) granulation of the obtained in step b) the concentrate, preferably at a temperature of 50 0 C to 62 ° C, and d) coating the granules obtained in c) with one or more of the coating agent (coating agent (s))
  • coating compositions which are selected from the group consisting of
  • step dl the biomass obtained in step a), d2) an L-lysine-containing compound, preferably selected from the group L-lysine hydrochloride or L-lysine sulfate,
  • a water-repellent substance preferably selected from the group of oils, polyethylene glycols and liquid paraffins.
  • the content of L-lysine is adjusted to a desired value.
  • the ratio of the ions is preferably adjusted so that the molar ion ratio according to the following formula
  • the fermentation broth-based solid product thus prepared has a lysine content (as lysine base) of 10% to 70% by weight or 20% to 70% by weight, preferably 30% by weight .-% to 70 wt .-% and most preferably from 40 wt .-% to 70 wt .-% based on the dry mass of the product.
  • lysine base 10% to 70% by weight or 20% to 70% by weight, preferably 30% by weight .-% to 70 wt .-% and most preferably from 40 wt .-% to 70 wt .-% based on the dry mass of the product.
  • Maximum levels of lysine base of 71% by weight, 72% by weight, 73% by weight are also possible.
  • the water content of the L-lysine-containing solid product is up to 5 wt .-%, preferably up to 4 wt .-%, and particularly preferably less than 3 wt .-%.

Abstract

Gegenstand der Erfindung ist ein Verfahren zur Herstellung von L-Aminosäuren unter Verwendung von coryneformen Bakterien, in denen der AmtR-Regulator abgeschwächt worden ist, sowie die entsprechenden rekombinanten Bakterien, Polynukleotide und Vektoren.

Description

Verfahren zur Herstellung von L-Aminosäuren
Gegenstand der Erfindung ist ein Verfahren zur Herstellung von L-Aminosäuren unter Verwendung von coryneformen Bakterien, in denen der AmtR-Regulator abgeschwächt worden ist .
Stand der Technik
L-Aminosäuren findet in der Humanmedizin, in der pharmazeutischen Industrie, in der Lebensmittelindustrie und ganz besonders in der Tierernährung Anwendung.
Es ist bekannt, dass L-Aminosäuren, wie beispielsweise das L-Lysin, durch Fermentation von Stämmen coryneformer Bakterien, insbesondere Corynebacterium glutamicum, hergestellt werden. Wegen der großen Bedeutung wird ständig an der Verbesserung der Herstellverfahren gearbeitet. Verfahrensverbesserungen können fermentationstechnische Maßnahmen wie zum Beispiel Rührung und Versorgung mit Sauerstoff, oder die Zusammensetzung der Nährmedien, wie zum Beispiel die Zuckerkonzentration während der Fermentation, oder die Aufarbeitung zur Produktform durch zum Beispiel Ionenaustauschchromatographie oder die intrinsischen Leistungseigenschaften des Mikroorganismus selbst betreffen.
Zur Verbesserung der Leistungseigenschaften dieser Mikroorganismen werden Methoden der Mutagenese, Selektion und Mutantenauswahl angewendet. Auf diese Weise erhält man Stämme, die resistent gegen Antimetabolite oder auxotroph für regulatorisch bedeutsame Metabolite sind und die L- Aminosäuren produzieren. Ein bekannter Antimetabolit ist das Lysinanalogon S- (2-Aminoethyl) -L-Cystein (AEC) .
Seit einigen Jahren werden ebenfalls Methoden der rekombinanten DNA-Technik zur Stammverbesserung von L- Aminosäure produzierenden Stämmen der Gattung Corynebacterium, insbesondere Corynebacterium glutamicum, eingesetzt, indem man einzelne Aminosäure-Biosynthesegene modifiziert und die Auswirkung auf die Aminosäure- Produktion untersucht.
Zusammenfassende Darstellungen zur Biologie, Genetik und Biotechnologie von Corynebacterium glutamicum sind im „Handbook of Corynebacterium glutamicum" (Eds.: L. Eggeling und M. Bott, CRC Press, Taylor & Francis, 2005), in der Spezialausgabe des Journal of Biotechnolgy (Chief Editor: A. Pühler) mit dem Titel „A New Era in Corynebacterium glutamicum Biotechnology" (Journal of Biotechnolgy 104/1-3, (2003)) und im Buch von T. Scheper (Managing Editor) „Microbial Production of L-Amino Acids" (Advances in Biochemical Engineering/Biotechnology 79, Springer Verlag, Berlin, Deutschland, 2003) zu finden.
Die Nukleotidsequenz des Genoms von Corynebacterium glutamicum ATCC13032 ist bei Ikeda und Nakagawa (Applied Microbiology and Biotechnology 62, 99-109 (2003)), in der EP 1 108 790 und bei Kalinowski et al . (Journal of Biotechnolgy 104(1-3), (2003)) beschrieben. Die Nukleotidsequenz des Genoms von Corynebacterium glutamicum R ist bei Yukawa et al . (Microbiology 153 (4) : 1042-1058 (2007)) beschrieben.
Die Nukleotidsequenz des Genoms von Corynebacterium efficiens ist bei Nishio et al (Genome Research. 13 (7), 1572-1579 (2003)) beschrieben. Die Nukleotidsequenzen des Genoms von Corynebacterium glutamicum und Corynebacterium efficiens sind ebenfalls in der Datenbank des National Center for Biotechnology Information (NCBI) der National Library of Medicine (Bethesda, MD, USA) , in der DNA Data Bank of Japan (DDBJ, Mishima, Japan) oder in der Nukleotidsequenz-Datenbank der European Molecular Biologies Laboratories (EMBL, Heidelberg, Deutschland bzw. Cambridge, UK) verfügbar.
Die Entschlüsselung des Corynebacterium glutamicum Genoms ermöglichte unter Anderem weitreichende Untersuchungen zum Stoffwechsel und regulatorischen Netzwerk dieses Bakteriums (Silberbach und Burkovski, Journal of Biotechnology 126(1) : 101-110 (2006) ) .
Eine wesentliche Vorraussetzung für die Synthese von Aminosäuren sowie generell für die Vermehrung der Zellen ist eine adäquate Versorgung mit Stickstoff. C. glutamicum ist in der Lage, verschiedene Stickstoffquellen, darunter Ammonium, L-Glutaminsäure, Glutamin und Harnstoff, zu verwerten. In Abhängigkeit von Konzentration und Art der verfügbaren Stickstoffquelle werden bestimmte Enzyme und Transportsysteme synthetisiert bzw. aktiviert. Aus energetischen Gründen ist eine strikte Regulation ( "Stickstoff-Kontrolle" ) notwendig. Die Regulation der Genexpression und die globale Signaltransduktion im Stickstoff-Metabolismus von C. glutamicum wurde von verschiedenen Autoren detailliert untersucht.
Die Expression Stickstoff-regulierter Gene wird in C. glutamicum durch den globalen Repressor AmtR reguliert. AmtR reprimiert bei guter Stickstoff-Versorgung die Expression der Gene des amt-soxA-ocd-Operons, des gltBD- Operons, des amtB-glnK-glnD-Operons sowie der Gene glnA und crnT (Jacoby et al . , Molecular Microbiology 37: 964-977 (2000); Beckers et al . , Microbiology, 147: 2961-2170 (2001); Nolden et al . , FEMS Microbiological Letters 201: 91-98 (2001)) . Bei weiteren Untersuchungen (Beckers et al . , Journal of Bacteriology 186(22) : 7645-52 (2004); Beckers et al., Molecular Microbiology 58(2) : 580-595 (2005)) konnte unter Anderem auch für die Gene des gluABCD-Operons, des NCgll915-1918-Operons, des urtABCDE-Operons, des ureABCEFGD-Operons sowie das codA-Gen und das NCgllO99-Gen eine AmtR-abhängige Regulation gezeigt werden.
In der EP 1 460 128 wird über die Auswirkung der Deletion des amtR-Gens in einem ΔargR-Stamm auf die Produktion verschiedener Aminosäuren berichtet.
Aufgabe der Erfindung Die Erfinder haben sich zur Aufgabe gestellt neue Maßnahmen zur verbesserten Herstellung von L-Aminosäuren, bereitzustellen.
Beschreibung der Erfindung
Gegenstand der Erfindung ist ein rekombinantes, L-
Aminosäure ausscheidendes, coryneformes Bakterium bei dem das amtR-Gen, das für einen AmtR-Regulator kodiert, dessen Aminosäuresequenz zu mindestens 85% oder zu mindestens 90%, bevorzugt zu mindestens 95%, besonders bevorzugt zu mindestens 98% oder zu mindestens 99% und ganz besonders bevorzugt identisch ist mit der Aminosäuresequenz von SEQ ID NO : 2 und im Wesentlichen eine Länge von 222 Aminosäuren umfasst, abgeschwächt worden ist, durch eine oder mehrere der Maßnahmen ausgewählt aus der Gruppe a. Substitution der Nukleobase Guanin an Position 7 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5 durch Thymin,
b. Substitution der Nukleobase Cytosin an Position 11 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5 durch Guanin,
c. Substitution der Nukleobase Thymin an Position 40 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5 durch Guanin,
d. Substitution der Nukleobase Thymin an Position 45 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5 durch
Guanin,
e. Deletion einer oder mehrerer der Nukleobasen von Position 40 bis 45, bevorzugt Deletion sämtlicher Nukleobasen von Position 40 bis 45, der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5, f. Deletion einer oder mehrerer der Nukleobasen zwischen Position 72 und 78 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5, g. Substitution einer oder mehrerer der Nukleobasen
Adenin oder Guanin zwischen Position 72 und 78 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5 gegen Thymin oder Cytosin,
h. Austausch des ATG Startkodons an Position 1 bis 3 der Kodierregion des amtR-Gens gegen ein GTG oder TTG Startkodon,
i. Austausch des Glycin an Position 3 der
Aminosäuresequenz gegen eine andere proteinogene L- Aminosäure, bevorzugt L-Glutaminsäure oder L-
Asparaginsäure, besonders bevorzugt L-Glutaminsäure, j . Austausch des L-Isoleucin an Position 24 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Asparagin, L-Glutamin, L-Glutaminsäure und L-Asparaginsäure, bevorzugt L-Asparaginsäure, k. Austausch des L-Leucin an Position 31 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Prolin, L-Asparagin, L-Glutamin, L- Phenylalanin, L-Tyrosin, L-Tryptophan, L-Glutaminsäure und L-Asparaginsäure, bevorzugt L-Prolin,
1. Austausch des L-Phenylalanin an Position 32 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe Glycin, L-Glutaminsäure , L-Asparaginsäure, L-Prolin und L-Cystein, bevorzugt L-Prolin,
m. Austausch des Glycin an Position 36 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Glutaminsäure , L-Asparaginsäure, L- Isoleucin, L-Histidin und L-Phenylalanin, bevorzugt L- Histidin, L-Glutaminsäure oder L-Asparaginsäure, besonders bevorzugt L-Asparaginsäure n. Austausch des L-Threonin an Position 42 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Prolin, L-Isoleucin, L-Methionin, L- Glutamin, L-Tryptophan, L-Glutaminsäure und L- Asparaginsäure, bevorzugt L-Glutaminsäure, o. Austausch des Glycin an Position 50 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Glutaminsäure, L-Asparaginsäure, L- Isoleucin, L-Histidin, L-Tryptophan und L- Phenylalanin, bevorzugt L-Tryptophan,
p. Austausch des L-Glutamin an Position 53 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Cystein, L-Methionin, L-Tyrosin, L- Tryptophan und L-Phenylalanin, bevorzugt L- Phenylalanin,
q. Austausch des L-Alanin an Position 54 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Phenylalanin, L-Isoleucin, L-Tryptophan, L-Tyrosin, L-Histidin, L-Glutaminsäure und L- Asparaginsäure, bevorzugt L-Histidin, r. Austausch des L-Serin an Position 55 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Prolin, L-Phenylalanin, L-Tryptophan, L- Lysin, L-Arginin, L-Glutaminsäure und L- Asparaginsäure, bevorzugt L-Phenylalanin, s. Austausch des L-Tyrosin an Position 57 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Prolin, Glycin, L-Methionin, L- Glutaminsäure und L-Asparaginsäure, bevorzugt L- Asparaginsäure, t. Austausch des L-Tyrosin an Position 58 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Prolin, L-Methionin und L-Cystein, bevorzugt L-Prolin, u. Austausch des L-Histidin an Position 59 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Lysin, L-Asparaginsäure, L-Isoleucin, L- Prolin und Glycin, bevorzugt L-Prolin, und
v. Austausch des L-Lysin an Position 63 der Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Alanin, L-Glutaminsäure, L- Asparaginsäure, L-Asparagin, L-Tyrosin und L- Tryptophan, bevorzugt L-Asparagin.
Für die Herstellung der erfindungsgemäßen Bakterien werden coryneforme Bakterien eingesetzt. Unter den coryneformen Bakterien wird die Gattung Corynebacterium bevorzugt. Innerhalb der Gattung Corynebacterium werden Stämme bevorzugt, die auf folgenden Arten beruhen:
Corynebacterium efficiens, wie zum Beispiel der Typstamm DSM44549,
Corynebacterium glutamicum, wie zum Beispiel der Typstamm ATCC13032 oder der Stamm R, und
Corynebacterium ammoniagenes, wie zum Beispiel der Stamm ATCC6871,
wobei die Art Corynebacterium glutamicum ganz besonders bevorzugt wird.
Einige Vertreter der Art Corynebacterium glutamicum sind im Stand der Technik auch unter anderen Bezeichnungen bekannt. Hierzu gehören beispielsweise: Corynebacterium acetoacidophilum ATCC13870,
Corynebacterium lilium DSM20137,
Corynebacterium melassecola ATCC17965,
Brevibacterium flavum ATCC14067,
Brevibacterium lactofermentum ATCC13869, und Brevibacterium divaricatum ATCC14020.
Der Begriff „Micrococcus glutamicus" für Corynebacterium glutamicum war ebenfalls gebräuchlich.
Einige Vertreter der Art Corynebacterium efficiens wurden im Stand der Technik auch als Corynebacterium thermoaminogenes bezeichnet, wie zum Beispiel der Stamm FERM BP-1539.
Die für die Maßnahmen der Abschwächung eingesetzten Stämme coryneformer Bakterien (Ausgangsstämme) besitzen bevorzugt bereits die Fähigkeit die gewünschte (n) L-Aminosäure (en) in der Zelle anzureichern oder in das sie umgebende Nährmedium auszuscheiden und dort zu akkumulieren. Hierfür wird im Folgenden auch der Ausdruck „produzieren" verwendet. Insbesondere besitzen die für die Maßnahmen der
Abschwächung eingesetzten Stämme coryneformer Bakterien die Fähigkeit > (mindestens) 0,25 g/l, > 0,5 g/l, > 1,0 g/l, > 1,5 g/l, ≥ 2,0 g/l, ≥ 4 g/l oder ≥ 10 g/l der gewünschten Verbindung in ≤ (maximal) 120 Stunden, ≤ 96 Stunden, ≤ 48 Stunden, < 36 Stunden, < 24 Stunden oder < 12 Stunden in der Zelle oder im Nährmedium anzureichern bzw. zu akkumulieren. Bei den Ausgangsstämmen handelt es sich bevorzugt um Stämme, die durch Mutagenese und Selektion, durch rekombinante DNA-Techniken oder durch eine Kombination beider Methoden hergestellt wurden.
Es ist offensichtlich und bedarf keiner weiteren Erklärungen, dass man zu einem erfindungsgemäßen Bakterium auch dadurch gelangen kann, indem man in einem Wildstamm, wie zum Beispiel in dem Typstamm ATCC13032 oder in dem Stamm ATCC14067, zunächst das amtR-Gen mit Hilfe der
Maßnahmen der Erfindung abschwächt und anschließend durch geeignete weitere genetische Massnahmen, das Bakterium veranlasst, die gewünschte (n) L-Aminosäure (en) zu produzieren .
Der Begriff L-Aminosäuren umfasst die proteinogenen Aminosäuren, sowie L-Ornithin und L-Homoserin. Unter proteinogenen L-Aminosäuren versteht man die L-Aminosäuren die in natürlichen Proteinen, das heißt in Proteinen von Mikroorganismen, Pflanzen, Tieren und Menschen, vorkommen. Zu den proteinogenen Aminosäuren zählen L-Asparaginsäure, L-Asparagin, L-Threonin, L-Serin, L-Glutaminsäure, L- Glutamin, L-Glycin, L-Alanin, L-Cystein, L-Valin, L- Methionin, L-Isoleucin, L-Leucin, L-Tyrosin, L- Phenylalanin, L-Histidin, L-Lysin, L-Tryptophan, L-Arginin, L-Prolin und gegebenenfalls L-Selenocystein und L-
Pyrrolysin. Bevorzugt werden die L-Aminosäuren L-Lysin, L- Glutaminsäure, L-Glutamin, L-Arginin, L-Prolin und L- Ornithin. Besonders bevorzugt wird L-Lysin. Werden im Folgenden Aminosäuren oder L-Aminosäuren erwähnt, umfasst der Begriff auch deren Salze wie beispielsweise das Lysin-Monohydrochlorid oder Lysin-Sulfat im Falle der Aminosäure L-Lysin. Bekannte Vertreter L-Lysin produzierender bzw. ausscheidender Stämme coryneformer Bakterien sind beispielsweise :
Corynebacterium glutamicum DM58-l/pDM6 (= DSM4697) beschrieben in EP 0 358 940,
Corynebacterium glutamicum MH20-22B (= DSM16835) beschrieben in Menkel et al . (Applied and Environmental Microbiology 55(3), 684-688 (1989)),
Corynebacterium glutamicum AHP-3 (= Ferm BP-7382) beschrieben in EP 1 108 790,
Corynebacterium glutamicum NRRL B-11474 beschrieben in US 4,275,157,
Corynebacterium glutamicum DSM13994 beschrieben in US 6,783,967
Corynebacterium glutamicum DSM16834 beschrieben in WO 06/063660,
Corynebacterium glutamicum DSM17119 beschrieben in WO 06/100211,
Corynebacterium glutamicum DSM17223 beschrieben in WO 06/125714,
Corynebacterium glutamicum DSM16937 beschrieben in WO 06/077004, und
Corynebacterium thermoaminogenes AJ12521 (= FERM BP-3304) beschrieben in US 5,250,423.
Angaben zur taxonomischen Einordnung von Stämmen der Gruppe der coryneformen Bakterien findet man unter anderem bei Seiler (Journal of General Microbiology 129, 1433-1477 (1983)), Kinoshita (1985, Glutamic Acid Bacteria, p 115- 142. In: Demain and Solomon (ed) , Biology of Industrial Microorganisms . The Benjamin/Cummins Publishing Co., London, UK) , Kämpfer und Kroppenstedt (Canadian Journal of Microbiology 42, 989-1005 (1996)), Liebl et al
(International Journal of Systematic Bacteriology 41, 255- 260 (1991)), Fudou et al (International Journal of Systematic and Evolutionary Microbiology 52, 1127-1131 (2002)) und in der US-A-5, 250, 434. Stämme mit der Bezeichnung „ATCC" können von der American Type Culture Collection (Manassas, VA, USA) bezogen werden. Stämme mit der Bezeichnung „DSM" können von der Deutschen Sammlung von Mikroorganismen und Zellkulturen (DSMZ, Braunschweig, Deutschland) bezogen werden. Stämme mit der Bezeichnung „NRRL" können von der Agricultural Research Service Patent Culture Collection (ARS, Peoria, Illinois, US) bezogen werden. Stämme mit der Bezeichnung „FERM" können vom National Institute of Advanced Industrial Science and Technology (AIST Tsukuba Central 6, 1-1-1 Higashi, Tsukuba Ibaraki, Japan) bezogen werden.
L-Lysin produzierende coryneforme Bakterien besitzen typischerweise eine „feed back" resistente bzw. desensibilisierte Aspartatkinase. Unter „feed back" resistenten Aspartatkinasen versteht man Aspartatkinasen (LysC) , die im Vergleich zur Wildform (Wildtyp) eine geringere Empfindlichkeit gegenüber der Hemmung durch Mischungen von Lysin und Threonin oder Mischungen von AEC (Aminoethylcystein) und Threonin oder Lysin allein oder AEC allein aufweisen. Die für diese im Vergleich zum Wildtyp desensibilisierten Aspartatkinasen kodierenden Gene bzw. Allele werden auch als lysCFBR-Allele bezeichnet. Im Stand der Technik sind zahlreiche lysCFBR-Allele beschrieben, die für Aspartatkinasevarianten kodieren, welche Aminosäureaustausche im Vergleich zum Wildtypprotein besitzen. Die Kodierregion des Wildtyp lysC-Gens von Corynebacterium glutamicum ATCC13032 entsprechend der Zugangsnummer AX756575 der NCBI Datenbank ist in SEQ ID NO : 7 und das von diesem Gen kodierte Polypeptid in SEQ ID NO: 8 dargestellt. Die Aminosäuresequenz der Wildform der Aspartatkinase variiert geringfügig bei verschiedenen Wildtypstämmen von Corynebacterium glutamicum. So enthält die Aspartatkinase des Wildtypstammes Corynebacterium glutamicum ATCC14067 an Position 317 Alanin. Die Wildtyp- Aspartatkinase von Stamm ATCC 13032 enthält an dieser Position Serin wie in SEQ ID NO: 8 dargestellt.
Die für die Maßnahmen der Erfindung eingesetzten L-Lysin produzierenden coryneformen Bakterien verfügen bevorzugt über ein lysC-Allel, das für eine Aspartatkinasevariante kodiert, welche die Aminosäuresequenz von SEQ ID NO: 13 besitzt, wobei diese eine oder mehrere der Aminosäureaustausche ausgewählt aus der Gruppe:
LysC A279T (Austausch von L-Alanin an Position 279 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen L-Threonin; siehe US 5,688,671 und Zugangsnummern E06825, E06826, E08178 und 174588 bis 174597) ,
LysC A279V (Austausch von L-Alanin an Position 279 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen L-Valin; siehe JP 6-261766 und Zugangsnummer E08179) ,
LysC L297Q (Austausch von L-Leucin an Position 297 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen L-Glutamin; siehe DE 102006026328,
LysC S301F (Austausch von L-Serin an Position 301 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen L-Phenylalanin; siehe US 6,844,176 und Zugangsnummer E08180),
LysC S301Y (Austausch von L-Serin an Position 301 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen L-Tyrosin; siehe Kalinowski et al . (Molecular and General Genetics 224, 317-324 (1990)) und Zugangsnummer X57226), LysC T308I (Austausch von L-Threonin an Position 308 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen L-Isoleucin; siehe JP 6-261766 und Zugangsnummer E08181)
LysC T311I (Austausch von L-Threonin an Position 311 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen L-Isoleucin; siehe WO 00/63388 und US 6,893,848) ,
LysC R320G (Austausch von L-Arginin an Position 320 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen Glycin; siehe Jetten et al . (Applied Microbiology and Biotechnology 43, 76-82 (995)) und Zugangsnummer L27125) ,
LysC G345D (Austausch von Glycin an Position 345 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen L-Asparaginsäure; siehe Jetten et al . (Applied Microbiology and Biotechnology 43, 76-82 (995)) und Zugangsnummer L16848),
LysC T380I (Austausch von L-Threonin an Position 380 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen L-Isoleucin; siehe WO 01/49854 und Zugangsnummer AX192358), und
LysC S381F (Austausch von L-Serin an Position 381 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen L-Phenylalanin; siehe EP 0435132)
umfasst, wobei ggf. an Postion 317 anstelle L-Serin L- Alanin enthalten ist.
Besonders bevorzugt werden das lysCFBR-Allel lysC T311I (Austausch von Threonin an Position 311 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen Isoleucin) und ein lysCFBR-Allel enthaltend mindestens einen Austausch ausgewählt aus der Gruppe A279T (Austausch von Alanin an Position 279 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen Threonin), S381F (Austausch von Serin an Position 381 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen Phenylalanin), wobei gegebenenfalls das Serin an Position 317 gegen Alanin ausgetauscht ist (S317A) .
Ganz besonders bevorzugt wird das lysCFBR-Allel lysC T311I (Austausch von Threonin an Position 311 des kodierten Aspartatkinaseproteins gemäß SEQ ID NO: 13 gegen Isoleucin) , wobei gegebenenfalls das Serin an Position 317 gegen Alanin ausgetauscht ist (S317A) .
Der Stamm DSM 16833 (WO 06/063660) besitzt ein lysCFBR- Allel, das für ein Aspartatkinaseprotein kodiert, welches den Aminosäureaustausch T311I enthält.
Der Stamm NRRL B-11474 (US 4,275,157) besitzt ein lysCFBR- Allel, das für ein Aspartatkinaseprotein kodiert, welches den Aminosäureaustausch S381F enthält.
Es hat sich weiterhin als vorteilhaft für die
Lysinproduktion herausgestellt, die lysCFBR-Allele zu überexprimieren .
In einer weiteren Ausführungsform besitzen die für die Massnahmen der Erfindung eingesetzten L-Lysin produzierenden Bakterien der Gattung Corynebacterium, die bevorzugt außerdem ein Polynukleotid enthalten, das für eine Lysin-insensitive Aspartatkinasevariante kodiert, eines oder mehrere der Merkmale ausgewählt aus der Gruppe:
a) überexprimiertes Polynukleotid (dapA-Gen) , das für eine Dihydrodipicolinat-Synthase (DapA, EC Nr.
4.2.1.52) kodiert,
b) überexprimiertes Polynukleotid (asd-Gen) , das für eine Aspartatsemialdehyd-Dehydrogenase (Asd, EC Nr. 1.2.1.11) kodiert,
c) überexprimiertes Polynukleotid (ddh-Gen) , das für eine meso-Diaminopimelate Dehydrogenase (Ddh, EC Nr. 1.4.1.16) kodiert, d) überexprimiertes Polynukleotid, (lysA-Gen) , das für eine Diaminopimelat-Decarboxylase (LysA, EC Nr. 4.1.1.20) kodiert,
e) überexprimiertes Polynukleotid (aat-Gen) , das für eine Aspartat-Aminotransferase (Aat, EC Nr. 2.6.1.1) kodiert,
f) überexprimiertes Polynukleotid (lysE-Gen) , das für eine Polypeptid mit L-Lysin-Export Aktivität (LysE, Lysin Efflux Permease) kodiert,
g) überexprimiertes Polynukleotid, das für eine Pyruvat- Carboxylase (Pyc, EC Nr. 6.4.1.1) kodiert, und
h) überexprimiertes Polynukleotid (dapB-Gen) , das für eine Dihydrodipicolinat-Synthase (DapB, EC Nr. 1.3.1.26) kodiert. Hierfür können die im Stand der Technik beschriebenen Gene von Bakterien verwendet werden. Bevorzugt werden die endogenen Gene bzw. Polynukleotide der Gattung Corynebacterium, besonders bevorzugt die der Art Corynebacterium glutamicum, Corynebacterium efficiens und Corynebacterium ammoniagenes und ganz besonders bevorzugt die der Art Corynebacterium glutamicum verwendet.
Unter endogenen Genen beziehungsweise Polynukleotiden versteht man die in der Population einer Art vorhandenen offenen Leserahmen (ORF) , Gene oder Allele beziehungsweise deren Polynukleotide.
Das dapA-Gen von Corynebacterium glutamicum Stamm ATCC13032 ist beispielsweise in der EP 0 197 335 beschrieben. Zur Überexpression des dapA-Gens von Corynebacterium glutamicum können außerdem unter anderem die Mutationen MC20 und MA16 des dapA-Promotors, wie in der US 6,861,246 beschrieben, eingesetzt werden.
Das asd-Gen von Corynebacterium glutamicum Stamm ATCC 21529 ist beispielsweise in der US 6,927,046 beschrieben. Das lysA-Gen von Corynebacterium glutamicum ATCC13869 (Brevibacterium lactofermentum) ist beispielsweise in der US 6,090,597 beschrieben.
Das ddh-Gen ist beispielsweise bei Ishino et al . (Agricultural and Biological Chemistry 52(11), 2903-2909 (1988)) beschrieben.
Das aat-Gen von Corynebacterium glutamicum ATCC13032 ist beispielsweise bei Kalinowski et al (Journal of Biotechnology 104 (1-3), 5-25 (2003); siehe auch Zugangsnummer NC 006958) beschrieben. Es wird dort als aspB-Gen bezeichnet. In der US 6,004,773 wird ein für eine Aspartat-Aminotransferase kodierendes Gen als aspC bezeichnet. Marienhagen et al (Journal of Bacteriology 187 (22), 7693-7646 (2005) bezeichnen das aat-Gen als aspT-Gen.
Das lysE-Gen von Corynebacterium glutamicum R127 ist beispielweise in der US 6,858,406 beschrieben. In gleicher Weise kann das in der US 6,861,246 verwendete lysE-Gen von Stamm ATCC13032 eingesetzt werden.
Das pyc-Gen von Corynebacterium glutamicum von Stamm ATCC 13032 ist beispielsweise in der WO 99/18228 und WO 00/39305 beschrieben. Weiterhin können Allele des pyc-Gens verwendet werden wie sie beispielsweise in der US 6,965,021 beschrieben sind. Die in dieser Patentschrift beschriebenen Pyruvat-Carboxylasen besitzen einen oder mehrere der Aminosäureaustausche ausgewählt aus der Gruppe: Pyc E153D (Austausch von L-Glutaminsäure an Position 153 gegen L- Asparaginsäure) , Pyc A182S (Austausch von L-Alanin an Position 182 gegen L-Serin) , Pyc A206S (Austausch von L- Alanin an Position 206 gegen L-Serin), Pyc H227R (Austausch von L-Histidin an Position 227 gegen L-Arginin) , Pyc A455G (Austausch von L-Alanin an Position 455 gegen Glycin) , und Pyc D1120E (Austausch von L-Asparaginsäure an Position 1120 gegen L-Glutaminsäure) . In gleicher weise kann das in der EP 1 108 790 beschrieben pyc-Allel verwendet werden, das für eine Pyruvat-Carboxylase kodiert, welche den
Aminosäureaustausch Pyc P458S (Austausch von L-Prolin an Position 458 gegen L-Serin) enthält. Unter Überexpression versteht man allgemein eine Erhöhung der intrazellulären Konzentration oder Aktivität einer Ribonukleinsäure, eines Proteins (Polypeptids) oder eines Enzyms im Vergleich zum Ausgangsstamm (Elternstamm) oder Wildtypstamm. Unter einem Ausgangsstamm (Elternstamm) versteht man den Stamm, an dem die zur Überexpression führende Maßnahme durchgeführt wurde.
Die Erhöhung der Konzentration oder Aktivität lässt sich beispielsweise dadurch erzielen, dass man die Kopienzahl der entsprechenden Polynukleotide chromosomal oder extrachromosomal um mindestens eine Kopie erhöht.
Eine weit verbreitete Methode zur Erhöhung der Kopienzahl besteht darin, dass man das entsprechende Polynukleotid in einen Vektor, bevorzugt ein Plasmid, einbaut, der von einem coryneformen Bakterium repliziert wird. Weiterhin kann man als Vektoren Transposons, Insertionselemente (IS-Elemente) oder Phagen einsetzen Im Stand der Technik ist eine Fülle geeigneter Vektoren beschrieben.
Eine andere verbreitete Methode zur Erzielung einer Überexpression ist das Verfahren der chromosomalen
Genamplifikation . Bei dieser Methode wird mindestens eine zusätzliche Kopie des interessierenden Polynukleotids in das Chromosom eines coryneformen Bakteriums eingefügt. Derartige Amplifikationsverfahren sind beispielsweise in der WO 03/014330 oder WO 03/040373 beschrieben.
Eine weitere Methode zur Erzielung einer Überexpression besteht darin, das entsprechende Gen beziehungsweise Allel in funktioneller Weise (operably linked) mit einem Promotor beziehungsweise einer Expressionskassette zu verknüpfen. Geeignete Promotoren für Corynebacterium glutamicum sind beispielsweise in der Fig. 1 des Übersichtsartikel von Patek et al . (Journal of Biotechnology 104(1-3), 311-323 (2003)) beschrieben. In gleicher Weise können die von Vasicova et al (Journal of Bacteriology 181, 6188-6191 (1999)) beschrieben Varianten des dapA-Promotors, beispielsweise der Promotor A25 eingesetzt werden. Weiterhin kann der gap-Promotor von Corynebacterium glutamicum (EP 06007373) verwendet werden. Schließlich können die hinlänglich bekannten von Amann et al . (Gene 69(2) , 301-315 (1988) ) und Amann und Brosius (Gene 40 (2-3) , 183-190 (1985) ) beschriebenen Promotoren T3, T7, SP6, M13, lac, tac und trc verwendet werden. Ein derartiger Promotor kann beispielsweise stromaufwärts des betreffenden Gens, typischerweise im Abstand von ungefähr 1 - 500 Nukleobasen vom Startkodon eingefügt werden.
Durch die Maßnahmen der Überexpression, wird die Aktivität oder Konzentration des entsprechenden Polypeptids im allgemeinen um mindestens 10%, 25%, 50%, 75%, 100%, 150%, 200%, 300%, 400% oder 500%, maximal bis 1000% oder 2000% bezogen auf die Aktivität oder Konzentration des Polypeptids im Stamm vor der zur Überexpression führenden Maßnahme, erhöht.
Es ist ebenfalls möglich, zusätzlich zu den Maßnahmen die das amtR-Gen betreffen, einzelne Biosynthesegene abzuschwächen oder auszuschalten.
So ist es gegebenenfalls zweckmäßig für die Verbesserung der Produktion von L-Lysin, L-Valin oder L-Isoleucin, bevorzugt L-Lysin, eines oder mehrere der Gene ausgewählt aus der Gruppe
a) ein für die Glucose-6-Phosphat-Isomerase (Pgi, EC Nr. 5.3.1.9) kodierendes Gen pgi, wie beispielsweise das in der US 6,586,214 und US 6,465,238 beschriebene pgi-Gen von Corynebacterium glutamicum,
b) ein für die Malat-Dehydrogenase (Mdh, EC Nr. 1.1.1.37) kodierendes Gen mdh, wie beispielsweise in der WO 02/02778 beschrieben,
c) ein für die Malat-Chinon Oxidoreduktase (Mqo, EC Nr. 1.1.99.16) kodierendes Gen mqo, wie beispielsweise in der US 7,094,106 und PCT/EP2005/057216 beschrieben, und
d) ein für die EIp Untereinheit des Pyruvat-Dehydrogenase Komplexes kodierendes aceE-Gen (AceE, EC Nr. 1.2.4.1) , wie beispielsweise in der EP-A-1767616 beschrieben, abzuschwächen oder auszuschalten.
Diese Massnahmen können im Falle der L-Lysin Produktion auch zusätzlich zur Verwendung von lysCFBR-Allelen und/oder der Überexpression eines oder mehrerer Gene ausgewählt aus der Gruppe dapA, dapB, asd, ddh, lysA, aat, lysE und pyc durchgeführt werden.
Der Begriff „Abschwächung" beschreibt in diesem Zusammenhang die Verringerung oder Ausschaltung der intrazellulären Aktivität eines oder mehrerer Enzyme (Proteine) in einem Mikroorganismus, die durch die entsprechende DNA kodiert werden, indem man beispielsweise einen schwachen Promotor verwendet oder ein Gen bzw. Allel verwendet, das für ein entsprechendes Enzym mit einer niedrigen Aktivität kodiert bzw. das entsprechende Gen oder Enzym (Protein) inaktiviert und gegebenenfalls diese Maßnahmen kombiniert.
Im Falle des AceE-Polypeptides (siehe SEQ ID NO: 2 von EP-A- 1767616) kann die Abschwächung auch durch einen oder mehrere der Aminosäureaustausche ausgewählt aus der Gruppe a) Austausch von AIa an Position 225 gegen VaI, Leu oder He, bevorzugt VaI, b) Austausch von GIy an Position 255 gegen Ser oder Thr, bevorzugt Ser, c) Austausch von Asn an Position 282 gegen GIn, und d) Austausch des Cys an Position 283 gegen eine andere Aminosäure, bevorzugt Ser, erzielt werden, wobei folgende Austausche ausgewählt aus der Gruppe e) Austausch an Position 282, f) gleichzeitiger Austausch an den Positionen 225 und 283, und g) gleichzeitiger Austausch an den Positionen 255 und 283, bevorzugt werden. Die Konzentration eines Proteins kann über 1- und 2- dimensionale Proteingelauftrennung und anschließende optische Identifizierung der Proteinkonzentration mit entsprechender Auswertesoftware im Gel bestimmt werden. Eine gebräuchliche Methode zur Präparation der Proteingele bei coryneformen Bakterien und zur Identifizierung der Proteine ist die von Hermann et al . (Electrophoresis, 22:1712-23 (2001)) beschriebene Vorgehensweise. Die Proteinkonzentration kann ebenfalls durch Western-Blot- Hybridisierung mit einem für das nachzuweisende Protein spezifischen Antikörper (Sambrook et al . , Molecular cloning: a laboratory manual . 2nd Ed. CoId Spring Harbor Laboratory Press, CoId Spring Harbor, N. Y., 1989) und anschließender optischer Auswertung mit entsprechender Software zur Konzentrationsbestimmung (Lohaus und Meyer (1998) Biospektrum 5:32-39; Lottspeich, Angewandte Chemie 38: 2476-2492 (1999)) bestimmt werden. Die Aktivität kann mit Hilfe eines geeigneten Enzymtest bestimmt werden.
Bei dem AmtR-Regulator, der im Folgenden auch als AmtR- Polypeptid oder Transkriptionsregulator AmtR bezeichnet wird, handelt es sich um ein Polypeptid mit der Aktivität eines Transkriptionsregulators, der bei Stickstoffüberschuss in der Zelle die Expression der Gene des StickstoffStoffwechseis reprimiert. Bei Stickstoffmangel erfolgt die Derepression .
Bei Kultur einer Wildtypstammes eines coryneformen Bakteriums, bevorzugt Corynebacterium glutamicum wie beispielsweise Stamm ATCC 13032, in einem Minimalmedium, welches als Stickstoffquelle Ammonium-Ionen enthält, besteht Stickstoffmangel bei einer Ammonium-Ionen Konzentration von ≤ 5 mM, bevorzugt ≤ 1 mM, besonders bevorzugt ≤ 0,5 mM.
Der Adenylierungsgrad des Signaltransduktionsproteins GInK im Cytoplasma des coryneformen Bakteriums gibt ebenfalls Auskunft darüber, ob für die Zelle Stickstoffmangel oder Stickstoffüberschuss besteht. Stickstoffmangel liegt dann vor wenn in der Zelle ≥ 80%, bevorzugt ≥ 90%, ≥ besonders bevorzugt 95% des Signaltransduktionsproteins in adenylierter Form vorliegen.
Zu den Genen des Stickstoffwechsels, die vom AmtR-Regulator bei Stickstoffüberschuss reprimiert werden, zählen unter Anderem amtA, amtB, codA, crnT, gdh, glnA, gluA, gltB, ureA und urtA (Tabelle 1 auf Seite 584 bei Beckers et al . (Molecular Microbiology 58(2), 580-595 (2005)) . Die Aminosäuresequenz des AmtR-Regulators coryneformer Bakterien ist zu mindestens 85% oder zu mindestens 90%, bevorzugt zu mindestens 95%, besonders bevorzugt zu mindestens 98% oder zu mindestens 99% identisch mit der Aminosäuresequenz von SEQ ID NO: 2 und umfasst oder besitzt im Wesentlichen eine Länge von 222 Aminosäuren, wobei eine Länge von 222 Aminosäuren bevorzugt wird. Ein Beispiel für einen AmtR-Regulator der mindestens 98% identisch ist mit der Aminosäuresequenz von SEQ ID NO: 2 ist der von Stamm ATCC14067. Er ist in SEQ ID NO:21 aufgeführt. Ganz besonders bevorzugt umfasst oder besitzt der AmtR-Regulator die Aminosäuresequenz von SEQ ID NO: 2. Gegebenenfalls enthält die Aminosäuresequenz von SEQ ID NO: 2 oder 21, maximal 3, bevorzugt maximal 2, besonders bevorzugt maximal einen konservative (n) Aminosäureaustausch (e) . Durch die konservativen Aminosäureaustausche wird die Aktivität des AmtR-Repressors im Wesentlichen nicht verändert.
Der Begriff „im Wesentlichen eine Länge von 222 Aminosäuren" trägt in diesem Zusammenhang der Tatsache Rechnung, dass durch Insertion oder Deletion einer (1) oder mehrerer, maximal 10, 9, 8, 7, 6, 5, 4, 3 oder 2, Aminosäuren innerhalb des Polypeptids oder am N- oder C- terminalen Ende des Polypeptids die Länge des kodierten Polypeptids bei verschiedenen Arten oder Stämmen L- Aminosäure auscheidender coryneformer Bakterien geringfügig variiert. Ein Beispiel hierfür ist der AmtR-Regulator von Corynebacterium efficiens. Die Länge des Polypeptids (Siehe SEQ ID NO: 11) beträgt in diesem Fall 223 Aminosäuren. Die unterschiedliche Länge des AmtR-Regulators ist durch Insertion der Aminosäure L-Glutaminsäure zwischen Position 151 und 153 von SEQ ID NO:2 bedingt.
Nachfolgend sind die Aminosäuren der Aminosäuresequenz des AmtR-Regulators von Corynebacterium efficiens (AmtR Ceff) den Aminosäuren der Aminosäuresequenz des AmtR- Regulators von Corynebacterium glutamicum (AmtR CgIu) zugeordnet . AmtR Ceff 1 magavgrprrsaprragknpreeildasaelftrqgfattsthqiadavg AmtR CgIu 1 magavgrprrsaprragknpreeildasaelftrqgfattsthqiadavg AmtR Ceff 51 irqaslyyhfpskteifltllkstvepsmvlagdlanleaspelrlwalv AmtR CgIu 51 irqaslyyhfpskteifltllkstvepstvlaedlstldagpemrlwaiv
AmtR Ceff 101 aaevrlllstkwnvgrlyqlpivaseefeeyhtqratltdtfrslateiv AmtR CgIu 101 asevrlllstkwnvgrlyqlpivgseefaeyhsqrealtnvfrdlateiv
AmtR Ceff 151 geddpraelpfhitmsaiemrrndgkvpsplsedslpdtavmladaalav
AmtR CgIu 151 g-ddpraelpfhitmsviemrrndgkipsplsadslpetaimladaslav
AmtR Ceff 201 lgadlpgdrvertlellrqadak AmtR CgIu 200 lgaplpadrvektlelikqadak
Für die Zuordnung der einzelnen Aminosäuren verschiedener AmtR-Regulatoren können auch sogenannte Alignment- Programme, wie beispielsweise das ClustalW- (Thompson et al. , Nucleic Acids Research 25 (24) , 4876-82 (1997) ) oder MAFFT-Progamm (Katoh et al . , Nucleic Acid Res. , 30:3059- 3066 (2002) ) verwendet werden. Die einzelnen Aminosäuren eines Polypeptids können dadurch, trotz formal unterschiedlicher Länge der Aminosäuresequenzen, einander eindeutig zugeordnet werden.
Bei den aromatischen L-Aminosäuren spricht man von konservativen Austauschen wenn L-Phenylalanin, L-Tryptophan und L-Tyrosin gegeneinander ausgetauscht werden. Bei den hydrophoben L-Aminosäuren spricht man von konservativen Austauschen wenn L-Leucin, L-Isoleucin und L-Valin gegeneinander ausgetauscht werden. Bei den polaren Aminosäuren spricht man von konservativen Austauschen wenn L-Glutamin und L-Asparagin gegeneinander ausgetauscht werden. Bei den basischen Aminosäuren spricht man von konservativen Austauschen wenn L-Arginin, L-Lysin und L-
Histidin gegeneinander ausgetauscht werden. Bei den sauren L-Aminosäuren spricht man von konservativen Austauschen wenn L-Asparaginsäure und L-Glutaminsäure gegeneinander ausgetauscht werden. Bei den Hydroxyl-Gruppen enthaltenden Aminosäuren spricht man von konservativen Austauschen wenn L-Serin und L-Threonin gegeneinander ausgetauscht werden.
Der Ausdruck „wird die Aktivität des AmtR-Repressors im Wesentlichen nicht verändert" bedeutet, dass durch die genannten maximal 3 konservativen Aminosäureaustausche, die Fähigkeit des AmtR-Repressors an seine DNA-Bindestelle zu binden um maximal 10 %, bevorzugt maximal 5 %, besonders bevorzugt 1 % und ganz besonders bevorzugt nicht verändert wird. Die Aktivität kann durch
Verzögerungsgelelektrophorese (gel retardation assay) unter Verwendung von doppelsträngigen DNA-Molekülen mit der Nukleotidsequenz einer AmtR-Bindestelle des amtA-Gens (Siehe SEQ ID NO: 14 und 15), einer AmtR-Bindestelle des amtB-Gens (Siehe SEQ ID NO: 16 und 17) oder einer AmtR- Bindestelle des gltB-Gens (Siehe SEQ ID NO: 18 und 19), bevorzugt unter Verwendung von doppelsträngigen DNA- Molekülen mit der Nukleotidsequenz einer AmtR-Bindestelle des amtA-Gens und ganz besonders bevorzugt unter Verwendung eines doppelsträngigen DNA-Molekülen mit der
Nukleotidsequenz von SEQ ID NO: 14 gemessen werden. Die Nukleotidsequenzen sind der Tabelle 1 von Beckers et al . (Molecular Microbiology 58(2), 580-595 (2005)) entnommen.
In der SEQ ID NO: 1 ist die Nukleotidsequenz der Kodierregion des amtR-Gens vom Typstamm von Corynebacterium glutamicum (Wildtypgen), das heißt ATCC13032, gemäß der Angaben der Datenbank des National Center for Biotechnology Information (NCBI) wiedergegeben. SEQ ID NO:2 und 4 zeigen die Aminosäuresequenz des kodierten Polypeptids. SEQ ID NO:2 und 4 enthalten an Position 34 L-Arginin, an Position 87 L-Threonin und an Position 203 L-Prolin. Es ist bekannt, dass durch wirtseigene Enzyme, sogenannte Aminopeptidasen, das endständige Methionin bei der Proteinsynthese entfernt werden kann. In der SEQ ID NO: 3 sind stromaufwärts (upstream) und stromabwärts (downstream) gelegene Nukleotidsequenzen zusätzlich angegeben.
In der SEQ ID NO: 10 ist die Nukleotidsequenz der Kodierregion des amtR-Gens von Corynebacterium efficiens Stamm YS-314 gemäß der Angaben der Datenbank des National Center for Biotechnology Information (NCBI) wiedergegeben. SEQ ID NO: 11 zeigt die Aminosäuresequenz des kodierten Polypeptids . In der SEQ ID NO: 20 ist die Nukleotidsequenz der Kodierregion des amtR-Gens von Corynebacterium glutamicum ATCC14067 wiedergegeben. Die Sequenz wurde vom Anmelder bestimmt. SEQ ID NO: 21 zeigt die Aminosäuresequenz des kodierten Polypeptids. Die Aminosäuresequenz von SEQ ID NO: 21 enthält an Position 34 L-Histidin, an Position 87 L- Isoleucin und an Position 203 L-Serin.
Die Nukleotidsequenz des Genoms von Corynebacterium glutamicum wurde von verschiedenen Arbeitsgruppen bestimmt.
Die von Kalinowski et al . (Journal of Biotechnology 104(1- 3), 5-25 (2003)) von der Universität Bielefeld (Deutschland) bestimmte Sequenz von Stamm ATCC13032 ist unter der Zugangsnummer NC_006985 verfügbar. Dem amtR-Gen wird dort die Bezeichnung cgO986 zugeordnet und umfasst die Region von Position 923864-924532 des komplementären Stranges .
Die von Ikeda und Nakagawa (Applied Microbiology 62 (2-3) , 99-109 (2003)) von der Kitasato Universität (Japan) bestimmte Sequenz von Stamm ATCC13032 ist unter der Zugangsnummer NC 003450 verfügbar. Dem amtR-Gen wird dort die Bezeichnung NCglO828 zugeordnet.
Die von Yukawa et al . (Microbiology 153 (Pt 4), 1042-58 (2007)) vom Research Institute of Innovative Technology for the Earth (RITE) (Japan) bestirnte Sequenz von Stamm R ist unter der Zugangsnummer NC_009342 verfügbar. Dem amtR-Gen wird dort die Bezeichnung cgR 0978 zugeordnet.
Die Nukleotidsequenz des Genoms von Corynebacterium efficiens wurde von Nishio et al . (Genome Research 2003 13(7), 1572-1579 (2003)) von der Firma Ajinomoto (Japan) bestimmt. Sie ist unter der Zugangsnummer NC 004369 verfügbar. Dem amtR-Gen wird dort die Bezeichnung COG1309K zugeordnet und umfasst die Region von Position 1002436- 1003107 des komplementären Stranges.
Der AmtR-Regulator gehört zur TetR-Familie der Transkriptionsregulatoren und weist wie die anderen Mitglieder dieser Familie an der DNA-Bindestelle ein typisches Helix-Turn-Helix Motiv auf (Ramos et al . , Microbiology and Molecular Biology Reviews 69(2) : 326-356 (2003); Jacoby et al . , Molecular Microbiology 37(4) : 964- 977 (2000) ) .
Die Nukleotidsequenzen der DNA, an die der AmtR-Regulator bindet, sind bekannt. Von Jakoby et al . (Molecular Microbiology 37(4), 964-977 (2000)) wurde mittels Deletionsanalysen, Verzögerungsgelelektrophorese (gel retardation assay) und dem Matchmaker One-Hybrid-System (Clontech Laboratories, Inc., Mountain View, USA) die Expression des amt-Gens, das für den Ammonium-Transporter Amt in Corynebacterium glutamicum (Siewe et al . , Journal of Biological Chemistry 271 (10) : 5398-5402 (1996)) kodiert, untersucht. Der Ammonium-Transporter Amt wird bei Jakoby et al . auch als „ (methyl) ammonium uptake System" bezeichnet. Bei Beckers et al . (Molecular Microbiology 58(2), 580-595 (2005)) wird das amt-Gen als amtA-Gen bezeichnet. Es trägt die NCBI Zugangsnummer NCgll521. Von Jakoby et al . wurde gezeigt, dass die Expression des amt-Gens durch Bindung des AmtR-Regulators an Bindemotive doppelsträngiger DNA mit der Nukleotidsequenz 5' -ATCTATAGAACGATAG-3' und 5'- ATCTATAGGCGGATAG-3' reprimiert wird.
Von Beckers et al . (Molecular Microbiology 58(2), 580-595 (2005) ) wurde das Konsensus Motiv (consensus motif) der Bindestelle für die vom AmtR-Regulator regulierten Gene bestimmt. Beckers et al . geben im Gegensatz zu Jakoby et al. (Molecular Microbiology 37(4), 964-977 (2000)) die Nukleotidsequenz des revers komplementären DNA-Stranges der Bindestelle an.
Weitere Ausführungen zum AmtR-Regulator findet man unter anderem bei Walter et al . (Journal of Molecular Microbiology 12, 131-138 (2007)) und A. Burkovski (Archives of Microbiology 179: 83-88 (2003); Aufsatz „Nitrogen Metabolism and its Regulation" im „Handbook of
Corynebacterium glutamicum" (Eds.: L. Eggeling und M. Bott, CRC Press, Taylor & Francis, 2005) . Der Begriff „Abschwächung" beinhaltet die Verringerung der intrazellulären Konzentration oder Aktivität eines oder mehrerer Polypeptide (Proteine) bzw. Enzyme in einem Mikroorganismus, die durch die entsprechende DNA kodiert werden, im Vergleich zum Elternstamm. Als Elternstamm oder Ausgangsstamm wird der Stamm bezeichnet, an dem die Maßnahmen der Abschwächung durchgeführt wurden. Die Abschwächung kann erzielt werden, indem die Expression eines Polypeptids, beispielsweise durch Verwendung eines schwachen Promotors, verringert wird oder indem ein Allel verwendet wird, das für ein Polypeptid mit einer niedrigeren Aktivität kodiert und gegebenenfalls diese Maßnahmen inaktiviert.
Die Promotorregion des amtR-Gens ist in SEQ ID NO: 5 dargestellt. Die Nukleotidsequenz von SEQ ID NO:5 ist in SEQ ID NO:3 enthalten. Position 1 von SEQ ID NO:5 entspricht Position 911 von SEQ ID NO:3. Position 90 von SEQ ID NO:5 entspricht Position 1000 von SEQ ID NO:3.
Erfindungsgemäß wird durch eine oder mehrere der Modifikationen der Promotorregion des amtR-Gens ausgewählt aus der Gruppe a. Substitution der Nukleobase Guanin an Position 7 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5 durch Thymin,
b. Substitution der Nukleobase Cytosin an Position 11 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5 durch Guanin,
c. Substitution der Nukleobase Thymin an Position 40 von SEQ ID NO: 5 durch Guanin,
d. Substitution der Nukleobase Thymin an Position 45 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5 durch Guanin,
e. Deletion einer oder mehrerer der Nukleobasen von Position 40 bis 45, bevorzugt Deletion sämtlicher Nukleobasen von Position 40 bis 45, der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5, f. Deletion einer oder mehrerer der Nukleobasen zwischen Position 72 und 78 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5, und g. Substitution einer mehrerer der Nukleobasen Adenin oder Guanin zwischen Position 72 und 78 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5 gegen Thymin oder Cytosin,
die Expression des AmtR-Regulators verringert.
Erfindungsgemäß wird weiterhin durch Austausch des ATG Startkodons an Position 1 bis 3 der Kodierregion des amtR- Gens gegen ein GTG oder TTG Startkodon die Expression des AmtR-Regulators verringert. Durch die Verringerung der Expression des amtR-Gens wird die intrazelluläre Konzentration des AmtR-Regulators auf >0 % bis <75 %, >0 % bis <50 %, >0 % bis <25 %, >0 % bis < 5 %,>0 % bis < 1 %, oder auf > 0,1 % bis <75 %, > 0,1 % bis <50 %, > 0,1 % bis < 25 %, > 0,1 % bis < 5 %, > 0,1 % bis < 1 %, oder auf > 1 % bis <75 %, > 1 % bis <50 %, > 1 % bis < 25 %, > 1 % bis < 5 %, oder auf > 5 % bis <75 %, > 5 % bis ≤50 %, ≥ 5 % bis ≤ 25 % der Konzentration im Elternstamm bzw. Ausgangsstamm herabgesetzt.
Erfindungsgemäß wird schließlich durch einen oder mehrere, bevorzugt maximal 3, besonders bevorzugt maximal 2, der Aminosäureaustausche ausgewählt aus der Gruppe a. Austausch des Glycin an Position 3 der Aminosäuresequenz, bevorzugt der Aminosäuresequenz gemäß SEQ ID NO:2, SEQ ID NO:21 oder SEQ ID NO:11, gegen eine andere proteinogene L-Aminosäure, bevorzugt L-Glutaminsäure oder L-Asparaginsäure, ganz besonders bevorzugt L-Glutaminsäure, b. Austausch des L-Isoleucin an Position 24 der Aminosäuresequenz, bevorzugt der Aminosäuresequenz gemäß SEQ ID NO:2, SEQ ID NO:21 oder SEQ ID NO: 11, gegen eine Aminosäure ausgewählt aus der Gruppe L- Asparagin, L-Glutamin, L-Glutaminsäure und L- Asparaginsäure, bevorzugt L-Asparaginsäure, c. Austausch des L-Leucin an Position 31 der
Aminosäuresequenz, bevorzugt der Aminosäuresequenz gemäß SEQ ID NO:2, SEQ ID NO:21 oder SEQ ID NO:11, gegen eine Aminosäure ausgewählt aus der Gruppe L- Prolin, L-Asparagin, L-Glutamin, L-Phenylalanin, L- Tyrosin, L-Tryptophan, L-Glutaminsäure und L- Asparaginsäure, bevorzugt L-Prolin, d. Austausch des L-Phenylalanin an Position 32 der Aminosäuresequenz, bevorzugt der Aminosäuresequenz gemäß SEQ ID NO:2, SEQ ID NO:21 oder SEQ ID NO:11, gegen eine Aminosäure ausgewählt aus der Gruppe
Glycin, L-Glutaminsäure , L-Asparaginsäure, L-Prolin und L-Cystein, bevorzugt L-Prolin,
e. Austausch des Glycin an Position 36 der Aminosäuresequenz, bevorzugt der Aminosäuresequenz gemäß SEQ ID NO:2, SEQ ID NO:21 oder SEQ ID NO:11, gegen eine Aminosäure ausgewählt aus der Gruppe L- Glutaminsäure , L-Asparaginsäure, L-Isoleucin, L- Histidin und L-Phenylalanin, bevorzugt L-Histidin, L- Glutaminsäure, oder L-Asparaginsäure, ganz besonders bevorzugt L-Asparaginsäure, f. Austausch des L-Threonin an Position 42 der Aminosäuresequenz, bevorzugt der Aminosäuresequenz gemäß SEQ ID NO:2, SEQ ID NO:21 oder SEQ ID NO:11, gegen eine Aminosäure ausgewählt aus der Gruppe L- Prolin, L-Isoleucin, L-Methionin, L-Glutamin, L- Tryptophan, L-Glutaminsäure und L-Asparaginsäure, bevorzugt L-Glutaminsäure, g. Austausch des Glycin an Position 50 der Aminosäuresequenz, bevorzugt der Aminosäuresequenz gemäß SEQ ID NO:2, SEQ ID NO:21 oder SEQ ID NO:11, gegen eine Aminosäure ausgewählt aus der Gruppe L- Glutaminsäure, L-Asparaginsäure, L-Isoleucin, L- Histidin, L-Tryptophan und L-Phenylalanin, bevorzugt L-Tryptophan,
h. Austausch des L-Glutamin an Position 53 der Aminosäuresequenz, bevorzugt der Aminosäuresequenz gemäß SEQ ID N0:2, SEQ ID N0:21 oder SEQ ID NO: 11, gegen eine Aminosäure ausgewählt aus der Gruppe L- Cystein, L-Methionin, L-Tyrosin, L-Tryptophan und L- Phenylalanin, bevorzugt L-Phenylalanin,
i. Austausch des L-Alanin an Position 54 der
Aminosäuresequenz, bevorzugt der Aminosäuresequenz gemäß SEQ ID N0:2, SEQ ID N0:21 oder SEQ ID N0:ll, gegen eine Aminosäure ausgewählt aus der Gruppe L- Phenylalanin, L-Isoleucin, L-Tryptophan, L-Tyrosin, L- Histidin, L-Glutaminsäure und L-Asparaginsäure, bevorzugt L-Histidin,
j . Austausch des L-Serin an Position 55 der
Aminosäuresequenz, bevorzugt der Aminosäuresequenz gemäß SEQ ID N0:2, SEQ ID N0:21 oder SEQ ID N0:ll, gegen eine Aminosäure ausgewählt aus der Gruppe L- Prolin, L-Phenylalanin, L-Tryptophan, L-Lysin, L- Arginin, L-Glutaminsäure und L-Asparaginsäure, bevorzugt L-Phenylalanin,
k. Austausch des L-Tyrosin an Position 57 der Aminosäuresequenz, bevorzugt der Aminosäuresequenz gemäß SEQ ID N0:2, SEQ ID N0:21 oder SEQ ID N0:ll, gegen eine Aminosäure ausgewählt aus der Gruppe L- Prolin, Glycin, L-Methionin, L-Glutaminsäure und L- Asparaginsäure, bevorzugt L-Asparaginsäure, 1. Austausch des L-Tyrosin an Position 58 der
Aminosäuresequenz, bevorzugt der Aminosäuresequenz gemäß SEQ ID N0:2, SEQ ID N0:21 oder SEQ ID N0:ll, gegen eine Aminosäure ausgewählt aus der Gruppe L- Prolin, L-Methionin und L-Cystein, bevorzugt L-Prolin, m. Austausch des L-Histidin an Position 59 der
Aminosäuresequenz, bevorzugt der Aminosäuresequenz gemäß SEQ ID NO: 2 oder SEQ ID NO: 11, gegen eine Aminosäure ausgewählt aus der Gruppe L-Lysin, L- Asparaginsäure, L-Isoleucin, L-Prolin und Glycin, bevorzugt L-Prolin, und n. Austausch des L-Lysin an Position 63 der
Aminosäuresequenz, bevorzugt der Aminosäuresequenz gemäß SEQ ID N0:2, SEQ ID N0:21 oder SEQ ID NO: 11, gegen eine Aminosäure ausgewählt aus der Gruppe L- Alanin, L-Glutaminsäure, L-Asparaginsäure, L- Asparagin, L-Tyrosin und L-Tryptophan, bevorzugt L- Asparagin
die Aktivität des AmtR-Regulators verringert. Bevorzugt wird der Austausch des Glycin an Position 3 der
Aminosäuresequenz und der Austausch des Glycin an Position 36 der Aminosäuresequenz.
Durch die erfindungsgemäßen Aminosäureaustausche wird die Aktivität des AmtR-Regulators auf > 0 % bis < 75 %, > 0 % bis <50 %, >0 % bis < 25 %, > 0 % bis < 5 %,> 0 % bis < 1 %, oder auf > 0,1 % bis <75 %, > 0,1 % bis <50 %, > 0,1 % bis < 25 %, > 0,1 % bis < 5 %, > 0,1 % bis < 1 %, oder auf > 1 % bis <75 %, > 1 % bis <50 %, > 1 % bis < 25 %, > 1 % bis < 5 % oder auf > 5 % bis <75 %, > 5 % bis <50 %, > 5 % bis ≤ 25 % der Aktivität des AmtR-Regulators des Wildtyps, bevorzugt mit der Aminosäuresequenz von SEQ ID NO: 2 oder SEQ ID NO: 11 verringert.
Darüberhinaus ist es erfindungsgemäß möglich die Expression der erfindungsgemäßen Varianten des AmtR-Regulators durch Verwendung bekannter, schwacher Promotoren abzusenken bzw. einzustellen. Hierzu gehören unter anderem die Promotoren seqP-RBS_01 to seqP-RBS_07, die in der Zeitschrift Research Disclosure unter der Nummer 512057 (Ausgabe Dezember 2006) offengelegt sind und die von M. Patek beschriebenen Varianten des dapA-Promotors, bevorzugt die Varianten C7, C13, Ol, C2, J2, B31, C5 und B6 (M. Patek im "Handbook of Corynebacterium glutamicum" (Lothar Eggeling and Michael Bott (editors) , CRC Press, Taylor and Francis Group, Boca Raton, FL, USA, 2005) ) .
Die Abschwächung des amtR-Gens kann mit verschiedenen Methoden bestimmt werden. Die Konzentration ist mit Hilfe von 1- und 2-dimensionaler Proteingelauftrennung und anschließender Bestimmung der Proteinkonzentration im Gel nachweisbar. Eine gebräuchliche Methode zur Präparation der Proteingele bei coryneformen Bakterien und zur Identifizierung der Proteine ist die von Hermann et al . (Electrophoresis, 22:1712-23 (2001)) beschriebene
Vorgehensweise. Die Proteinkonzentration kann weiterhin durch Western-Blot-Hybridisierung mit einem für das nachzuweisende Protein spezifischen Antikörper (Sambrook et al . , Molecular cloning: a laboratory manual . 2nd Ed. CoId Spring Harbor Laboratory Press, CoId Spring Harbor, N. Y., 1989) und anschließender optischer Auswertung mit entsprechender Software zur Konzentrationsbestimmung (Lohaus und Meyer (1998) Biospektrum 5:32-39; Lottspeich (1999) Angewandte Chemie 111:2630-2647) analysiert werden. Die Aktivität des AmtR-Regulators als DNA-bindendem Protein kann mittels Verzögerungsgelelektrophorese (retardation gel electrophoresis) (Wilson et al . (2001) Journal of Bacteriology 183:2151-2155) gemessen werden. Dieser Test wird auch als „DNA band shift assay" bezeichnet. Die Wirkung von DNA-bindenden Proteinen auf die Expression der von ihnen kontrolierten Gene kann schließlich auch durch verschiedene, gut beschriebene Methoden des Reportergen- Assays nachgewiesen werden (Sambrook et al . , Molecular cloning: a laboratory manual. 2nd Ed. CoId Spring Harbor Laboratory Press, CoId Spring Harbor, N. Y., 1989) .
Gegenstand der Erfindung ist ebenfalls ein isoliertes Polynukleotid umfassend die Promotorregion oder im Wesentlichen bestehend aus der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5, welche eine oder mehrere der erfindungsgemäßen Modifikationen aufweist.
Bevorzugt umfasst die erfindungsgemäße Promotorregion des amtR-Gens < (maximal) 5000, < 4000, < 3000, < 2000, < 1000, < 750, < 500, < 250, oder < 100 Nukleobasen bzw. Basenpaare an Nukleotidsequenzen, die die erfindungsgemäße Promotorregion stromaufwärts (upstream) und stromabwärts (downstream) natürlicherweise flankieren.
Der Begriff „natürlich" beeinhaltet in diesem Zusammenhang auch Nukleotidsequenzen welche die erfindungsgemäßen Mutationen enthalten.
Gegenstand der Erfindung ist weiterhin ein isoliertes Polynukleotid umfassend die Kodierregion oder im Wesentlichen bestehend aus der Kodierregion des amtR-Gens, welche für ein Polypeptid mit der Aminosäuresequenz gemäß SEQ ID NO:2 oder 21 kodiert, wobei anstelle des ATG Startkodons ein GTG oder TTG Startkodon verwendet wird.
Gegenstand der Erfindung ist schließlich ein isoliertes Polynukleotid kodierend für einen AmtR-Regulator, dessen
Aminosäuresequenz zu mindestens 85% oder zu mindestens 90%, bevorzugt zu mindestens 95%, besonders bevorzugt zu mindestens 98% oder zu mindestens 99% und ganz besonders bevorzugt identisch ist mit der Aminosäuresequenz von SEQ ID NO : 2 und im Wesentlichen eine Länge von 222 Aminosäuren, bevorzugt eine Länge von 222 Aminosäuren, umfasst oder besitzt und einen (1) oder mehrere, bevorzugt maximal 3, besonders bevorzugt maximal 2 der erfindungsgemäßen Aminosäureaustausche, das heißt der Aminosäureaustausche an den Positionen 3, 24, 31, 32, 36, 42, 50, 53, 54, 55, 57, 58, 59 und 63, aufweist.
Bevorzugt wird ein isoliertes Polynukleotid, das für einen AmtR-Regulator kodiert, der die Aminosäuresequenz von SEQ ID NO:2 umfasst oder besitzt und der einen (1) oder mehrere, bevorzugt maximal 3, besonders bevorzugt maximal 2 der erfindungsgemäßen Aminosäureaustausche, das heißt der Aminosäureaustausche an den Positionen 3, 24, 31, 32, 36, 42, 50, 53, 54, 55, 57, 58, 59 und 63, aufweist. Gegebenenfalls enthält die Aminosäuresequenz darüber hinaus maximal 3, bevorzugt maximal 2 besonders bevorzugt maximal (einen) konservative (n) Aminosäureaustausch (e) . Bevorzugt wird weiterhin ein isoliertes Polynukleotid, das für einen AmtR-Regulator kodiert, der die Aminosäuresequenz von SEQ ID NO: 11 umfasst oder besitzt und der einen (1) oder mehrere, bevorzugt maximal 3, besonders bevorzugt maximal 2 der erfindungsgemäßen Aminosäureaustausche, das heißt der Aminosäureaustausche an den Positionen 3, 24, 31, 32, 36, 42, 50, 53, 54, 55, 57, 58, 59 und 63, aufweist. Gegebenenfalls enthält die Aminosäuresequenz darüber hinaus maximal 3, bevorzugt maximal 2 besonders bevorzugt maximal (einen) konservative (n) Aminosäureaustausch (e) .
Bevorzugt wird schließlich ein isoliertes Polynukleotid, das für einen AmtR-Regulator kodiert, der die Aminosäuresequenz von SEQ ID NO: 21 umfasst oder besitzt und der einen (1) oder mehrere, bevorzugt maximal 3, besonders bevorzugt maximal 2 der erfindungsgemäßen
Aminosäureaustausche, das heißt der Aminosäureaustausche an den Positionen 3, 24, 31, 32, 36, 42, 50, 53, 54, 55, 57, 58, 59 und 63, aufweist. Gegebenenfalls enthält die Aminosäuresequenz bevorzugt maximal (einen) konservative (n) Aminosäureaustausch (e) .
Ein Beispiel für einen konservativen Aminosäureaustausch ist der Austausch des Valin an Position 141 der Aminosäuresequenz gegen Isoleucin.
Besonders bevorzugt wird ein isoliertes Polynukleotid, das für einen AmtR-Regulator mit der Aminosäuresequenz von SEQ ID NO : 2 , kodiert, wobei das Glycin an Position 3 gegen eine andere proteinogene Aminosäure, bevorzugt L-Glutaminsäure oder L-Asparaginsäure, besonders bevorzugt L-Glutaminsäure, ausgetauscht wird. Die Aminsäuresequenz der Variante des AmtR-Polypeptids welche L-Glutaminsäure an Position 3 enthält ist in SEQ ID NO: 6 und 8 dargestellt.
Besonders bevorzugt wird weiterhin ein isoliertes Polynukleotid, das für einen AmtR-Regulator mit der Aminosäuresequenz von SEQ ID NO: 2, kodiert, wobei das Glycin an Position 36 gegen eine andere proteinogene
Aminosäure, bevorzugt L-Histidin, L-Glutaminsäure oder L- Asparaginsäure, ganz besonders bevorzugt L-Asparaginsäure, ausgetauscht wird.
Gegenstand der Erfindung ist weiterhin ein isoliertes Polynukleotid, welches die Nukleotidsequenz gemäß SEQ ID NO:5 oder 7 umfasst oder besitzt.
Gegenstand der Erfindung ist schließlich ein isoliertes Polynukleotid kodierend für mindestens einen Teil der Aminosäuresequenz des AmtR-Polypeptids, der ≥ (mindestens) 5, > 10, > 20, > 40, > 80 oder > 100 Aminosäuren umfasst und der mindestens einen erfindungsgemäßen
Aminosäureaustausch im AmtR-Polypeptid enthält, wobei die zum erfindungsgemäßen Aminosäureaustausch führende Mutation im Polynukleotid von Nukleotidsequenzen mit einer Länge von < (maximal) 5000, < 4000, < 3000, < 2000, < 1000, < 750, < 500, ≤ 250, oder ≤ 100 Nukleobasen bzw. Basenpaaren stromaufwärts (upstream) und stromabwärts (downstream) flankiert wird, die in coryneformen Bakterien natürlicherweise vorkommt.
So enthält beispielsweise ein Polynukleotid mit der Nukleotidsequenz von Position 500 bis 1510 von SEQ ID NO: 8 einen Teil der Kodierregion des amtR-Gens, der für eine Aminosäuresequenz mit einer Länge von 170 Aminosäuren kodiert, wobei diese den erfindungsgemäßen Aminosäureaustausch an Position 3 des AmtR-Polypeptids aufweist, und eine Nukleotidsequenz mit einer Länge von mindestens 500 Nukleobasen stromaufwärts und stromabwärts der zum Aminosäureaustausch führenden Mutation, wie sie natürlicherweise in Corynebacterium glutamicum vorkommt.
Gegenstand der Erfindung sind auch Vektoren, welche die erfindungsgemäßen Polynukleotide enthalten.
Gegenstand der Erfindung sind schließlich auch Zellen von Mikroorganismen, insbesondere von Bakterien, bevorzugt der Gattung Corynebacterium und Escherichia, besonders bevorzugt der Art Corynebacterium glutamicum und Escherichia coli, die die genannten Polynukleotide oder Vektoren enthalten oder unter Verwendung der genannten Polynukleotide oder Vektoren hergestellt wurden.
Zur Herstellung der erfindungsgemäßen Polynukleotide können klassische in-vivo Mutageneseverfahren mit Zellpopulationen von Bakterien der Gattung Corynebacterium unter Verwendung mutagener Stoffe wie beispielsweise N-Methyl-N ' -Nitro-N- Nitrosoguanidin (MNNG) oder von ultraviolettem Licht verwendet werden. Anschließend wird aus den Mutanten DNA bereitgestellt, beziehungsweise isoliert und mit Hilfe der Polymerase-Kettenreaktion (PCR) unter Verwendung von
Primerpaaren, die die Amplifizierung des amtR-Gens bzw. amtR-Allels erlauben, das entsprechende Polynukleotid synthetisiert und isoliert. Hierzu können beliebige Primerpaare aus der stromaufwärts und stromabwärts der Kodierregion gelegenen Nukleotidsequenz und der dazu komplementären Nukleotidsequenz ausgewählt werden
Anleitungen und Informationen zur PCR findet der Fachmann beispielsweise im Handbuch „PCR-Strategies" (Innis, Feifand und Sninsky, Academic Press, Inc., 1995), im Handbuch von Diefenbach und Dveksler „PCR Primer - a laboratory manual" (CoId Spring Harbor Laboratory Press, 1995), im Handbuch von Gait „Oligonukleotide synthesis: A Practical Approach" (IRL Press, Oxford, UK, 1984) und bei Newton und Graham „PCR" (Spektrum Akademischer Verlag, Heidelberg, Deutschland, 1994) . Weitere Anleitungen zur PCR finden sich beispielsweise in der WO 06/100177 auf Seiten 15 bis 17.
In einem weiteren Arbeitschritt wird dann die Nukleotidsequenz des Polynukleotids bestimmt. Diese kann beispielsweise nach dem Kettenabbruchverfahren von Sanger et al . (Proceedings of the National Academies of Sciences, U. S. A., 74, 5463-5467 (1977)) mit den von Zimmermann et al . (Nucleic Acids Research 18, 1067 (1990)) angegebenen Modifikationen bestimmt werden.
Das von dieser Nukleotidsequenz kodierte Polypeptid kann dann bezüglich der Aminosäuresequenz analysiert werden. Dazu wird die Nukleotidsequenz in ein Programm zur Übersetzung von DNA-Sequenz in eine Aminosäuresequenz eingegeben. Geeignete Programme sind beispielsweise das Programm „Patentin", das bei Patentämtern, beispielsweise dem US-Patentamt (USPTO) erhältlich ist, oder das „Translate Tool", das auf dem ExPASy Proteomics Server im World Wide Web (Gasteiger et al . , Nucleic Acids Research 31, 3784-3788 (2003)) verfügbar ist.
Es ist ebenfalls möglich das erfindungsgemäße Polynukleotid bzw. amtR-Allel, durch Methoden der in-vitro Genetik herzustellen .
Geeignete Methoden für die in-vitro Mutagenese sind unter anderem die Behandlung mit Hydroxylamin nach Miller (Miller, J. H.: A Short Course in Bacterial Genetics. A Laboratory Manual and Handbook for Escherichia coli and Related Bacteria, CoId Spring Harbor Laboratory Press, CoId Spring Harbor, 1992) oder der Einsatz einer
Polymerasekettenreaktion unter Verwendung einer DNA- Polymerase, die eine hohe Fehlerquote aufweist. Eine derartige DNA-Polymerase ist beispielsweise die Mutazyme DNA Polymerase (GeneMorph PCR Mutagenesis Kit, Nr.600550) der Firma Stratagene (LaJoIIa, CA, USA) . Weiterhin können mutagene Oligonukleotide, wie bei T. A. Brown (Gentechnologie für Einsteiger, Spektrum Akademischer Verlag, Heidelberg, 1993) und R. M. Horton (PCR-Mediated Recombination and Mutagenesis, Molecular Biotechnology 3, 93-99 (1995)) beschrieben, eingesetzt werden. Die von
Papworth et al . (Strategies 9(3), 3-4 (1996)) beschriebene Methode unter Verwendung des "Quik Change Site-directed Mutagenesis Kit" der Firma Stratagene (La Jolla, California, USA) kann ebenfalls eingesetzt werden.
Die auf diese Weise hergestellten Polynukleotide, können dazu verwendet werden, um rekombinante Stämme der Gattung Corynebacterium, bevorzugt Corynebacterium glutamicum herzustellen, die die erfindungsgemäßen Varianten des AmtR- Regulators enthalten und/oder die erfindungsgemäßen Modifikationen im Promotorbereich des amtR-Gens enthalten und die im Vergleich zum Ausgangs- beziehungsweise Elternstamm in erhöhtem Umfang L-Aminosäuren in das sie umgebende Medium abgeben und/oder im Zellinneren anhäufen.
Eine verbreitete Methode zum Einbau von Mutationen in Gene von Bakterien der Gattung Corynebacterium, insbesondere der Art Corynebacterium glutamicum, ist die des
Allelaustausches, die auch unter der Bezeichnung „gene replacement" bekannt ist. Bei diesem Verfahren wird ein DNA-Fragment, welches die interessierende Mutation enthält, in den gewünschten Stamm überführt und die Mutation durch wenigstens zwei Rekombinationsereignisse beziehungsweise „cross over"-Ereignisse in das Chromosom des gewünschten Stammes inkorporiert beziehungsweise die im betreffenden Stamm vorhandene Sequenz eines Gens gegen die mutierte Sequenz ausgetauscht.
Das DNA-Fragment, enthaltend die interessierende Mutation, liegt bei dieser Methode typischerweise in einem Vektor, insbesondere einem Plasmid, vor, das vorzugsweise von dem mit der Mutation zu versehenden Stamm nicht oder nur begrenzt, d. h. unter ausgewählten Kulturbedingungen, repliziert wird. Als Hilfs- oder Zwischenwirt, in dem der Vektor replizierbar ist, wird im Allgemeinen ein Bakterium der Gattung Escherichia, bevorzugt der Spezies Escherichia coli verwendet.
Beispiele für derartige Plasmidvektoren sind die von Schäfer et al . (Gene 145, 69-73 (1994)) beschriebenen pK*mob und pK*mobsacB Vektoren, wie beispielsweise pKlδmobsacB, und die in der WO 02/070685 und WO 03/014362 beschriebenen Vektoren. Diese sind in Escherichia coli aber nicht in Corynebacterium replikativ. Besonders geeignet sind Vektoren, die ein konditional negativ dominant wirkendes Gen wie beispielsweise das sacB-Gen (Levansucrase-Gen) von beispielsweise Bacillus oder das galK-Gen (Galaktosekinase-Gen) von beispielsweise Escherichia coli enthalten. Unter einem konditional negativ dominant wirkenden Gen versteht man ein Gen, das unter bestimmten Bedingungen nachteilig beispielsweise toxisch für den Wirt ist, unter anderen Bedingungen aber keine negativen Auswirkungen auf den das Gen tragenden Wirt hat. Diese ermöglichen die Selektion auf
Rekombinationsereignisse, bei denen der Vektor aus dem Chromosom eliminiert wird.
Weiterhin wurde von Nakamura et al . (US 6,303,383) ein Temperatur-sensitives Plasmid für Corynebacterium beschrieben, das lediglich bei Temperaturen unterhalb von 31°C replizieren kann. Es kann ebenfalls für die Massnahmen der Erfindung eingesetzt werden.
Der Vektor wird anschließend durch Konjugation beispielsweise nach der Methode von Schäfer (Journal of Bacteriology 172, 1663-1666 (1990)) oder Transformation beispielsweise nach der Methode von Dunican und Shivnan (Bio/Technology 7, 1067-1070 (1989)) in das Corynebacterium überführt. Gegebenenfalls kann die Überführung der DNA auch durch ballistische Methoden (z. B. Partikelbeschuss) erzielt werden.
Nach homologer Rekombination mittels eines ersten, Integration bewirkenden "cross-over"-Ereignisses und eines geeigneten zweiten, eine Exzision bewirkenden "cross-over"- Ereignisses im Zielgen bzw. in der Zielsequenz erreicht man den Einbau der Mutation und erhält ein rekombinantes Bakterium. Als Zielgen bezeichnet man das Gen, in dem der gewünschte Austausch erfolgen soll.
Zur Identifizierung und Charakterisierung der erhaltenen Stämme können unter anderem die Methoden der Southern Blotting Hybridisierung, der Polymerase-Kettenreaktion, der Sequenzbestimmung, die Methode des „Fluorescence Resonance Energy Transfer" (FRET) (Lay et al . Clinical Chemistry 43, 2262-2267 (1997)) oder Methoden der Enzymologie eingesetzt werden .
Von Schwarzer und Pühler (Bio/Technology 9, 84-87 (1991)) wurde diese Methode verwendet, um ein lysA-Allel, welches eine Deletion trug, und um ein lysA-Allel, welches eine Insertion trug, in das Chromosom von C. glutamicum anstelle des Wildtypgens einzubauen. Von Nakagawa et al . (EP 1108790) und Ohnishi et al . (Applied Microbiology and Biotechnology 58(2), 217-223 (2002)) wurde diese Methode eingesetzt, um verschiedene Mutationen ausgehend von den isolierten Allelen bzw. Polynukleotiden in das Chromosom von C. glutamicum einzubauen.
So kann beispielsweise für den Einbau der Mutation, die zum Aminosäureaustausch des Glycins gegen L-Glutaminsäure an Position 3 von SEQ ID NO:2 führt, bevorzugt wie in SEQ ID NO: 6 und 8 dargestellt, ein Polynukleotid bzw. DNA-Fragment verwendet werden, das mindestens die Nukleotidsequenz von Position 958 bis 1058 von SEQ ID NO: 8 umfasst. Dieses DNA- Fragment enthält die erfindungsgemäße Mutation und stromaufwärts und stromabwärts davon eine Nukleotidsequenz mit einer Länge von jeweils mindestens 50 Nukleobasen.
Bevorzugt werden DNA-Fragmente die stromaufwärts und stromabwärts der Mutation eine Nukleotidsequenz mit einer Länge von jeweils mindestens ca. 100, besonders bevorzugt jeweils mindestens ca. 250 Nukleobasen und ganz besonders bevorzugt jeweils mindestens ca. 500 Nukleobasen besitzen. Die maximale Länge der stromaufwärts und stromabwärts der Mutation gelegenen Nukleotidsequenz liegt im Allgemeinen bei ca. 500, ca. 750, ca. 1000, ca. 1500, ca. 2000, ca. 3000, ca. 4000 oder 5000 Nukleobasen. Die Gesamtlänge des für den Allelaustausch eingesetzten Polynukleotids beträgt dementsprechend maximal ca. 1000, maximal ca. 1500, maximal ca. 2000, maximal ca. 3000, maximal ca. 4000, maximal ca. 6000, maximal ca. 8000 oder 10000 Nukleobasen.
Die Leistung der erfindungsgemäßen Bakterien der Gattung Corynebacterium bzw. des Fermentationsprozesses unter Verwendung derselben bezüglich eines oder mehrerer der Parameter ausgewählt aus der Gruppe der L-Aminosäure- Konzentration (gebildete L-Aminosäure pro Volumen) , der L- Aminosäure-Ausbeute (gebildete L-Aminosäure pro verbrauchter Kohlenstoff-Quelle) , der L-Aminosäure-Bildung (gebildete L-Aminosäure pro Volumen und Zeit) und der spezifischen L-Aminosäure-Bildung (gebildete L-Aminosäure pro Zelltrockenmasse bzw. Biotrockenmasse und Zeit oder gebildete L-Aminosäure pro Zellprotein und Zeit) oder auch anderer Prozess-Parameter und Kombinationen davon, wird um mindestens 0,5%, mindestens 1%, mindestens 1,5% oder mindestens 2% bezogen auf den Ausgangstamm bzw. Elternstamm bzw. den Fermentationsprozess unter Verwendung derselben erhöht .
Die erfindungsgemäß hergestellten Bakterien der Gattung Corynebacterium können kontinuierlich - wie beispielsweise in der WO 05/021772 beschrieben- oder diskontinuierlich im batch - Verfahren (Satzkultivierung bzw. Satzverfahren) oder im fed batch (Zulaufverfahren) oder repeated fed batch Verfahren (repetitives Zulaufverfahren) zum Zwecke der Produktion der gewünschten L-Aminosäuren kultiviert werden. Eine Zusammenfassung allgemeiner Art über bekannte Kultivierungsmethoden ist im Lehrbuch von Chmiel (Bioprozesstechnik 1. Einführung in die
Bioverfahrenstechnik (Gustav Fischer Verlag, Stuttgart, 1991)) oder im Lehrbuch von Storhas (Bioreaktoren und periphere Einrichtungen (Vieweg Verlag, Braunschweig/Wiesbaden, 1994)) verfügbar.
Das zu verwendende Kulturmedium beziehungsweise Fermentationsmedium muß in geeigneter Weise den Ansprüchen der jeweiligen Stämme genügen. Beschreibungen von Kulturmedien verschiedener Mikroorganismen sind im Handbuch „Manual of Methods for General Bacteriology,, der American Society for Bacteriology (Washington D. C, USA, 1981) enthalten. Die Begriffe Kulturmedium und
Fermentationsmedium beziehungsweise Medium sind gegenseitig austauschbar .
Als Kohlenstoffquelle können Zucker und Kohlehydrate wie z.B. Glucose, Saccharose, Lactose, Fructose, Maltose, Melasse, Saccharose-haltige Lösungen aus der Zuckerrübenoder Zuckerrohrherstellung, Stärke, Stärkehydrolysat und Cellulose, Öle und Fette, wie zum Beispiel Sojaöl, Sonnenblumenöl, Erdnußöl und Kokosfett, Fettsäuren, wie zum Beispiel Palmitinsäure, Stearinsäure und Linolsäure, Alkohole wie zum Beispiel Glycerin, Methanol und Ethanol und organische Säuren, wie zum Beispiel Essigsäure oder Milchsäure verwendet werden.
Als Stickstoffquelle können organische Stickstoff-haltige Verbindungen wie Peptone, Hefeextrakt, Fleischextrakt, Malzextrakt, Maisquellwasser, Sojabohnenmehl und Harnstoff oder anorganische Verbindungen wie Ammoniumsulfat, Ammoniumchlorid, Ammoniumphosphat, Ammoniumcarbonat und Ammoniumnitrat verwendet werden. Die Stickstoffquellen können einzeln oder als Mischung verwendet werden.
Als Phosphorquelle können Phosphorsäure,
Kaliumdihydrogenphosphat oder Dikaliumhydrogenphosphat oder die entsprechenden Natrium-haltigen Salze verwendet werden.
Das Kulturmedium muß weiterhin Salze beispielsweise in Form von Chloriden oder Sulfaten von Metallen wie beispielsweise Natrium, Kalium, Magnesium, Calcium und Eisen enthalten, wie zum Beispiel Magnesiumsulfat oder Eisensulfat, die für das Wachstum notwendig sind. Schließlich können essentielle Wuchsstoffe wie Aminosäuren beispielsweise Homoserin und Vitamine beispielsweise Thiamin, Biotin oder Pantothensäure zusätzlich zu den oben genannten Stoffen eingesetzt werden.
Die genannten Einsatzstoffe können zur Kultur in Form eines einmaligen Ansatzes hinzugegeben oder in geeigneter Weise während der Kultivierung zugefüttert werden.
Zur pH-Kontrolle der Kultur werden basische Verbindungen wie Natriumhydroxid, Kaliumhydroxid, Ammoniak beziehungsweise Ammoniakwasser oder saure Verbindungen wie Phosphorsäure oder Schwefelsäure in geeigneter Weise eingesetzt. Der pH wird im Allgemeinen auf einen Wert von 6,0 bis 8,5 vorzugsweise 6,5 bis 8 eingestellt. Zur Kontrolle der Schaumentwicklung können Antischaummittel, wie zum Beispiel Fettsäurepolyglykolester eingesetzt werden. Zur Aufrechterhaltung der Stabilität von Plasmiden können dem Medium geeignete, selektiv wirkende Stoffe, wie zum Beispiel Antibiotika hinzugefügt werden. Um aerobe Bedingungen aufrechtzuerhalten, werden Sauerstoff oder
Sauerstoff-haltige Gasmischungen, wie zum Beispiel Luft in die Kultur eingetragen. Die Verwendung von Flüssigkeiten, die mit Wasserstoffperoxid angereichert sind, ist ebenfalls möglich. Gegebenenfalls wird die Fermentation bei Überdruck, beispielsweise bei einem Überdruck von 0,03 bis 0,2 MPa, gefahren. Die Temperatur der Kultur liegt normalerweise bei 200C bis 45°C und vorzugsweise bei 25°C bis 400C, besonders bevorzugt bei 30° bis 37°C. Bei batch- Verfahren wird die Kultivierung solange fortgesetzt, bis sich ein Maximum der gewünschten L-Aminosäure, gebildet hat. Dieses Ziel wird normalerweise innerhalb von 10
Stunden bis 160 Stunden erreicht. Bei kontinuierlichen Verfahren sind längere Kultivierungszeiten möglich. Durch die Tätigkeit der Bakterien kommt es zu einer Anreicherung (Akkumulation) der L-Aminosäure im Fermentationsmedium und/oder in den Bakterienzellen.
Beispiele für geeignete Fermentationsmedien finden sich unter anderem in den Patentschriften 5,770,409, US 5,840,551 und US 5,990,350 oder US 5,275,940.
Die Analyse von L-Aminosäuren zur Bestimmung der Konzentration zu einem oder mehreren Zeitpunkt (en) im Verlauf der Fermentation kann durch Trennung der L- Aminosäuren mittels Ionenaustauschchromatographie vorzugsweise Kationenaustauschchromatographie mit anschließender Nachsäulenderivatisierung unter Verwendung von Ninhydrin erfolgen, so wie bei Spackman et al .
(Analytical Chemistry 30: 1190-1206 (1958)) beschrieben. Anstelle von Ninhydrin kann auch ortho-Phtaldialdehyd zur Nachsäulenderivatisierung eingesetzt werden. Einen Übersichtsartikel zur Ionenaustauschchromatographie findet man bei Pickering (LC-GC (Magazine of Chromatographie Science) 7(6), 484-487 (1989)) .
Es ist ebenfalls möglich eine Vorsäulenderivatisierung beispielsweise unter Verwendung von ortho-Phtaldialdehyd oder Phenylisothiocyanat vorzunehmen und die entstandenen Aminosäurederivate durch Reversed-Phase-Chromatographie (RP) vorzugsweise in Form der Hochleistungsflüssigkeits- chromatographie (HPLC) aufzutrennen. Eine derartige Methode ist beispielsweise bei Lindroth et al . (Analytical Chemistry 51: 1167-1174 (1979)) beschrieben.
Die Detektion erfolgt photometrisch (Absorption, Fluoreszenz) .
Eine zusammenfassende Darstellung zur Aminosäureanalyse findet man unter anderem im Lehrbuch „Bioanalytik" von Lottspeich und Zorbas (Spektrum Akademischer Verlag, Heidelberg, Deutschland 1998) .
Gegenstand der Erfindung ist dementsprechend auch ein Verfahren zur Herstellung von L-Aminosäuren, bevorzugt L-
Lysin, L-Glutaminsäure, L-Glutamin, L-Arginin, L-Prolin und L-Ornithin, besonders bevorzugt L-Lysin, dadurch gekennzeichnet, dass man folgende Schritte durchführt: a) Fermentation der erfindungsgemäßen coryneformen Bakterien, bevorzugt der Gattung Corynebacterium, besonders bevorzugt der Art Corynebacterium glutamicum, in einem geeignetem Nährmedium, und
b) Akkumulation der L-Aminosäure in dem Nährmedium und/oder in den Zellen der genannten Bakterien.
Anschließend erfolgt die Bereitstellung bzw. Herstellung oder Gewinnung eines L-Aminosäure haltigen Produktes in flüssiger oder fester Form.
Durch die Maßnahmen der Fermentation erhält man eine Fermentationsbrühe, welche die gewünschte L-Aminosäure enthält.
Unter einer Fermentationsbrühe versteht man ein Fermentationsmedium bzw. Nährmedium, in dem ein Mikroorganismus für eine gewisse Zeit und bei einer gewissen Temperatur kultiviert wurde. Das Fermentationsmedium beziehungsweise die während der Fermentation eingesetzten Medien enthält/enthalten sämtliche Substanzen beziehungsweise Komponenten, die eine Vermehrung des Mikroorganismus und eine Bildung der gewünschten L-Aminosäure sicherstellen. Bei Abschluss der Fermentation enthält die entstandene Fermentationsbrühe dementsprechend
a) die infolge der Vermehrung der Zellen des Mikroorganismus entstandene Biomasse (Zellmasse) des Mikroorganismus,
b) die im Laufe der Fermentation gebildete L-Aminosäure,
c) die im Laufe der Fermentation gebildeten organischen Nebenprodukte, und
d) die durch die Fermentation nicht verbrauchten Bestandteile des eingesetzten Fermentationsmediums beziehungsweise der Einsatzstoffe wie beispielsweise Vitamine wie Biotin oder Salze wie Magnesiumsulfat.
Zu den organischen Nebenprodukten gehören Stoffe, die von den bei der Fermentation eingesetzten Mikroorganismen neben der jeweiligen L-Aminosäure erzeugt und gegebenenfalls ausgeschieden werden. Hierzu gehören auch Zucker wie zum Beispiel Trehalose.
Die Fermentationsbrühe wird dem Kulturgefäß beziehungsweise dem Fermentationsbehälter entnommen, gegebenenfalls gesammelt, und dazu verwendet, ein L-Aminosäure haltiges Produkt in flüssiger oder fester Form bereitzustellen. Hierfür wird auch der Ausdruck „Gewinnen des L-Aminosäure haltigen Produktes" verwendet. Im einfachsten Fall stellt die L-Aminosäure-haltige Fermentationsbrühe selbst das gewonnene Produkt dar.
Durch eine oder mehrere der Maßnahmen ausgewählt aus der Gruppe
a) teilweise (> 0% bis < 80%) bis vollständige (100%) oder nahezu vollständige (> 80%, > 90%, > 95%, > 96%, > 97%, > 98%, > 99%) Entfernung des Wassers,
b) teilweise (> 0% bis < 80%) bis vollständige (100%) oder nahezu vollständige (> 80%, > 90%, > 95%, > 96%, > 97%, > 98%, > 99%) Entfernung der Biomasse, wobei diese gegebenenfalls vor der Entfernung inaktiviert wird,
c) teilweise (> 0% bis < 80%) bis vollständige (100%) oder nahezu vollständige (> 80%, > 90%, > 95%, > 96%, > 97%, > 98%, > 99%, > 99,3%, > 99,7%) Entfernung der im Laufe der Fermentation gebildeten organischen Nebenprodukte, und
d) teilweise (> 0%) bis vollständige (100%) oder nahezu vollständige (> 80%, > 90%, > 95%, > 96%, > 97%, > 98%, > 99%, > 99,3%, > 99,7%) Entfernung der durch die Fermentation nicht verbrauchten Bestandteile des eingesetzten Fermentationsmediums beziehungsweise der Einsatzstoffe,
aus der Fermentationsbrühe erzielt man eine Konzentrierung bzw. Reinigung der L-Aminosäure . Auf diese Weise werden Produkte isoliert, die einen gewünschten Gehalt an L- Aminosäure aufweisen.
Die teilweise (> 0% bis < 80%) bis vollständige (100%) oder nahezu vollständige (≥ 80% bis < 100%) Entfernung des Wassers (Maßnahme a) ) wird auch als Trocknung bezeichnet.
Durch vollständige oder nahezu vollständige Entfernung des Wassers, der Biomasse, der organischen Nebenprodukte und der nicht verbrauchten Bestandteile des eingesetzten Fermentationsmediums gelangt man zu reinen ( (≥ 80 Gew.-%, ≥ 90 Gew.-%) oder hochreinen (> 95 Gew.-%, > 97 Gew.-%, > 99% Gew.-%) Produktformen der L-Aminosäuren . Für die Massnahmen gemäß a) , b) , c) oder d) sind im Stand der Technik eine Fülle von technischen Anleitungen verfügbar.
Im Falle der Aminosäure L-Lysin sind im Stand der Technik im wesentlichen vier verschiedene Produktformen bekannt.
Eine Gruppe L-Lysin-haltiger Produkte umfasst konzentrierte, wässrige, alkalische Lösungen von aufgereinigtem L-Lysin (EP-B-0534865) . Eine weitere Gruppe, wie beispielsweise in der US 6,340,486 und US 6,465,025 beschrieben, umfasst wässrige, saure, Biomasse-haltige Konzentrate von L-Lysin-haltigen Fermentationsbrühen. Die bekannteste Gruppe fester Produkte umfasst pulverförmige oder kristalline Formen von aufgereinigtem beziehungsweise reinem L-Lysin, das typischerweise in Form eines Salzes wie zum Beispiel L-Lysin-Monohydrochlorid vorliegt. Eine weitere Gruppe fester Produktformen ist beispielsweise in der EP-B-0533039 beschrieben. Die dort beschriebene Produktform enthält neben L-Lysin den größten Teil der während der fermentativen Herstellung verwendeten und nicht verbrauchten Einsatzstoffe und gegebenfalls die Biomasse des eingesetzten Mikroorganismus mit einem Anteil von >0% - 100%.
Entsprechend der verschiedenen Produktformen kennt man verschiedenste Verfahren, bei denen aus der Fermentationsbrühe das L-Lysin-haltige Produkt oder das gereinigte L-Lysin hergestellt wird.
Zur Herstellung von festem, reinen L-Lysin werden im wesentlichen Methoden der Ionenaustauschchromatographie gegebenfalls unter Verwendung von Aktivkohle und Methoden der Kristallisierung angewendet. Auf diese Weise erhält man die entsprechende Base oder ein entsprechendes Salz wie beispielsweise das Monohydrochlorid (Lys-HCl) oder das Lysinsulfat (Lys2-H2SO4) .
In der EP-B-0534865 ein Verfahren zur Herstellung wässriger, basischer L-Lysin-haltiger Lösungen aus
Fermentationsbrühen beschrieben. Bei dem dort beschriebenen Verfahren wird die Biomasse aus der Fermentationsbrühe abgetrennt und verworfen. Mittels einer Base wie beispielsweise Natrium-, Kalium- oder Ammoniumhydroxid wird ein pH-Wert zwischen 9 bis 11 eingestellt. Die mineralischen Bestandteile (anorganischen Salze) werden nach Konzentrierung und Abkühlung durch Kristallisation aus der Brühe abgetrennt und entweder als Dünger verwendet oder verworfen .
Bei Verfahren zur Herstellung von Lysin unter Verwendung der erfindungsgemäßen Bakterien werden solche Verfahren bevorzugt, bei denen Produkte erhalten werden, die Bestandteile der Fermentationsbrühe enthalten. Diese werden insbesondere als Tierfuttermitteladditive verwendet.
Je nach Anforderung kann die Biomasse ganz oder teilweise durch Separationsmethoden wie z.B. der Zentrifugation, der Filtration, dem Dekantieren oder einer Kombination hieraus aus der Fermentationsbrühe entfernt oder vollständig in ihr belassen werden. Gegebenenfalls wird die Biomasse beziehungsweise die Biomasse enthaltene Fermentationsbrühe während eines geeigneten Verfahrensschrittes inaktiviert beispielsweise durch thermische Behandlung (Erhitzen) oder durch Säurezugabe.
In einer Verfahrensweise wird die Biomasse vollständig oder nahezu vollständig entfernt, sodass keine (0 %) oder höchstens 30%, höchstens 20%, höchstens 10%, höchstens 5%, höchstens 1% oder höchstens 0,1% Biomasse im hergestellten Produkt verbleibt. In einer weiteren Verfahrensweise wird die Biomasse nicht oder nur in geringfügigen Anteilen entfernt, sodass sämtliche (100%) oder mehr als 70%, 80%, 90%, 95%, 99% oder 99,9% Biomasse im hergestellten Produkt verbleibt. In einem erfindungsgemäßen Verfahren wird dementsprechend die Biomasse in Anteilen ≥ 0% bis ≤ 100% entfernt .
Schließlich kann die nach der Fermentation erhaltene Fermentationsbrühe vor oder nach der vollständigen oder teilweisen Entfernung der Biomasse mit einer anorganischen Säure wie beispielsweise Salzsäure, Schwefelsäure oder Phosphorsäure oder organischen Säure wie beispielsweise Propionsäure auf einen sauren pH Wert gestellt werden (GB 1,439,728 oder EP 1 331 220) . Es ist gleichfalls möglich die Fermentationsbrühe mit der vollständig enthaltenen
Biomasse anzusäuern. Schließlich kann die Brühe auch durch Zusatz von Natriumbisulfit (NaHSO3, GB 1,439,728) oder einem anderen Salz beispielsweise Ammonium-, Alkali- oder Erdalkalisalz der schwefligen Säure stabilisiert werden.
Bei der Abtrennung der Biomasse werden gegebenenfalls in der Fermentationsbrühe enthaltene organische oder anorganische Feststoffe teilweise oder ganz entfernt. Die in der Fermentationsbrühe gelösten organischen Nebenprodukte und die gelösten nicht verbrauchten Bestandteile des Fermentationsmediums (Einsatzstoffe) bleiben mindestens teilweise (> 0%), bevorzugt zu mindestens 25%, besonders bevorzugt zu mindestens 50% und ganz besonders bevorzugt zu mindestens 75% im Produkt. Gegebenenfalls bleiben diese auch vollständig (100%) oder nahezu vollständig, das heißt > 95% oder > 98% oder größer 99%, im Produkt. Enthält ein Produkt in diesem Sinn mindestens einen Teil der Bestandteile der
Fermentationsbrühe, so wird dies auch mit dem Begriff „Produkt auf Fermentationsbrühebasis" umschrieben.
Anschließend wird der Brühe mit bekannten Methoden wie z.B. mit Hilfe eines Rotationsverdampfers, Dünnschichtverdampfers, Fallfilmverdampfers, durch
Umkehrosmose oder durch Nanofiltration Wasser entzogen beziehungsweise eingedickt oder konzentriert. Diese aufkonzentrierte Fermentationsbrühe kann anschließend durch Methoden der Gefriertrocknung, der Sprühtrocknung, der Sprühgranulation oder durch anderweitige Verfahren wie zum Beispiel in der zirkulierenden Wirbelschicht gemäß PCT/EP2004/006655 beschrieben, zu rieselfähigen Produkten insbesondere zu einem feinteiligen Pulver oder vorzugsweise grobkörnigem Granulat aufgearbeitet werden. Gegebenenfalls wird aus dem erhaltenen Granulat durch Sieben oder Staubabtrennung ein gewünschtes Produkt isoliert.
Es ist ebenfalls möglich, die Fermentationsbrühe direkt d. h. ohne vorherige Aufkonzentrierung durch Sprühtrocknung oder Sprühgranulation zu trocknen.
Unter „rieselfähig" versteht man Pulver, die aus einer Serie von Glasauslaufgefäßen mit verschieden großen AuslaufÖffnungen mindestens aus dem Gefäß mit der Öffnung 5 mm (Millimeter) ungehindert auslaufen (Klein: Seifen, Öle, Fette, Wachse 94, 12 (1968)) .
Mit „feinteilig" ist ein Pulver mit überwiegendem Anteil (> 50 %) einer Korngröße von 20 bis 200 μm Durchmesser gemeint . Mit „grobkörnig" ist ein Produkt mit einem überwiegendem Anteil (> 50 %) einer Korngröße von 200 bis 2000 μm Durchmesser gemeint.
Die Korngrößenbestimmung kann mit Methoden der Laserbeugungsspektrometrie durchgeführt werden. Die entsprechenden Methoden sind im Lehrbuch zur
„Teilchengrößenmessung in der Laborpraxis" von R. H. Müller und R. Schuhmann, Wissenschaftliche Verlagsgesellschaft Stuttgart (1996) oder im Lehrbuch „Introduction to Particle Technology" von M. Rhodes, Verlag Wiley & Sons (1998) beschrieben .
Das rieselfähige, feinteilige Pulver kann wiederum durch geeignete Kompaktier- oder Granulier-Verfahren in ein grobkörniges, gut rieselfähiges, lagerfähiges und weitgehend staubfreies Produkt überführt werden.
Der Begriff „staubfrei" bedeutet, daß das Produkt lediglich geringe Anteile (< 5 %) an Körngrößen unter 100 μm Durchmesser enthält.
„Lagerfähig", im Sinne dieser Erfindung, bedeutet ein Produkt, das mindestens ein (1) Jahr oder länger, bevorzugt mindestens 1,5 Jahre oder länger, besonders bevorzugt zwei (2) Jahre oder länger in trockener und kühler Umgebung gelagert werden kann, ohne dass ein wesentlicher Verlust (maximal 5%) der jeweiligen Aminosäure auftritt. Ein weiterer Gegenstand der Erfindung ist ein Verfahren, das in seinen Grundzügen in der DE 102006016158 beschrieben ist, und bei dem die unter Verwendung der erfindungsgemäßen Mikroorganismen erhaltene Fermentationsbrühe, aus der die Biomasse gegebenenfalls ganz oder teilweise abgetrennt wurde, weiterverarbeitet wird, indem man ein Verfahren durchführt das mindestens folgende Schritte umfasst:
a) den pH-Wert durch Zugabe von Schwefelsäure auf 4,0 bis 5,2, insbesondere 4,9 bis 5,1, absenkt, und ein molares SuIfat/L-Lysin-Verhältnis von 0,85 bis 1,2, bevorzugt 0,9 bis 1,0, besonders bevorzugt >0,9 bis <0,95, in der Brühe einstellt, gegebenenfalls durch Zugabe von einer weiteren oder mehreren Sulfat-haltigen Verbindung (n) und
b) das so erhaltene Gemisch durch Wasserentzug aufkonzentriert, und gegebenenfalls granuliert,
wobei gegebenenfalls vor Schritt a) eine oder beide der folgenden Massnahmen durchgeführt wird/werden:
c) Messung des molaren Verhältnisses von SuIfat/L-Lysin zur Ermittlung der benötigten Menge an Sulfat-haltigen Verbindung (n)
d) Zusatz einer Sulfat-haltigen Verbindung ausgewählt aus der Gruppe Ammoniumsulfat, Ammoniumhydrogensulfat und Schwefelsäure in entsprechenden Verhältnissen.
Gegebenenfalls wird weiterhin vor Schritt b) ein Salz der schwefligen Säure, bevorzugt Alkalihydrogensulfit, besonders bevorzugt Natriumhydrogensulfit in einer Konzentration von 0,01 bis 0,5 Gew.-%, bevorzugt 0,1 bis 0,3 Gew.-%, besonders bevorzugt 0,1 bis 0,2 Gew.-% bezogen auf die Fermentationsbrühe hinzugesetzt.
Als bevorzugte Sulfat-haltigen Verbindungen im Sinne der oben genannten Verfahrensschritte sind insbesondere Ammoniumsulfat und/oder Ammoniumhydrogensulfat oder entsprechende Mischungen von Ammoniak und Schwefelsäure und Schwefelsäure selbst zu nennen.
Das molare SuIfat/L-Lysin-Verhältnis V wird nach der
Formel: V = 2 x [SO4 2"] / [L-Lysin] berechnet. Diese Formel berücksichtigt die Tatsache, dass das SO4 2- Anion, bzw. die Schwefelsäure zweiwertig ist. Ein Verhältnis V = I bedeutet, dass ein stöchiometrisch zusammengesetztes Lys2- H2SO4) vorliegt, während bei einem Verhältnis von V = 0,9 ein 10%iger Sulfatmangel und bei einem Verhältnis von V = 1,1 ein 10% SuIfatüberschuss gefunden wird.
Vorteilhaft bei der Granulation oder Kompaktierung ist der Einsatz von üblichen organischen oder anorganischen Hilfsstoffen, beziehungsweise Trägern wie Stärke, Gelatine, Cellulosederivaten oder ähnlichen Stoffen, wie sie üblicherweise in der Lebensmittel- oder Futterverarbeitung als Binde-, Gelier-, oder Verdickungsmittel Verwendung finden, oder von weiteren Stoffen wie zum Beispiel Kieselsäuren, Silikaten (EP0743016A) Stearaten.
Weiterhin ist es vorteilhaft die Oberfläche der erhaltenen Granulate mit Ölen zu behandeln so wie es in der WO 04/054381 beschrieben ist. Als Öle können Mineralöle, pflanzliche Öle oder Mischungen pflanzlicher Öle verwendet werden. Beispiele für derartige Öle sind Sojaöl, Olivenöl, Soj aöl/Lecithingemische . In gleicher Weise sind auch Silikonöle, Polyethylenglykole oder Hydroxyethylcellulose geeignet. Durch die Behandlung der Oberflächen mit den genannten Ölen erzielt man eine erhöhte Abriebfestigkeit des Produktes und einen Verringerung des Staubanteils. Der Gehalt an Öl im Produkt beträgt 0,02 bis 2,0 Gew.-%, bevorzugt 0,02 bis 1,0 Gew.-%, und ganz besonders bevorzugt 0,2 bis 1,0 Gew.-% bezogen auf die Gesamtmenge des Futtermitteladditivs.
Bevorzugt sind Produkte mit einem Anteil von ≥ 97 Gew.-% einer Korngröße von 100 bis 1800 μm oder einem Anteil von ≥ 95 Gew.-% einer Korngröße von 300 bis 1800 μm Durchmesser. Der Anteil an Staub d. h. Partikeln mit einer Korngrösse < 100 μm liegt bevorzugt bei > 0 bis 1 Gew.-%, besonders bevorzugt bei maximal 0,5 Gew.-%.
Alternativ kann das Produkt aber auch auf einen in der Futtermittelverarbeitung bekannten und üblichen organischen oder anorganischen Trägerstoff wie zum Beispiel Kieselsäuren, Silikate, Schrote, Kleien, Mehle, Stärken, Zucker oder andere aufgezogen und/oder mit üblichen Verdickungs- oder Bindemitteln vermischt und stabilisiert werden. Anwendungsbeispiele und Verfahren hierzu sind in der Literatur (Die Mühle + Mischfuttertechnik 132 (1995) 49, Seite 817) beschrieben.
Schließlich kann das Produkt auch durch Beschichtungsverfahren („Coating") mit Filmbildnern wie beispielsweise Metallcarbonate, Kieselsäuren, Silikate, Alginate, Stearate, Stärken, Gummis und Celluloseether, wie in der DE-C-4100920 beschrieben, in einen Zustand gebracht werden, in dem es stabil gegenüber der Verdauung durch Tiermägen insbesondere dem Magen von Wiederkäuern ist.
Zur Einstellung einer gewünschten L-Lysin Konzentration im Produkt kann je nach Anforderung das L-Lysin während des Verfahrens in Form eines Konzentrates oder gegebenenfalls einer weitgehend reinen Substanz beziehungsweise dessen Salz in flüssiger oder fester Form hinzugefügt werden. Diese können einzeln oder als Mischungen zur erhaltenen oder aufkonzentrierten Fermentationsbrühe, oder auch während des Trocknungs- oder Granulationsprozesses hinzugefügt werden. Ein weiterer Gegenstand der Erfindung ist ein Verfahren zur Herstellung eines festen Lysin-haltigen Produktes, wie es in seinen Grundzügen in der US 20050220933 beschrieben ist, und das die Aufarbeitung der unter Verwendung der erfindungsgemäßen Mikroorganismen erhaltenen Fermentationsbrühe in folgenden Schritten umfasst:
a) Filtration der Fermentationsbrühe, bevorzugt mit einem Membranfilter, so dass ein Biomasse-haltiger Schlamm und ein Filtrat erhalten wird,
b) Aufkonzentration des Filtrates, bevorzugt so, dass ein Feststoffgehalt von 48 bis 52 Gew.-% erhalten wird,
c) Granulation des in Schritt b) erhaltenen Konzentrates, bevorzugt bei einer Temperatur von 500C bis 62°C, und d) Beschichtung des in c) erhaltenen Granulates mit einem oder mehreren der Beschichtungsmittel (coating agent(s))
Zur Beschichtung in Schritt d) werden bevorzugt Beschichtungsmittel verwendet, welche ausgewählt werden aus der Gruppe, bestehend aus
dl) der in Schritt a) erhaltenen Biomasse, d2) einer L-Lysin-haltigen Verbindung, bevorzugt ausgewählt aus der Gruppe L-Lysinhydrochlorid oder L- Lysinsulfat,
d3) einem im wesentlichen L-Lysin-freien Stoff mit L- Lysingehalt < 1 Gew.-%, bevorzugt < 0,5 Gew.-%, bevorzugt ausgewählt aus der Gruppe Stärke, Karageenan, Agar, Kieselsäuren, Silikate, Schrote, Kleien und Mehle, und
d4) einem wasserabstoßenden Stoff, bevorzugt ausgewählt aus der Gruppe Öle, Polyethylenglykole und flüssige Paraffine .
Durch die Massnahmen entsprechend den Schritten dl) bis d4) , insbesondere dl) bis d3) , wird der Gehalt an L-Lysin auf einen gewünschten Wert eingestellt.
Bei der Herstellung L-Lysin-haltiger Produkte wird das Verhältnis der Ionen bevorzugt so eingestellt, dass das molare Ionenverhältnis entsprechend nachstehender Formel
2x [SO4 2"] + [Cl"] - [NH4 +] - [Na+] - [K+] -2x [Mg2+] -2x [Ca2+] / [L-Lys]
0,68 bis 0,95, bevorzugt 0,68 bis 0,90, besonders bevorzugt 0,68 bis 0,86 ergibt, so wie von Kushiki et al . in der US 20030152633 beschrieben.
Im Falle des L-Lysins hat das auf diese Weise hergestellte feste Produkt auf Fermentationsbrühebasis einen Lysingehalt (als Lysinbase) von 10 Gew.-% bis 70 Gew.-% oder 20 Gew.-% bis 70 Gew.-%, bevorzugt 30 Gew.-% bis 70 Gew.-% und ganz besonders bevorzugt von 40 Gew.-% bis 70 Gew.-% bezogen auf die Trockenmasse des Produkts. Maximale Gehalte an Lysinbase von 71 Gew.-% , 72 Gew.-%, 73 Gew.-% sind ebenfalls möglich.
Der Wassergehalt des L-Lysin-haltigen, festen Produktes beträgt bis zu 5 Gew.-%, bevorzugt bis zu 4 Gew.-%, und besonders bevorzugt weniger als 3 Gew.-%.

Claims

Patentansprüche
1. Rekombinantes, L-Aminosäure ausscheidendes, coryneformes Bakterium bei dem das amtR-Gen, das für einen AmtR-Regulator kodiert, dessen Aminosäuresequenz mindestens 90% identisch ist mit der Aminosäuresequenz von SEQ ID NO : 2 und im Wesentlichen eine Länge von 222 Aminosäuren umfasst, abgeschwächt worden ist, durch eine oder mehrere der Maßnahmen ausgewählt aus der Gruppe a) Substitution der Nukleobase Guanin an Position 7 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5 durch Thymin,
b) Substitution der Nukleobase Cytosin an Position 11 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5 durch Guanin,
c) Substitution der Nukleobase Thymin an Position 40 der Promoterregion des amtR-gen gemäß SEQ ID NO: 5 durch Guanin,
d) Substitution der Nukleobase Thymin an Position 45 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5 durch Guanin,
e) Deletion einer oder mehrerer der Nukleobasen von Position 40 bis 45, bevorzugt Deletion sämtlicher Nukleobasen von Position 40 bis 45, der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5, f) Deletion einer oder mehrerer der Nukleobasen zwischen Position 72 und 78 der Promotorregion des amtR-Gens gemäß SEQ ID NO: 5, g) Substitution einer mehrerer der Nukleobasen Adenin oder Guanin zwischen Position 72 und 78 der
Promotorregion des amtR-Gens gemäß SEQ ID NO: 5 gegen Thymin oder Cytosin, h) Austausch des ATG Startkodons an Position 1 bis 3 der Kodierregion des amtR-Gens gegen ein GTG oder TTG Startkodon,
i) Austausch des Glycin an Position 3 der Aminosäuresequenz gegen eine andere proteinogene L-
Aminosäure,
j) Austausch des L-Isoleucin an Position 24 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Asparagin, L-Glutamin, L- Glutaminsäure und L-Asparaginsäure, bevorzugt L-
Asparaginsäure,
k) Austausch des L-Leucin an Position 31 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Prolin, L-Asparagin, L-Glutamin, L-Phenylalanin, L-Tyrosin, L-Tryptophan, L-
Glutaminsäure und L-Asparaginsäure, bevorzugt L- Prolin,
1) Austausch des L-Phenylalanin an Position 32 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe Glycin, L-Glutaminsäure , L-
Asparaginsäure, L-Prolin und L-Cystein, bevorzugt L-Prolin,
m) Austausch des Glycin an Position 36 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Glutaminsäure , L-Asparaginsäure,
L-Isoleucin, L-Histidin und L-Phenylalanin, bevorzugt L-Histidin, L-Glutaminsäure oder L- Asparaginsäure,
n) Austausch des L-Threonin an Position 42 der Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Prolin, L-Isoleucin, L-Methionin, L-Glutamin, L-Tryptophan, L-Glutaminsäure und L- Asparaginsäure, bevorzugt L-Glutaminsäure,
o) Austausch des Glycin an Position 50 der Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Glutaminsäure, L-Asparaginsäure, L-Isoleucin, L-Histidin, L-Tryptophan und L- Phenylalanin, bevorzugt L-Tryptophan,
p) Austausch des L-Glutamin an Position 53 der Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Cystein, L-Methionin, L-Tyrosin, L-Tryptophan und L-Phenylalanin, bevorzugt L- Phenyl alanin,
q) Austausch des L-Alanin an Position 54 der Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Phenylalanin, L-Isoleucin, L- Tryptophan, L-Tyrosin, L-Histidin, L-Glutaminsäure und L-Asparaginsäure, bevorzugt L-Histidin,
r) Austausch des L-Serin an Position 55 der Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Prolin, L-Phenylalanin, L- Tryptophan, L-Lysin, L-Arginin, L-Glutaminsäure und L-Asparaginsäure, bevorzugt L-Phenylalanin,
s) Austausch des L-Tyrosin an Position 57 der Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Prolin, Glycin, L-Methionin, L- Glutaminsäure und L-Asparaginsäure, bevorzugt L- Asparaginsäure,
t) Austausch des L-Tyrosin an Position 58 der Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Prolin, L-Methionin und L-Cystein, bevorzugt L-Prolin,
u) Austausch des L-Histidin an Position 59 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Lysin, L-Asparaginsäure, L-
Isoleucin, L-Prolin und Glycin, bevorzugt L-Prolin, und
v) Austausch des L-Lysin an Position 63 der
Aminosäuresequenz gegen eine Aminosäure ausgewählt aus der Gruppe L-Alanin, L-Glutaminsäure, L- Asparaginsäure, L-Asparagin, L-Tyrosin und L- Tryptophan, bevorzugt L-Asparagin.
2. Bakterium gemäß Anspruch 1, dadurch gekennzeichnet, dass die Aminosäuresequenz des AmtR-Regulators eine Länge von 222 oder 223 Aminosäuren umfasst.
3. Bakterium gemäß Anspruch 2, dadurch gekennzeichnet, dass die Aminosäuresequenz des AmtR-Regulators die Sequenz von SEQ ID NO:2, SEQ ID NO:21 oder SEQ ID NO: 11 umfasst.
4. Bakterium gemäß einem oder mehreren der Ansprüche 1 bis 3, dadurch gekennzeichnet, dass die Abschwächung durch eine oder mehrere der Maßnahmen von Anspruch 1 a) bis 1 g) erzielt wird, oder durch die Maßnahmen von Anspruch 1 h) erzielt wird, oder
durch eine oder mehrere der Maßnahmen von Anspruch 1 i) bis 1 v) .
5. Bakterium gemäß Anspruch 4, dadurch gekennzeichnet, dass die Abschwächung durch die Maßnahme von Anspruch 1 i) oder Anspruch 1 m) erzielt wird.
6. Bakterium gemäß Anspruch 5, dadurch gekennzeichnet, dass das Glycin an Position 3 gegen L-Glutaminsäure oder L-Asparaginsäure, bevorzugt
gegen L-Glutaminsäure ausgetauscht wird.
7. Bakterium gemäß Anspruch 6, dadurch gekennzeichnet, das der Austausch des Glycin an Position 3 von SEQ ID NO: 2 gegen L-Glutaminsäure durch den Austausch der Nukleobase Guanin an Position 8 von SEQ ID NO: 1 gegen Adenin erzielt wird.
8. Bakterium gemäß einem der Ansprüche 1 bis 7, dadurch gekennzeichnet, dass das L-Aminosäure ausscheidendem Bakterium L-Lysin, L-Glutaminsäure, L-Glutamin, L-Arginin, L-Prolin oder L-Ornithin, bevorzugt
L-Lysin ausscheidet.
9. Bakterium gemäß Ansprüche 8, dadurch gekennzeichnet, dass das Bakterium im Falle eines
L-Lysin ausscheidenden Bakteriums ein Polynukleotid enthält, das für ein Polypeptid mit Aspartatkinase- Aktivität kodiert, welche im Vergleich zum Wildtyp gegenüber der Hemmung durch Lysin und Threonin desensibilisiert ist.
10. Bakterium gemäß Anspruch 9, dadurch gekennzeichnet, dass das Polynukleotid, das für ein Polypeptid mit Aspartatkinase-Aktivität kodiert, überexprimiert wird.
11. Bakterium gemäß einem der Ansprüche 8-10, dadurch gekennzeichnet, dass das Bakterium im Falle eines L-Lysin ausscheidenden Bakteriums zusätzlich eines oder mehrere der Merkmale ausgewählt aus der folgenden Gruppe besitzt:
a) überexprimiertes Polynukleotid, das für eine Dihydrodipicolinat-Synthase (DapA) kodiert,
b) überexprimiertes Polynukleotid, das für eine Aspartatsemialdehyd-Dehydrogenase (Asd) kodiert,
c) überexprimiertes Polynukleotid, das für eine meso-Diaminopimelat-Dehydrogenase (Ddh) kodiert,
d) überexprimiertes Polynukleotid, das für eine Diaminopimelat-Decarboxylase (LysA) kodiert,
e) überexprimiertes Polynukleotid, das für eine Aspartat-Aminotransferase (Aat) kodiert,
f ) überexprimiertes Polynukleotid, das für ein
Polypeptid mit L-Lysin-Export Aktivität (LysE) kodiert, g) überexprimiertes Polynukleotid, das für eine Pyruvat-Carboxylase (Pyc) kodiert, und
h) überexprimiertes Polynukleotid, das für eine Dihydrodipicolinat-Reduktase (DapB) kodiert.
12. Bakterium gemäß einem der Ansprüche 1 bis 11, dadurch gekennzeichnet, dass es sich bei dem coryneformen Bakterium um ein Bakterium der Gattung Corynebacterium, bevorzugt
um ein Bakterium der Art Corynebacterium glutamicum handelt.
13. Verfahren zur fermentativen Herstellung von L- Aminosäuren, dadurch gekennzeichnet, dass man folgende Schritte durchführt,
a) Fermentation eines Bakteriums gemäß einem der Ansprüche 1 bis 12 in einem Nährmedium, und
b) Akkumulation der L- Aminosäure in dem Nährmedium und/oder in den Zellen der genannten Bakterien.
14. Verfahren nach Anspruch 13 dadurch gekennzeichnet, dass es sich um ein Verfahren ausgewählt aus der Gruppe Satzverfahren, Zulaufverfahren und kontinuierliches Verfahren handelt.
15. Verfahren nach einem der Ansprüche 13 oder 14 dadurch gekennzeichnet, dass es sich bei der L- Aminosäure um L-Lysin handelt.
16. Verfahren nach einem der Ansprüche 13 - 15, dadurch gekennzeichnet, dass man ein L-Aminosäure haltiges Produkt gewinnt.
17. Verfahren nach Anspruch 16, dadurch gekennzeichnet, dass man die L-Aminosäure reinigt oder,
dass Bestandteile der Fermentationsbrühe und/oder
Biomasse in ihrer Gesamtheit oder in Anteilen (> 0 bis 100%) im Produkt verbleiben.
18. Verfahren nach einem der Ansprüche 13 bis 16, dadurch gekennzeichnet, dass man einer L-Lysin haltigen Fermentationsbrühe Wasser entzieht und ein Produkt mit einem Wassergehalt von maximal 5 Gew.-% erhält oder,
dass man eine L-Lysin haltige Fermentationsbrühe zunächst konzentriert und anschließend sprühtrocknet oder sprühgranuliert.
19. Isoliertes Polynukleotid umfassend die Promotorregion des amtR-Gens gemäß SEQ ID NO: 5, welche eine oder mehrere Modifikationen aufweist.
20. Isoliertes Polynukleotid umfassend die Kodierregion des amtR-Gens, welche für ein Polypeptid mit der Aminosäuresequenz gemäß SEQ ID NO: 2, SEQ ID NO: 21 oder SEQ ID NO: 11 kodiert, wobei anstelle des ATG
Startkodons im Polynukleotid ein GTG oder TTG Startkodon verwendet wird.
21. Isoliertes Polynukleotid kodierend für einen AmtR- Regulator, dessen Aminosäuresequenz zu mindestens 85% identisch ist mit der Aminosäuresequenz von SEQ
ID NO: 2 und im Wesentlichen eine Länge von 222 Aminosäuren umfasst und einen oder mehrere, Aminosäureaustausche an den Positionen 3, 24, 31, 32, 36, 42, 50, 53, 54, 55, 57, 58, 59 und 63, oder den entsprechenden Positionen aufweist.
22. Vektor enthaltend ein Polynukleotid gemäß einem oder mehreren der Ansprüche 19 bis 21.
23. Eine Mikroorganismen-Zelle enthaltend den Vektor gemäß Anspruch 22 oder ein Polynukleotid gemäß einem oder mehreren der Ansprüche 19 bis 21.
PCT/EP2009/056046 2008-05-20 2009-05-19 Verfahren zur herstellung von l-aminosäuren WO2009141330A1 (de)

Priority Applications (3)

Application Number Priority Date Filing Date Title
BRPI0913067-5A BRPI0913067A2 (pt) 2008-05-20 2009-05-19 Processo para preparação de l-aminoácidos
EP09749820.8A EP2276845B1 (de) 2008-05-20 2009-05-19 Verfahren zur herstellung von l-aminosäuren
DK09749820.8T DK2276845T3 (da) 2008-05-20 2009-05-19 Fremgangsmåde til fremstilling af l-aminosyrer

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
DE102008001874.0 2008-05-20
DE102008001874A DE102008001874A1 (de) 2008-05-20 2008-05-20 Verfahren zur Herstellung von L-Aminosäuren

Publications (1)

Publication Number Publication Date
WO2009141330A1 true WO2009141330A1 (de) 2009-11-26

Family

ID=40904118

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2009/056046 WO2009141330A1 (de) 2008-05-20 2009-05-19 Verfahren zur herstellung von l-aminosäuren

Country Status (6)

Country Link
US (2) US8697850B2 (de)
EP (1) EP2276845B1 (de)
BR (1) BRPI0913067A2 (de)
DE (1) DE102008001874A1 (de)
DK (1) DK2276845T3 (de)
WO (1) WO2009141330A1 (de)

Cited By (14)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE102009030342A1 (de) 2009-06-25 2010-12-30 Evonik Degussa Gmbh Verfahren zur fermentativen Herstellung von organisch chemischen Verbindungen
DE102011006716A1 (de) 2011-04-04 2012-10-04 Evonik Degussa Gmbh Mikroorganismus und Verfahren zur fermentativen Herstellung einer organisch-chemischen Verbindung
WO2013000827A1 (de) 2011-06-28 2013-01-03 Evonik Degussa Gmbh Varianten des promotors des für die glyzerinaldehyd-3-phosphat-dehydrogenase kodierenden gap-gens
EP2762571A1 (de) 2013-01-30 2014-08-06 Evonik Industries AG Mikroorganismus und Verfahren zur fermentativen Herstellung von Aminosäuren
CN105624175A (zh) * 2011-12-21 2016-06-01 Cj第一制糖株式会社 利用具有产生l-赖氨酸能力的微生物产生l-赖氨酸的方法
EP3456833A1 (de) 2017-09-18 2019-03-20 Evonik Degussa GmbH Methode zur fermentativen production von l-aminosäuren
EP3467114A1 (de) 2017-10-05 2019-04-10 Evonik Degussa GmbH Verfahren zur fermentativen herstellung von l-aminosäuren
EP3594355A1 (de) 2018-07-12 2020-01-15 Evonik Operations GmbH Verfahren zur fermentativen herstellung von l-lysin
EP3599282A1 (de) 2018-07-24 2020-01-29 Evonik Operations GmbH Verfahren zur fermentativen herstellung von l-lysin
EP3628742A1 (de) 2018-09-26 2020-04-01 Evonik Operations GmbH Verfahren zur fermentativen herstellung von l-lysin
EP3660158A1 (de) 2018-11-29 2020-06-03 Evonik Operations GmbH Verfahren zur fermentativen herstellung von l-lysin
EP3670526A1 (de) 2018-12-18 2020-06-24 Evonik Operations GmbH Verfahren zur fermentativen herstellung von l-lysin unter verwendung von c.-glutamicum-stämmen mit einem mutierten kup-transporter
EP3686277A1 (de) 2019-01-23 2020-07-29 Evonik Operations GmbH Verfahren zur fermentativen herstellung von l-lysin
WO2021048353A1 (en) 2019-09-11 2021-03-18 Evonik Operations Gmbh Coryneform bacteria with a heterologous threonine transporter and their use in the production of l-threonine

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE102008001874A1 (de) 2008-05-20 2009-11-26 Evonik Degussa Gmbh Verfahren zur Herstellung von L-Aminosäuren
ES2781752T3 (es) * 2013-10-24 2020-09-07 Evonik Operations Gmbh Aditivo para piensos para animales que contiene L-aminoácido
EP2865274B1 (de) * 2013-10-24 2020-03-04 Evonik Operations GmbH L-Aminosäure enthaltendes Futtermitteladditiv
EP3498853A1 (de) 2017-12-14 2019-06-19 Evonik Degussa GmbH Verfahren zur fermentativen herstellung von l-lysin
CN111197021B (zh) * 2020-01-13 2021-09-21 江南大学 一种l-赖氨酸产量提高的重组谷氨酸棒杆菌及其构建方法
WO2023041425A1 (en) 2021-09-20 2023-03-23 Evonik Operations Gmbh Method for the fermentative production of l-lysine using c. glutamicum strains expressing modified gluconate repressor proteins gntr1 and gntr2

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1108790A2 (de) 1999-12-16 2001-06-20 Kyowa Hakko Kogyo Co., Ltd. Neue Polynukleotide
EP1460128A1 (de) * 2003-03-03 2004-09-22 Ajinmoto Co., Inc. Verfahren zur Herstellung von L-Arginin oder L-Lysin mittels Fermentation
WO2006077004A2 (de) 2005-01-19 2006-07-27 Degussa Gmbh Allele des mqo-gens aus coryneformen bakterien

Family Cites Families (50)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
SU507634A1 (ru) 1973-09-24 1976-03-25 Институт Микробиологии Имени А.Кирхенштейна Ан Латвийской Сср Способ получени -лизина
JPS559783A (en) 1978-07-10 1980-01-23 Ajinomoto Co Inc Preparation of l-lysine by fermentation
JPH0655149B2 (ja) 1985-03-12 1994-07-27 協和醗酵工業株式会社 Ｌ―リジンの製造法
JPS6261766A (ja) 1985-09-11 1987-03-18 Kawasaki Steel Corp 中心偏析の少ない連続鋳造方法
US5250434A (en) 1987-03-27 1993-10-05 Ajinomoto Co., Inc. Microorganisms for production of glutamic acid
GB2223754B (en) 1988-09-12 1992-07-22 Degussa Dna encoding phosphoenolpyruvate carboxylase
DE3943117A1 (de) 1989-12-27 1991-07-04 Forschungszentrum Juelich Gmbh Verfahren zur fermentativen herstellung von aminosaeure, insbesondere l-lysin, dafuer geeignete mikroorganismen und rekombinante dna
JP2990735B2 (ja) 1990-04-20 1999-12-13 味の素株式会社 Ｌ―リジンの発酵的製造法
JP3023615B2 (ja) 1990-08-30 2000-03-21 協和醗酵工業株式会社 発酵法によるｌ―トリプトファンの製造法
DE4100920A1 (de) 1991-01-15 1992-07-16 Degussa Wirkstoffzubereitung zur oralen verabreichung an wiederkaeuer
FR2679569B1 (fr) 1991-07-26 1995-05-19 Eurolysine Procede de separation de la lysine sous la forme de solutions aqueuses et utilisation de ces solutions pour l'alimentation animale.
DE4130868C2 (de) 1991-09-17 1994-10-13 Degussa Tierfuttermittelsupplement auf der Basis einer Aminosäure und Verfahren zu dessen Herstellung
KR100292038B1 (ko) 1992-12-04 2001-06-01 이데이 노부유끼 디스크장치
JP2590764B2 (ja) 1994-11-29 1997-03-12 日本電気株式会社 不揮発性半導体記憶装置
AU706285B2 (en) 1995-05-16 1999-06-10 Ajinomoto Co., Inc. Feed additive
DE19547361A1 (de) 1995-12-19 1997-06-26 Degussa Verfahren zur Herstellung von L-Aminosäuren durch Fermentation
DE19548222A1 (de) 1995-12-22 1997-06-26 Forschungszentrum Juelich Gmbh Verfahren zur mikrobiellen Herstellung von Aminosäuren durch gesteigerte Aktivität von Exportcarriern
JP4035855B2 (ja) 1996-06-05 2008-01-23 味の素株式会社 Ｌ−リジンの製造法
SK285201B6 (sk) 1996-12-05 2006-08-03 Ajinomoto Co., Inc. Rekombinantná DNA, autonómne reprodukovaná v bunkách koryneformnej baktérie, koryneformná baktéria a spôsob výroby L-lyzínu, vektor pVK7
DE59812638D1 (de) 1997-10-04 2005-04-14 Degussa Verfahren zur mikrobiellen herstellung von aminosäuren der aspartat- und/oder glutamatfamilie und im verfahren einsetzbare mittel
US5990350A (en) 1997-12-16 1999-11-23 Archer Midland Company Process for making granular L-lysine
MXPA01006290A (es) 1998-12-23 2002-04-17 Massachusetts Inst Technology Piruvato carboxilasa a partir de corynebacterium glutamicum.
JP2000262288A (ja) 1999-03-16 2000-09-26 Ajinomoto Co Inc コリネ型細菌の温度感受性プラスミド
ATE510917T1 (de) 1999-04-19 2011-06-15 Kyowa Hakko Bio Co Ltd Desensibilisierte aspartokinase
CN1236690C (zh) 1999-06-23 2006-01-18 德古萨股份公司 含有赖氨酸的含水动物饲料添加剂及其生产方法
US6861246B2 (en) 1999-07-07 2005-03-01 Degussa Ag L-lysine-producing corynebacteria and process for the preparation of lysine
US6962989B1 (en) * 1999-07-08 2005-11-08 Basf Aktiengesellschaft Corynebacterium glutamicum genes encoding novel proteins
US6927046B1 (en) 1999-12-30 2005-08-09 Archer-Daniels-Midland Company Increased lysine production by gene amplification using coryneform bacteria
CA2425754C (en) 2000-10-13 2014-02-18 Archer-Daniels-Midland Company Feedback-resistant pyruvate carboxylase gene from corynebacterium
US6783967B2 (en) 2001-02-16 2004-08-31 Degussa Ag Nucleotide sequences which code for the rpoB gene
DE10109996A1 (de) 2001-03-01 2002-09-05 Basf Ag Verfahren zur Veränderung des Genoms von gram-positiven Bakterien mit einem neuen konditional negativ dominanten Markergen
DE10112992A1 (de) 2001-03-17 2002-09-26 Degussa Verfahren zur fermentativen Herstellung von L-Aminosäuren unter Verwendung coryneformer Bakterien
US7049106B2 (en) 2001-04-10 2006-05-23 Degussa Ag Process for the production of L-amino acids by fermentation using coryneform bacteria with an attenuated mqo gene
ATE409752T1 (de) 2001-08-06 2008-10-15 Evonik Degussa Gmbh Coryneforme bakterien, die chemische substanzen bilden ii
BR0211723A (pt) 2001-08-06 2004-09-21 Degussa Bactérias corineformes que produzem compostos quìmicos i
DE10137815A1 (de) 2001-08-06 2003-02-27 Basf Ag Verfahren zur Herstellung eines marker-freien mutierten Zielorganismus sowie dafür geeignete Plasmidvektoren
US6844176B1 (en) 2001-10-16 2005-01-18 Degussa Ag Alleles of the lysC gene from corynebacteria
JP2003219807A (ja) 2002-01-25 2003-08-05 Ajinomoto Co Inc Ｌ−リジンを主成分とする造粒乾燥物
JP2006521083A (ja) * 2002-11-29 2006-09-21 ビーエーエスエフ　アクチェンゲゼルシャフト メチオニンの生産方法
US20040115304A1 (en) 2002-12-16 2004-06-17 Frank Dubner Feesdstuffs additives containing L-lysine with improved abrasion resistance, and process for their production
DE10331366A1 (de) 2003-07-11 2005-01-27 Degussa Ag Verfahren zur Granulation eines Tierfuttermittel-Zusatzes
WO2005021772A1 (en) 2003-08-29 2005-03-10 Degussa Ag Process for the preparation of l-lysine
KR101052573B1 (ko) 2004-04-02 2011-07-29 씨제이제일제당 (주) 균일한 함량을 갖는 과립형 동물 사료 첨가제를 제조하는 방법 및 그에 의하여 제조되는 과립형 동물 사료 첨가제
DE102005032426A1 (de) 2004-12-18 2006-06-22 Degussa Ag Allele des gnd-Gens aus coryneformen Bakterien
DE102005013676A1 (de) 2005-03-24 2006-09-28 Degussa Ag Allele des zwf-Gens aus coryneformen Bakterien
DE102005023829A1 (de) 2005-05-24 2006-11-30 Degussa Ag Allele des opcA-Gens aus coryneformen Bakterien
DE102006016158A1 (de) 2005-10-08 2007-04-12 Degussa Ag L-Lysin enthaltende Futtermitteladditive
DE102006026328A1 (de) 2006-06-02 2008-01-03 Evonik Degussa Gmbh Verfahren zur Herstellung eines L-Lysin enthaltenden Futtermitteladditivs
US8133714B2 (en) 2007-09-27 2012-03-13 Evonik Degussa Gmbh Process for the fermentative preparation of organic chemical compounds using coryneform bacteria in which the SugR gene is present in attenuated form
DE102008001874A1 (de) 2008-05-20 2009-11-26 Evonik Degussa Gmbh Verfahren zur Herstellung von L-Aminosäuren

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1108790A2 (de) 1999-12-16 2001-06-20 Kyowa Hakko Kogyo Co., Ltd. Neue Polynukleotide
EP1460128A1 (de) * 2003-03-03 2004-09-22 Ajinmoto Co., Inc. Verfahren zur Herstellung von L-Arginin oder L-Lysin mittels Fermentation
WO2006077004A2 (de) 2005-01-19 2006-07-27 Degussa Gmbh Allele des mqo-gens aus coryneformen bakterien

Non-Patent Citations (9)

* Cited by examiner, † Cited by third party
Title
BECKERS GABRIELE ET AL: "Regulation of AmtR-controlled gene expression in Corynebacterium glutamicum: mechanism and characterization of the AmtR regulon.", MOLECULAR MICROBIOLOGY OCT 2005, vol. 58, no. 2, October 2005 (2005-10-01), pages 580 - 595, XP002539889, ISSN: 0950-382X *
EIKMANNS ET AL., MICROBIOLOGY, vol. 140, 1994, pages 1817 - 1828
HANAHAN: "DNA cloning. A practical approach", vol. 1, 1989, ILR-PRESS, COLD SPRING HABOR
IKEDA, NAKAGAWA, APPLIED MICROBIOLOGY AND BIOTECHNOLOGY, vol. 62, 2003, pages 99 - 109
KALINOWSKI ET AL., JOURNAL OF BIOTECHNOLGY, vol. 104, no. 1-3, 2003
SAMBROCK ET AL.: "Molecular Cloning: a laboratory manual.2nd Ed.", 1989, COLD SPRING HABOR
SCHÄFER ET AL., GENE, vol. 145, 1994, pages 69 - 73
SCHÄFER ET AL., JOURNAL OF MICROBIOLOGY, vol. 172, 1990, pages 1663 - 1666
SIMON ET AL., BIO/TECHNOLOGIE, vol. 1, 1993, pages 784 - 791

Cited By (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE102009030342A1 (de) 2009-06-25 2010-12-30 Evonik Degussa Gmbh Verfahren zur fermentativen Herstellung von organisch chemischen Verbindungen
US9163268B2 (en) 2009-06-25 2015-10-20 Evonik Degussa Gmbh Method for fermentatively preparing L-amino acids
DE102011006716A1 (de) 2011-04-04 2012-10-04 Evonik Degussa Gmbh Mikroorganismus und Verfahren zur fermentativen Herstellung einer organisch-chemischen Verbindung
WO2012136506A2 (de) 2011-04-04 2012-10-11 Evonik Degussa Gmbh Mikroorganismus und verfahren zur fermentativen herstellung einer organisch-chemischen verbindung
WO2013000827A1 (de) 2011-06-28 2013-01-03 Evonik Degussa Gmbh Varianten des promotors des für die glyzerinaldehyd-3-phosphat-dehydrogenase kodierenden gap-gens
DE102011118019A1 (de) 2011-06-28 2013-01-03 Evonik Degussa Gmbh Varianten des Promotors des für die Glyzerinaldehyd-3-phosphat-Dehydrogenase kodierenden gap-Gens
CN105624175A (zh) * 2011-12-21 2016-06-01 Cj第一制糖株式会社 利用具有产生l-赖氨酸能力的微生物产生l-赖氨酸的方法
EP2762571A1 (de) 2013-01-30 2014-08-06 Evonik Industries AG Mikroorganismus und Verfahren zur fermentativen Herstellung von Aminosäuren
WO2014117992A1 (de) 2013-01-30 2014-08-07 Evonik Industries Ag Mikroorganismus und verfahren zur fermentativen herstellung von aminosäuren
EP3456833A1 (de) 2017-09-18 2019-03-20 Evonik Degussa GmbH Methode zur fermentativen production von l-aminosäuren
EP3456834A1 (de) 2017-09-18 2019-03-20 Evonik Degussa GmbH Verfahren zur fermentativen herstellung von l-aminosäuren
EP3467099A1 (de) 2017-10-05 2019-04-10 Evonik Degussa GmbH Verfahren zur fermentativen herstellung von l-aminosäuren
EP3467114A1 (de) 2017-10-05 2019-04-10 Evonik Degussa GmbH Verfahren zur fermentativen herstellung von l-aminosäuren
EP3594355A1 (de) 2018-07-12 2020-01-15 Evonik Operations GmbH Verfahren zur fermentativen herstellung von l-lysin
EP3599282A1 (de) 2018-07-24 2020-01-29 Evonik Operations GmbH Verfahren zur fermentativen herstellung von l-lysin
US10689677B2 (en) 2018-09-26 2020-06-23 Evonik Operations Gmbh Method for the fermentative production of L-lysine by modified Corynebacterium glutamicum
EP3628742A1 (de) 2018-09-26 2020-04-01 Evonik Operations GmbH Verfahren zur fermentativen herstellung von l-lysin
EP3660158A1 (de) 2018-11-29 2020-06-03 Evonik Operations GmbH Verfahren zur fermentativen herstellung von l-lysin
WO2020109367A1 (en) 2018-11-29 2020-06-04 Evonik Operations Gmbh Method for the fermentative production of l-lysine using an l-lysine excreting bacterium of the species corynebacterium glutamicum having a completely or partly deleted whib4 gene
US11198895B2 (en) 2018-11-29 2021-12-14 Evonik Operations Gmbh Method for the fermentative production of L-lysine using an L-lysine excreting bacterium of the species Corynebacterium glutamicum having a completely or partly deleted WHIB4 gene
EP3670526A1 (de) 2018-12-18 2020-06-24 Evonik Operations GmbH Verfahren zur fermentativen herstellung von l-lysin unter verwendung von c.-glutamicum-stämmen mit einem mutierten kup-transporter
EP3670525A1 (de) 2018-12-18 2020-06-24 Evonik Operations GmbH Verfahren zur fermentativen herstellung von l-lysin unter verwendung von c.-glutamicum-stämmen mit einem mutierten kup-transporter
US10717999B2 (en) 2018-12-18 2020-07-21 Evonik Operations Gmbh Method for the fermentative production of L-lysine using C. glutamicum strains with a mutated kup transporter
EP3686277A1 (de) 2019-01-23 2020-07-29 Evonik Operations GmbH Verfahren zur fermentativen herstellung von l-lysin
US10829746B2 (en) 2019-01-23 2020-11-10 Evonik Operations Gmbh Method for the fermentative production of L-lysine
WO2021048353A1 (en) 2019-09-11 2021-03-18 Evonik Operations Gmbh Coryneform bacteria with a heterologous threonine transporter and their use in the production of l-threonine

Also Published As

Publication number Publication date
US20140127787A1 (en) 2014-05-08
US9422568B2 (en) 2016-08-23
US8697850B2 (en) 2014-04-15
EP2276845B1 (de) 2014-01-22
DK2276845T3 (da) 2014-04-22
DE102008001874A1 (de) 2009-11-26
EP2276845A1 (de) 2011-01-26
BRPI0913067A2 (pt) 2015-08-11
US20090311758A1 (en) 2009-12-17

Similar Documents

Publication Publication Date Title
EP2276845B1 (de) Verfahren zur herstellung von l-aminosäuren
EP2041276B1 (de) Verfahren zur herstellung von l-aminosäuren mittels mutanten des glta-gens kodierend für citratsynthase
EP1824968B1 (de) Allele des gnd-gens aus coryneformen bakterien
EP2061881B1 (de) Allele des rel-gens aus coryneformen bakterien
EP2026662A2 (de) Verfahren zur herstellung eines l-lysin enthaltende futtermitteladditives
DE102005013676A1 (de) Allele des zwf-Gens aus coryneformen Bakterien
DE102005045301A1 (de) Verfahren zur Herstellung von organisch-chemischen Verbindungen unter Verwendung coryneformer Bakterien
EP2078085B1 (de) Allele des prpd1-gens aus coryneformen bakterien
EP2089525B1 (de) Allele des oxyr-gens aus coryneformen bakterien
EP1902067B1 (de) Allele des opca-gens aus coryneformen bakterien
WO2005083082A1 (de) Verfahren zur herstellung von l-aminosäuren unter verwendung rekombinanter coryneformer bakterien mit verminderter aktivität des regulators asur
DE102004009454A1 (de) Verfahren zur fermentativen Herstellung von L-Aminosäuren unter Verwendung von rekombinanten Mikroorganismen
EP1841859B1 (de) Allele des mqo-gens aus coryneformen bakterien
EP2694536B1 (de) Mikroorganismus und verfahren zur fermentativen herstellung einer organisch-chemischen verbindung
DE102009030342A1 (de) Verfahren zur fermentativen Herstellung von organisch chemischen Verbindungen
WO2015165743A1 (de) Verfahren zur produktion von l-lysin unter verwendung eines alkaliphilen bakteriums

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 09749820

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2009749820

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: PI0913067

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20101122