WO2006082530A2 - Conjugation of streptococcal capsular saccharides to carrier proteins - Google Patents
Conjugation of streptococcal capsular saccharides to carrier proteins Download PDFInfo
- Publication number
- WO2006082530A2 WO2006082530A2 PCT/IB2006/000756 IB2006000756W WO2006082530A2 WO 2006082530 A2 WO2006082530 A2 WO 2006082530A2 IB 2006000756 W IB2006000756 W IB 2006000756W WO 2006082530 A2 WO2006082530 A2 WO 2006082530A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- saccharide
- conjugate
- carrier
- linker
- capsular
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/09—Lactobacillales, e.g. aerococcus, enterococcus, lactobacillus, lactococcus, streptococcus
- A61K39/092—Streptococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/02—Bacterial antigens
- A61K39/09—Lactobacillales, e.g. aerococcus, enterococcus, lactobacillus, lactococcus, streptococcus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/56—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule
- A61K47/61—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic macromolecular compound, e.g. an oligomeric, polymeric or dendrimeric molecule the organic macromolecular compound being a polysaccharide or a derivative thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/6415—Toxins or lectins, e.g. clostridial toxins or Pseudomonas exotoxins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/643—Albumins, e.g. HSA, BSA, ovalbumin or a Keyhole Limpet Hemocyanin [KHL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/646—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the entire peptide or protein drug conjugate elicits an immune response, e.g. conjugate vaccines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P39/00—General protective or antinoxious agents
- A61P39/04—Chelating agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/315—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/575—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
- A61K2039/6037—Bacterial toxins, e.g. diphteria toxoid [DT], tetanus toxoid [TT]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
- A61K2039/6068—Other bacterial proteins, e.g. OMP
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
- A61K2039/6081—Albumin; Keyhole limpet haemocyanin [KLH]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/62—Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier
- A61K2039/627—Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier characterised by the linker
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/64—Medicinal preparations containing antigens or antibodies characterised by the architecture of the carrier-antigen complex, e.g. repetition of carrier-antigen units
Definitions
- This invention is in the field of conjugating bacterial capsular saccharides to carriers in order to form glycoconjugates.
- the glycoconjugates are useful for immunisation.
- the capsular saccharides of bacteria have been used for many years in vaccines against capsulated bacteria. As saccharides are T-independent antigens, however, they are poorly immunogenic. Conjugation to a carrier can convert T-independent antigens into T-dependent antigens, thereby enhancing memory responses and allowing protective immunity to develop.
- the most effective saccharide vaccines are therefore based on glycoconjugates, and the prototype conjugate vaccine was against Haemophilus influenzae type b ('Hib') [e.g. see chapter 14 of ref. 78].
- Streptococcus agalactiae also known as 'group B streptococcus', or simply as 'GBS'.
- TT tetanus toxoid
- CRM 197 CRM 197 [2].
- the reductive amination involves an amine group on the side chain of an amino acid in the carrier and an aldehyde group in the saccharide.
- GBS capsular saccharides do not include an aldehyde group in their natural form then this is generated before conjugation by periodate oxidation of a portion of the saccharide's sialic acid residues, as shown in Figure 1 [2,10].
- conjugate vaccines prepared in this manner for each of GBS serotypes Ia, Ib, II, III, and V have been shown to be safe and immunogenic in humans [11], there remains a need for further and better ways of preparing conjugates of GBS capsular saccharides.
- the invention is based on three conjugation methods that can be used in place of the direct reductive amination disclosed in the prior art, all of which aim (a) to retain sialic acid residues in a form that is closer than the prior art to the form see in the native polysaccharide, and (b) to allow the use of a linker in the conjugation reaction, in order to improve coupling to carriers: ⁇
- reductive amination of oxidised sialic acid residue side chains is used, but the aldehyde groups are first animated, and then the amine is coupled to a carrier via a linker. This method is illustrated in 'route A' of Figure 2.
- sialic acid residues and/or N-acetyl-glucosamine residues are de-N-acetylated to give amine groups, and the amine groups are coupled to a carrier protein via a linker.
- This method is illustrated in 'route B' of Figure 2.
- linkage is via galactose residues in the capsular saccharide rather than sialic acid residues. This method avoids disrupting key epitopes formed by sialic acid residues.
- the invention provides a process for preparing a conjugate of a
- S.agalactiae capsular saccharide and a carrier molecule comprising the steps of: (a) oxidising a S.agalactiae capsular saccharide in order to introduce an aldehyde group into at least one terminal sialic acid residue in the saccharide; (b) subjecting the aldehyde group to reductive amination with ammonia or a primary amine, to give a -CH 2 -linked amine; (c) reacting the -CH 2 -linked amine with a bifunctional linker, to give an activated saccharide; and (d) reacting the activated saccharide with a carrier molecule, thereby giving the conjugate.
- the invention also provides a conjugate, wherein the conjugate comprises a S.agalactiae capsular saccharide moiety joined to a carrier via a linker moiety, and wherein the linker moiety is attached to a sialic acid residue in the capsular saccharide moiety.
- the invention provides a process for preparing a conjugate of a S.agalactiae capsular saccharide and a carrier molecule, comprising the steps of: (a) de-N-acetylating the capsular saccharide, to give a de-N-acetylated saccharide; (b) reacting the de-N-acetylated saccharide with a bifunctional linker, to give an activated saccharide; and (c) reacting the activated saccharide with a carrier molecule, thereby giving the conjugate. Between steps (a) and (b), the process may involve a step of partial re-N-acetylation of the saccharide.
- the invention provides a process for preparing a conjugate of a capsular saccharide and a carrier molecule, comprising the steps of: (a) oxidising a capsular saccharide in order to introduce an aldehyde group into at least one galactose residue in the saccharide, to give a modified galactose residue; and (b) coupling the modified galactose residue to a carrier molecule.
- the coupling in step (b) may be direct, or may be via a linker molecule.
- the invention also provides a conjugate, wherein the conjugate comprises a capsular saccharide moiety joined to a carrier via a linker moiety, and wherein the linker moiety is attached to a galactose residue in the capsular saccharide moiety.
- Oxidation of galactose residues is particularly useful for conjugation of S.agalactiae capsular saccharides, but is also suitable for use with other bacteria that have galactose- containing capsular saccharides e.g.
- the capsular saccharide The capsular saccharide
- the invention is based on the capsular saccharide of Streptococcus agalactiae.
- the capsular polysaccharide is covalently linked to the peptidoglycan backbone of GBS, and is distinct from the group B antigen, which is another saccharide that is attached to the peptidoglycan backbone.
- the GBS capsular polysaccharides are chemically related, but are antigenically very different. All GBS capsular polysaccharides share the following trisaccharide core: ⁇ -D-GlcpNAc(l ⁇ 3) ⁇ -D-Galp(l ⁇ 4) ⁇ -D-Glcp
- the various GBS serotypes differ by the way in which this core is modified.
- the difference between serotypes Ia and III arises from the use of either the GIcNAc (Ia) or the Gal (III) in this core for linking consecutive trisaccharide cores (Figure 4).
- Serotypes Ia and Ib both have a [ ⁇ -D-Neu/>NAc(2 ⁇ 3) ⁇ -D-Gal/>(l ⁇ ] disaccharide linked to the GIcNAc in the core, but the linkage is either 1 ⁇ 4 (Ia) or 1 ⁇ 3 (Ib).
- GBS-related disease arises primarily from serotypes Ia, Ib, II, III, IV, V, VI, VII, and VIII, with over 90% being caused by five serotypes: Ia, Ib, II, III & V.
- the invention preferably uses a saccharide from one of these five serotypes.
- the capsular saccharides of each of these five serotypes include: (a) a terminal N-acetyl-neuraminic acid ( ⁇ eu ⁇ Ac) residue (commonly referred to as sialic acid), which in all cases is linked 2— »3 to a galactose residue; and (b) a N-acetyl- glucosamine residue (Glc ⁇ Ac) within the trisaccharide core.
- All five saccharides include galactose residues within the trisaccharide core, but serotypes Ia, Ib, II & III also contain additional galactose residues in each repeating unit, with the serotype II saccharide containing three galactose residues per repeating unit.
- the galactose residues involved in the conjugation reactions may be a residue in the trisaccharide core or a residue outside the trisaccharide core.
- the linkages involve the same-positioned galactose in the various linked repeating units, but it is also possible to link to differently-positioned galactose residues in different repeating units.
- Saccharides used according to the invention may be in their native form, or may have been modified.
- the saccharide may be shorter than the native capsular saccharide, or may be chemically modified.
- the saccharide used according to the invention may be a substantially full-length capsular polysaccharide, as found in nature, or it may be shorter than the natural length.
- Full-length polysaccharides may be depolymerised to give shorter fragments for use with the invention e.g. by hydrolysis in mild acid, by heating, by sizing chromatography, etc. Chain length has been reported to affect immunogenicity of GBS saccharides in rabbits [4]
- serotype Ib it is preferred to use polysaccharides with a MW up to ⁇ 50kDa.
- serotype III it is preferred to use polysaccharides with a MW up to ⁇ 50kDa.
- These molecular masses can be measured by gel filtration relative to dextran standards, such as those available from Polymer Standard Service [13].
- the saccharide may be chemically modified relative to the capsular saccharide as found in nature.
- the saccharide may be de-O-acetylated (partially or fully), de-N-acetylated (partially or fully), N-propionated (partially or fully), etc.
- De-acetylation may occur before, during or after conjugation, but preferably occurs before conjugation.
- de-acetylation may or may not affect immunogenicity e.g. the NeisVac-CTM vaccine uses a de-O-acetylated saccharide, whereas MenjugateTM is acetylated, but both vaccines are effective.
- O-acetylation on GBS saccharides in various serotypes is discussed in reference 14, and it is preferred to retain O-acetylation of sialic acid residues at positions 7, 8 and/or 9 before during and after conjugation e.g. by protection/de-protection, by re-acetylation, etc.
- the effect of de-acetylation etc. can be assessed by routine assays.
- Capsular saccharides can be purified by known techniques, as described in the references herein.
- a typical process involves base extraction, centrifugation, filtration, RNase/DNase treatment, protease treatment, concentration, size exclusion chromatography, ultrafiltration, anion exchange chromatography, and further ultrafiltration.
- Treatment of GBS cells with the enzyme mutanolysin, which cleaves the bacterial cell wall to free the cell wall components, is also useful.
- the purification process described in reference 15 can be used. This involves base extraction, ethanol/CaCl 2 treatment, CTAB precipitation, and re-solubilisation.
- the invention is not limited to saccharides purified from natural sources, however, and the saccharides may be obtained by other methods, such as total or partial synthesis.
- the invention involves the use of carrier molecules, which are typically proteins.
- carrier molecules which are typically proteins.
- covalent conjugation of saccharides to carriers enhances the immunogenicity of saccharides as it converts them from T-independent antigens to T-dependent antigens, thus allowing priming for immunological memory. Conjugation is particularly useful for paediatric vaccines [e.g. ref. 16] and is a well known technique ⁇ e.g. reviewed in refs. 17 to 25].
- Preferred carrier proteins are bacterial toxins or toxoids, such as diphtheria toxoid or tetanus toxoid.
- the CRMl 97 mutant of diphtheria toxin [26-28] is a particularly preferred carrier for, as is a diphtheria toxoid.
- suitable carrier proteins include the N.meningitidis outer membrane protein [29], synthetic peptides [30,31], heat shock proteins [32,33], pertussis proteins [34,35], cytokines [36], lymphokines [36], hormones [36], growth factors [36], human serum albumin (preferably recombinant), artificial proteins comprising multiple human CD4 + T cell epitopes from various pathogen-derived antigens [37] such as N19 [38], protein D from H.influenzae [39,40], pneumococcal surface protein PspA [41], pneumolysin [42], iron-uptake proteins [43], toxin A or B from C.difficile [44], a GBS protein (see below; particularly GBS67) [195], etc.
- Attachment to the carrier is preferably via a -NH 2 group e.g. in the side chain of a lysine residue in a carrier protein, or of an arginine residue. Where a saccharide has a free aldehyde group then this can react with an amine in the carrier to form a conjugate by reductive animation.
- the third aspect of the invention may be based on reductive amination involving an oxidised galactose in the saccharide (from which an aldehyde is formed) and an amine in the carrier or in the linker. Attachment may also be via a -SH group e.g. in the side chain of a cysteine residue.
- carrier protein e.g. to reduce the risk of carrier suppression.
- different carrier proteins can be used for different GBS serotypes e.g. serotype Ia saccharides might be conjugated to CRMl 97 while serotype Ib saccharides might be conjugated to tetanus toxoid.
- more than one carrier protein for a particular saccharide antigen e.g. serotype III saccharides might be in two groups, with some conjugated to CRMl 97 and others conjugated to tetanus toxoid. In general, however, it is preferred to use the same carrier protein for all saccharides.
- a single carrier protein might carry more than one saccharide antigen [45,46].
- a single carrier protein might have conjugated to it saccharides from serotypes Ia and Ib.
- different saccharides can be mixed prior to the conjugation reaction.
- the separate conjugates may be based on the same carrier. Conjugates with a saccharide :protein ratio (w/w) of between 1 :5 (i.e. excess protein) and 5:1 (i.e. excess saccharide) are preferred. Ratios between 1:2 and 5:1 are preferred, as are ratios between 1:1.25 and 1:2.5. Ratios between 1:1 and 4:1 are also preferred.
- the invention provides a conjugate, wherein the conjugate comprises a S.agalactiae capsular saccharide moiety joined to a carrier, wherein the weight ratio of saccharide :carrier is at least 2:1.
- compositions may include a small amount of free carrier [47].
- the unconjugated form is preferably no more than 5% of the total amount of the carrier protein in the composition as a whole, and more preferably present at less than 2% by weight.
- composition of the invention includes a depolymerised oligosaccharide, it is preferred that depolymerisation precedes conjugation.
- the first aspect of the invention involves oxidation of sialic acid to form an aldehyde
- the third aspect involves oxidation of galactose to form an aldehyde.
- the aldehyde can then be used for reactions such as reductive amination.
- Oxidation of hydroxyls to give aldehydes can be achieved chemically or enzymatically. These reactions will typically take place in aqueous conditions.
- Typical reactions to produce aldehydes in siajic acids include the use of periodate salts, and particularly meta-periodates ⁇ e.g. sodium or potassium meta-periodate e.g. NaIO 4 ), to oxidise vicinal hydroxides [10].
- Periodate oxidation has been reported for at least serogroups II [3,50], III [2] and V [50].
- Other oxidation conditions can be used e.g. use of osmium tetroxide, etc.
- the -OH that is oxidised is preferably the primary -OH ⁇ i.e. not the secondary or anomeric -OH groups), which is attached to C-6.
- galactose into galactohexodialose.
- a galactose oxidase enzyme from any suitable source ⁇ e.g. from Fusarium fungi, or Dactylium dendroides).
- the enzyme can be used in recombinant form, or purified from its native source.
- the galactose oxidase enzyme has EC number 1.1.3.9, and is also known as D-Galactose:oxygen 6-oxidoreductase.
- the enzyme uses a copper ion cofactor and can be inhibited by cyanide, diethyldithiocarbamate, azide and hydroxylamine, so use of these reagents prior to oxidation is preferably avoided.
- the pH optimum for the D. dendroides is around neutral, which is thus the preferred pH for oxidation.
- a product of the enzymatic reaction is H 2 O 2 (reduced oxygen), and the concentration of this product can be controlled e.g. if its presence is damaging to the saccharide.
- the preferred oxidation reactions involve the terminal carbon atoms in the monosaccharides i.e. the highest-numbered carbons by standard nomenclature.
- the proportion of monosaccharide subunits in a saccharide chain that are converted to include an aldehyde group can be controlled by varying reaction conditions.
- reference 50 reports that controlled periodate oxidation of serotype II GBS polysaccharide resulted in the modification of 7% of sialic acid residues as determined by gas chromatography-mass spectrometry analysis, with a higher percentage being seen for serotype V GBS polysaccharide.
- Reference 2 reports 25% conversion for serotype III.
- Preliminary studies of reaction conditions ⁇ e.g. time, temperature, concentrations, etc.)can be performed to find optimum conditions for any desired end result. In general, it is typical to introduce aldehyde groups into between 5% and 50% (e.g.
- reductive amination of the new aldehyde group is used to give a group for attachment of the linker.
- Reductive amination can also be used in the third aspect of the invention after the aldehyde group has been produced, either to attach a linker or for direct linkage to a carrier.
- Reductive amination is a standard technique in organic chemistry, and has been used extensively in the production of conjugates of capsular saccharides for vaccine use.
- the reductive amination involves either ammonia or a primary amine (NH 2 R).
- an ammonium salt e.g. ammonium chloride
- an appropriate reducing agent e.g. cyanoborohydrides, such as sodium cyanoborohydride NaBH 3 CN; borane-pyridine; sodium triacetoxyborohydride; borohydride exchange resin; etc.
- cyanoborohydrides such as sodium cyanoborohydride NaBH 3 CN; borane-pyridine; sodium triacetoxyborohydride; borohydride exchange resin; etc.
- the oxidised galactose has an aldehyde group on C-6.
- This group can be coupled to a bifunctional linker by reductive amination in the same way as described above i.e. involving ammonia or a primary amine.
- reductive amination can be used to link the aldehyde to a carrier directly, without use of a linker, by utilising an amine group on the carrier.
- Reductive amination will generally be carried out in a polar protic solvent, such as water or alcohol.
- the first and second aspects of the invention involve the use of a bifunctional linker.
- a bifunctional linker is used to provide a first group for coupling to an amine group in the modified capsular saccharide and a second group for coupling to the carrier (typically for coupling to an amine in the carrier).
- the first group in the bifunctional linker is thus able to react with the amine group (-NHR) on the modified sialic acid (or galactose) residue. This reaction will typically involve an electrophilic substitution of the amine's hydrogen.
- the second group in the bifunctional linker is able to react with the amine group on the carrier. This reaction will again typically involve an electrophilic substitution of the amine.
- the invention can use both heterobifunctional linkers and homobifunctional linkers.
- a bifunctional linker of the formula X-L-X where: the two X groups are the same as each other and can react with the amines; and where L is a linking moiety in the linker.
- a preferred X group is N-oxysuccinimide.
- L preferably has formula -L'-L 2 -L'-, where L' is carbonyl.
- Preferred L 2 groups are straight chain alkyls with 1 to 10 carbon atoms (e.g. Ci, C 2 , C 3 , C 4 , C 5 , C 6 , C 7 , C 8 , C 9 , C )0 ) e.g. -(CH 2 ) 4 -.
- a preferred linker is thus adipic acid N-hydroxysuccinimide diester (SIDEA):
- X groups are those which form esters when combined with HO-L-OH, such as norborane, p-nitrobenzoic acid, and sulfo-N-hydroxysuccinimide.
- bifunctional linkers reactive with amines for use with the invention include acryloyl halides (e.g. chloride) [54], haloacylhalides [55], disuccinimidyl glutarate, disuccinimidyl suberate, ethylene glycol bis[succinimidylsuccinate], etc.
- the linker will generally be added in molar excess to modified saccharide.
- linker/saccharide reaction will generally take place in an aprotic solvent (e.g. DMSO, ethanol acetate, etc.), as the linkers are typically insoluble in water. Where water-soluble linkers are used, however, then a wider range of solvents is available, including protic solvents such as water.
- Suitable linkers include sulphonated forms, such as sulphonated SIDEA:
- the sialic acid residues in GBS capsular saccharides are N-acetylated, as are the glucosamine residues within the trisaccharide core.
- the first aspect of the invention introduces amine groups in at C-8 of the sialic acid via an aldehyde intermediate
- the second aspect of the invention uses amine groups produced by de-N-acetylation of the sialic acid and/or N-acetyl-glucosamine residues.
- the reaction schemes for amines produced in this way are generally the same as described for the first aspect of the invention.
- De-N-acetylation of GBS saccharides can conveniently be achieved by treating the saccharide with a base.
- GBS saccharides can be purified by a process involving base extraction [51] then de-N-acetylation may be a side-reaction during purification.
- N-acetyl groups may be part of important epitopes in GBS saccharides, complete de-N-acetylation may not be desirable, but this process is difficult to control. If the extent of de-N-acetylation is greater than desired, therefore, the invention may involve a step of controlled re-N-acetylation.
- Re-N-acetylation can conveniently be performed using a reagent such as acetic anhydride (CH 3 CO) 2 O e.g. in 5% ammonium bicarbonate [52]. Rather than use re-N-acetylation, however, the inventors have found that base extraction of the saccharide from bacteria can, if performed quickly enough without prolonged storage of the saccharide, give a saccharide with less than 25% de-N-acetylation.
- a reagent such as acetic anhydride (CH 3 CO) 2 O e.g. in 5% ammonium bicarbonate [52].
- the result of de-N-acetylation and optional re-N-acetylation is a saccharide in which at least 1 sialic acid residue or glucosamine is de-N-acetylated.
- at least 60% of the sialic acid residues and glucosamine residues in the GBS saccharide are N-acetylated e.g. >70%, >75%, >80%, >85%,
- de-N-acetylated groups i.e. -NH 2 groups
- -NH 2 groups de-N-acetylated groups
- the saccharide is substantially totally re-N-acetylated prior to the reductive amination (preferably prior to oxidation of galactose in the third aspect), in order to avoid the presence of free amine groups on sialic acids that would otherwise offer alternative linking groups to the aminated aldehyde.
- Conjugates of the invention are formed by mixing the modified GBS saccharide with the carrier under suitable reaction conditions.
- two types of conjugate can be made, as shown in Figure 5: (a) a conjugate where an individual saccharide is attached to a single carrier e.g. through its reducing terminus; and (b) a conjugate where an individual saccharide is attached to multiple carriers e.g. because several monosaccharide subunits are reactive.
- a single carrier protein can link to multiple saccharide molecules because it can have multiple exposed lysine side chains.
- Conjugates of type (b) are more typical in the present invention, because the modified sialic acid or galactose residues of the invention occur at multiple sites along a single saccharide [50]. In preferred conjugates of the invention, therefore, a single saccharide molecule is coupled on average to more than one carrier molecule.
- the number of carrier molecules attached to a saccharide will depend on the number of free aldehyde groups that are present. As mentioned above, it is preferred that 5-50% of sialic acid (first method) or galactose (third method) residues in the saccharide are oxidised.
- the conjugates will include a linker moiety. This linker moiety originates neither in the saccharide nor the carrier, but is a third molecule used during conjugate preparation, and can readily be distinguished from both the saccharide and carrier protein in a final conjugate product.
- the linker moiety may include atoms such as carbon, hydrogen, oxygen and/or nitrogen. Linkers that comprise carbon and hydrogen are preferred, and linkers that further comprise oxygen and/or nitrogen are also preferred. Linkers that include nitrogen atoms may include a carbon atom bonded to a nitrogen atom, which in turn is bonded to a second carbon atom (-C-N-C-). Linkers that include an oxygen atom preferably include it as part of a carbonyl group. Linker moieties with a molecular weight of between 30-500 Da are preferred. Linkers containing two carbonyl groups are preferred.
- a particularly preferred linker moiety is -NH-C(O)-(CH 2 ) n -C(O)-, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
- the value of n is preferably 4.
- the terminal -NH- in this linker is preferably attached to a carbon atom from the saccharide moiety.
- the terminal -C(O)- is preferably attached to a nitrogen atom in an amino acid side chain in the carrier.
- the preferred linker moiety can conveniently be introduced by a process involving: reductive amination of an aldehyde in an oxidised sialic acid; reaction of the resulting -NH 2 group with a bifunctional linker that is a diester (e.g.
- a disuccinimidyl ester of a dioic acid (e.g. of adipic acid, HOOC-(CH 2 ) 4 -COOH); and reductive amination of the product (see Figure 6 [53]).
- a dioic acid e.g. of adipic acid, HOOC-(CH 2 ) 4 -COOH
- chemistries that can be used to attach a linker to a terminal -NH 2 in a saccharide, which may have been introduced (as in the first aspect of the invention) or may be part of a de-N-acetylated monosaccharide residue (as in the second aspect of the invention), include:
- - acryloylation e.g. by reaction with acryloyl chloride
- Michael-type addition to either the ⁇ -NH 2 of an amino acid side chain or to a -SH of a cysteine side chain [54].
- the resulting linker is -NH-C(O)-(CH 2 ) 2 - (propionamido), as shown in Figure 8, or -C(O)-(CH 2 ) 2 - if an existing -NH 2 takes part in the reaction.
- the linker is -NH-C(O)-CH 2 - (as shown in Figure 9) or -C(O)-CH 2 -, depending on whether an existing or added -NH 2 takes part in the reaction.
- Another preferred linker moiety is -C(O)-(CH 2 ) n -C(O)-, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10.
- the value of n is preferably 4.
- One terminal -C(O)- in this linker is preferably attached to a nitrogen carbon atom from the saccharide moiety, and the other terminal -C(O)- is preferably attached to a nitrogen atom in an amino acid side chain in the carrier.
- the preferred linker moiety can conveniently be introduced by a process involving: reaction of a -NH 2 group in a de-N-acetylated monosaccharide unit with a bifunctional linker that is a diester (e.g.
- a disuccinimidyl ester of a dioic acid (e.g. of adipic acid, HOOC-(CH 2 ) 4 -COOH); and reductive amination of the product (Figure 7).
- Other options include conjugating via hydroxyl groups in the saccharide. Hydroxyls can be activated (e.g. by CNBr or CDAP) and then subjected to conjugation.
- the invention provides a composition comprising a conjugate of the invention and one or more further antigens.
- the further antigen(s) may comprise further conjugates of the invention, and so the invention provides a composition comprising more than one conjugate of the invention.
- the further antigen(s) may be GBS saccharide conjugates prepared by methods other than those of the invention, and so the invention provides a composition comprising a first GBS saccharide conjugate and a second GBS saccharide conjugate, wherein the first conjugate is a conjugate of the invention and the second conjugate is not a conjugate of the invention.
- the different GBS conjugates may include different types of conjugate from the same GBS serotype and/or conjugates from different GBS serotypes.
- the invention provides a composition comprising conjugates from two or three of serotypes Ia, Ib and III.
- the composition will be produced by preparing separate conjugates (e.g. a different conjugate for each serotype) and then combining the conjugates.
- the further antigen(s) may comprise GBS amino acid sequences, as set out below.
- compositions of the invention may further comprise one or more non-GBS antigens, including additional bacterial, viral or parasitic antigens. These may be selected from the following:
- N. meningitidis serogroup B such as those in refs. 56 to 62, with protein '287' (see below) and derivatives (e.g. ' ⁇ G287') being particularly preferred.
- OMV outer-membrane vesicle
- an antigen from hepatitis A virus such as inactivated virus [e.g. 72, 73; chapter 15 of ref. 78].
- an antigen from hepatitis B virus such as the surface and/or core antigens [e.g. 13,1A; chpater
- Bordetella pertussis such as pertussis holotoxin (PT) and filamentous haemagglutinin (FHA) from B.pertussis, optionally also in combination with pertactin and/or agglutinogens 2 and 3 [e.g. refs. 76 & 77; chapter 21 of ref. 78].
- - a diphtheria antigen such as a diphtheria toxoid [e.g. chapter 13 of ref. 78].
- - a tetanus antigen such as a tetanus toxoid [e.g. chapter 27 of ref. 78].
- N. gonorrhoeae an antigen from N. gonorrhoeae [e.g. 56, 57, 58].
- an antigen from Chlamydia pneumoniae e.g. 79, 80, 81, 82, 83, 84, 85].
- an antigen from Chlamydia frachomatis e.g. 86].
- rabies antigen(s) e.g. 90
- lyophilised inactivated virus e.g.9l, RabAvertTM
- - measles, mumps and/or rubella antigens [e.g. chapters 19, 20 and 26 of ref. 78].
- - influenza antigen(s) e.g. chapters 17 & 18 of ref. 78]
- haemagglutinin and/or neuraminidase surface proteins such as the haemagglutinin and/or neuraminidase surface proteins.
- Streptococcus pyogenes group A streptococcus [e.g. 93, 94, 95].
- an antigen from Staphylococcus aureus [e.g. 96].
- a saccharide or carbohydrate antigen is used, it is preferably conjugated to a carrier in order to enhance immunogenicity. Conjugation of H.influenzae B, meningococcal and pneumococcal saccharide antigens is well known.
- Toxic protein antigens may be detoxified where necessary ⁇ e.g. detoxification of pertussis toxin by chemical and/or genetic means [77]).
- a diphtheria antigen is included in the composition it is preferred also to include tetanus antigen and pertussis antigens.
- a tetanus antigen is included it is preferred also to include diphtheria and pertussis antigens.
- a pertussis antigen is included it is preferred also to include diphtheria and tetanus antigens.
- Antigens may be adsorbed to an aluminium salt.
- One type of preferred composition includes further antigens from sexually-transmitted pathogens, such as: herpesvirus; N. gonorrhoeae; papillomavirus; C. trachomatis; etc.
- Another type of preferred composition includes further antigens that affect the elderly and/or the immunocompromised, and so the GBS antigens of the invention can be combined with one or more antigens from the following non-GBS pathogens: influenza virus, Enterococcus faecalis, Staphylococcus aureus, Staphylococcus epidermis, Pseudomonas aeruginosa, Legionella pneumophila, Listeria monocytogenes, Neisseria meningitidis, and parainfluenza virus.
- influenza virus Enterococcus faecalis
- Staphylococcus aureus Staphylococcus epidermis
- Pseudomonas aeruginosa Legionella pneumophila
- Listeria monocytogenes Listeria monocytogenes
- Neisseria meningitidis and parainfluenza virus.
- Antigens in the composition will typically be present at a concentration of at least l ⁇ g/ml each. In general, the concentration of any given antigen will be sufficient to elicit an immune response against that antigen.
- nucleic acid encoding the antigen may be used [e.g. refs. 97 to 105]. Protein components of the compositions of the invention may thus be replaced by nucleic acid (preferably DNA e.g. in the form of a plasmid) that encodes the protein. In practical terms, there may be an upper limit to the number of antigens included in compositions of the invention.
- the number of antigens (including GBS antigens) in a composition of the invention may be less than 20, less than 19, less than 18, less than 17, less than 16, less than 15, less than 14, less than 13, less than 12, less than 11, less than 10, less than 9, less than 8, less than 7, less than 6, less than 5, less than 4, or less than 3.
- the number of GBS antigens in a composition of the invention may be less than 6, less than 5, or less than 4.
- the invention provides a pharmaceutical composition
- a pharmaceutical composition comprising (a) a conjugate of the invention and (b) a pharmaceutically acceptable carrier.
- Typical 'pharmaceutically acceptable carriers' include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition.
- Suitable carriers are typically large, slowly metabolised macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, sucrose [106], trehalose [107], lactose, and lipid aggregates (such as oil droplets or liposomes).
- Such carriers are well known to those of ordinary skill in the art.
- the vaccines may also contain diluents, such as water, saline, glycerol, etc.
- auxiliary substances such as wetting or emulsifying agents, pH buffering substances, and the like, may be present.
- Sterile pyrogen-free, phosphate-buffered physiologic saline is a typical carrier. A thorough discussion of pharmaceutically acceptable excipients is available in reference 108.
- compositions of the invention may be in aqueous form (i.e. solutions or suspensions) or in a dried form (e.g. lyophilised). If a dried vaccine is used then it will be reconstituted into a liquid medium prior to injection. Lyophilisation of conjugate vaccines is known in the art e.g. the MenjugateTM product is presented in lyophilised form, whereas NeisVac-CTM and MeningitecTM are presetned in aqueous form. To stabilise conjugates during lyophilisation, it may be preferred to include a sugar alcohol (e.g. mannitol) or a disaccharide (e.g. sucrose or trehalose) e.g.
- a sugar alcohol e.g. mannitol
- a disaccharide e.g. sucrose or trehalose
- compositions may be presented in vials, or they may be presented in ready-filled syringes.
- the syringes may be supplied with or without needles.
- a syringe will include a single dose of the composition, whereas a vial may include a single dose or multiple doses.
- compositions of the invention are also suitable for reconstituting other vaccines from a lyophilised form.
- the invention provides a kit, which may comprise two vials, or may comprise one ready-filled syringe and one vial, with the contents of the syringe being used to reactivate the contents of the vial prior to injection.
- compositions of the invention may be packaged in unit dose form or in multiple dose form.
- vials are preferred to pre-filled syringes.
- Effective dosage volumes can be routinely established, but a typical human dose of the composition has a volume of 0.5ml e.g. for for intramuscular injection.
- the pH of the composition is preferably between 6 and 8, preferably about 7. Stable pH may be maintained by the use of a buffer. If a composition comprises an aluminium hydroxide salt, it is preferred to use a histidine buffer [109].
- the composition may be sterile and/or pyrogen-free. Compositions of the invention may be isotonic with respect to humans.
- compositions of the invention are immunogenic, and are more preferably vaccine compositions.
- Vaccines according to the invention may either be prophylactic (i.e. to prevent infection) or therapeutic (i.e. to treat infection), but will typically be prophylactic.
- Immunogenic compositions used as vaccines comprise an immunologically effective amount of antigen(s), as well as any other components, as needed.
- 'immunologically effective amount' it is meant that the administration of that amount to an individual, either in a single dose or as part of a series, is effective for treatment or prevention. This amount varies depending upon the health and physical condition of the individual to be treated, age, the taxonomic group of individual to be treated (e.g.
- non-human primate, primate, etc. the capacity of the individual's immune system to synthesise antibodies, the degree of protection desired, the formulation of the vaccine, the treating doctor's assessment of the medical situation, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials.
- the quantity of an individual saccharide antigen will generally be between 1-50 ⁇ g (measured as mass of saccharide) e.g. about l ⁇ g, about 2.5 ⁇ g, about 4 ⁇ g, about 5 ⁇ g, or about lO ⁇ g.
- GBS affects various areas of the body and so the compositions of the invention may be prepared in various forms.
- the compositions may be prepared as injectables, either as liquid solutions or suspensions.
- the composition may be prepared for pulmonary administration e.g. as an inhaler, using a fine powder or a spray.
- the composition may be prepared as a suppository or pessary.
- the composition may be prepared for nasal, aural or ocular administration e.g.
- compositions of the invention may include an antimicrobial, particularly when packaged in multiple dose format.
- Compositions of the invention may comprise detergent e.g. a Tween (polysorbate), such as Tween 80.
- Detergents are generally present at low levels e.g. ⁇ 0.01%.
- Compositions of the invention may include sodium salts (e.g. sodium chloride) to give tonicity. A concentration of 10+2mg/ml NaCl is typical.
- compositions of the invention will generally include a buffer.
- a phosphate buffer is typical.
- compositions of the invention will generally be administered in conjunction with other immunoregulatory agents.
- compositions will usually include one or more adjuvants.
- adjuvants include, but are not limited to:
- Mineral containing compositions suitable for use as adjuvants in the invention include mineral salts, such as aluminium salts and calcium salts.
- the invention includes mineral salts such as hydroxides (e.g. oxyhydroxides), phosphates (e.g. hydroxyphosphates, orthophosphates), sulphates, etc. [e.g. see chapters 8 & 9 of ref. 117], or mixtures of different mineral compounds (e.g. a mixture of a phosphate and a hydroxide adjuvant, optionally with an excess of the phosphate), with the compounds taking any suitable form (e.g. gel, crystalline, amorphous, etc.), and with adsorption to the salt(s) being preferred.
- the mineral containing compositions may also be formulated as a particle of metal salt [118].
- Aluminum salts may be included in vaccines of the invention such that the dose of Al 3+ is between 0.2 and 1.0 mgper dose.
- a typical aluminium phosphate adjuvant is amorphous aluminium hydroxyphosphate with PO4/AI molar ratio between 0.84 and 0.92, included at 0.6mg Al 34 VmI.
- Adsorption with a low dose of aluminium phosphate may be used e.g. between 50 and lOO ⁇ g Al 3+ per conjugate per dose. Where an aluminium phosphate it used and it is desired not to adsorb an antigen to the adjuvant, this is favoured by including free phosphate ions in solution (e.g. by the use of a phosphate buffer).
- Oil emulsion compositions suitable for use as adjuvants in the invention include squalene-water emulsions, such as MF59 (5% Squalene, 0.5% Tween 80, and 0.5% Span 85, formulated into submicron particles using a microfluidizer) [Chapter 10 of ref. 117; see also refs. 119-121]. MF59 is used as the adjuvant in the FLU ADTM influenza virus trivalent subunit vaccine.
- Particularly preferred adjuvants for use in the compositions are submicron oil-in-water emulsions.
- Preferred submicron oil-in-water emulsions for use herein are squalene/water emulsions optionally containing varying amounts of MTP-PE, such as a submicron oil-in-water emulsion containing 4-5% w/v squalene, 0.25-1.0% w/v Tween 80 (polyoxyelthylenesorbitan monooleate), and/or 0.25-1.0% Span 85 (sorbitan trioleate), and, optionally, N-acetylmuramyl-L-alanyl-D-isogluatminyl-L-alanine- 2-(r-2'-dipalmitoyl-sn-glycero-3-hydroxyphosphophoryloxy)-ethylamine (MTP-PE).
- MTP-PE N-acetylmuramyl-L-alanyl
- CFA Complete Freund's adjuvant
- IFA incomplete Freund's adjuvant
- Saponin formulations may also be used as adjuvants in the invention.
- Saponins are a heterologous group of sterol glycosides and triterpenoid glycosides that are found in the bark, leaves, stems, roots and even flowers of a wide range of plant species. Saponins isolated from the bark of the Quillaia saponaria Molina tree have been widely studied as adjuvants. Saponin can also be commercially obtained from Smilax ornata (sarsaprilla), Gypsophilla paniculata (brides veil), and Saponaria officianalis (soap root).
- Saponin adjuvant formulations include purified formulations, such as QS21, as well as lipid formulations, such as ISCOMs.
- Saponin compositions have been purified using HPLC and RP-HPLC. Specific purified fractions using these techniques have been identified, including QS7, QS 17, QS 18, QS21, QH-A, QH-B and QH-C.
- the saponin is QS21.
- a method of production of QS21 is disclosed in ref. 124.
- Saponin formulations may also comprise a sterol, such as cholesterol [125]. Combinations of saponins and cholesterols can be used to form unique particles called immunostimulating complexs (ISCOMs) [chapter 23 of ref. 117].
- ISCOMs typically also include a phospholipid such as phosphatidylethanolamine or phosphatidylcholine.
- the ISCOM includes one or more of QuilA, QHA and QHC. ISCOMs are further described in refs. 125-127.
- the ISCOMS may be devoid of additional detergent(s) [128].
- Virosomes and virus-like particles can also be used as adjuvants in the invention.
- These structures generally contain one or more proteins from a virus optionally combined or formulated with a phospholipid. They are generally non-pathogenic, non-replicating and generally do not contain any of the native viral genome.
- the viral proteins may be recombinantly produced or isolated from whole viruses.
- viral proteins suitable for use in virosomes or VLPs include proteins derived from influenza virus (such as HA or NA), Hepatitis B virus (such as core or capsid proteins), Hepatitis E virus, measles virus, Sindbis virus, Rotavirus, Foot-and-Mouth Disease virus, Retrovirus, Norwalk virus, human Papilloma virus, HIV, RNA-phages, Q ⁇ -phage (such as coat proteins), GA- phage, fr-phage, AP205 phage, and Ty (such as retrotransposon Ty protein pi).
- influenza virus such as HA or NA
- Hepatitis B virus such as core or capsid proteins
- Hepatitis E virus measles virus
- Sindbis virus Rotavirus
- Foot-and-Mouth Disease virus Retrovirus
- Norwalk virus Norwalk virus
- human Papilloma virus HIV
- RNA-phages Q ⁇ -phage (such as coat proteins)
- GA- phage f-phage
- Adjuvants suitable for use in the invention include bacterial or microbial derivatives such as non-toxic derivatives of enterobacterial lipopolysaccharide (LPS), Lipid A derivatives, immunostimulatory oligonucleotides and ADP-ribosylating toxins and detoxified derivatives thereof.
- Non-toxic derivatives of LPS include monophosphoryl lipid A (MPL) and 3-0-deacylated MPL (3dMPL).
- 3dMPL is a mixture of 3 de-O-acylated monophosphoryl lipid A with 4, 5 or 6 acylated chains.
- a preferred "small particle" form of 3 De-O-acylated monophosphoryl lipid A is disclosed in ref. 138.
- 3dMPL small particles
- Other non-toxic LPS derivatives include monophosphoryl lipid A mimics, such as aminoalkyl glucosaminide phosphate derivatives e.g. RC-529 [139,140].
- Lipid A derivatives include derivatives of lipid A from Escherichia coli such as OM- 174.
- OM- 174 is described for example in refs. 141 & 142.
- Immunostimulatory oligonucleotides suitable for use as adjuvants in the invention include nucleotide sequences containing a CpG motif (a dinucleotide sequence containing an unmethylated cytosine linked by a phosphate bond to a guanosine). Double-stranded RNAs and oligonucleotides containing palindromic or poly(dG) sequences have also been shown to be immunostimulatory.
- the CpG' s can include nucleotide modifications/analogs such as phosphorothioate modifications and can be double-stranded or single-stranded.
- References 143, 144 and 145 disclose possible analog substitutions e.g. replacement of guanosine with 2'-deoxy-7-deazaguanosine.
- the adjuvant effect of CpG oligonucleotides is further discussed in refs. 146-151.
- the CpG sequence may be directed to TLR9, such as the motif GTCGTT or TTCGTT [152].
- the CpG sequence may be specific for inducing a ThI immune response, such as a CpG-A ODN, or it may be more specific for inducing a B cell response, such a CpG-B ODN.
- CpG-A and CpG-B ODNs are discussed in refs. 153-155.
- the CpG is a CpG-A ODN.
- the CpG oligonucleotide is constructed so that the 5' end is accessible for receptor recognition.
- two CpG oligonucleotide sequences may be attached at their 3' ends to form "immunomers". See, for example, refs. 152 & 156-158.
- Bacterial ADP-ribosylating toxins and detoxified derivatives thereof may be used as adjuvants in the invention.
- the protein is derived from E.coli ⁇ E.coli heat labile enterotoxin "LT"), cholera ("CT"), or pertussis ("PT").
- LT E.coli ⁇ E.coli heat labile enterotoxin
- CT cholera
- PT pertussis
- the use of detoxified ADP-ribosylating toxins as mucosal adjuvants is described in ref. 159 and as parenteral adjuvants in ref. 160.
- the toxin or toxoid is preferably in the form of a holotoxin, comprising both A and B subunits.
- the A subunit contains a detoxifying mutation; preferably the B subunit is not mutated.
- the adjuvant is a detoxified LT mutant such as LT-K63, LT-R72, and LT-G192.
- LT-K63 LT-K63
- LT-R72 LT-G192.
- ADP-ribosylating toxins and detoxified derivaties thereof, particularly LT-K63 and LT-R72, as adjuvants can be found in refs. 161-168.
- Numerical reference for amino acid substitutions is preferably based on the alignments of the A and B subunits of ADP-ribosylating toxins set forth in ref. 169, specifically incorporated herein by reference in its entirety.
- Human immunomodulators suitable for use as adjuvants in the invention include cytokines, such as interleukins ⁇ e.g. IL-I, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12 [170], etc.) [171], interferons (e.g. interferon- ⁇ ), macrophage colony stimulating factor, and tumor necrosis factor.
- cytokines such as interleukins ⁇ e.g. IL-I, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12 [170], etc.
- interferons e.g. interferon- ⁇
- macrophage colony stimulating factor e.g. interferon- ⁇
- tumor necrosis factor e.g., tumor necrosis factor.
- Bioadhesives and mucoadhesives may also be used as adjuvants in the invention.
- Suitable bioadhesives include esterified hyaluronic acid microspheres [172] or mucoadhesives such as cross-linked derivatives of poly(acrylic acid), polyvinyl alcohol, polyvinyl pyrollidone, polysaccharides and carboxymethylcellulose. Chitosan and derivatives thereof may also be used as adjuvants in the invention [173].
- Microparticles may also be used as adjuvants in the invention.
- Microparticles i.e. a particle of ⁇ 100nm to ⁇ 150 ⁇ m in diameter, more preferably ⁇ 200nm to ⁇ 30 ⁇ m in diameter, and most preferably ⁇ 500nm to ⁇ 10 ⁇ m in diameter
- materials that are biodegradable and non-toxic e.g. a poly( ⁇ -hydroxy acid), a polyhydroxybutyric acid, a polyorthoester, a polyanhydride, a polycaprolactone, etc.
- a negatively-charged surface e.g. with SDS
- a positively-charged surface e.g. with a cationic detergent, such as CTAB
- Liposomes Chosomes 13 & 14 ofref. 117
- liposome formulations suitable for use as adjuvants are described in refs. 174-176.
- Adjuvants suitable for use in the invention include polyoxyethylene ethers and polyoxyethylene esters [177]. Such formulations further include polyoxyethylene sorbitan ester surfactants in combination with an octoxynol [178] as well as polyoxyethylene alkyl ethers or ester surfactants in combination with at least one additional non-ionic surfactant such as an octoxynol [179].
- Preferred polyoxyethylene ethers are selected from the following group: polyoxyethylene-9-lauryl ether (laureth 9), polyoxyethylene-9-steoryl ether, polyoxytheylene-8-steoryl ether, polyoxyethylene-4- lauryl ether, polyoxyethylene-35-lauryl ether, and polyoxyethylene-23-lauryl ether.
- PCPP Polvphosphazene
- muramyl peptides suitable for use as adjuvants in the invention include N-acetyl- muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-no ⁇ nuramyl-L-alanyl-D-isoglutamine (nor- MDP), and N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(r-2'-dipalmitoyl-5/z-glycero-3- hydiOxyphosphoryloxy)-ethylamine MTP-PE).
- thr-MDP N-acetyl- muramyl-L-threonyl-D-isoglutamine
- nor- MDP N-acetyl-no ⁇ nuramyl-L-alanyl-D-isoglutamine
- N-MDP N-acetylmuramy
- Imiquamod and its homologues e,g. "Resiquimod 3M"
- refs. 182 and 183 described further in refs. 182 and 183.
- N. Thiosemicarbazone Compounds examples include those described in ref. 184.
- the thiosemicarbazones are particularly effective in the stimulation of human peripheral blood mononuclear cells for the production of cytokines, such as T ⁇ F- ⁇ .
- Tryptanthrin Compounds examples include those described in ref. 185.
- the tryptanthrin compounds are particularly effective in the stimulation of human peripheral blood mononuclear cells for the production of cytokines, such as T ⁇ F- ⁇ .
- the invention may also comprise combinations of aspects of one or more of the adjuvants identified above.
- the following combinations may be used as adjuvant compositions in the invention: (1) a saponin and an oil-in-water emulsion [186]; (2) a saponin ⁇ e.g. QS21) + a non-toxic
- LPS derivative e.g. 3dMPL [187]; (3) a saponin (e.g. QS21) + a non-toxic LPS derivative (e.g.
- 3dMPL 3dMPL + a cholesterol
- a saponin e.g. QS21
- 3dMPL + IL-12 optionally + a sterol
- RibiTM adjuvant system (RAS), (Ribi Immunochem) containing 2% squalene, 0.2% Tween 80, and one or more bacterial cell wall components from the group consisting of monophosphorylipid A
- MPL trehalose dimycolate
- CWS cell wall skeleton
- MPL + CWS DetoxTM
- one or more mineral salts such as an aluminum salt
- LPS (such as 3dMPL).
- compositions of the invention use a hydroxide adjuvant, whereas MeningitecTM uses a phosphate adjuvant. It is possible in compositions of the invention to adsorb some antigens to an aluminium hydroxide but to have other antigens in association with an aluminium phosphate. In general, however, it is preferred to use only a single salt e.g. a hydroxide or a phosphate, but not both. Not all conjugates need to be adsorbed i.e. some or all can be free in solution. Methods of treatment
- the invention also provides a method for raising an immune response in a mammal, comprising administering a pharmaceutical composition of the invention to the mammal.
- the immune response is preferably protective and preferably involves antibodies.
- the method may raise a booster response.
- the mammal is preferably a human.
- the vaccine is for prophylactic use, the human is preferably a child (e.g. a toddler or infant) or a teenager; where the vaccine is for therapeutic use, the human is preferably an adult.
- a vaccine intended for children may also be administered to adults e.g. to assess safety, dosage, immunogenicity, etc.
- a preferred class of humans for treatment are females of child-bearing age (e.g. teenagers and above). Another preferred class is pregnant females.
- the invention also provides a composition of the invention for use as a medicament.
- the medicament is preferably able to raise an immune response in a mammal (i.e. it is an immunogenic composition) and is more preferably a vaccine.
- the invention also provides the use of a conjugate of the invention in the manufacture of a medicament for raising an immune response in a mammal.
- a conjugate of the invention in the manufacture of a medicament for raising an immune response in a mammal.
- These uses and methods are preferably for the prevention and/or treatment of a disease caused by S.agalactiae e.g. neonatal sepsis or bacteremia, neonatal pneumonia, neonatal meningitis, endometritis, osteomyelitis, septic arthritis, etc.
- a conjugate may be administered to a female (before or during pregnancy) in order to protect offspring (so-called 'maternal immunisation' [190-192]).
- compositions of the invention can confer an antibody titre in a patient that is superior to the criterion for seroprotection for each antigenic component for an acceptable percentage of human subjects.
- Antigens with an associated antibody titre above which a host is considered to be seroconverted against the antigen are well known, and such titres are published by organisations such as WHO.
- Preferably more than 80% of a statistically significant sample of subjects is seroconverted, more preferably more than 90%, still more preferably more than 93% and most preferably 96-100%.
- compositions of the invention will generally be administered directly to a patient.
- Direct delivery may be accomplished by parenteral injection (e.g. subcutaneously, intraperitoneal Iy, intravenously, intramuscularly, or to the interstitial space of a tissue), or by rectal, oral, vaginal, topical, transdermal, intranasal, ocular, aural, pulmonary or other mucosal administration.
- Intramuscular administration to the thigh or the upper arm is preferred.
- Injection may be via a needle (e.g. a hypodermic needle), but needle-free injection may alternatively be used.
- a typical intramuscular dose is 0.5 ml.
- the invention may be used to elicit systemic and/or mucosal immunity.
- Dosage treatment can be a single dose schedule or a multiple dose schedule. Multiple doses may be used in a primary immunisation schedule and/or in a booster immunisation schedule. A primary dose schedule may be followed by a booster dose schedule. Suitable timing between priming doses (e.g. between 4-16 weeks), and between priming and boosting, can be routinely determined.
- GBS proteins can be included in compositions of the invention. These may be used as carrier proteins for conjugates of the invention, carrier proteins for other conjugates, or as unconjugated protein antigens.
- GBS protein antigens for use with the invention include those disclosed in references 93 and 193- 195.
- Five preferred GBS protein antigens for use with the invention are known as: GBS67; GBS80; GBS104; GBS276; and GBS322 [see ref. 93]. Further details of these five antigens are given below.
- the full-length sequences for these five GBS proteins are SEQ ID NOs 1 to 5 herein.
- compositions of the invention may thus include (a) a polypeptide comprising an amino acid sequence selected from SEQ ID NOs 1 to 5, and/or (b) a polypeptide comprising (i) an amino acid sequence that has sequence identity to one or more of SEQ ID NOs 1 to 5 and/or (ii) a fragment of SEQ ID NOs 1 to 5.
- the degree of sequence identity in (i) is preferably greater than 50% (e.g. 60%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more).
- polypeptides include homologs, orthologs, allelic variants and functional mutants.
- the fragments of (ii) should comprise at least n consecutive amino acids from the sequences and, depending on the particular sequence, n is 7 or more (e.g. 8, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 or more).
- the fragment may comprise at least one T-cell or, preferably, a B-cell epitope of the sequence.
- T- and B-cell epitopes can be identified empirically (e.g. using PEPSCAN [196,197] or similar methods), or they can be predicted (e.g.
- SEQ ID NOs 1 to 5 without their N-terminal amino acid residue or without their N-terminal signal peptide. Removal of one or more domains, such as a leader or signal sequence region, a transmembrane region, a cytoplasmic region or a cell wall anchoring motif can be used. Preferred fragments are given below (SEQ ID NOs 6 to 19).
- polypeptide may, compared to SEQ ID NOs 1 to 5, include one or more (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) conservative amino acid replacements i.e. replacements of one amino acid with another which has a related side chain.
- conservative amino acid replacements i.e. replacements of one amino acid with another which has a related side chain.
- Genetically-encoded amino acids are generally divided into four families: (1) acidic i.e. aspartate, glutamate; (2) basic i.e. lysine, arginine, histidine; (3) non-polar i.e. alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan; and (4) uncharged polar i.e.
- polypeptides may also include one or more (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) single amino acid deletions relative to SEQ ID NOs 1 to 5.
- polypeptides may also include one or more (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.) insertions (e.g. each of 1, 2, 3, 4 or 5 amino acids) relative to the SEQ ID NOs 1 to 5.
- Polypeptides of the invention can be prepared in many ways e.g. by chemical synthesis (in whole or in part), by digesting longer polypeptides using proteases, by translation from RNA, by purification from cell culture (e.g. from recombinant expression), from the organism itself (e.g. after bacterial culture, or direct from patients), etc.
- a preferred method for production of peptides ⁇ 40 amino acids long involves in vitro chemical synthesis [209,210].
- Solid-phase peptide synthesis is particularly preferred, such as methods based on tBoc or Fmoc [211] chemistry.
- Enzymatic synthesis [212] may also be used in part or in full.
- biological synthesis may be used e.g.
- the polypeptides may be produced by translation. This may be carried out in vitro or in vivo. Biological methods are in general restricted to the production of polypeptides based on L-amino acids, but manipulation of translation machinery (e.g. of aminoacyl tRNA molecules) can be used to allow the introduction of D-amino acids (or of other non natural amino acids, such as iodotyrosine or methylphenylalanine, azidohomoalanine, etc.) [213]. Where D-amino acids are included, however, it is preferred to use chemical synthesis. Polypeptides of the invention may have covalent modifications at the C-terminus and/or N-terminus.
- GBS proteins can take various forms (e.g. native, fusions, glycosylated, non-glycosylated, lipidated, non-lipidated, phosphorylated, non-phosphorylated, myristoylated, non-myristoylated, monomeric, multimeric, particulate, denatured, etc.). They are preferably used in purified or substantially purified form i.e. substantially free from other polypeptides (e.g. free from naturally-occurring polypeptides), particularly from other GBS or host cell polypeptides).
- Nucleotide and amino acid sequence of GBS67 sequenced from serotype V strain 2603 V/R are set forth in ref. 93 as SEQ ID NOs 3745 & 3746.
- the amino acid sequence is SEQ ID NO:1 herein: MRKYQKFSKILTLSLFCLSQIPLNTNVLGESTVPENGAKGKL WKKTDDQNKPLSKATFVL KTTAHPESKIEKVT AELT
- GBS67 contains a C-terminus transmembrane region which is indicated by the underlined region closest to the C-terminus of SEQ ID NO: 1 above.
- One or more amino acids from the transmembrane region may be removed, or the amino acid may be truncated before the transmembrane region.
- An example of such aGBS67 fragment is setforth below as SEQ IDNO: 18.
- GBS67 contains an amino acid motif indicative of a cell wall anchor, shown in italics in SEQ ID NO: 1 above. In some recombinant host cell systems, it may be preferable to remove this motif to facilitate secretion of a recombinant GBS67 protein from the host cell. Accordingly, in one preferred fragment of GBS67 for use in the invention, the transmembrane and the cell wall anchor motif are removed from GBS67.
- SEQ ID NO: 19 An example of such a GBS67 fragment is set forth below as SEQ ID NO: 19.
- GBS80 GBS80 refers to a putative cell wall surface anchor family protein. Nucleotide and amino acid sequence of GBS80 sequenced from serotype V isolated strain 2603 V/R are set forth in ref.93 as SEQ ID NOs 8779 & 8780. The amino acid sequence is set forth below as SEQ IDNO: 2:
- GBS80 contains a N-terminal leader or signal sequence region which is indicated by the underlined sequence above. One or more amino acids from the leader or signal sequence region of GBS80 can be removed.
- An example of such a GBS80 fragment is set forth below as SEQ ID NO: 6:
- GBS80 contains a C-terminal transmembrane region which is indicated by the underlined sequence near the end of SEQ ID NO: 2 above.
- An example of such afragment is setforthbelow as SEQ IDNO:7:
- GBS80 contains an amino acid motifindicative of a cell wall anchor, shown in italics in SEQ ID NO: 2 above. In some recombinant host cell systems, it may be preferable to remove this motif to facilitate secretion of a recombinant GBS80 protein from the host cell. Thus the transmembrane and/or cytoplasmic regions andthe cell wall anchormotifmay be removed from GBS80.
- An example of such a fragment is setforth belowas SEQIDNO: 8.
- the leader or signal sequence region, the transmembrane and cytoplasmic regions and the cell wall anchor motif are removed from the GBS80 sequence.
- An example of such a GBS80 fragment is set forth below as SEQ ID NO: 9:
- GBS104 refers to a putative cell wall surface anchor family protein. It has been referred to as emaA.
- the amino acid sequence is SEQ DDNO: 3 herein:
- GBS104 contains an N-terminal leader or signal sequence region which is indicated by the underlined sequence at the beginning ofSEQ ID NO: 3 above. One or more amino acids from the leader or signal sequenceregion ofGBS104 may be removed.
- An example of such aGBS104 fragment is setforth below as SEQ IDNO 11.
- GBS104 contains a C-terminal transmembrane and/or cytoplasmic region which is indicated by the underlined region near the end of SEQ ID NO:3 above. One or more amino acids from the transmembrane or cytoplasmic regions may be removed.
- An example of such a GBS104 fragment is set forth below as SEQ DDNO 12:
- GBS104 include an 830 amino acid fragment of GBS104 of amino acids 28-858 (numbered by SEQ ID NO: 3), a 359 amino acid fragment of GBS104 of amino acids 28-387, a 581 amino acid fragment of GBS 104 of amino acids 28-609, or a 740 amino acid fragment of GBS 104 of amino acids 28-768.
- GBS276 refers to a C5a peptidase. Further description of GBS276 can be found in references 214-217. Nucleotide and amino acid sequences ofGBS276 sequenced from serotypeV isolated strain 2603 V/Rare setforth inRef.93 as SEQIDNOs 8941 & 8942. The amino acidsequence is SEQ IDNO: 4herein:
- GBS276 contains an N-terminal leader or signal sequence region which is indicated by the underlined sequence at the beginning ofSEQ ID NO: 4 above. One or more amino acids from the leader or signal sequence region ofGBS276 maybe removed.
- An example of such a GBS276 fragment is setforth below as SEQ IDNO: 14:
- GBS276 One ormore amino acids fromthe leader orsignal sequence region and one ormore amino acids fromthe transmembrane or cytoplasmic regions of GBS276 may be removed.
- An example of such a GBS276 fragment is setforthbelow as SEQ IDNO: 16:
- GBS322 refers to a surface immunogenic protein, also referred to as 'sip'.
- Nucleotide and amino acid sequences of GBS322 sequenced from serotype V isolated strain 2603 WR are set forth in Ref. 93 as SEQ ID NOs 8539 & 8540.
- the amino acid sequence is SEQ ID NO: 5 herein:
- composition comprising X may consist exclusively of X or may include something additional e.g. X + Y.
- the word “substantially” does not exclude “completely” e.g. a composition which is “substantially free” from Y may be completely free from Y. Where necessary, the word “substantially” may be omitted from the definition of the invention.
- the invention provides a process involving multiple sequential steps, the invention can also provide a process involving less than the total number of steps.
- the invention provides a process comprising the steps of: (a) oxidising a GBS capsular saccharide in order to introduce an aldehyde group into a terminal sialic acid residue; and (b) subjecting the aldehyde group to reductive amination.
- steps (c) and (d) need not be performed in order to fall within the scope of the invention, as the product of steps (a) and (b) has utility as an intermediate in conjugate preparation, and may be used, stored, exported, etc. for separate and later use e.g. in steps (c) and (d).
- the invention encompasses processes involving only the later steps of a method.
- the invention encompasses a process comprising a step of coupling a modified galactose residue to a carrier molecule, in which the starting material for the process is a saccharide that was previously oxidised to introduce an aldehyde group into a galactose residue.
- a primary amine can be represented by formula NH 2 R.
- the R group will preferably be electron donating, and includes Ci -8 hydrocarbyl, more preferably Ci -8 alkyl, especially methyl.
- R is preferably -CH 3 , -C 2 H 5 or -C 3 H 7 .
- hydrocarbyP includes linear, branched or cyclic monovalent groups consisting of carbon and hydrogen.
- Hydrocarbyl groups thus include alkyl, alkenyl and alkynyl groups, cycloalkyl (including polycycloalkyl), cycloalkenyl and aryl groups and combinations thereof, e.g. alkylcycloalkyl, alkylpolycycloalkyl, alkylaryl, alkenylaryl, cycloalkylaryl, cycloalkenylaryl, cycloalkylalkyl, polycycloalkylalkyl, arylalkyl, arylalkenyl, aryl cycloalkyl and arylcycloalkenyl groups.
- Preferred hydrocarbyl are Ci -I4 hydrocarbyl, more preferably C ⁇ .% hydrocarbyl.
- Figure 1 shows periodate oxidation of a terminal sialic acid residue.
- Figure 2 illustrates the first and second aspects of the invention.
- Figure 3 shows the repeating structures of capsular saccharides in GBS serotypes Ia, Ib, II, III & V.
- Figure 4 shows the difference between the repeating structures in GBS serotypes Ia and III.
- Figure 5 shows two types of conjugate that can be prepared.
- Figure 6 shows a preferred conjugation reaction using the succinimidyl diester of adipic acid, according to the first aspect of the invention.
- Figure 7 shows a preferred conjugation reaction using the succinimidyl diester of adipic acid, according to the second aspect of the invention.
- Figures 8 and 9 shows the use of (8) acryloylation and (9) a haloacylhalide, to prepare conjugates, after reductive amination of an aldehyde formed by oxidation of a terminal sialic acid residue.
- Capsular saccharide from GBS serotype Ib was purified as described in reference 15 and then re-acetylated as described above.
- the saccharide was de-N-acetylated to provide amine groups for linking. These amine groups were used to covalently conjugate the saccharides to monomeric tetanus toxoid (TT) either by direct reductive amination (on C8 of sialic acid, as described in the prior art) or via a SIDEA spacer (as described for meningococcal saccharides in ref. 218).
- Sialic acid content in the conjugates was determined was performed according to the colorimetric method of ref. 219. The total saccharide amount was extrapolated from sialic acid content (sialic acids are on average 31% by weight of the polymer). Protein concentration in the conjugate was determined with the Micro BCA Protein Assay Kit (Pierce). A polysaccharide :protein weight ratio of between 1 and 4 was the target, and results were as follows:
- CRMl 97 and tetanus toxoid were both used as carriers for GBS type III saccharide, and results were:
- Conjugates of type Ia, Ib and III were made using four different carriers: tetanus toxoid; CRM197; GBS80; and GBS67. With the tetanus and CRM carriers the %s oxidation were 9.1% for Ia, 14.2% for Ib and 13% for III; with the GBS carriers the %s were 8.2%, 9.0% and 7.9%. Animals immunised with the conjugates were then tested for protection against the respective GBS types (i.e. homologous challenge), and results were as follows, expressed as the % of animals surviving lethal challenge:
- GBS carriers were able to provide some protection against the type V strain, and so the use of GBS proteins as carriers offers a background level of protein-mediated protection which can be supplemented by saccharides conjugated to the protein.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Immunology (AREA)
- Molecular Biology (AREA)
- Organic Chemistry (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Toxicology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Virology (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
- Immobilizing And Processing Of Enzymes And Microorganisms (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| NZ560432A NZ560432A (en) | 2005-02-01 | 2006-02-01 | Conjugation of streptococcal capusular saccharides |
| CA2596683A CA2596683C (en) | 2005-02-01 | 2006-02-01 | Conjugation of streptococcal capsular saccharides |
| JP2007553744A JP5390103B2 (ja) | 2005-02-01 | 2006-02-01 | 連鎖球菌性莢膜糖の複合 |
| CN200680007342XA CN101304765B (zh) | 2005-02-01 | 2006-02-01 | 链球菌荚膜糖的偶联 |
| EP06727404A EP1846038A2 (en) | 2005-02-01 | 2006-02-01 | Conjugation of streptococcal capsular saccharides |
| AU2006211052A AU2006211052B2 (en) | 2005-02-01 | 2006-02-01 | Conjugation of streptococcal capsular saccharides |
| MX2007009277A MX2007009277A (es) | 2005-02-01 | 2006-02-01 | Conjugacion de sacarido capsular estreptococico. |
| EP18194584.1A EP3498302A1 (en) | 2005-02-01 | 2006-02-01 | Conjugation of streptococcal capsular saccharides to carrier proteins |
| US11/883,614 US8513392B2 (en) | 2005-02-01 | 2006-02-01 | Conjugation of streptococcal capsular saccharides |
| IL184981A IL184981A (en) | 2005-02-01 | 2007-08-01 | A pair of streptococcal capsular saccharides |
| ZA2007/06969A ZA200706969B (en) | 2005-02-01 | 2007-08-20 | Conjugation of Streptococcal capsular saccharides |
| US13/912,919 US9040055B2 (en) | 2005-02-01 | 2013-06-07 | Conjugation of streptococcal capsular saccharides |
| US14/707,147 US9675691B2 (en) | 2005-02-01 | 2015-05-08 | Conjugation of streptococcal capsular saccharides |
| US15/592,339 US10188719B2 (en) | 2005-02-01 | 2017-05-11 | Conjugation of Streptococcal capsular saccharides |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GB0502095.3 | 2005-02-01 | ||
| GBGB0502095.3A GB0502095D0 (en) | 2005-02-01 | 2005-02-01 | Conjugation of streptococcal capsular saccharides |
Related Child Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US11/883,614 A-371-Of-International US8513392B2 (en) | 2005-02-01 | 2006-02-01 | Conjugation of streptococcal capsular saccharides |
| EP18194584.1A Previously-Filed-Application EP3498302A1 (en) | 2005-02-01 | 2006-02-01 | Conjugation of streptococcal capsular saccharides to carrier proteins |
| US13/912,919 Division US9040055B2 (en) | 2005-02-01 | 2013-06-07 | Conjugation of streptococcal capsular saccharides |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2006082530A2 true WO2006082530A2 (en) | 2006-08-10 |
| WO2006082530A3 WO2006082530A3 (en) | 2008-07-03 |
Family
ID=34307820
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2006/000756 Ceased WO2006082530A2 (en) | 2005-02-01 | 2006-02-01 | Conjugation of streptococcal capsular saccharides to carrier proteins |
Country Status (12)
| Country | Link |
|---|---|
| US (4) | US8513392B2 (https=) |
| EP (2) | EP1846038A2 (https=) |
| JP (3) | JP5390103B2 (https=) |
| CN (2) | CN101304765B (https=) |
| AU (1) | AU2006211052B2 (https=) |
| CA (2) | CA2830588A1 (https=) |
| GB (1) | GB0502095D0 (https=) |
| IL (1) | IL184981A (https=) |
| MX (1) | MX2007009277A (https=) |
| NZ (1) | NZ560432A (https=) |
| WO (1) | WO2006082530A2 (https=) |
| ZA (1) | ZA200706969B (https=) |
Cited By (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1937304A2 (en) * | 2005-08-24 | 2008-07-02 | Novartis Vaccines and Diagnostics S.r.l. | Zwitterionization of capsular saccharides |
| WO2010049806A1 (en) | 2008-10-27 | 2010-05-06 | Novartis Ag | Purification method |
| JP2010515718A (ja) * | 2007-01-11 | 2010-05-13 | ノバルティス アーゲー | 修飾糖類 |
| WO2011110531A3 (en) * | 2010-03-09 | 2012-03-08 | Glaxosmithkline Biologicals S.A. | Conjugation process of bacterial polysaccharides to carrier proteins |
| US8137673B2 (en) | 2000-10-27 | 2012-03-20 | Novartis Vaccines And Diagnostics, Inc. | Nucleic acids and proteins from Streptococcus groups A & B |
| WO2012035519A1 (en) | 2010-09-16 | 2012-03-22 | Novartis Ag | Immunogenic compositions |
| WO2013009564A1 (en) * | 2011-07-08 | 2013-01-17 | Novartis Ag | Tyrosine ligation process |
| WO2013088378A2 (en) | 2011-12-12 | 2013-06-20 | Novartis Ag | Method of detecting the presence of an antibody in a sample |
| EP2659912A2 (en) | 2007-07-17 | 2013-11-06 | Novartis AG | Conjugate purification |
| WO2014053607A1 (en) | 2012-10-03 | 2014-04-10 | Novartis Ag | Immunogenic compositions |
| WO2014111344A1 (en) * | 2013-01-15 | 2014-07-24 | Novartis Ag | Cycloalkyne derivatized saccharides |
| US8858957B2 (en) | 2007-09-12 | 2014-10-14 | Novartis Ag | GAS57 mutant antigens and GAS57 antibodies |
| US8945589B2 (en) | 2003-09-15 | 2015-02-03 | Novartis Vaccines And Diagnostics, Srl | Immunogenic compositions for Streptococcus agalactiae |
| US9056912B2 (en) | 2003-07-31 | 2015-06-16 | Novartis Vaccines And Diagnostics, Srl | Immunogenic compositions for Streptococcus pyogenes |
| EP3034516A1 (en) | 2014-12-19 | 2016-06-22 | Novartis AG | Purification of streptococcal capsular polysaccharide |
| WO2016178123A1 (en) | 2015-05-04 | 2016-11-10 | Pfizer Inc. | Group b streptococcus polysaccharide-protein conjugates, methods for producing conjugates, immunogenic compositions comprising conjugates, and uses thereof |
| RU2605834C2 (ru) * | 2012-06-20 | 2016-12-27 | Ск Кемикалс Ко., Лтд. | Поливалентная композиция, содержащая конъюгаты пневмококковый полисахарид-белок |
| RU2606152C1 (ru) * | 2012-12-11 | 2017-01-10 | Ск Кемикалс Ко., Лтд. | Мультивалентная композиция на основе конъюгатов пневмококковый полисахарид-белок |
| WO2018087635A1 (en) | 2016-11-09 | 2018-05-17 | Pfizer Inc. | Immunogenic polysaccharide protein conjugated comprising a polysaccharide derived from b streptococcus gbs |
| WO2019030271A1 (en) * | 2017-08-10 | 2019-02-14 | Glaxosmithkline Biologicals Sa | NOMV MULTI-FUNCTIONALIZED CONJUGATES |
| EP3347042A4 (en) * | 2015-09-10 | 2019-02-20 | Inventprise, LLC. | MULTIVALENT PPV CONJUGATES |
| US10258579B2 (en) | 2012-03-14 | 2019-04-16 | Nanovelos Sp. Z O.O. | Process for the preparation of polysaccharide nanoparticles |
| WO2020229964A1 (en) | 2019-05-10 | 2020-11-19 | Glaxosmithkline Biologicals Sa | Conjugate production |
| WO2021250628A1 (en) | 2020-06-12 | 2021-12-16 | Glaxosmithkline Biologicals Sa | Bacterial immunization using nanoparticle vaccine |
| WO2023111826A1 (en) | 2021-12-14 | 2023-06-22 | Glaxosmithkline Biologicals Sa | Bacterial immunization using qbeta hairpin nanoparticle constructs |
| EP3817775B1 (en) * | 2018-07-04 | 2024-09-04 | Vaxcyte, Inc. | Improvements in immunogenic conjugates |
| US12239697B2 (en) | 2018-06-11 | 2025-03-04 | Inventprise, Inc. | Virus-like particle conjugates |
| US12252454B2 (en) | 2020-08-19 | 2025-03-18 | Vaxcyte, Inc. | Carrier-protein polysaccharide conjugation methods |
| WO2025172892A1 (en) | 2024-02-16 | 2025-08-21 | Glaxosmithkline Biologicals Sa | Modified proteins and methods |
Families Citing this family (21)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CZ20024224A3 (cs) * | 2000-06-29 | 2003-05-14 | Glaxosmithkline Biologicals S. A. | Farmaceutický prostředek |
| US7527797B1 (en) | 2000-09-01 | 2009-05-05 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Vibrio cholerae 0139 conjugate vaccines |
| GB0502095D0 (en) | 2005-02-01 | 2005-03-09 | Chiron Srl | Conjugation of streptococcal capsular saccharides |
| PE20110072A1 (es) * | 2005-06-27 | 2011-02-04 | Glaxosmithkline Biolog Sa | Composicion inmunogenica |
| JP5666310B2 (ja) * | 2008-12-03 | 2015-02-12 | 株式会社カネカ | ホルミル基含有多孔質担体、それを用いた吸着体、およびそれらの製造方法 |
| GB201003333D0 (en) * | 2010-02-26 | 2010-04-14 | Novartis Ag | Immunogenic proteins and compositions |
| GB201103836D0 (en) * | 2011-03-07 | 2011-04-20 | Glaxosmithkline Biolog Sa | Conjugation process |
| US9358284B2 (en) | 2011-09-14 | 2016-06-07 | Glaxosmithkline Biologicals Sa | Methods for making saccharide-protein glycoconjugates |
| TR201808684T4 (tr) * | 2012-10-02 | 2018-07-23 | Glaxosmithkline Biologicals Sa | Lineer olmayan sakarit konjügatları. |
| US11160855B2 (en) | 2014-01-21 | 2021-11-02 | Pfizer Inc. | Immunogenic compositions comprising conjugated capsular saccharide antigens and uses thereof |
| MX2017001638A (es) * | 2014-08-05 | 2017-04-27 | Glaxosmithkline Biologicals Sa | Molecula portadora para antigenos. |
| JP2018522978A (ja) * | 2015-07-01 | 2018-08-16 | グラクソスミスクライン バイオロジカルズ ソシエテ アノニム | 免疫原性組成物 |
| KR102225282B1 (ko) * | 2015-07-21 | 2021-03-10 | 화이자 인코포레이티드 | 접합된 캡슐형 사카라이드 항원을 포함하는 면역원성 조성물, 그를 포함하는 키트 및 그의 용도 |
| BE1024634B1 (fr) * | 2016-04-05 | 2018-05-14 | Gsk Vaccines S.R.L. | Compositions immunogenes |
| CN107955079B (zh) * | 2017-11-08 | 2020-05-01 | 江南大学 | 双聚唾液酸仿生材料及其制备方法 |
| CN109045292A (zh) * | 2018-11-08 | 2018-12-21 | 山东大学 | 一种a群链球菌寡糖蛋白缀合物及其制备方法与应用 |
| CA3152520A1 (en) * | 2019-08-27 | 2021-03-04 | OneBioPharma, Inc. | Antimicrobial vaccine compositions |
| US11173199B2 (en) | 2019-11-13 | 2021-11-16 | Alopexx Inc. | Low contaminant compositions |
| CN111909279B (zh) * | 2020-08-14 | 2022-06-24 | 石河子大学 | 一种金黄色葡萄球菌与无乳链球菌免疫原融合表达及其应用 |
| CN112939164B (zh) * | 2021-03-15 | 2022-05-24 | 广西大学 | 海产养殖水体的消毒方法 |
| CN118453847A (zh) * | 2024-05-22 | 2024-08-09 | 中国人民解放军军事科学院军事医学研究院 | Sip蛋白在制备荚膜多糖结合疫苗中的应用、及包含Sip蛋白的偶联物及其制备方法和应用 |
Family Cites Families (113)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4057685A (en) | 1972-02-02 | 1977-11-08 | Abbott Laboratories | Chemically modified endotoxin immunizing agent |
| US4356170A (en) * | 1981-05-27 | 1982-10-26 | Canadian Patents & Development Ltd. | Immunogenic polysaccharide-protein conjugates |
| SE8205892D0 (sv) | 1982-10-18 | 1982-10-18 | Bror Morein | Immunogent membranproteinkomplex, sett for framstellning och anvendning derav som immunstimulerande medel och sasom vaccin |
| US4761283A (en) * | 1983-07-05 | 1988-08-02 | The University Of Rochester | Immunogenic conjugates |
| US5916588A (en) | 1984-04-12 | 1999-06-29 | The Liposome Company, Inc. | Peptide-containing liposomes, immunogenic liposomes and methods of preparation and use |
| US6090406A (en) | 1984-04-12 | 2000-07-18 | The Liposome Company, Inc. | Potentiation of immune responses with liposomal adjuvants |
| JPS626698A (ja) * | 1985-07-03 | 1987-01-13 | Hayashibara Biochem Lab Inc | ガラクチト−ルの測定方法 |
| IT1187753B (it) | 1985-07-05 | 1987-12-23 | Sclavo Spa | Coniugati glicoproteici ad attivita' immunogenica trivalente |
| US5057540A (en) | 1987-05-29 | 1991-10-15 | Cambridge Biotech Corporation | Saponin adjuvant |
| US5785973A (en) * | 1988-02-01 | 1998-07-28 | Praxis Biologics, Inc. | Synthetic peptides representing a T-cell epitope as a carrier molecule for conjugate vaccines |
| AU631377B2 (en) | 1988-08-25 | 1992-11-26 | Liposome Company, Inc., The | Affinity associated vaccine |
| DE3841091A1 (de) | 1988-12-07 | 1990-06-13 | Behringwerke Ag | Synthetische antigene, verfahren zu ihrer herstellung und ihre verwendung |
| CA2006700A1 (en) | 1989-01-17 | 1990-07-17 | Antonello Pessi | Synthetic peptides and their use as universal carriers for the preparation of immunogenic conjugates suitable for the development of synthetic vaccines |
| CA2017507C (en) | 1989-05-25 | 1996-11-12 | Gary Van Nest | Adjuvant formulation comprising a submicron oil droplet emulsion |
| KR920703114A (ko) | 1989-07-14 | 1992-12-17 | 원본미기재 | 접합체 백신을 위한 시토킨 및 호르몬 운반체 |
| IT1237764B (it) | 1989-11-10 | 1993-06-17 | Eniricerche Spa | Peptidi sintetici utili come carriers universali per la preparazione di coniugati immunogenici e loro impiego per lo sviluppo di vaccini sintetici. |
| SE466259B (sv) | 1990-05-31 | 1992-01-20 | Arne Forsgren | Protein d - ett igd-bindande protein fraan haemophilus influenzae, samt anvaendning av detta foer analys, vacciner och uppreningsaendamaal |
| ES2127198T3 (es) * | 1990-08-02 | 1999-04-16 | Antex Biolog Inc | Receptores de adhesion para microorganismos patogenos u oportunistas. |
| ATE128628T1 (de) | 1990-08-13 | 1995-10-15 | American Cyanamid Co | Faser-hemagglutinin von bordetella pertussis als träger für konjugierten impfstoff. |
| US5153312A (en) | 1990-09-28 | 1992-10-06 | American Cyanamid Company | Oligosaccharide conjugate vaccines |
| IT1262896B (it) | 1992-03-06 | 1996-07-22 | Composti coniugati formati da proteine heat shock (hsp) e oligo-poli- saccaridi, loro uso per la produzione di vaccini. | |
| CA2138997C (en) | 1992-06-25 | 2003-06-03 | Jean-Paul Prieels | Vaccine composition containing adjuvants |
| IL102687A (en) | 1992-07-30 | 1997-06-10 | Yeda Res & Dev | Conjugates of poorly immunogenic antigens and synthetic pepide carriers and vaccines comprising them |
| EP0667787B1 (en) * | 1992-09-24 | 2001-07-18 | Brigham And Women's Hospital | Group b streptococcus type ii and type v polysaccharide-protein conjugate vaccines |
| ZA937034B (en) | 1992-09-24 | 1995-06-23 | Brigham & Womens Hospital | Group B streptococcus type II and type V polysaccharide-protein conjugate vaccines |
| US5776468A (en) | 1993-03-23 | 1998-07-07 | Smithkline Beecham Biologicals (S.A.) | Vaccine compositions containing 3-0 deacylated monophosphoryl lipid A |
| GB9326174D0 (en) | 1993-12-22 | 1994-02-23 | Biocine Sclavo | Mucosal adjuvant |
| GB9326253D0 (en) | 1993-12-23 | 1994-02-23 | Smithkline Beecham Biolog | Vaccines |
| US6239116B1 (en) | 1994-07-15 | 2001-05-29 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
| US6207646B1 (en) | 1994-07-15 | 2001-03-27 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
| US6429199B1 (en) | 1994-07-15 | 2002-08-06 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules for activating dendritic cells |
| AUPM873294A0 (en) | 1994-10-12 | 1994-11-03 | Csl Limited | Saponin preparations and use thereof in iscoms |
| IL117483A (en) | 1995-03-17 | 2008-03-20 | Bernard Brodeur | MENINGITIDIS NEISSERIA shell protein is resistant to proteinase K. |
| UA56132C2 (uk) | 1995-04-25 | 2003-05-15 | Смітклайн Бічем Байолоджікалс С.А. | Композиція вакцини (варіанти), спосіб стабілізації qs21 відносно гідролізу (варіанти), спосіб приготування композиції вакцини |
| US6284884B1 (en) * | 1995-06-07 | 2001-09-04 | North American Vaccine, Inc. | Antigenic group B streptococcus type II and type III polysaccharide fragments having a 2,5-anhydro-D-mannose terminal structure and conjugate vaccine thereof |
| TR199701547T1 (xx) | 1995-06-07 | 1998-03-21 | Smithkline Beecham Biologicals S.A. | Polisakarit antijen protein e�leni�i i�eren a��. |
| GB9513261D0 (en) | 1995-06-29 | 1995-09-06 | Smithkline Beecham Biolog | Vaccines |
| DK1005368T3 (da) | 1997-03-10 | 2010-01-04 | Ottawa Hospital Res Inst | Anvendelse af nukleinsyrer, der indeholder ikke-metyleret CpG dinukleotid i kombination med alun som hjælpestoffer |
| US6426074B1 (en) * | 1997-03-19 | 2002-07-30 | The Brigham And Women's Hospital Inc. | Group B Streptococcus vaccine |
| US6818222B1 (en) | 1997-03-21 | 2004-11-16 | Chiron Corporation | Detoxified mutants of bacterial ADP-ribosylating toxins as parenteral adjuvants |
| US6299881B1 (en) | 1997-03-24 | 2001-10-09 | Henry M. Jackson Foundation For The Advancement Of Military Medicine | Uronium salts for activating hydroxyls, carboxyls, and polysaccharides, and conjugate vaccines, immunogens, and other useful immunological reagents produced using uronium salts |
| EP0977764A4 (en) | 1997-03-26 | 2001-04-11 | Brigham & Womens Hospital | PROCESS FOR PRODUCING SACCHARIDE FRAGMENTS |
| PT970114E (pt) * | 1997-04-18 | 2006-12-29 | Novartis Ag | Neoglicoproteínas |
| GB9712347D0 (en) | 1997-06-14 | 1997-08-13 | Smithkline Beecham Biolog | Vaccine |
| GB9713156D0 (en) | 1997-06-20 | 1997-08-27 | Microbiological Res Authority | Vaccines |
| AU1145699A (en) | 1997-09-05 | 1999-03-22 | Smithkline Beecham Biologicals (Sa) | Oil in water emulsions containing saponins |
| DE69830326T2 (de) * | 1997-10-03 | 2006-02-02 | Galenica Pharmaceuticals, Inc. | Iminbildende polysaccharide, deren herstellung und verwendung als zusatzmittel und immunstimulierende mittel |
| CA2671261A1 (en) | 1997-11-06 | 1999-05-20 | Novartis Vaccines And Diagnostics S.R.L. | Neisserial antigens |
| JP2002536958A (ja) | 1997-11-21 | 2002-11-05 | ジェンセット | Chlamydiapneumoniaeゲノム配列およびポリペプチド、それらのフラグメント、ならびに特に感染症の診断、予防および治療のためのそれらの使用 |
| EP2218731A1 (en) | 1997-11-28 | 2010-08-18 | Merck Serono Biodevelopment | Chlamydia trachomatis genomic sequence and polypeptides, fragments thereof and uses thereof, in particular for the diagnosis, prevention and treatment of infection |
| GB9725084D0 (en) | 1997-11-28 | 1998-01-28 | Medeva Europ Ltd | Vaccine compositions |
| US20010051364A1 (en) * | 1997-12-23 | 2001-12-13 | Francis Michon | Procedures for the extraction and isolation of bacterial capsular polysaccharides for use as vaccines or linked to proteins as conjugate vaccines |
| KR100757630B1 (ko) * | 1997-12-23 | 2007-09-10 | 박스터 헬쓰케어 에스.에이. | 신규한 추출 및 단리 방법으로 수득되는 세균성 캡슐형 다당류 |
| EP1047784B2 (en) | 1998-01-14 | 2015-03-18 | Novartis Vaccines and Diagnostics S.r.l. | Neissera meningitidis antigens |
| DE69815396T3 (de) * | 1998-01-16 | 2007-05-16 | Unilever N.V. | Zum binden von zellulose befähigtes polysaccharid-konjugat |
| IL137809A0 (en) | 1998-02-12 | 2001-10-31 | American Cyanamid Co | Pneumococcal and meningococcal vaccines formulated with interleukin-12 |
| US7018637B2 (en) | 1998-02-23 | 2006-03-28 | Aventis Pasteur, Inc | Multi-oligosaccharide glycoconjugate bacterial meningitis vaccines |
| US6303114B1 (en) | 1998-03-05 | 2001-10-16 | The Medical College Of Ohio | IL-12 enhancement of immune responses to T-independent antigens |
| US6645503B1 (en) * | 1998-03-10 | 2003-11-11 | Wyeth Holdings Corporation | Antigenic conjugates of conserved lipopolysaccharides of gram negative bacteria |
| WO1999052549A1 (en) | 1998-04-09 | 1999-10-21 | Smithkline Beecham Biologicals S.A. | Adjuvant compositions |
| US6573245B1 (en) * | 1998-04-28 | 2003-06-03 | Galenica Pharmaceuticals, Inc. | Modified polysaccharide adjuvant-protein antigen conjugates, the preparation thereof and the use thereof |
| EP2261338A3 (en) | 1998-05-01 | 2012-01-04 | Novartis Vaccines and Diagnostics, Inc. | Neisseria meningitidis antigens and compositions |
| US6562798B1 (en) | 1998-06-05 | 2003-05-13 | Dynavax Technologies Corp. | Immunostimulatory oligonucleotides with modified bases and methods of use thereof |
| GB9817052D0 (en) | 1998-08-05 | 1998-09-30 | Smithkline Beecham Biolog | Vaccine |
| DE69941574D1 (de) * | 1998-08-19 | 2009-12-03 | Baxter Healthcare Sa | Immunogenes beta-propionamido-gebundenes polysaccharid-protein konjugat geeignet als impfstoff und hergestellt bei verwendung von n-acryloyliertem polysaccharid |
| BR9914374A (pt) | 1998-10-09 | 2002-09-17 | Chiron Corp | Sequências genÈmicas de neisseria e métodos para seu uso |
| KR100629028B1 (ko) | 1998-10-16 | 2006-09-26 | 글락소스미스클라인 바이오로지칼즈 에스.에이. | 애쥬번트 시스템 및 백신 |
| CA2350775A1 (en) | 1998-11-12 | 2000-05-18 | The Regents Of The University Of California | Chlamydia pneumoniae genome sequence |
| GB9828000D0 (en) | 1998-12-18 | 1999-02-10 | Chiron Spa | Antigens |
| US6146902A (en) | 1998-12-29 | 2000-11-14 | Aventis Pasteur, Inc. | Purification of polysaccharide-protein conjugate vaccines by ultrafiltration with ammonium sulfate solutions |
| EP1034792A1 (en) | 1999-03-11 | 2000-09-13 | Pasteur Merieux Serums Et Vaccins | Intranasal delivery of pneumococcal polysaccharide vaccines |
| ATE459373T1 (de) | 1999-03-19 | 2010-03-15 | Glaxosmithkline Biolog Sa | Impfstoff gegen kapsulare polysaccharide von streptococcus pneumoniae |
| TR200200777T2 (tr) | 1999-09-24 | 2002-09-23 | Smithkline Beecham Biologicals S.A. | Polioksietilen alkil eteri veya esteriyle en az bir iyonik olmayan yüzey aktif maddeli adjuvant. |
| HUP0202885A3 (en) | 1999-09-24 | 2004-07-28 | Smithkline Beecham Biolog | Vaccines |
| PT2289545T (pt) | 2000-01-17 | 2016-09-06 | Glaxosmithkline Biologicals Sa | Vacina de omv suplementada contra meningococos |
| US20010044416A1 (en) | 2000-01-20 | 2001-11-22 | Mccluskie Michael J. | Immunostimulatory nucleic acids for inducing a Th2 immune response |
| JP2004502415A (ja) | 2000-07-03 | 2004-01-29 | カイロン エセ.ピー.アー. | Chlamydiapneumoniaeに対する免疫化 |
| US7892552B2 (en) * | 2001-08-08 | 2011-02-22 | University Of Utah Research Foundation | Group B Streptococcus polypeptides nucleic acids and therapeutic compositions and vaccines thereof |
| WO2002012294A2 (en) * | 2000-08-08 | 2002-02-14 | St. Jude Children's Research Hospital | Group b streptococcus polypeptides nucleic acids and therapeutic compositions and vaccines thereof |
| AU2001294750C1 (en) | 2000-09-26 | 2008-09-18 | Idera Pharmaceuticals, Inc. | Modulation of immunostimulatory activity of immunostimulatory oligonucleotide analogs by positional chemical changes |
| CA2881568C (en) * | 2000-10-27 | 2019-09-24 | Novartis Vaccines And Diagnostics, Inc. | Nucleic acids and proteins from streptococcus groups a & b |
| WO2002091998A2 (en) | 2001-05-11 | 2002-11-21 | Aventis Pasteur, Inc. | Novel meningitis conjugate vaccine |
| GB0115176D0 (en) * | 2001-06-20 | 2001-08-15 | Chiron Spa | Capular polysaccharide solubilisation and combination vaccines |
| RU2323002C2 (ru) | 2001-07-26 | 2008-04-27 | Чирон Срл. | Вакцины, содержащие алюминиевые адъюванты и гистидин |
| WO2003015815A1 (en) * | 2001-08-21 | 2003-02-27 | The Brigham And Women's Hospital, Inc. | Improved conjugate vaccines |
| CA2492823A1 (en) | 2001-09-14 | 2003-03-27 | Cytos Biotechnology Ag | In vivo activation of antigen presenting cells for enhancement of immune responses induced by virus like particles |
| DE60234375D1 (de) | 2001-09-14 | 2009-12-24 | Cytos Biotechnology Ag | VERPACKUNG VON IMMUNSTIMULIERENDEM CpG IN VIRUSÄHNLICHEN PARTIKELN: HERSTELLUNGSVERFAHREN UND VERWENDUNG |
| US7265085B2 (en) * | 2001-10-10 | 2007-09-04 | Neose Technologies, Inc. | Glycoconjugation methods and proteins/peptides produced by the methods |
| WO2003035836A2 (en) | 2001-10-24 | 2003-05-01 | Hybridon Inc. | Modulation of immunostimulatory properties of oligonucleotide-based compounds by optimal presentation of 5' ends |
| GB0210128D0 (en) | 2002-05-02 | 2002-06-12 | Chiron Spa | Nucleic acids and proteins from streptococcus groups A & B |
| WO2004011027A1 (en) * | 2002-07-30 | 2004-02-05 | Baxter International Inc. | Chimeric multivalent polysaccharide conjugate vaccines |
| US20070053924A1 (en) | 2002-08-26 | 2007-03-08 | Herve Tettelin | Conserved and specific streptococcal genomes |
| ES2504166T3 (es) * | 2002-09-13 | 2014-10-08 | Novartis Vaccines And Diagnostics, Inc. | Vacuna de estreptococo del grupo B |
| US7521062B2 (en) | 2002-12-27 | 2009-04-21 | Novartis Vaccines & Diagnostics, Inc. | Thiosemicarbazones as anti-virals and immunopotentiators |
| CA2513655C (en) | 2003-01-21 | 2011-11-22 | Chiron Corporation | Use of tryptanthrin compounds for immune potentiation |
| EP2172213B1 (en) * | 2003-01-30 | 2013-04-03 | Novartis AG | Injectable vaccines against multiple meningococcal serogroups |
| EP2289907A3 (en) * | 2003-05-07 | 2011-08-31 | Intercell AG | Streptococcus agalactiae antigens I + II |
| ES2505695T3 (es) * | 2003-07-31 | 2014-10-10 | Novartis Vaccines And Diagnostics, Inc. | Composiciones inmunógenas para Streptococcus pyogenes |
| US8048432B2 (en) * | 2003-08-06 | 2011-11-01 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Polysaccharide-protein conjugate vaccines |
| EP1651262A2 (en) * | 2003-08-06 | 2006-05-03 | THE GOVERNMENT OF THE UNITED STATES OF AMERICA, as represented by THE SECRETARY, DEPARTMENT OF HEALTH AND HUMAN SERVICES | Process for preparing polysaccharide-protein conjugate vaccines |
| US20060198819A1 (en) * | 2003-08-08 | 2006-09-07 | Novo Nordisk Healthcare A/G | Use of galactose oxidase for selective chemical conjugation of protractor molecules to proteins of therapeutic interest |
| CA2556169C (en) * | 2004-01-29 | 2011-11-22 | Andrew Lees | Use of amino-oxy functional groups in the preparation of vaccines |
| MX2007005202A (es) * | 2004-11-01 | 2007-07-09 | Brigham & Womens Hospital | Polisacaridos de estreptococo modificados y usos de los mismos. |
| GB0502095D0 (en) * | 2005-02-01 | 2005-03-09 | Chiron Srl | Conjugation of streptococcal capsular saccharides |
| GB0502096D0 (en) * | 2005-02-01 | 2005-03-09 | Chiron Srl | Purification of streptococcal capsular polysaccharide |
| CA2620416A1 (en) * | 2005-08-24 | 2007-03-01 | Novartis Vaccines And Diagnostics S.R.L. | Zwitterionization of capsular saccharides |
| US7700578B2 (en) * | 2005-09-21 | 2010-04-20 | The United States Of America As Represented By The Secretary Of The Navy | Capsule composition for use as immunogen against Campylobacter jejuni |
| GB0522303D0 (en) * | 2005-11-01 | 2005-12-07 | Chiron Srl | Culture method |
| US8431160B2 (en) * | 2006-02-24 | 2013-04-30 | Novartis Ag | Microparticles containing biodegradable polymer and cationic polysaccharide for use in immunogenic compositions |
| CA2692069C (en) * | 2007-06-20 | 2016-10-18 | Baxter Healthcare S.A. | Modified polysaccharides for conjugate vaccines |
| GB0713880D0 (en) * | 2007-07-17 | 2007-08-29 | Novartis Ag | Conjugate purification |
| CN103897045A (zh) * | 2009-01-12 | 2014-07-02 | 诺华股份有限公司 | 抗革兰氏阳性细菌疫苗中的Cna_B结构域 |
| GB201101665D0 (en) * | 2011-01-31 | 2011-03-16 | Novartis Ag | Immunogenic compositions |
-
2005
- 2005-02-01 GB GBGB0502095.3A patent/GB0502095D0/en not_active Ceased
-
2006
- 2006-02-01 CN CN200680007342XA patent/CN101304765B/zh not_active Expired - Fee Related
- 2006-02-01 EP EP06727404A patent/EP1846038A2/en not_active Withdrawn
- 2006-02-01 MX MX2007009277A patent/MX2007009277A/es active IP Right Grant
- 2006-02-01 CA CA2830588A patent/CA2830588A1/en not_active Abandoned
- 2006-02-01 WO PCT/IB2006/000756 patent/WO2006082530A2/en not_active Ceased
- 2006-02-01 JP JP2007553744A patent/JP5390103B2/ja not_active Expired - Fee Related
- 2006-02-01 CA CA2596683A patent/CA2596683C/en not_active Expired - Fee Related
- 2006-02-01 EP EP18194584.1A patent/EP3498302A1/en not_active Withdrawn
- 2006-02-01 CN CN201310059546.XA patent/CN103349780B/zh not_active Expired - Fee Related
- 2006-02-01 US US11/883,614 patent/US8513392B2/en not_active Expired - Fee Related
- 2006-02-01 NZ NZ560432A patent/NZ560432A/en not_active IP Right Cessation
- 2006-02-01 AU AU2006211052A patent/AU2006211052B2/en not_active Ceased
-
2007
- 2007-08-01 IL IL184981A patent/IL184981A/en not_active IP Right Cessation
- 2007-08-20 ZA ZA2007/06969A patent/ZA200706969B/en unknown
-
2013
- 2013-01-25 JP JP2013011819A patent/JP5818826B2/ja not_active Expired - Fee Related
- 2013-06-07 US US13/912,919 patent/US9040055B2/en not_active Expired - Lifetime
-
2015
- 2015-05-08 US US14/707,147 patent/US9675691B2/en not_active Expired - Lifetime
- 2015-05-21 JP JP2015103396A patent/JP2015147806A/ja active Pending
-
2017
- 2017-05-11 US US15/592,339 patent/US10188719B2/en not_active Expired - Lifetime
Cited By (65)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10428121B2 (en) | 2000-10-27 | 2019-10-01 | Novartis Ag | Nucleic acids and proteins from streptococcus groups A and B |
| US9840538B2 (en) | 2000-10-27 | 2017-12-12 | Novartis Ag | Nucleic acids and proteins from Streptococcus groups A and B |
| US8137673B2 (en) | 2000-10-27 | 2012-03-20 | Novartis Vaccines And Diagnostics, Inc. | Nucleic acids and proteins from Streptococcus groups A & B |
| US9738693B2 (en) | 2000-10-27 | 2017-08-22 | Novartis Ag | Nucleic acids and proteins from streptococcus groups A and B |
| US9056912B2 (en) | 2003-07-31 | 2015-06-16 | Novartis Vaccines And Diagnostics, Srl | Immunogenic compositions for Streptococcus pyogenes |
| US8945589B2 (en) | 2003-09-15 | 2015-02-03 | Novartis Vaccines And Diagnostics, Srl | Immunogenic compositions for Streptococcus agalactiae |
| EP1937304A2 (en) * | 2005-08-24 | 2008-07-02 | Novartis Vaccines and Diagnostics S.r.l. | Zwitterionization of capsular saccharides |
| AU2006283302B2 (en) * | 2005-08-24 | 2012-11-15 | Novartis Vaccines And Diagnostics Srl | Zwitterionization of capsular saccharides |
| JP2010515718A (ja) * | 2007-01-11 | 2010-05-13 | ノバルティス アーゲー | 修飾糖類 |
| US9463250B2 (en) | 2007-07-17 | 2016-10-11 | Glaxosmithkline Biologicals Sa | Conjugate purification |
| EP2659912A2 (en) | 2007-07-17 | 2013-11-06 | Novartis AG | Conjugate purification |
| US8858957B2 (en) | 2007-09-12 | 2014-10-14 | Novartis Ag | GAS57 mutant antigens and GAS57 antibodies |
| US9102741B2 (en) | 2007-09-12 | 2015-08-11 | Novartis Ag | GAS57 mutant antigens and GAS57 antibodies |
| WO2010049806A1 (en) | 2008-10-27 | 2010-05-06 | Novartis Ag | Purification method |
| US8753645B2 (en) | 2010-03-09 | 2014-06-17 | Glaxosmithkline Biologicals S.A. | Conjugation process of bacterial polysaccharides to carrier proteins |
| WO2011110531A3 (en) * | 2010-03-09 | 2012-03-08 | Glaxosmithkline Biologicals S.A. | Conjugation process of bacterial polysaccharides to carrier proteins |
| EP2815762A3 (en) * | 2010-03-09 | 2015-03-25 | GlaxoSmithKline Biologicals S.A. | Conjugation process of bacterial polysaccharides to carrier proteins |
| EP2815762B1 (en) | 2010-03-09 | 2017-05-31 | GlaxoSmithKline Biologicals S.A. | Conjugation process of bacterial polysaccharides to carrier proteins |
| US9265839B2 (en) | 2010-03-09 | 2016-02-23 | Glaxosmithkline Biologicals S.A. | Conjugation process of bacterial polysaccharides to carrier proteins |
| US9265840B2 (en) | 2010-03-09 | 2016-02-23 | Glaxosmithkline Biologicals S.A. | Conjugation process of bacterial polysaccharides to carrier proteins |
| EA023059B1 (ru) * | 2010-03-09 | 2016-04-29 | Глаксосмитклайн Байолоджикалс С.А. | Способ конъюгирования бактериальных полисахаридов с белками-носителями |
| WO2012035519A1 (en) | 2010-09-16 | 2012-03-22 | Novartis Ag | Immunogenic compositions |
| EP2616099B1 (en) | 2010-09-16 | 2018-05-30 | GlaxoSmithKline Biologicals SA | Immunogenic compositions |
| RU2608905C2 (ru) * | 2010-09-16 | 2017-01-26 | Глэксосмитклайн Байолоджикалз С.А. | Иммуногенные композиции |
| US9149541B2 (en) | 2011-07-08 | 2015-10-06 | Novartis Ag | Tyrosine ligation process |
| US20140141034A1 (en) * | 2011-07-08 | 2014-05-22 | Novartis Ag | Tyrosine ligation process |
| WO2013009564A1 (en) * | 2011-07-08 | 2013-01-17 | Novartis Ag | Tyrosine ligation process |
| WO2013088378A2 (en) | 2011-12-12 | 2013-06-20 | Novartis Ag | Method of detecting the presence of an antibody in a sample |
| US10258579B2 (en) | 2012-03-14 | 2019-04-16 | Nanovelos Sp. Z O.O. | Process for the preparation of polysaccharide nanoparticles |
| RU2605834C2 (ru) * | 2012-06-20 | 2016-12-27 | Ск Кемикалс Ко., Лтд. | Поливалентная композиция, содержащая конъюгаты пневмококковый полисахарид-белок |
| US10034949B2 (en) | 2012-06-20 | 2018-07-31 | Sk Chemicals Co., Ltd. | Polyvalent pneumococcal polysaccharide-protein conjugate composition |
| US10058607B2 (en) | 2012-06-20 | 2018-08-28 | Sk Chemicals Co., Ltd. | Polyvalent pneumococcal polysaccharide-protein conjugate composition |
| WO2014053607A1 (en) | 2012-10-03 | 2014-04-10 | Novartis Ag | Immunogenic compositions |
| US9855324B2 (en) | 2012-10-03 | 2018-01-02 | Glaxosmithkline Biologicals Sa | Immunogenic compositions |
| EP3482770B1 (en) | 2012-10-03 | 2020-11-25 | GlaxoSmithKline Biologicals S.A. | Immunogenic compositions |
| WO2014053612A1 (en) | 2012-10-03 | 2014-04-10 | Novartis Ag | Immunogenic composition |
| EP2903636B1 (en) | 2012-10-03 | 2018-07-18 | GlaxoSmithKline Biologicals S.A. | Immunogenic compositions |
| EP3482770A1 (en) | 2012-10-03 | 2019-05-15 | GlaxoSmithKline Biologicals S.A. | Immunogenic compositions |
| US10286055B2 (en) | 2012-10-03 | 2019-05-14 | Glaxosmithkline Biologicals Sa | Immunogenic composition |
| RU2606152C1 (ru) * | 2012-12-11 | 2017-01-10 | Ск Кемикалс Ко., Лтд. | Мультивалентная композиция на основе конъюгатов пневмококковый полисахарид-белок |
| US9981029B2 (en) | 2012-12-11 | 2018-05-29 | Sk Chemical Co., Ltd. | Multivalent pneumococcal polysaccharide-protein conjugate composition |
| US12409231B2 (en) | 2013-01-15 | 2025-09-09 | Glaxosmithkline Biologicals Sa | Cycloalkyne derivatized saccharides |
| US11135300B2 (en) | 2013-01-15 | 2021-10-05 | Glaxosmithkline Biologicals Sa | Cycloalkyne derivatized saccharides |
| WO2014111344A1 (en) * | 2013-01-15 | 2014-07-24 | Novartis Ag | Cycloalkyne derivatized saccharides |
| EP3034516A1 (en) | 2014-12-19 | 2016-06-22 | Novartis AG | Purification of streptococcal capsular polysaccharide |
| WO2016097147A1 (en) | 2014-12-19 | 2016-06-23 | Glaxosmithkline Biologicals Sa | Purification of streptococcal capsular polysaccharide |
| US10946086B2 (en) | 2015-05-04 | 2021-03-16 | Pfizer Inc. | Group B Streptococcus polysaccharide-protein conjugates, methods for producing conjugates, immunogenic compositions comprising conjugates, and uses thereof |
| WO2016178123A1 (en) | 2015-05-04 | 2016-11-10 | Pfizer Inc. | Group b streptococcus polysaccharide-protein conjugates, methods for producing conjugates, immunogenic compositions comprising conjugates, and uses thereof |
| US10226525B2 (en) | 2015-05-04 | 2019-03-12 | Pfizer Inc. | Group B Streptococcus polysaccharide-protein conjugates, methods for producing conjugates, immunogenic compositions comprising conjugates, and uses thereof |
| EP3347042A4 (en) * | 2015-09-10 | 2019-02-20 | Inventprise, LLC. | MULTIVALENT PPV CONJUGATES |
| US10736952B2 (en) | 2015-09-10 | 2020-08-11 | Inventprise, Llc | Multivalent VLP conjugates |
| WO2018087635A1 (en) | 2016-11-09 | 2018-05-17 | Pfizer Inc. | Immunogenic polysaccharide protein conjugated comprising a polysaccharide derived from b streptococcus gbs |
| US10751402B2 (en) | 2016-11-09 | 2020-08-25 | Pfizer Inc. | Immunogenic compositions and uses thereof |
| US11147865B2 (en) | 2016-11-09 | 2021-10-19 | Pfizer Inc. | Immunogenic compositions and uses thereof |
| US12527855B2 (en) | 2016-11-09 | 2026-01-20 | Pfizer Inc. | Immunogenic compositions and uses thereof |
| US12016913B2 (en) | 2016-11-09 | 2024-06-25 | Pfizer Inc. | Immunogenic compositions and uses thereof |
| WO2019030271A1 (en) * | 2017-08-10 | 2019-02-14 | Glaxosmithkline Biologicals Sa | NOMV MULTI-FUNCTIONALIZED CONJUGATES |
| US12005109B2 (en) | 2017-08-10 | 2024-06-11 | Glaxosmithkline Biologicals Sa | Multi-functionalized nOMV conjugates |
| US12239697B2 (en) | 2018-06-11 | 2025-03-04 | Inventprise, Inc. | Virus-like particle conjugates |
| EP3817775B1 (en) * | 2018-07-04 | 2024-09-04 | Vaxcyte, Inc. | Improvements in immunogenic conjugates |
| WO2020229964A1 (en) | 2019-05-10 | 2020-11-19 | Glaxosmithkline Biologicals Sa | Conjugate production |
| WO2021250628A1 (en) | 2020-06-12 | 2021-12-16 | Glaxosmithkline Biologicals Sa | Bacterial immunization using nanoparticle vaccine |
| US12252454B2 (en) | 2020-08-19 | 2025-03-18 | Vaxcyte, Inc. | Carrier-protein polysaccharide conjugation methods |
| WO2023111826A1 (en) | 2021-12-14 | 2023-06-22 | Glaxosmithkline Biologicals Sa | Bacterial immunization using qbeta hairpin nanoparticle constructs |
| WO2025172892A1 (en) | 2024-02-16 | 2025-08-21 | Glaxosmithkline Biologicals Sa | Modified proteins and methods |
Also Published As
| Publication number | Publication date |
|---|---|
| US10188719B2 (en) | 2019-01-29 |
| CN101304765A (zh) | 2008-11-12 |
| CA2596683C (en) | 2013-12-31 |
| US9040055B2 (en) | 2015-05-26 |
| AU2006211052A1 (en) | 2006-08-10 |
| US8513392B2 (en) | 2013-08-20 |
| JP5818826B2 (ja) | 2015-11-18 |
| CA2830588A1 (en) | 2006-08-10 |
| MX2007009277A (es) | 2007-09-19 |
| ZA200706969B (en) | 2008-11-26 |
| CN103349780B (zh) | 2016-05-04 |
| GB0502095D0 (en) | 2005-03-09 |
| US20150231231A1 (en) | 2015-08-20 |
| WO2006082530A3 (en) | 2008-07-03 |
| CN101304765B (zh) | 2013-03-27 |
| CA2596683A1 (en) | 2006-08-10 |
| NZ560432A (en) | 2010-12-24 |
| US9675691B2 (en) | 2017-06-13 |
| US20090043077A1 (en) | 2009-02-12 |
| US20130295132A1 (en) | 2013-11-07 |
| CN103349780A (zh) | 2013-10-16 |
| IL184981A0 (en) | 2007-12-03 |
| IL184981A (en) | 2016-06-30 |
| JP5390103B2 (ja) | 2014-01-15 |
| EP1846038A2 (en) | 2007-10-24 |
| EP3498302A1 (en) | 2019-06-19 |
| AU2006211052B2 (en) | 2012-03-29 |
| US20170246285A1 (en) | 2017-08-31 |
| JP2008532930A (ja) | 2008-08-21 |
| JP2013079285A (ja) | 2013-05-02 |
| JP2015147806A (ja) | 2015-08-20 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10188719B2 (en) | Conjugation of Streptococcal capsular saccharides | |
| CN103209708B (zh) | 免疫原性组合物 | |
| US10736959B2 (en) | Conjugation of Staphylococcus aureus type 5 and type 8 capsular polysaccharides | |
| AU2013202983A1 (en) | Immunogenic compositions |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200680007342.X Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: MX/a/2007/009277 Country of ref document: MX Ref document number: 184981 Country of ref document: IL Ref document number: 2007553744 Country of ref document: JP Ref document number: 2596683 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 560432 Country of ref document: NZ |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006211052 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006727404 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2006211052 Country of ref document: AU Date of ref document: 20060201 Kind code of ref document: A |
|
| WWP | Wipo information: published in national office |
Ref document number: 2006211052 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3214/KOLNP/2007 Country of ref document: IN |
|
| WWP | Wipo information: published in national office |
Ref document number: 2006727404 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11883614 Country of ref document: US |