WO1999024578A2 - Neisserial antigens - Google Patents
Neisserial antigens Download PDFInfo
- Publication number
- WO1999024578A2 WO1999024578A2 PCT/IB1998/001665 IB9801665W WO9924578A2 WO 1999024578 A2 WO1999024578 A2 WO 1999024578A2 IB 9801665 W IB9801665 W IB 9801665W WO 9924578 A2 WO9924578 A2 WO 9924578A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- protein
- sequence
- pep
- expression
- gene
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/22—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Neisseriaceae (F)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Definitions
- This invention relates to antigens from Neisseria bacteria.
- Neisseria meningitidis .and Neisseria gonorrhoeae are non-motile, gram negative diplococci that are pathogenic in humans.
- N. meningitidis colonises the pharynx and causes meningitis (and, occasionally, septicaemia in the absence of meningitis);
- N.gonorrhoeae colonises the genital tract and causes gonorrhea. Although colonising different areas of the body and causing completely different diseases, the two pathogens are closely related, although one feature that clearly differentiates meningococcus from gonococcus is the presence of a polysaccharide capsule that is present in all pathogenic meningococci.
- N.gonorrhoeae caused approximately 800,000 cases per year during the period 1983-1990 in the United States alone (chapter by Meitzner & Cohen, "Vaccines Against Gonococcal Infection", In: New Generation Vaccines, 2nd edition, ed. Levine, Woodrow, Kaper, & Cobon, Marcel Dekker, New York, 1997, pp.817-842).
- the disease causes significant morbidity but limited mortality.
- Vaccination against N.gonorrhoeae would be highly desirable, but repeated attempts have failed.
- the main candidate antigens for this vaccine are surface-exposed proteins such as pili, porins, opacity-associated proteins (Opas) and other surface-exposed proteins such as the Lip, Laz, IgAl protease and transferrin-binding proteins.
- the lipooligosaccharide (LOS) has also been suggested as vaccine (Meitzner & Cohen, supra).
- N. meningitidis causes both endemic and epidemic disease.
- the attack rate is 0.6-1 per 100,000 persons per year, and it can be much greater during outbreaks (see Lieberman et al. (1996) Safety and Immunogenicity of a Serogroups A/C Neisseria meningitidis Oligosaccharide-Protein Conjugate Vaccine in Young Children. JAMA 275(19):1499-1503; Schuchat et al (1997) Bacterial Meningitis in the United States in 1995. NEnglJMed 337(14):970- 976).
- endemic disease rates are much higher and during epidemics incidence rates can reach 500 cases per 100,000 persons per year.
- N meningitidis is the major cause of bacterial meningitis at all ages in the United States (Schuchat et al (1997) supra).
- 12 serogroups of N meningitidis have been identified.
- Group A is the pathogen most often implicated in epidemic disease in sub-Saharan Africa.
- Serogroups B and C are responsible for the vast majority of cases in the United States and in most developed countries.
- Serogroups W135 and Y are responsible for the rest of the cases in the United States and developed countries.
- the meningococcal vaccine currently in use is a tetravalent polysaccharide vaccine composed of serogroups A, C, Y and W135. Although efficacious in adolescents and adults, it induces a poor immune response and short duration of protection, and cannot be used in infants [eg. Morbidity .and Mortality weekly report, Vol.46, No. RR-5 (1997)]. This is because polysaccharides are T-cell independent antigens that induce a weak immune response that cannot be boosted by repeated immunization.
- conjugate vaccines against serogroups A and C have been developed and are at the final stage of clinical testing (Zollinger WD "New and Improved Vaccines Against Meningococcal Disease” in: New Generation Vaccines, supra, pp. 469-488; Lieberman et al (1996) supra; Costantino et al (1992) Development and phase I clinical testing of a conjugate vaccine against meningococcus A and C. Vaccine 10:691-698).
- Meningococcus B remains a problem, however. This serotype currently is responsible for approximately 50% of total meningitis in the United States, Europe, and South America.
- the polysaccharide approach cannot be used because the menB capsular polysaccharide is a polymer of ⁇ (2-8)-linked N-acetyl neuraminic acid that is also present in mammalian tissue. This results in tolerance to the .antigen; indeed, if an immune response were elicited, it would be .anti-self, .and therefore undesirable.
- the capsular polysaccharide has, for instance, been chemically modified substituting the N-acetyl groups with ⁇ -propionyl groups, leaving the specific antigenicity unaltered (Romero & Outschoorn (1994) Current status of Meningococcal group B vaccine candidates: capsular or non-capsular? Clin Microbiol Rev 7(4):559-575).
- OMPs outer membrane proteins
- containing either the OMPs alone, or OMPs enriched in porins, or deleted of the class 4 OMPs that are believed to induce antibodies that block bactericidal activity This approach produces vaccines that are not well characterized. They are able to protect against the homologous str-ain, but .are not effective at large where there are many antigenic variants of the outer membrane proteins.
- multivalent vaccines containing up to nine different porins have been constructed (eg. Poolman JT (1992) Development of a meningococcal vaccine. Infect. Agents Dis. 4:13-28).
- a certain amount of sequence data is available for meningococcal and gonoccocal genes and proteins (eg. EP-A-0467714, WO96/29412), but this is by no means complete.
- the provision of further sequences could provide an opportunity to identify secreted or surface-exposed proteins that are presumed t.argets for the immune system and which are not antigenically variable.
- some of the identified proteins could be components of efficacious vaccines against meningococcus B, some could be components of vaccines against all meningococcal serotypes, and others could be components of vaccines against all pathogenic Neisseriae.
- the invention provides proteins comprising the Neisserial amino acid sequences disclosed in the examples. These sequences relate to N meningitidis ox N.gonorrhoeae.
- proteins comprising sequences homologous (ie. having sequence identity) to the Neisserial amino acid sequences disclosed in the examples.
- the degree of identity is preferably greater than 50% (eg. 65%, 80%, 90%, or more).
- These homologous proteins include mutants and allelic variants of the sequences disclosed in the examples.
- 50% identity or more between two proteins is considered to be an indication of functional equivalence.
- the invention further provides proteins comprising fragments of the Neisserial amino acid sequences disclosed in the examples.
- the fragments should comprise at least n consecutive .amino acids from the sequences and, depending on the particular sequence, n is 7 or more (eg. 8, 10, 12, 14, 16, 18, 20 or more).
- n is 7 or more (eg. 8, 10, 12, 14, 16, 18, 20 or more).
- the fragments comprise an epitope from the sequence.
- the proteins of the invention can, of course, be prepared by various means (eg. recombinant expression, purification from cell culture, chemical synthesis etc.) and in various forms (eg. native, fusions etc.). They are preferably prepared in substantially pure or isolated form (ie. substantially free from other Neisserial or host cell proteins)
- the invention provides antibodies which bind to these proteins. These may be polyclonal or monoclonal and may be produced by any suitable means.
- the invention provides nucleic acid comprising the Neisserial nucleotide sequences disclosed in the examples.
- the invention provides nucleic acid comprising sequences homologous (ie. having sequence identity) to the Neisserial nucleotide sequences disclosed in the examples.
- the invention provides nucleic acid which can hybridise to the Neisserial nucleic acid disclosed in the examples, preferably under "high stringency” conditions (eg. 65°C in a O.lxSSC, 0.5% SDS solution).
- Nucleic acid comprising fragments of these sequences are also provided. These should comprise at least n consecutive nucleotides from the Neisserial sequences and, depending on the particular sequence, n is 10 or more (eg 12, 14, 15, 18, 20, 25, 30, 35, 40 or more).
- the invention provides nucleic acid encoding the proteins and protein fragments of the invention.
- nucleic acid comprising sequences complementary to those described above (eg. for antisense or probing purposes).
- Nucleic acid according to the invention can, of course, be prepared in many ways (eg. by chemical synthesis, from genomic or cDNA libraries, from the organism itself etc.) and can take various forms (eg. single stranded, double stranded, vectors, probes etc.).
- nucleic acid includes DNA and RNA, and also their analogues, such as those containing modified backbones, and also peptide nucleic acids (PNA) etc.
- the invention provides vectors comprising nucleotide sequences of the invention (eg. expression vectors) and host cells transformed with such vectors.
- compositions comprising protein, antibody, and/or nucleic acid according to the invention.
- These compositions may be suitable as vaccines, for instance, or as diagnostic reagents, or as immunogenic compositions.
- the invention also provides nucleic acid, protein, or antibody according to the invention for use as medicaments (eg. as vaccines) or as diagnostic reagents. It also provides the use of nucleic acid, protein, or antibody according to the invention in the manufacture of: (i) a medicament for treating or preventing infection due to Neisserial bacteria; (ii) a diagnostic reagent for detecting the presence of Neisserial bacteria or of antibodies raised against Neisserial bacteria; and/or (iii) a reagent which can raise antibodies against Neisserial bacteria.
- Said Neisserial bacteria may be any species or strain (such as N.gonorrhoeae, or any strain of N. meningitidis, such as strain A, strain B or strain C).
- the invention also provides a method of treating a patient, comprising administering to the patient a therapeutically effective amount of nucleic acid, protein, and/or antibody according to the invention.
- the invention provides various processes.
- a process for producing proteins of the invention comprising the step of culturing a host cell according to the invention under conditions which induce protein expression.
- a process for producing protein or nucleic acid of the invention wherein the the protein or nucleic acid is synthesised in part or in whole using chemical means.
- a process for detecting polynucleotides of the invention comprising the steps of: (a) contacting a nucleic probe according to the invention with a biological sample under hybridizing conditions to form duplexes; and (b) detecting said duplexes.
- a process for detecting proteins of the invention comprising the steps of: (a) contacting an antibody according to the invention with a biological sample under conditions suitable for the formation of an antibody-antigen complexes; and (b) detecting said complexes.
- a composition containing X is "substantially free of Y when at least 85% by weight of the total X+Y in the composition is X.
- X comprises at least about 90% by weight of the total of X+Y in the composition, more preferably at least about 95% or even 99% by weight.
- composition “comprising” means “including” as well as “consisting” eg. a composition “comprising” X may consist exclusively of X or may include something additional to X, such as X+Y.
- heterologous refers to two biological components that are not found together in nature. The components may be host cells, genes, or regulatory regions, such as promoters. Although the heterologous components .are not found together in nature, they can function together, as when a promoter heterologous to a gene is operably linked to the gene. Another example is where a Neisserial sequence is heterologous to a mouse host cell. A further examples would be two epitopes from the same or different proteins which have been assembled in a single protein in an arrangement not found in nature.
- An "origin of replication” is a polynucleotide sequence that initiates and regulates replication of polynucleotides, such as an expression vector.
- the origin of replication behaves as an autonomous unit of polynucleotide replication within a cell, capable of replication under its own control.
- An origin of replication may be needed for a vector to replicate in a particular host cell. With certain origins of replication, an expression vector can be reproduced at a high copy number in the presence of the appropriate proteins within the cell. Examples of origins are the autonomously replicating sequences, which are effective in yeast; and the viral T-antigen, effective in COS-7 cells.
- a “mutant" sequence is defined as DNA, RNA or amino acid sequence differing from but having sequence identity with the native or disclosed sequence. Depending on the particul.ar sequence, the degree of sequence identity between the native or disclosed sequence and the mutant sequence is preferably greater than 50% (eg. 60%, 70%, 80%, 90%, 95%, 99% or more, calculated using the Smith- Waterman algorithm as described above).
- an "allelic variant" of a nucleic acid molecule, or region, for which nucleic acid sequence is provided herein is a nucleic acid molecule, or region, that occurs essentially at the same locus in the genome of another or second isolate, and that, due to natural variation caused by, for example, mutation or recombination, has a similar but not identical nucleic acid sequence.
- a coding region allelic variant typically encodes a protein having similar activity to that of the protein encoded by the gene to which it is being compared.
- An allelic variant can also comprise an alteration in the 5' or 3' untranslated regions of the gene, such as in regulatory control regions (eg. see US patent 5,753,235).
- Neisserial nucleotide sequences can be expressed in a variety of different expression systems; for example those used with mammalian cells, baculoviruses, plants, bacteria, and yeast. i. Mammalian Systems
- a mammalian promoter is any DNA sequence capable of binding mammalian RNA polymerase and initiating the downstream (3') transcription of a coding sequence (eg. structural gene) into mRNA.
- a promoter will have a transcription initiating region, which is usually placed proximal to the 5' end of the coding sequence, and a TATA box, usually located 25-30 base pairs (bp) upstream of the transcription initiation site. The TATA box is thought to direct RNA polymerase II to begin RNA synthesis at the correct site.
- a mammalian promoter will also contain an upstream promoter element, usually located within 100 to 200 bp upstream of the TATA box.
- An upstream promoter element determines the rate at which transcription is imtiated and can act in either orientation [Sambrook et al. (1989) "Expression of Cloned Genes in Mammalian Cells.” In Molecular Cloning: A Laboratory Manual, 2nd ed.].
- Mammalian viral genes are often highly expressed and have a broad host range; therefore sequences encoding mammalian viral genes provide particularly useful promoter sequences. Examples include the SV40 early promoter, mouse mammary tumor virus LTR promoter, adenovirus major late promoter (Ad MLP), and herpes simplex virus promoter. In addition, sequences derived from non- viral genes, such as the murine metallotheionein gene, also provide useful promoter sequences. Expression may be either constitutive or regulated (inducible), depending on the promoter can be induced with glucocorticoid in hormone-responsive cells.
- Enhancer is a regulatory DNA sequence that can stimulate transcription up to 1000-fold when linked to homologous or heterologous promoters, with synthesis beginning at the normal RNA start site. Enhancers are also active when they are placed upstream or downstream from the transcription initiation site, in either normal or flipped orien- tation, or at a distance of more than 1000 nucleotides from the promoter [Maniatis et al. (1987) Science 236:1237; Alberts et al. (1989) Molecular Biology of the Cell, 2nd ed.]. Enhancer elements derived from viruses may be particularly useful, because they usually have a broader host range.
- Examples include the SV40 early gene enhancer [Dijkema et al (1985) EMBO J. 4:761] and the enhancer/promoters derived from the long terminal repeat (LTR) of the Rous Sarcoma Virus [Gorman et al. (1982b) Proc. Natl. Acad. Sci. 79:6777] and from human cytomegalovirus [Boshart et al. (1985) Cell 41:521 ⁇ . Additionally, some enhancers are regulatable and become active only in the presence of an inducer, such as a hormone or metal ion [Sassone-Corsi and Borelli (1986) Trends Genet. 2:215; Maniatis et al. (1987) Science 236:1237].
- an inducer such as a hormone or metal ion
- a DNA molecule may be expressed intracellularly in mammalian cells.
- a promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus of the recombin.ant protein will always be a methionine, which is encoded by the ATG start codon. If desired, the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide.
- foreign proteins can also be secreted from the cell into the growth media by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provides for secretion of the foreign protein in mammalian cells.
- a leader sequence fragment that provides for secretion of the foreign protein in mammalian cells.
- processing sites encoded between the leader fragment and the foreign gene that can be cleaved either in vivo or in vitro.
- the leader sequence fragment usually encodes a signal peptide comprised of hydrophobic .amino acids which direct the secretion of the protein from the cell.
- the adenovirus triparite leader is an example of a leader sequence that provides for secretion of a foreign protein in mammalian cells.
- transcription termination and polyadenylation sequences recognized by mammalian cells are regulatory regions located 3' to the translation stop codon and thus, together with the promoter elements, flank the coding sequence.
- the 3' terminus of the mature mRNA is formed by site- specific post-transcriptional cleavage and polyadenylation [Birnstiel et al. (1985) Cell 41:349; Proudfoot and Whitelaw (1988) "Termination and 3' end processing of eukaryotic RNA. In Transcription and splicing (ed. B.D. Hames and D.M. Glover); Proudfoot (1989) Trends Biochem. Sci. 14:105].
- transcription terminater/polyadenylation signals include those derived from SV40 [Sambrook et al (1989) "Expression of cloned genes in cultured mammalian cells.” In Molecular Cloning: A Laboratory Manual].
- the above described components comprising a promoter, polyadenylation signal, and transcription termination sequence are put together into expression constructs.
- Enhancers, introns with functional splice donor and acceptor sites, and leader sequences may also be included in an expression construct, if desired.
- Expression constructs are often maintained in a replicon, such as an extrachromosomal element (eg. plasmids) capable of stable maintenance in a host, such as mammalian cells or bacteria.
- Mammalian replication systems include those derived from animal viruses, which require trans-acting factors to replicate.
- plasmids containing the replication systems of papovaviruses such as SV40 [Gluzman (1981) Cell 25:175] or polyomavirus, replicate to extremely high copy number in the presence of the appropriate viral T antigen.
- mammalian replicons include those derived from bovine papillomavirus and Epstein-Barr virus.
- the replicon may have two replicaton systems, thus allowing it to be maintained, for example, in mammalian cells for expression and in a prokaryotic host for cloning and amplification.
- mammalian-bacteria shuttle vectors include pMT2 [Kaufman et al. (1989) Mol. Cell. Biol. 9:946] and pHEBO [Shimizu et al. (1986) Mol. Cell. Biol. 5:1074].
- the transformation procedure used depends upon the host to be transformed.
- Methods for introduction of heterologous polynucleotides into mammalian cells include dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, and direct microinjection of the DNA into nuclei.
- Mammalian cell lines available as hosts for expression are known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC), including but not limited to, Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (eg. Hep G2), and a number of other cell lines.
- ATCC American Type Culture Collection
- CHO Chinese hamster ovary
- HeLa cells HeLa cells
- BHK baby hamster kidney cells
- COS monkey kidney cells
- human hepatocellular carcinoma cells eg. Hep G2
- the polynucleotide encoding the protein can also be inserted into a suitable insect expression vector, and is operably linked to the control elements within that vector.
- Vector construction employs techniques which are known in the art.
- the components of the expression system include a transfer vector, usually a bacterial plasmid, which contains both a fragment of the baculovirus genome, and a convenient restriction site for insertion of the heterologous gene or genes to be expressed; a wild type baculovirus with a sequence homologous to the baculovirus-specific fragment in the transfer vector (this allows for the homologous recombination of the heterologous gene in to the baculovirus genome); and appropriate insect host cells and growth media.
- the vector and the wild type viral genome are transfected into an insect host cell where the vector and viral genome are allowed to recombine.
- the packaged recombinant virus is expressed and recombinant plaques are identified and purified.
- Materials and methods for baculovirus/insect cell expression systems are commercially available in kit form from, ter alia, Invitrogen, San Diego CA ("MaxBac” kit). These techniques are generally known to those skilled in the art and fully described in Summers and Smith, Texas Agricultural Experiment Station Bulletin No. 1555 (1987) (hereinafter "Summers and Smith”).
- an intermediate transplacement construct Prior to inserting the DNA sequence encoding the protein into the baculovirus genome, the above described components, comprising a promoter, leader (if desired), coding sequence of interest, and transcription termination sequence, are usually assembled into an intermediate transplacement construct (transfer vector).
- This construct may contain a single gene and operably linked regulatory elements; multiple genes, each with its owned set of operably linked regulatory elements; or multiple genes, regulated by the same set of regulatory elements.
- Intermediate transplacement constructs are often maintained in a replicon, such as an extrachromosomal element (eg. plasmids) capable of stable maintenance in a host, such as a bacterium.
- the replicon will have a replication system, thus allowing it to be maintained in a suitable host for cloning and amplification.
- pAc373 the most commonly used transfer vector for introducing foreign genes into AcNPV.
- Many other vectors known to those of skill in the art, have also been designed. These include, for example, pVL985 (which alters the polyhedrin start codon from ATG to ATT, and which introduces a BamHl cloning site 32 basepairs downstream from the ATT; see Luckow and Summers, Virology (1989) 77:31.
- the pl.asmid usually also contains the polyhedrin polyadenylation signal (Miller et al. (1988) Ann. Rev. Microbiol, 42:177) and a prokaryotic ampicillin-resistance (amp) gene and origin of replication for selection and propagation in E. coli.
- Baculovirus transfer vectors usually contain a baculovirus promoter.
- a baculovirus promoter is any DNA sequence capable of binding a baculovirus RNA polymerase and initiating the downstream (5' to 3') transcription of a coding sequence (eg. structural gene) into mRNA.
- a promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site and a transcription initiation site.
- a baculovirus transfer vector may also have a second domain called an enhancer, which, if present, is usually distal to the structural gene. Expression may be either regulated or constitutive.
- Structural genes abundantly transcribed at late times in a viral infection cycle, provide particularly useful promoter sequences. Examples include sequences derived from the gene encoding the viral polyhedron protein, Friesen et al., (1986) "The Regulation of Baculovirus Gene Expression,” in: The Molecular Biology of Baculoviruses (ed. Walter Doerfler); EPO Publ. Nos. 127 839 and 155 476; and the gene encoding the plO protein, Vlak et al., (1988), J. Gen. Virol. 69:765.
- DNA encoding suitable signal sequences can be derived from genes for secreted insect or baculovirus proteins, such as the baculovirus polyhedrin gene (Carbonell et al. (1988) Gene, 73:409).
- the signals for mammalian cell posttranslational modifications such as signal peptide cleavage, proteolytic cleavage, and phosphorylation
- the signals required for secretion and nuclear accumulation also appear to be conserved between the invertebrate cells and vertebrate cells
- leaders of non-insect origin such as those derived from genes encoding human ⁇ -interferon, Maeda et al., (1985), Nature 315:592; human gastrin-releasing peptide, Lebacq-Verheyden et al, (1988), Molec.
- a recombinant polypeptide or polyprotein may be expressed intracellularly or, if it is expressed with the proper regulatory sequences, it can be secreted.
- Good intracellular expression of nonfused foreign proteins usually requires heterologous genes that ideally have a short leader sequence containing suitable translation initiation signals preceding an ATG start signal. If desired, methionine at the N-terminus may be cleaved from the mature protein by in vitro incubation with cyanogen bromide.
- recombinant polyproteins or proteins which are not naturally secreted can be secreted from the insect cell by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provides for secretion of the foreign protein in insects.
- the leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the translocation of the protein into the endoplasmic reticulum.
- an insect cell host is co-transformed with the heterologous DNA of the transfer vector and the genomic DNA of wild type baculovirus — usually by co-transfection.
- the promoter and transcription termination sequence of the construct will usually comprise a 2-5kb section of the baculovirus genome.
- the insertion can be into a gene such as the polyhedrin gene, by homologous double crossover recombination; insertion can also be into a restriction enzyme site engineered into the desired baculovirus gene. Miller et al, (1989), Bioessays :91.
- the DNA sequence, when cloned in place of the polyhedrin gene in the expression vector, is flanked both 5' and 3' by polyhedrin-specific sequences and is positioned downstream of the polyhedrin promoter.
- the newly formed baculovirus expression vector is subsequently packaged into an infectious recombinant baculovirus. Homologous recombination occurs at low frequency (between about 1% and about 5%); thus, the majority of the virus produced after cotransfection is still wild-type virus. Therefore, a method is necessary to identify recombinant viruses.
- An advantage of the expression system is a visual screen allowing recombinant viruses to be distinguished.
- the polyhedrin protein which is produced by the native virus, is produced at very high levels in the nuclei of infected cells at late times after viral infection. Accumulated polyhedrin protein forms occlusion bodies that also contain embedded particles.
- occlusion bodies up to 15 ⁇ m in size, are highly refractile, giving them a bright shiny appearance that is readily visualized under the light microscope.
- Cells infected with recombinant viruses lack occlusion bodies.
- the transfection supernatant is plaqued onto a monolayer of insect cells by techniques known to those skilled in the art. Namely, the plaques are screened under the light microscope for the presence (indicative of wild-type virus) or absence (indicative of recombinant virus) of occlusion bodies.
- Recombinant baculovirus expression vectors have been developed for infection into several insect cells.
- recombinant baculoviruses have been developed for, inter alia: Aedes aegypti , Autographa californica, Bombyx mori, Drosophila melanogaster, Spodoptera frugiperda, and Trichoplusi ⁇ ni (WO 89/046699; Garbonell et al, (1985) J Virol. 56:153; Wright (1986) N ⁇ twre 527:718; Smith et al, (1983) Mol. Cell. Biol. 5:2156; and see generally, Fraser, et ⁇ l. (1989) In Vitro Cell. Dev. Biol.
- Cells and cell culture media are commercially available for both direct and fusion expression of heterologous polypeptides in a baculovirus/expression system; cell culture technology is generally known to those skilled in the art. See, eg. Summers and Smith supra.
- the modified insect cells may then be grown in an appropriate nutrient medium, which allows for stable maintenance of the plasmid(s) present in the modified insect host.
- the expression product gene is under inducible control, the host may be grown to high density, and expression induced.
- the product will be continuously expressed into the medium and the nutrient medium must be continuously circulated, while removing the product of interest and augmenting depleted nutrients.
- the product may be purified by such techniques as chromatography, eg. HPLC, affinity chromatography, ion exchange chromatography, etc.; electrophoresis; density gradient centrifugation; solvent extraction, or the like.
- the product may be further purified, as required, so as to remove substantially any insect proteins which are also secreted in the medium or result from lysis of insect cells, so as to provide a product which is at least substantially free of host debris, eg. proteins, lipids and polysaccharides.
- host debris eg. proteins, lipids and polysaccharides.
- recombinant host cells derived from the transformants are incubated under conditions which allow expression of the recombinant protein encoding sequence. These conditions will vary, dependent upon the host cell selected. However, the conditions are readily ascertainable to those of ordinary skill in the art, based upon what is known in the art. iii. Plant Systems There are many plant cell culture and whole plant genetic expression systems known in the art.
- Exemplary plant cellular genetic expression systems include those described in patents, such as: US 5,693,506; US 5,659,122; and US 5,608,143. Additional examples of genetic expression in plant cell culture has been described by Zenk, Phytochemistry 30:3861-3863 (1991). Descriptions of plant protein signal peptides may be found in addition to the references described above in Vaulcombe et al., Mol. Gen. Genet. 209:33-40 (1987); Chandler et al., Plant Molecular Biology 3:407-418 (1984); Rogers, J Biol. Chem.
- a desired polynucleotide sequence is inserted into an expression cassette comprising genetic regulatory elements designed for operation in plants.
- the expression cassette is inserted into a desired expression vector with companion sequences upstream and downstream from the expression cassette suitable for expression in a plant host.
- the companion sequences will be of plasmid or viral origin and provide necessary characteristics to the vector to permit the vectors to move DNA from .an original cloning host, such as bacteria, to the desired plant host.
- the basic bacterial/plant vector construct will preferably provide a broad host range prokaryote replication origin; a prokaryote selectable marker; and, for Agrobacterium transformations, T DNA sequences for Agrobacterium-mediated transfer to plant chromosomes.
- the construct will preferably also have a selectable marker gene suitable for determining if a plant cell has been transformed.
- a selectable marker gene suitable for determining if a plant cell has been transformed is found in Wilmink and Dons, 1993, Plant Mol. Biol. Reptr, 11(2):165-185.
- Sequences suitable for permitting integration of the heterologous sequence into the plant genome are also recommended. These might include transposon sequences and the like for homologous recombination as well as Ti sequences which permit random insertion of a heterologous expression cassette into a plant genome. Suitable prokaryote selectable markers include resistance toward antibiotics such as ampicillin or tetracycline. Other DNA sequences encoding additional functions may also be present in the vector, as is known in the art.
- the nucleic acid molecules of the subject invention may be included into an expression cassette for expression of the protein(s) of interest.
- the recombinant expression cassette will contain in addition to the heterologous protein encoding sequence the following elements, a promoter region, plant 5' untranslated sequences, initiation codon depending upon whether or not the structural gene comes equipped with one, and a transcription .and translation termination sequence.
- Unique restriction enzyme sites at the 5' and 3' ends of the cassette allow for easy insertion into a pre-existing vector.
- a heterologous coding sequence may be for any protein relating to the present invention.
- the sequence encoding the protein of interest will encode a signal peptide which allows processing and translocation of the protein, as appropriate, and will usually lack any sequence which might result in the binding of the desired protein of the invention to a membrane. Since, for the most part, the transcriptional initiation region will be for a gene which is expressed and translocated during germination, by employing the signal peptide which provides for translocation, one may also provide for translocation of the protein of interest. In this way, the protein(s) of interest will be translocated from the cells in which they are expressed and may be efficiently harvested. Typically secretion in seeds are across the aleurone or scutellar epithelium layer into the endosperm of the seed. While it is not required that the protein be secreted from the cells in which the protein is produced, this facilitates the isolation and purification of the recombinant protein.
- the ultimate expression of the desired gene product will be in a eucaryotic cell it is desirable to determine whether any portion of the cloned gene contains sequences which will be processed out as introns by the host's splicosome machinery. If so, site-directed mutagenesis of the "intron" region may be conducted to prevent losing a portion of the genetic message as a false intron code, Reed and Maniatis, Cell 41:95-105, 1985.
- the vector can be microinjected directly into plant cells by use of micropipettes to mechanically transfer the recombinant DNA. Crossway, Mol. Gen. Genet, 202:179-185, 1985.
- the genetic material may also be transferred into the plant cell by using polyethylene glycol, Krens, et al., Nature, 296, 72-7 , 1982.
- Another method of introduction of nucleic acid segments is high velocity ballistic penetration by small particles with the nucleic acid either within the matrix of small beads or particles, or on the surface, Klein, et al., Nature, 327, 70-73, 1987 and Knudsen and Muller, 1991, Planta, 185:330-336 teaching particle bombardment of barley endosperm to create transgenic barley.
- Yet another method of introduction would be fusion of protoplasts with other entities, either minicells, cells, lysosomes or other fusible lipid-surfaced bodies, Fraley, et al., Proc. Natl. Acad. Sci. USA, 79, 1859-1863, 1982.
- the vector may also be introduced into the plant cells by electroporation.
- electroporation fromm et al., Proc. Natl Acad. Sci. USA 82:5824, 1985.
- plant protoplasts are electroporated in the presence of plasmids containing the gene construct. Electrical impulses of high field strength reversibly permeabilize biomembranes allowing the introduction of the plasmids. Electroporated plant protoplasts reform the cell wall, divide, and form plant callus. All plants from which protoplasts can be isolated and cultured to give whole regenerated plants can be transformed by the present invention so that whole plants are recovered which contain the transferred gene.
- plants can be regenerated from cultured cells or tissues, including but not limited to all major species of sugarcane, sugar beet, cotton, fruit and other trees, legumes and vegetables.
- Some suitable plants include, for example, species from the genera Fragaria, Lotus, Medicago, Onobrychis, Trifolium, Trigonella, Vigna, Citrus, Linum, Geranium, Manihot, Daucus, Arabidopsis, Brassica, Raphanus, Sinapis, Atropa, Capsicum, Datura, Hyoscyamus, Lycopersion, Nicotiana, Solanum, Petunia, Digitalis, Majorana, Cichorium, Helianthus, Lactuca, Bromus, Asparagus, Antirrhinum, Hererocallis, Nemesia, Pelargonium, Panicum, Pennisetum, Ranunculus, Senecio, Salpiglossis, Cucumis, Browaalia, Glycine, Lolium,
- Means for regeneration vary from species to species of plants, but generally a suspension of transformed protoplasts containing copies of the heterologous gene is first provided. Callus tissue is formed and shoots may be induced from callus and subsequently rooted. Alternatively, embryo formation can be induced from the protoplast suspension. These embryos germinate as natural embryos to form plants.
- the culture media will generally contain various amino acids and hormones, such as auxin and cytokinins. It is also advantageous to add glutamic acid and proline to the medium, especially for such species as corn and alfalfa. Shoots and roots normally develop simultaneously. Efficient regeneration will depend on the medium, on the genotype, and on the history of the culture. If these three variables are controlled, then regeneration is fully reproducible and repeatable.
- the desired protein of the invention may be excreted or alternatively, the protein may be extracted from the whole plant. Where the desired protein of the invention is secreted into the medium, it may be collected. Alternatively, the embryos and embryoless-half seeds or other plant tissue may be mechanically disrupted to release any secreted protein between cells and tissues. The mixture may be suspended in a buffer solution to retrieve soluble proteins. Conventional protein isolation and purification methods will be then used to purify the recombinant protein. Parameters of time, temperature pH, oxygen, and volumes will be adjusted through routine methods to optimize expression and recovery of heterologous protein. iv. Bacterial Systems
- a bacterial promoter is any DNA sequence capable of binding bacterial RNA polymerase and initiating the downstream (3') transcription of a coding sequence (eg. structural gene) into mRNA.
- a promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site and a transcription initiation site.
- a bacterial promoter may also have a second domain called an operator, that may overlap an adjacent RNA polymerase binding site at which RNA synthesis begins. The operator permits negative regulated (inducible) transcription, as a gene repressor protein may bind the operator and thereby inhibit transcription of a specific gene.
- Constitutive expression may occur in the absence of negative regulatory elements, such as the operator.
- positive regulation may be achieved by a gene activator protein binding sequence, which, if present is usually proximal (5') to the RNA polymerase binding sequence.
- An example of a gene activator protein is the catabolite activator protein (CAP), which helps initiate transcription of the lac operon in Escherichia coli (E. coli) [Raibaud et al. (1984) Annu. Rev. Genet. 18:173].
- Regulated expression may therefore be either positive or negative, thereby either enhancing or reducing transcription.
- Sequences encoding metabolic pathway enzymes provide particularly useful promoter sequences. Examples include promoter sequences derived from sugar metabolizing enzymes, such as galactose, lactose (lac) [Chang et al. (1977) Nature 795:1056], and maltose. Additional examples include promoter sequences derived from biosynthetic enzymes such as tryptophan (trp) [Goeddel et al. (1980) NMC. Acids Res. 5:4057; Yelverton et al. (1981) Nucl. Acids Res. 9:731; US patent 4,738,921; EP-A-0036776 and EP-A-0121775].
- sugar metabolizing enzymes such as galactose, lactose (lac) [Chang et al. (1977) Nature 795:1056]
- maltose additional examples include promoter sequences derived from biosynthetic enzymes such as tryptophan (trp) [Go
- synthetic promoters which do not occur in nature also function as bacterial promoters.
- transcription activation sequences of one bacterial or bacteriophage promoter may be joined with the operon sequences of another bacterial or bacteriophage promoter, creating a synthetic hybrid promoter [US patent 4,551,433].
- the tac promoter is a hybrid trp-lac promoter comprised of both trp promoter .and lac operon sequences that is regulated by the lac repressor [A ann et al. (1983) Gene 25:167; de Boer et al. (1983) Proc. Natl. Acad. Sci. 80:21].
- a bacterial promoter can include naturally occurring promoters of non-bacterial origin that have the ability to bind bacterial RNA polymerase and initiate transcription.
- a naturally occurring promoter of non-bacterial origin can also be coupled with a compatible RNA polymerase to produce high levels of expression of some genes in prokaryotes.
- the bacteriophage T7 RNA polymerase/promoter system is an example of a coupled promoter system [Studier et al. (1986) J. Mol. Biol. 759:113; Tabor et al. (1985) Proc Natl. Acad. Sci. 52:1074].
- a hybrid promoter can also be comprised of a bacteriophage promoter and an E. coli operator region ( ⁇ PO- A-0 267 851).
- an efficient ribosome binding site is also useful for the expression of foreign genes in prokaryotes.
- the ribosome binding site is called the Shine-Dalgarno (SD) sequence and includes an initiation codon (ATG) and a sequence 3-9 nucleotides in length located 3-11 nucleotides upstream of the initiation codon [Shine et al. (1975) Nature 254:3A].
- SD sequence is thought to promote binding of mRNA to the ribosome by the pairing of bases between the SD sequence and the 3' and of E. coli 16S rRNA [Steitz et al.
- a DNA molecule may be expressed infracellularly.
- a promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus will always be a methionine, which is encoded by the ATG start codon. If desired, methionine at the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide or by either in vivo on in vitro incubation with a bacterial methionine N-terminal peptidase (EPO-A-0 219 237).
- Fusion proteins provide an alternative to direct expression. Usually, a DNA sequence encoding the N-terminal portion of an endogenous bacterial protein, or other stable protein, is fused to the 5' end of heterologous coding sequences. Upon expression, this construct will provide a fusion of the two amino acid sequences.
- the bacteriophage lambda cell gene can be linked at the 5' terminus of a foreign gene and expressed in bacteria.
- the resulting fusion protein preferably retains a site for a processing enzyme (factor Xa) to cleave the bacteriophage protein from the foreign gene [Nagai et al. (1984) Nature 509:810]. Fusion proteins can also be made with sequences from the lacZ [Jia et al.
- the DNA sequence at the junction of the two amino acid sequences may or may not encode a cleavable site.
- a ubiquitin fusion protein is made with the ubiquitin region that preferably retains a site for a processing enzyme (eg. ubiquitin specific processing-protease) to cleave the ubiquitin from the foreign protein.
- a processing enzyme eg. ubiquitin specific processing-protease
- foreign proteins can also be secreted from the cell by creating chimeric DNA molecules that encode a fusion protein comprised of a signal peptide sequence fragment that provides for secretion of the foreign protein in bacteria [US patent 4,336,336].
- the signal sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the secretion of the protein from the cell.
- the protein is either secreted into the growth media (gram-positive bacteria) or into the periplasmic space, located between the inner and outer membrane of the cell (gram-negative bacteria).
- processing sites which can be cleaved either in vivo or in vitro encoded between the signal peptide fragment and the foreign gene.
- DNA encoding suitable signal sequences can be derived from genes for secreted bacterial proteins, such as the E. coli outer membrane protein gene (ompA) [Masui et al. (1983), in: Experimental Manipulation of Gene Expression; Ghrayeb et al. (1984) EMBO J. 5:2437] and the E. coli alkaline phosphatase signal sequence (phoA) [Oka et al. (1985) Proc. Natl. Acad. Sci. 52:7212].
- the signal sequence of the alpha-amylase gene from various Bacillus strains can be used to secrete heterologous proteins from B. subtilis [Palva et al. (1982) Proc. Natl. Acad. Sci. USA 79:5582; EP-A-0 244 042].
- transcription termination sequences recognized by bacteria are regulatory regions located 3' to the translation stop codon, and thus together with the promoter flank the coding sequence. These sequences direct the transcription of an mRNA which can be translated into the polypeptide encoded by the DNA. Transcription termination sequences frequently include DNA sequences of about 50 nucleotides capable of forming stem loop structures that aid in terminating transcription. Examples include transcription termination sequences derived from genes with strong promoters, such as the trp gene in E. coli as well as other biosynthetic genes.
- expression constructs are often maintained in a replicon, such as an extrachromosomal element (eg. plasmids) capable of stable maintenance in a host, such as bacteria.
- a replicon will have a replication system, thus allowing it to be maintained in a prokaryotic host either for expression or for cloning and amplification.
- a replicon may be either a high or low copy number plasmid.
- a high copy number plasmid will generally have a copy number ranging from about 5 to about 200, and usually about 10 to about 150.
- a host containing a high copy number plasmid will preferably contain at least about 10, and more preferably at least about 20 plasmids. Either a high or low copy number vector may be selected, depending upon the effect of the vector and the foreign protein on the host.
- the expression constructs can be integrated into the bacterial genome with an integrating vector.
- Integrating vectors usually contain at least one sequence homologous to the bacterial chromosome that allows the vector to integrate. Integrations appear to result from recombinations between homologous DNA in the vector and the bacterial chromosome.
- integrating vectors constructed with DNA from various Bacillus strains integrate into the Bacillus chromosome (EP-A- 0 127 328). Integrating vectors may also be comprised of bacteriophage or transposon sequences.
- extrachromosomal and integrating expression constructs may contain selectable markers to allow for the selection of bacterial strains that have been transformed.
- Selectable markers can be expressed in the bacterial host and may include genes which render bacteria resistant to drugs such as ampicillin, chloramphenicol, erythromycin, kanamycin (neomycin), and tetracycline [Davies et al. (1978) Annu. Rev. Microbiol. 52:469].
- Selectable markers may also include biosynthetic genes, such as those in the histidine, tryptophan, and leucine biosynthetic pathways.
- Transformation vectors are usually comprised of a selectable market that is either maintained in a replicon or developed into an integrating vector, as described above.
- Expression and transformation vectors have been developed for transformation into many bacteria.
- expression vectors have been developed for, inter alia, the following bacteria: Bacillus subtilis [Palva et al. (1982) Proc. Natl. Acad. Sci. USA 79:5582; EP-A-0 036 259 and EP-A-0 063 953; WO 84/04541], Escherichia coli [Shimatake et al. (1981) N ⁇ twre 292:128; Amann et al. (1985) Gene 40:183; Studier et al. (1986) J Mol. Biol.
- Methods of introducing exogenous DNA into bacterial hosts are well-known in the art, and usually include either the transformation of bacteria treated with CaCl 2 or other agents, such as divalent cations and DMSO.
- DNA can also be introduced into bacterial cells by electroporation. Transformation procedures usually vary with the bacterial species to be transformed. See eg. [Masson et al. (1989) FEMS Microbiol. Lett. 60:273; Palva et al. (1982) Proc. Natl. Acad. Sci. USA 79:5582; EP-A-0 036 259 and EP-A-0 063 953; WO 84/04541, Bacillus], [Miller et al. (1988) Proc. Natl. Acad. Sci.
- yeast expression systems are also known to one of ordinary skill in the art.
- a yeast promoter is any yeast promoter.
- a promoter will have a transcription initiation region which is usually placed proximal to the 5' end of the coding sequence. This transcription initiation region usually includes an RNA polymerase binding site (the "TATA Box") and a transcription initiation site.
- a yeast promoter may also have a second domain called an upstream activator sequence (UAS), which, if present, is usually distal to the structural gene.
- UAS upstream activator sequence
- the UAS permits regulated (inducible) expression. Constitutive expression occurs in the absence of a UAS. Regulated expression may be either positive or negative, thereby either enhancing or reducing transcription.
- Yeast is a fermenting organism with an active metabolic pathway, therefore sequences encoding enzymes in the metabolic pathway provide particularly useful promoter sequences. Examples include alcohol dehydrogenase (ADH) (EP-A-0 284 044), enolase, glucokinase, glucose-6- phosphate isomerase, glyceraldehyde-3-phosphate-dehydrogenase (GAP or GAPDH), hexokinase, phosphofructokinase, 3-phosphoglycerate mutase, and pyruvate kinase (PyK) (EPO-A-0 329 203).
- the yeast PH05 gene encoding acid phosphatase, also provides useful promoter sequences [Myanohara et al. (1983) Proc. Natl. Acad. Sci. USA 80:1].
- synthetic promoters which do not occur in nature also function as yeast promoters.
- UAS sequences of one yeast promoter may be joined with the transcription activation region of another yeast promoter, creating a synthetic hybrid promoter.
- hybrid promoters include the ADH regulatory sequence linked to the GAP transcription activation region (US Patent Nos. 4,876,197 and 4,880,734).
- Other examples of hybrid promoters include promoters which consist of the regulatory sequences of either the ADH2, GAL4, GALIO, OR PH05 genes, combined with the transcriptional activation region of a glycolytic enzyme gene such as GAP or PyK (EP-A-0 164 556).
- a yeast promoter can include naturally occurring promoters of non-yeast origin that have the ability to bind yeast RNA polymerase and initiate transcription.
- promoters include, inter alia, [Cohen et al. (1980) Proc. Natl. Acad. Sci. USA 77:1078; Henikoff et al. (1981) N ⁇ twre 255:835; Hollenberg et al. (1981) Curr. Topics Microbiol. Immunol. 96:1 9; Hollenberg et al. (1979) "The Expression of Bacterial Antibiotic Resistance Genes in the Yeast Saccharomyces cerevisiae," in: Plasmids of Medical, Environmental and Commercial Importance (eds. K. ⁇ . Timmis and A. Puhler); Mercerau-Puigalon et al. (1980) Gene 77:163; Panthier et al. (1980) Curr. Genet. 2:109;].
- a DNA molecule may be expressed mtracellularly in yeast.
- a promoter sequence may be directly linked with the DNA molecule, in which case the first amino acid at the N-terminus of the recombinant protein will always be a methionine, which is encoded by the ATG start codon. If desired, methionine at the N-terminus may be cleaved from the protein by in vitro incubation with cyanogen bromide. Fusion proteins provide an alternative for yeast expression systems, as well as in mammalian, baculovirus, and bacterial expression systems. Usually, a DNA sequence encoding the N-terminal portion of an endogenous yeast protein, or other stable protein, is fused to the 5' end of heterologous coding sequences.
- this construct will provide a fusion of the two amino acid sequences.
- the yeast or human superoxide dismutase (SOD) gene can be linked at the 5' terminus of a foreign gene and expressed in yeast.
- the DNA sequence at the junction of the two amino acid sequences may or may not encode a cleavable site. See eg. EP-A-0 196 056.
- Another example is a ubiquitin fusion protein.
- Such a fusion protein is made with the ubiquitin region that preferably retains a site for a processing enzyme (eg. ubiquitin-specific processing protease) to cleave the ubiquitin from the foreign protein.
- a processing enzyme eg. ubiquitin-specific processing protease
- foreign proteins can also be secreted from the cell into the growth media by creating chimeric DNA molecules that encode a fusion protein comprised of a leader sequence fragment that provide for secretion in yeast of the foreign protein.
- a leader sequence fragment that provide for secretion in yeast of the foreign protein.
- processing sites encoded between the leader fragment and the foreign gene that can be cleaved either in vivo or in vitro.
- the leader sequence fragment usually encodes a signal peptide comprised of hydrophobic amino acids which direct the secretion of the protein from the cell.
- DNA encoding suitable signal sequences can be derived from genes for secreted yeast proteins, such as the yeast invertase gene (EP-A-0 012 873; JPO. 62,096,086) and the A-factor gene (US patent 4,588,684).
- leaders of non-yeast origin such as an interferon leader, exist that also provide for secretion in yeast (EP-A-0 060 057).
- a preferred class of secretion leaders are those that employ a fragment of the yeast alpha-factor gene, which contains both a "pre" signal sequence, and a "pro” region.
- the types of alpha-factor fragments that can be employed include the full-length pre-pro alpha factor leader (about 83 amino acid residues) as well as truncated alpha-factor leaders (usually about 25 to about 50 amino acid residues) (US Patents 4,546,083 and 4,870,008; EP-A-0 324 274).
- Additional leaders employing an alpha-factor leader fragment that provides for secretion include hybrid alpha-factor leaders made with a presequence of a first yeast, but a pro-region from a second yeast alphafactor. (eg.
- transcription termination sequences recognized by yeast are regulatory regions located 3' to the translation stop codon, and thus together with the promoter flank the coding sequence. These sequences direct the transcription of an mRNA which can be translated into the polypeptide encoded by the DNA. Examples of transcription terminator sequence and other yeast-recognized termination sequences, such as those coding for glycolytic enzymes.
- Expression constructs are often maintained in a replicon, such as an extrachromosomal element (eg. plasmids) capable of stable maintenance in a host, such as yeast or bacteria.
- the replicon may have two replication systems, thus allowing it to be maintained, for example, in yeast for expression and in a prokaryotic host for cloning and amplification.
- yeast- bacteria shuttle vectors include YEp24 [Botstein et al. (1979) Gene 5:17-24], pCl/1 [Brake et al. (1984) Proc. Natl. Acad.
- a replicon may be either a high or low copy number plasmid.
- a high copy number plasmid will generally have a copy number ranging from about 5 to about 200, and usually about 10 to about 150.
- a host containing a high copy number plasmid will preferably have at least about 10, and more preferably at least about 20. Enter a high or low copy number vector may be selected, depending upon the effect of the vector and the foreign protein on the host. See eg. Brake et al., supra.
- the expression constructs can be integrated into the yeast genome with an integrating vector.
- Integrating vectors usually contain at least one sequence homologous to a yeast chromosome that allows the vector to integrate, and preferably contain two homologous sequences flanking the expression construct. Integrations appear to result from recombinations between homologous DNA in the vector and the yeast chromosome [Orr- Weaver et al. (1983) Methods in Enzymol. 101:228-245].
- An integrating vector may be directed to a specific locus in yeast by selecting the appropriate homologous sequence for inclusion in the vector. See Orr- Weaver et al., supra.
- One or more expression construct may integrate, possibly affecting levels of recombinant protein produced [Rine et al.
- the chromosomal sequences included in the vector can occur either as a single segment in the vector, which results in the integration of the entire vector, or two segments homologous to adjacent segments in the chromosome and flanking the expression construct in the vector, which can result in the stable integration of only the expression construct.
- extrachromosomal and integrating expression constructs may contain selectable markers to allow for the selection of yeast strains that have been transformed.
- Selectable markers may include biosynthetic genes that can be expressed in the yeast host, such as ADE2, HIS4, LEU2, TRP1, and ALG7, and the G418 resistance gene, which confer resistance in yeast cells to tunicamycin and G418, respectively.
- a suitable selectable marker may also provide yeast with the ability to grow in the presence of toxic compounds, such as metal.
- the presence of CUP1 allows yeast to grow in the presence of copper ions [Butt et al. (1987) Microbiol, Rev. 57:351].
- Transformation vectors are usually comprised of a selectable marker that is either maintained in a replicon or developed into an integrating vector, as described above.
- Expression and transformation vectors have been developed for transformation into many yeasts.
- expression vectors have been developed for, inter alia, the following yeasts: Candida albicans [Kurtz, et al. (1986) Mol.
- Pichia pastoris [Cregg, et al. (1985) Mol. Cell. Biol. 5:3376; US Patent Nos. 4,837,148 and 4,929,555], Saccharomyces cerevisiae [Hinnen et al. (1978) Proc. Natl. Acad. Sci. USA
- Methods of introducing exogenous DNA into yeast hosts are well-known in the art, and usually include either the transformation of spheroplasts or of intact yeast cells treated with alkali cations.
- Transformation procedures usually vary with the yeast species to be transformed. See eg. [Kurtz et al. (1986) Mol. Cell. Biol. 5:142; Kunze et al. (1985) J. Basic Microbiol. 25:141; Candida]; [Gleeson et al. (1986) J. Gen. Microbiol. 752:3459; Roggenkamp et al. (1986) Mol. Gen. Genet. 202:302; Hansenula]; [Das et al. (1984) J. Bacteriol. 755:1165; De Louvencourt et al. (1983) J. Bacteriol. 154:1165; Van den Berg et al.
- antibody refers to a polypeptide or group of polypeptides composed of at least one antibody combining site.
- An “antibody combining site” is the three-dimensional binding space with an internal surface shape and charge distribution complementary to the features of an epitope of an antigen, which allows a binding of the antibody with the antigen.
- Antibody includes, for example, vertebrate antibodies, hybrid antibodies, chimeric antibodies, humanised antibodies, altered antibodies, univalent .antibodies, Fab proteins, and single domain antibodies.
- Antibodies against the proteins of the invention are useful for affinity chromatography, immunoassays, and distinguishing/identifying Neisserial proteins.
- Antibodies to the proteins of the invention may be prepared by conventional methods.
- the protein is first used to immunize a suitable animal, preferably a mouse, rat, rabbit or goat. Rabbits and goats are preferred for the preparation of polyclonal sera due to the volume of serum obtainable, and the availability of labeled anti-rabbit and anti-goat antibodies.
- Immunization is generally performed by mixing or emulsifying the protein in saline, preferably in an adjuvant such as Freund's complete adjuvant, and injecting the mixture or emulsion parenterally (generally subcutaneously or intramuscularly). A dose of 50-200 ⁇ g/injection is typically sufficient.
- Immunization is generally boosted 2-6 weeks later with one or more injections of the protein in saline, preferably using Freund's incomplete adjuvant.
- Polyclonal antisera is obtained by bleeding the immunized animal into a glass or plastic container, incubating the blood at 25°C for one hour, followed by incubating at 4°C for 2-18 hours. The serum is recovered by centrifugation (eg. l,000g for 10 minutes). About 20-50 ml per bleed may be obtained from rabbits.
- Monoclonal antibodies are prepared using the standard method of Kohler & Milstein [Nature (1975) 256:495-96], or a modification thereof.
- a mouse or rat is immunized as described above.
- the spleen (and optionally several large lymph nodes) is removed and dissociated into single cells.
- the spleen cells may be screened (after removal of nonspecifically adherent cells) by applying a cell suspension to a plate or well coated with the protein antigen.
- B-cells expressing membrane-bound i munoglobulin specific for the antigen bind to the plate, and are not rinsed away with the rest of the suspension.
- Resulting B-cells, or all dissociated spleen cells are then induced to fuse with myeloma cells to form hybridomas, and are cultured in a selective medium (eg. hypoxanthine, aminopterin, thymidine medium, "HAT").
- a selective medium eg. hypoxanthine, aminopterin, thymidine medium, "HAT”
- the resulting hybridomas are plated by limiting dilution, and are assayed for the production of antibodies which bind specifically to the immunizing antigen (and which do not bind to unrelated antigens).
- the selected MAb-secreting hybridomas are then cultured either in vitro (eg. in tissue culture bottles or hollow fiber reactors), or in vivo (as ascites in mice).
- the antibodies may be labeled using conventional techniques. Suitable labels include fluorophores, chromophores, radioactive atoms (particularly 32 P and 125 I), electron-dense reagents, enzymes, and ligands having specific binding partners. Enzymes are typically detected by their activity. For example, horseradish peroxidase is usually detected by its ability to convert 3,3',5,5'-tetramethylbenzidine (TMB) to a blue pigment, quantifiable with a spectrophotometer. "Specific binding partner” refers to a protein capable of binding a ligand molecule with high specificity, as for example in the case of an antigen and a monoclonal antibody specific therefor.
- 125 I may serve as a radioactive label or as an electron-dense reagent.
- HRP may serve as enzyme or as antigen for a MAb.
- MAbs .and avidin also require labels in the practice of this invention: thus, one might label a MAb with biotin, and detect its presence with avidin labeled with 125 I, or with an anti-biotin MAb labeled with HRP.
- Other permutations and possibilities will be readily apparent to those of ordinary skill in the art, and are considered as equivalents within the scope of the instant invention.
- compositions can comprise either polypeptides, antibodies, or nucleic acid of the invention.
- the pharmaceutical compositions will comprise a therapeutically effective amount of either polypeptides, antibodies, or polynucleotides of the claimed invention.
- therapeutically effective amount refers to an amount of a therapeutic agent to treat, ameliorate, or prevent a desired disease or condition, or to exhibit a detectable therapeutic or preventative effect.
- the effect can be detected by, for example, chemical markers or antigen levels.
- Therapeutic effects also include reduction in physical symptoms, such as decreased body temperature.
- the precise effective amount for a subject will depend upon the subject's size and health, the nature and extent of the condition, and the therapeutics or combination of therapeutics selected for administration. Thus, it is not useful to specify an exact effective amount in advance. However, the effective amount for a given situation can be determined by routine experimentation and is within the judgement of the clinician.
- an effective dose will be from about 0.01 mg/ kg to 50 mg kg or 0.05 mg/kg to about 10 mg/kg of the DNA constructs in the individual to which it is administered.
- a pharmaceutical composition can also contain a pharmaceutically acceptable carrier.
- pharmaceutically acceptable carrier refers to a carrier for administration of a therapeutic agent, such as antibodies or a polypeptide, genes, and other therapeutic agents.
- the term refers to any pharmaceutical carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition, and which may be administered without undue toxicity.
- Suitable carriers may be large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, and inactive virus particles. Such carriers are well known to those of ordinary skill in the art.
- Pharmaceutically acceptable salts can be used therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like.
- Pharmaceutically acceptable carriers in therapeutic compositions may contain liquids such as water, saline, glycerol and ethanol. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, .and the like, may be present in such vehicles.
- the therapeutic compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared. Liposomes are included within the definition of a pharmaceutically acceptable carrier.
- compositions of the invention can be administered directly to the subject.
- the subjects to be treated can be animals; in particular, human subjects can be treated.
- Direct delivery of the compositions will generally be accomplished by injection, either subcutaneously, intraperitoneally, intravenously or intramuscularly or delivered to the interstitial space of a tissue.
- the compositions can also be administered into a lesion.
- Other modes of administration include oral and pulmonary administration, suppositories, and transdermal or transcutaneous applications (eg. see WO98/20734), needles, and gene guns or hyposprays.
- Dosage treatment may be a single dose schedule or a multiple dose schedule.
- Vaccines according to the invention may either be prophylactic (ie. to prevent infection) or therapeutic (ie. to treat disease after infection).
- Such vaccines comprise immunising antigen(s), immunogen(s), polypeptide(s), protein(s) or nucleic acid, usually in combination with "pharmaceutically acceptable carriers,” which include any carrier that does not itself induce the production of antibodies harmful to the individual receiving the composition.
- Suitable carriers are typically large, slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycolic acids, polymeric amino acids, amino acid copolymers, lipid aggregates (such as oil droplets or liposomes), and inactive virus particles.
- Such carriers are well known to those of ordinary skill in the art. Additionally, these carriers may function as immunostimulating agents ("adjuvants").
- the antigen or immunogen may be conjugated to a bacterial toxoid, such as a toxoid from diphtheria, tetanus, cholera, H. pylori, etc. pathogens.
- Preferred adjuvants to enhance effectiveness of the composition include, but are not limited to: (1) aluminum salts (alum), such as aluminum hydroxide, aluminum phosphate, aluminum sulfate, etc; (2) oil-in-water emulsion formulations (with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components), such as for example (a) MF59TM (WO 90/14837; Chapter 10 in Vaccine design: the subunit and adjuvant approach, eds.
- aluminum salts alum
- oil-in-water emulsion formulations with or without other specific immunostimulating agents such as muramyl peptides (see below) or bacterial cell wall components
- MF59TM WO 90/14837
- Span 85 containing various amounts of MTP-PE (see below), although not required) formulated into submicron particles using a microfluidizer such as Model HOY microfiuidizer (Microfluidics, Newton, MA), (b) SAF, containing 10% Squalane, 0.4% Tween 80, 5% pluronic- blocked polymer L121, and thr-MDP (see below) either microfluidized into a submicron emulsion or vortexed to generate a larger particle size emulsion, and (c) RibiTM adjuvant system (RAS), (Ribi Immunochem, Hamilton, MT) containing 2% Squalene, 0.2% Tween 80, and one or more bacterial cell wall components from the group consisting of monophosphorylipid A (MPL), trehalose dimycolate (TDM), and cell wall
- MPL monophosphorylipid A
- TDM trehalose dimycolate
- interferons eg. gamma interferon
- M-CSF macrophage colony stimulating factor
- TNF tumor necrosis factor
- other substances that act as immunostimulating agents to enhance the effectiveness of the composition.
- Alum and MF59TM are preferred.
- muramyl peptides include, but are not limited to, N-acetyl-muramyl-L- threonyl-D-isoglutamine (thr-MDP), N-acetyl-normuramyl-L-alanyl-D-isoglutamine (nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-( 1 '-2'-dipalmitoyl-5 «-glycero-3 - hydroxyphosphoryloxy)-ethylamine (MTP-PE), etc.
- thr-MDP N-acetyl-muramyl-L- threonyl-D-isoglutamine
- nor-MDP N-acetyl-normuramyl-L-alanyl-D-isoglutamine
- MTP-PE N-acetylmuramyl-L-alany
- the immunogenic compositions typically will contain diluents, such as water, saline, glycerol, ethanol, etc. Additionally, auxiliary substances, such as wetting or emulsifying agents, pH buffering substances, and the like, may be present in such vehicles.
- the immunogenic compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid vehicles prior to injection may also be prepared.
- the preparation also may be emulsified or encapsulated in liposomes for enhanced adjuvant effect, as discussed above under pharmaceutically acceptable carriers.
- Immunogenic compositions used as vaccines comprise an immunologically effective amount of the antigenic or immunogenic polypeptides, as well as any other of the above-mentioned components, as needed.
- immunologically effective amount it is meant that the administration of that amount to an individual, either in a single dose or as part of a series, is effective for treatment or prevention.
- This amount varies depending upon the health and physical condition of the individual to be treated, the taxonomic group of individual to be treated (eg. nonhuman primate, primate, etc.), the capacity of the individual's immune system to synthesize antibodies, the degree of protection desired, the formulation of the vaccine, the treating doctor's assessment of the medical situation, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials.
- the immunogenic compositions are conventionally administered parenterally, eg. by injection, either subcutaneously, intramuscularly, or transdermally/transcutaneously (eg. WO98/20734). Additional formulations suitable for other modes of administration include oral and pulmonary formulations, suppositories, and transdermal applications. Dosage treatment may be a single dose schedule or a multiple dose schedule.
- the vaccine may be administered in conjunction with other immunoregulatory agents.
- DNA vaccination may be employed [eg. Robinson & Torres (1997) Seminars in Immunology 9:271-283; Donnelly et al. (1997) Annu Rev Immunol 15:617-648; see later herein].
- Gene therapy vehicles for delivery of constructs including a coding sequence of a therapeutic of the invention, to be delivered to the mammal for expression in the mammal can be administered either locally or systemically.
- constructs can utilize viral or non- viral vector approaches in in vivo or ex vivo modality. Expression of such coding sequence can be induced using endogenous mammalian or heterologous promoters. Expression of the coding sequence in vivo can be either constitutive or regulated.
- the invention includes gene delivery vehicles capable of expressing the contemplated nucleic acid sequences.
- the gene delivery vehicle is preferably a viral vector and, more preferably, a retroviral, adenoviral, adeno-associated viral (AAV), herpes viral, or alphavirus vector.
- the viral vector can also be an astrovirus, coronavirus, orthomyxovirus, papovavirus, paramyxovirus, parvovirus, picornavirus, poxvirus, or togavirus viral vector. See generally, Jolly (1994) Cancer Gene Therapy 1:51-64; Kimura (1994) Human Gene Therapy 5:845-852; Connelly (1995) Human Gene Therapy 6:185-193; and Kaplitt (1994) Nature Genetics 6:148-153.
- Retroviral vectors are well known in the art and we contemplate that any retroviral gene therapy vector is employable in the invention, including B, C and D type retroviruses, xenotropic retroviruses (for example, NZB-X1, NZB-X2 and NZB9-1 (see O'Neill (1985) J. Virol. 53:160) polytropic retroviruses eg. MCF and MCF-MLV (see Kelly (1983) J. Virol. 45:291), spumaviruses and lentiviruses. See RNA Tumor Viruses, Second Edition, Cold Spring Harbor Laboratory, 1985.
- xenotropic retroviruses for example, NZB-X1, NZB-X2 and NZB9-1 (see O'Neill (1985) J. Virol. 53:160)
- polytropic retroviruses eg. MCF and MCF-MLV (see Kelly (1983) J. Virol. 45:291)
- retroviral gene therapy vector may be derived from different retroviruses.
- retro vector LTRs may be derived from a Murine Sarcoma Virus, a tRNA binding site from a Rous Sarcoma Virus, a packaging signal from a Murine Leukemia Virus, and an origin of second strand synthesis from an Avian Leukosis Virus.
- Retroviral vectors may be used to generate transduction competent retroviral vector particles by introducing them into appropriate packaging cell lines (see US patent 5,591,624).
- Retrovirus vectors can be constructed for site-specific integration into host cell DNA by incorporation of a chimeric integrase enzyme into the retroviral particle (see WO96/37626). It is preferable that the recombinant viral vector is a replication defective recombinant virus.
- Packaging cell lines suitable for use with the above-described retrovirus vectors are well known in the art, are readily prepared (see WO95/30763 and WO92/05266), and can be used to create producer cell lines (also termed vector cell lines or "VCLs") for the production of recombinant vector particles.
- the packaging cell lines are made from human parent cells (eg. HT1080 cells) or mink parent cell lines, which eliminates inactivation in human serum.
- Preferred retroviruses for the construction of retroviral gene therapy vectors include Avian Leukosis Virus, Bovine Leukemia, Virus, Murine Leukemia Virus, Mink-Cell Focus-Inducing Virus, Murine Sarcoma Virus, Reticuloendothehosis Virus and Rous Sarcoma Virus.
- Particularly preferred Murine Leukemia Viruses include 4070A and 1504A (Hartley and Rowe (1976) J Virol 19:19-25), Abelson (ATCC No. VR-999), Friend (ATCC No. VR-245), Graffi, Gross (ATCC Nol VR-590), Kirsten, Harvey Sarcoma Virus and Rauscher (ATCC No.
- Retroviruses may be obtained from depositories or collections such as the American Type Culture Collection (“ATCC”) in Rockville, Maryland or isolated from known sources using commonly available techniques.
- ATCC American Type Culture Collection
- Exemplary known retroviral gene therapy vectors employable in this invention include those described in patent applications GB2200651, EP0415731, EP0345242, EP0334301, WO89/02468; WO89/05349, WO89/09271, WO90/02806, WO90/07936, WO94/03622, WO93/25698, WO93/25234, WO93/11230, WO93/10218, WO91/02805, WO91/02825, WO95/07994, US 5,219,740, US 4,405,712, US 4,861,719, US 4,980,289, US 4,777,127, US 5,591,624.
- Human adenoviral gene therapy vectors are also known in the art and employable in this invention. See, for example, Berkner (1988) Biotechniques 6:616 and Rosenfeld (1991) Science 252:431, and WO93/07283, WO93/06223, and WO93/07282.
- Exemplary known adenoviral gene therapy vectors employable in this invention include those described in the above referenced documents and in WO94/12649, WO93/03769, WO93/19191, WO94/28938, WO95/11984, WO95/00655, WO95/27071, WO95/29993, WO95/34671, WO96/05320, WO94/08026, WO94/11506, WO93/06223, WO94/24299, WO95/14102, WO95/24297, WO95/02697, WO94/28152, WO94/24299, WO95/09241, WO95/25807, WO95/05835, WO94/18922 and WO95/09654.
- the gene delivery vehicles of the invention also include adenovirus associated virus (AAV) vectors.
- AAV adenovirus associated virus
- Leading and preferred examples of such vectors for use in this invention are the AAV-2 based vectors disclosed in Srivastava, WO93/09239.
- Most preferred AAV vectors comprise the two AAV inverted terminal repeats in which the native D-sequences are modified by substitution of nucleotides, such that at least 5 native nucleotides and up to 18 native nucleotides, preferably at least 10 native nucleotides up to 18 native nucleotides, most preferably 10 native nucleotides are retained and the remaining nucleotides of the D-sequence are deleted or replaced with non-native nucleotides.
- the native D-sequences of the AAV inverted terminal repeats are sequences of 20 consecutive nucleotides in each AAV inverted terminal repeat (ie. there is one sequence at each end) which are not involved in HP formation.
- the non-native replacement nucleotide may be any nucleotide other than the nucleotide found in the native D-sequence in the same position.
- Other employable exemplary AAV vectors are pWP-19, pWN-1, both of which are disclosed in Nahreini (1993) Gene 124:257-262.
- Another example of such an AAV vector is psub201 (see Samulski (1987) J Virol. 61:3096).
- Another exemplary AAV vector is the Double-D ITR vector. Construction of the Double-D ITR vector is disclosed in US Patent 5,478,745.
- Still other vectors are those disclosed in Carter US Patent 4,797,368 and MuzyczkaUS Patent 5,139,941, Chartejee US Patent 5,474,935, and Kotin WO94/288157.
- Yet a further example of an AAV vector employable in this invention is SSV9AFABTKneo, which contains the AFP enhancer and albumin promoter and directs expression predominantly in the liver. Its structure and construction are disclosed in Su (1996) Human Gene Therapy 7:463-470. Additional AAV gene therapy vectors are described in US 5,354,678, US 5,173,414, US 5,139,941, and US 5,252,479.
- the gene therapy vectors of the invention also include herpes vectors.
- Leading and preferred examples are herpes simplex virus vectors containing a sequence encoding a thymidine kinase polypeptide such as those disclosed in US 5,288,641 and EP0176170 (Roizman).
- herpes simplex virus vectors include HFEM/ICP6-LacZ disclosed in WO95/04139 (Wistar Institute), pHSVlac described in Geller (1988) Science 241:1667-1669 and in WO90/09441 and WO92/07945, HSV Us3::pgC-lacZ described in Fink (1992) Human Gene Therapy 3:11-19 and HSV 7134, 2 RH 105 and GAL4 described in EP 0453242 (Breakefield), and those deposited with the ATCC as accession numbers ATCC VR-977 and ATCC VR-260.
- alpha virus gene therapy vectors that can be employed in this invention.
- Preferred alpha virus vectors are Sindbis viruses vectors. Togaviruses, Semliki Forest virus (ATCC VR-67; ATCC VR-1247), Middleberg virus (ATCC VR-370), Ross River virus (ATCC VR-373; ATCC VR-1246), Venezuelan equine encephalitis virus (ATCC VR923; ATCC VR-1250; ATCC VR-1249; ATCC VR-532), and those described in US patents 5,091,309, 5,217,879, and WO92/10578. More particularly, those alpha virus vectors described in US Serial No.
- alpha viruses may be obtained from depositories or collections such as the ATCC in Rockville, Maryland or isolated from known sources using commonly available techniques.
- alphavirus vectors with reduced cytotoxicity are used (see USSN 08/679640).
- DNA vector systems such as eukarytic layered expression systems are also useful for expressing the nucleic acids of the invention. See WO95/07994 for a detailed description of eukaryotic layered expression systems.
- the eukaryotic layered expression systems of the invention are derived from alphavirus vectors and most preferably from Sindbis viral vectors.
- viral vectors suitable for use in the present invention include those derived from poliovirus, for example ATCC VR-58 and those described in Evans, Nature 339 (1989) 385 and Sabin (1973) J. Biol. Standardization 1:115; rhinovirus, for example ATCC VR-1110 and those described in Arnold (1990) J Cell Biochem L401; pox viruses such as canary pox virus or vaccinia virus, for example ATCC VR-111 and ATCC VR-2010 and those described in Fisher-Hoch (1989) Proc Natl Acad Sci 86:317; Flexner (1989) Ann NY Acad Sci 569:86, Flexner (1990) Vaccine 8:17; in US 4,603,112 and US 4,769,330 and WO89/01973; SV40 virus, for example ATCC VR-305 and those described in Mulligan (1979) N ⁇ twre 277:108 and Madzak (1992) J Gen Virol 73:1533; influenza virus, for example ATCC VR-797 and recombinant influenza viruses made
- measles virus for example ATCC VR-67 and VR-1247 and those described in EP-0440219; Aura virus, for example ATCC VR-368; Bebaru virus, for example ATCC VR-600 and ATCC VR-1240; Cabassou virus, for example ATCC VR-922; Chikungunya virus, for example ATCC VR-64 and ATCC VR-1241; Fort Morgan Virus, for example ATCC VR-924; Getah virus, for example ATCC VR-369 and ATCC VR-1243; Kyzylagach virus, for example ATCC VR-927; Mayaro virus, for example ATCC VR-66; Mucambo virus, for example ATCC VR-580 and ATCC VR-1244; ⁇ dumu virus, for example ATCC VR-371; Pixuna virus, for example ATCC VR-372 and ATCC VR-1245; Tonate virus, for example ATCC VR-925; Triniti virus, for example ATCC VR-469; Una virus, for example ATCC VR-374; Whataro
- compositions of this invention into cells is not limited to the above mentioned viral vectors.
- Other delivery methods and media may be employed such as, for example, nucleic acid expression vectors, polycationic condensed DNA linked or unlinked to killed adenovirus alone, for example see US Serial No. 08/366,787, filed December 30, 1994 and Curiel (1992) Hum Gene Ther 3:147-154 ligand linked DNA, for example see Wu (1989) J Biol Chem 264:16985-16987, eucaryotic cell delivery vehicles cells, for example see US Serial No.08/240,030, filed May 9, 1994, and US Serial No.
- Particle mediated gene transfer may be employed, for example see US Serial No. 60/023,867. Briefly, the sequence can be inserted into conventional vectors that contain conventional control sequences for high level expression, and then incubated with synthetic gene transfer molecules such as polymeric DNA-binding cations like polylysine, protamine, and albumin, linked to cell targeting ligands such as asialoorosomucoid, as described in Wu 8c Wu (1987) J. Biol. Chem. 262:.4429-4432, insulin as described in Hucked (1990) Biochem Pharmacol 40:253-263, galactose as described in Plank (1992) Bioconjugate Chem 3:533-539, lactose or transferrin.
- synthetic gene transfer molecules such as polymeric DNA-binding cations like polylysine, protamine, and albumin, linked to cell targeting ligands such as asialoorosomucoid, as described in Wu 8c Wu (1987) J. Biol. Chem
- Naked DNA may also be employed.
- Exemplary naked DNA introduction methods are described in WO 90/11092 and US 5,580,859. Uptake efficiency may be improved using biodegradable latex beads.
- DNA coated latex beads are efficiently transported into cells after endocytosis initiation by the beads. The method may be improved further by treatment of the beads to increase hydrophobicity and thereby facilitate disruption of the endosome and release of the DNA into the cytoplasm.
- Liposomes that can act as gene delivery vehicles are described in US 5,422,120, WO95/13796, WO94/23697, WO91/14445 and EP-524,968.
- the nucleic acid sequences encoding a polypeptide can be inserted into conventional vectors that contain conventional control sequences for high level expression, and then be incubated with synthetic gene transfer molecules such as polymeric DNA-binding cations like polylysine, protamine, and albumin, linked to cell targeting ligands such as asialoorosomucoid, insulin, galactose, lactose, or transferrin.
- Non-viral delivery systems include the use of liposomes to encapsulate DNA comprising the gene under the control of a variety of tissue-specific or ubiquitously-active promoters.
- Further non-viral delivery suitable for use includes mechanical delivery systems such as the approach described in Woffendin et al (1994) Proc. Natl. Acad. Sci. USA 91(24): 11581-11585.
- the coding sequence and the product of expression of such can be delivered through deposition of photopolymerized hydrogel materials.
- Exemplary liposome and polycationic gene delivery vehicles are those described in US 5,422,120 and 4,762,915; inWO 95/13796; WO94/23697; and WO91/14445; in EP-0524968; and in Stryer, Biochemistry, pages 236-240 (1975) W.H. Freeman, San Francisco; Szoka (1980) Biochem BiophysActa 600:1; Bayer (1979) Biochem Biophys Acta 550:464; Rivnay (1987) Meth Enzymol 149:119; Wang (1987) Proc Natl Acad Sci 84:7851; Plant (1989) Anal Biochem 176:420.
- a polynucleotide composition can comprises therapeutically effective amount of a gene therapy vehicle, as the term is defined above.
- an effective dose will be from about 0.01 mg/ kg to 50 mg/kg or 0.05 mg/kg to about 10 mg/kg of the DNA constructs in the individual to which it is administered.
- the polynucleotide compositions of the invention can be administered (1) directly to the subject; (2) delivered ex vivo, to cells derived from the subject; or (3) in vitro for expression of recombinant proteins.
- the subjects to be treated can be mammals or birds. Also, human subjects can be treated.
- Direct delivery of the compositions will generally be accomplished by injection, either subcutaneously, intraperitoneally, intravenously or intramuscularly or delivered to the interstitial space of a tissue.
- the compositions can also be administered into a lesion.
- Other modes of administration include oral and pulmonary administration, suppositories, and transdermal or transcutaneous applications (eg. see WO98/20734), needles, and gene guns or hyposprays.
- Dosage treatment may be a single dose schedule or a multiple dose schedule.
- telomeres Methods for the ex vivo delivery and reimplantation of transformed cells into a subject are known in the art and described in eg. WO93/14778.
- Examples of cells useful in ex vivo applications include, for example, stem cells, particularly hematopoetic, lymph cells, macrophages, dendritic cells, or tumor cells.
- delivery of nucleic acids for both ex vivo and in vitro applications can be accomplished by the following procedures, for example, dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, and direct microinjection of the DNA into nuclei, all well known in the art.
- polypeptides which include, without limitation: asioloorosomucoid (ASOR); transferrin; asialoglycoproteins; antibodies; antibody fragments; ferritin; interleukins; interferons, granulocyte, macrophage colony stimulating factor (GM-CSF), granulocyte colony stimulating factor (G-CSF), macrophage colony stimulating factor (M-CSF), stem cell factor and erythropoietin.
- Viral antigens such as envelope proteins, can also be used.
- proteins from other invasive organisms such as the 17 amino acid peptide from the circumsporozoite protein of plasmodium falciparum known as RII.
- Other groups that can be included are, for example: hormones, steroids, androgens, estrogens, thyroid hormone, or vitamins, folic acid.
- polyalkylene glycol can be included with the desired polynucleotides/polypeptides.
- the polyalkylene glycol is polyethlylene glycol.
- mono-, di-, or polysaccarides can be included.
- the polysaccharide is dextran or DEAE-dextran.
- chitosan and poly(lactide-co-glycolide) D.Lipids. and Liposomes
- the desired polynucleoti.de/polypeptide can also be encapsulated in lipids or packaged in liposomes prior to delivery to the subject or to cells derived therefrom.
- Lipid encapsulation is generally accomplished using liposomes which are able to stably bind or entrap and retain nucleic acid.
- the ratio of condensed polynucleotide to lipid preparation can vary but will generally be around 1:1 (mg DNA:micromoles lipid), or more of hpid.
- Liposomal preparations for use in the present invention include cationic (positively charged), anionic (negatively charged) and neutral preparations.
- Cationic liposomes have been shown to mediate intracellular delivery of plasmid DNA (Feigner (1987) Proc. Natl. Acad. Sci. USA 84:7413-7416); mRNA (Malone (1989) Proc. Natl. Acad. Sci. USA 86:6077-6081); and purified transcription factors (Debs (1990) J. Biol. Chem. 265:10189-10192), in functional form.
- Cationic liposomes are readily available.
- N[l-2,3-dioleyloxy)propyl]-N,N,N-triethylammonium (DOTMA) liposomes are available under the trademark Lipofectin, from GLBCO BRL, Grand Island, NY. (See, also, Feigner supra).
- Other commercially available liposomes include transfectace (DDAB/DOPE) and DOTAP/DOPE (Boerhinger).
- Other cationic liposomes can be prepared from readily available materials using techniques well known in the art. See, eg. Szoka (1978) Proc. Natl. Acad. Sci. USA 75:4194-4198; WO90/11092 for a description of the synthesis of DOTAP (l,2-bis(oleoyloxy)-3-(trimethylammonio)propane) liposomes.
- anionic and neutral liposomes are readily available, such as from Avanti Polar Lipids (Birmingham, AL), or can be easily prepared using readily available materials.
- Such materials include phosphatidyl choline, cholesterol, phosphatidyl ethanolamine, dioleoylphosphatidyl choline (DOPC), dioleoylphosphatidyl glycerol (DOPG), dioleoylphoshatidyl ethanolamine (DOPE), among others.
- DOPC dioleoylphosphatidyl choline
- DOPG dioleoylphosphatidyl glycerol
- DOPE dioleoylphoshatidyl ethanolamine
- the liposomes can comprise multilammelar vesicles (MLVs), small unilamellar vesicles (SUVs), or large unilamellar vesicles (LUVs).
- MLVs multilammelar vesicles
- SUVs small unilamellar vesicles
- LUVs large unilamellar vesicles
- the various liposome-nucleic acid complexes are prepared using methods known in the art. See eg. Straubinger (1983) Meth. Immunol. 101 :512-527; Szoka (1978) Proc. N ⁇ tl. Ac ⁇ d. Sci. USA 75:4194-4198; Papahadjopoulos (1975) Biochim. Biophys. Act ⁇ 394:483; Wilson (1979) Cell 17:77); Deamer & Bangham (1976) Biochim. Biophys.
- lipoproteins can be included with the polynucleotide/polypeptide to be delivered.
- lipoproteins to be utilized include: chylomicrons, HDL, IDL, LDL, and VLDL. Mutants, fragments, or fusions of these proteins can also be used. Also, modifications of naturally occurring lipoproteins can be used, such as acetylated LDL. These lipoproteins can target the delivery of polynucleotides to cells expressing lipoprotein receptors. Preferably, if lipoproteins are including with the polynucleotide to be delivered, no other targeting ligand is included in the composition.
- Naturally occurring lipoproteins comprise a lipid and a protein portion.
- the protein portion are known as apoproteins.
- apoproteins A, B, C, D, and E have been isolated and identified. At least two of these contain several proteins, designated by Roman numerals, Al, All, ATV; Cl, CII, CIII.
- a lipoprotein can comprise more than one apoprotein.
- naturally occurring chylomicrons comprises of A, B, C, and E, over time these lipoproteins lose A and acquire C and E apoproteins.
- VLDL comprises A, B, C, and E apoproteins
- LDL comprises apoprotein B; and HDL comprises apoproteins A, C, and E.
- Lipoproteins contain a variety of lipids including, triglycerides, cholesterol (free and esters), and phopholipids.
- the composition of the lipids varies in naturally occurring lipoproteins.
- chylomicrons comprise mainly triglycerides.
- a more detailed description of the lipid content of naturally occurring lipoproteins can be found, for example, in Meth. Enzymol. 128 (1986).
- the composition of the lipids are chosen to aid in conformation of the apoprotein for receptor binding activity.
- the composition of lipids can also be chosen to facilitate hydrophobic interaction and association with the polynucleotide binding molecule.
- Naturally occurring lipoproteins can be isolated from serum by ultracentrifugation, for instance. Such methods are described in Meth. Enzymol. (supra); Pitas (1980) J. Biochem. 255:5454-5460 and Mahey (1979) J Clin. Invest 64:743-750. Lipoproteins can also be produced by in vitro or recombinant methods by expression of the apoprotein genes in a desired host cell. See, for example, Atkinson (1986) Annu Rev Biophys Chem 15 :403 and Radding (1958) Biochim Biophys Acta 30: 443. Lipoproteins can also be purchased from commercial suppliers, such as Biomedical Techniologies, Inc., Stoughton, Massachusetts, USA. Further description of lipoproteins can be found in Zuckermann et al. PCT/US97/14465.
- Polycationic agents can be included, with or without lipoprotein, in a composition with the desired polynucleotide/polypeptide to be delivered.
- Polycationic agents typically, exhibit a net positive charge at physiological relevant pH and are capable of neutralizing the electrical charge of nucleic acids to facilitate delivery to a desired location. These agents have both in vitro, ex vivo, and in vivo applications. Polycatiomc agents can be used to deliver nucleic acids to a living subject either intramuscularly, subcutaneously, etc.
- polypeptides as polycationic agents: polylysine, polyarginine, polyorr ⁇ hine, and protamine.
- Other examples include histones, protamines, human serum albumin, DNA binding proteins, non-histone chromosomal proteins, coat proteins from DNA viruses, such as (XI 74, transcriptional factors also contain domains that bind DNA and therefore may be useful as nucleic aid condensing agents.
- transcriptional factors such as C/CEBP, c-jun, c-fos, AP-1, AP-2, AP-3, CPF, Prot-1, Sp-1, Oct-1, Oct-2, CREP, and TF1TD contain basic domains that bind DNA sequences.
- Organic polycationic agents include: spermine, spermidine, and purtrescine.
- polycationic agent The dimensions and of the physical properties of a polycationic agent can be extrapolated from the list above, to construct other polypeptide polycationic agents or to produce synthetic polycatiomc agents.
- Synthetic polycationic agents which are useful include, for example, DEAE-dextran, polybrene.
- LipofectinTM, and lipofectAMLNETM are monomers that form polycationic complexes when combined with polynucleotides/polypeptides.
- Neisserial antigens of the invention can be used in immunoassays to detect antibody levels (or, conversely, anti-Neisserial antibodies can be used to detect antigen levels). Immunoassays based on well defined, recombinant antigens can be developed to replace invasive diagnostics methods. Antibodies to Neisserial proteins within biological samples, including for example, blood or serum samples, can be detected. Design of the immunoassays is subject to a great deal of variation, and a variety of these are known in the art. Protocols for the immunoassay may be based, for example, upon competition, or direct reaction, or sandwich type assays. Protocols may also, for example, use solid supports, or may be by immunoprecipitation.
- assays involve the use of labeled antibody or polypeptide; the labels may be, for example, fluorescent, chemiluminescent, radioactive, or dye molecules.
- Assays which amplify the signals from the probe are also known; examples of which are assays which utilize biotin and avidin, and enzyme-labeled and mediated immunoassays, such as ELISA assays.
- Kits suitable for immunodiagnosis and containing the appropriate labeled reagents are constructed by packaging the appropriate materials, including the compositions of the invention, in suitable containers, along with the remaining reagents and materials (for example, suitable buffers, salt solutions, etc.) required for the conduct of the assay, as well as suitable set of assay instructions.
- Hybridization refers to the association of two nucleic acid sequences to one another by hydrogen bonding. Typically, one sequence will be fixed to a solid support and the other will be free in solution. Then, the two sequences will be placed in contact with one another under conditions that favor hydrogen bonding. Factors that affect this bonding include: the type and volume of solvent; reaction temperature; time of hybridization; agitation; agents to block the non-specific attachment of the liquid phase sequence to the solid support (Denhardt's reagent or BLOTTO); concentration of the sequences; use of compounds to increase the rate of association of sequences (dextran sulfate or polyethylene glycol); and the stringency of the washing conditions following hybridization. See Sambrook et al. [supra] Volume 2, chapter 9, pages 9.47 to 9.57.
- “Stringency” refers to conditions in a hybridization reaction that favor association of very similar sequences over sequences that differ.
- the combination of temperature and salt concentration should be chosen that is approximately 120 to 200°C below the calculated Tm of the hybrid under study.
- the temperature and salt conditions can often be determined empirically in preliminary experiments in which samples of genomic DNA immobilized on filters are hybridized to the sequence of interest and then washed under conditions of different stringencies. See Sambrook et al. at page 9.50.
- Variables to consider when performing, for example, a Southern blot are (1) the complexity of the DNA being blotted and (2) the homology between the probe and the sequences being detected.
- the total amount of the fragment(s) to be studied can vary a magnitude of 10, from 0.1 to l ⁇ g for a plasmid or phage digest to IO "9 to 10 "8 g for a single copy gene in a highly complex eukaryotic genome.
- substantially shorter blotting, hybridization, and exposure times a smaller amount of starting polynucleotides, and lower specific activity of probes can be used.
- a single-copy yeast gene can be detected with an exposure time of only 1 hour starting with 1 ⁇ g of yeast DNA, blotting for two hours, and hybridizing for 4-8 hours with a probe of IO 8 cpm/ ⁇ g.
- a conservative approach would start with 10 ⁇ g of DNA, blot overnight, .and hybridize overnight in the presence of 10% dextran sulfate using a probe of greater than 10 s cpm/ ⁇ g, resulting in an exposure time of -24 hours.
- Tm melting temperature
- Tm 81 + 16.6(log 10 Ci) + 0.4[%(G + C)]-0.6(%formamide) - 600/n-1.5(%mismatch).
- Ci is the salt concentration (monovalent ions) and n is the length of the hybrid in b.ase pairs (slightly modified from Meinkoth & Wahl (1984) Anal. Biochem. 138: 267-284).
- the temperature of the hybridization and washes and the salt concentration during the washes are the simplest to adjust. As the temperature of the hybridization increases (ie. stringency), it becomes less likely for hybridization to occur between str.ands that are nonhomologous, and as a result, background decreases. If the radiolabeled probe is not completely homologous with the immobilized fragment (as is frequently the case in gene family and interspecies hybridization experiments), the hybridization temperature must be reduced, and background will increase. The temperature of the washes affects the intensity of the hybridizing band and the degree of background in a similar manner. The stringency of the washes is also increased with decreasing salt concentrations.
- Methods such as PCR, branched DNA probe assays, or blotting techniques utilizing nucleic acid probes according to the invention can determine the presence of cDNA or mRNA.
- a probe is said to "hybridize” with a sequence of the invention if it can form a duplex or double stranded complex, which is stable enough to be detected.
- the nucleic acid probes will hybridize to the Neisserial nucleotide sequences of the invention (including both sense and antisense strands). Though many different nucleotide sequences will encode the amino acid sequence, the native Neisserial sequence is preferred because it is the actual sequence present in cells.
- mRNA represents a coding sequence and so a probe should be complementary to the coding sequence; single-stranded cDNA is complementary to mRNA, and so a cDNA probe should be complementary to the non-coding sequence.
- the probe sequence need not be identical to the Neisserial sequence (or its complement) — some variation in the sequence and length can lead to increased assay sensitivity if the nucleic acid probe can form a duplex with target nucleotides, which can be detected. Also, the nucleic acid probe can include additional nucleotides to stabilize the formed duplex. Additional Neisserial sequence may also be helpful as a label to detect the formed duplex. For example, a non-complementary nucleotide sequence may be attached to the 5' end of the probe, with the remainder of the probe sequence being complementary to a Neisserial sequence. Alternatively, non-complementary bases or longer sequences can be interspersed into the probe, provided that the probe sequence has sufficient complementarity with the a Neisserial sequence in order to hybridize therewith and thereby form a duplex which can be detected.
- the exact length and sequence of the probe will depend on the hybridization conditions, such as temperature, salt condition and the like.
- the nucleic acid probe typically contains at least 10-20 nucleotides, preferably 15-25, and more preferably at least 30 nucleotides, although it may be shorter than this. Short primers generally require cooler temperatures to form sufficiently stable hybrid complexes with the template.
- Probes may be produced by synthetic procedures, such as the triester method of Matteucci et al. [J. Am. Chem. Soc. (1981) 103:3185], or according to Urdea et al. [Proc. Natl. Acad. Sci. USA (1983) 80: 7461], or using commercially available automated oligonucleotide synthesizers.
- the chemical nature of the probe can be selected according to preference. For certain applications, DNA or RNA are appropriate. For other applications, modifications may be incorporated eg. backbone modifications, such as phosphorothioates or methylphosphonates, can be used to increase in vivo half-life, alter RNA affinity, increase nuclease resistance etc. [eg. see Agrawal & Iyer (1995) Cwrr Opin Biotechnol 6:12-19; Agrawal (1996) TIBTECH 14:376-387]; analogues such as peptide nucleic acids may also be used [eg. see Corey (1997) TIBTECH 15:224-229; Buchardt et al. (1993) TIBTECH 11:384-386].
- backbone modifications such as phosphorothioates or methylphosphonates
- PCR polymerase chain reaction
- the assay is described in: Mullis et al. [Meth. Enzymol. (1987) 155: 335-350]; US patents 4,683,195 and 4,683,202.
- Two "primer" nucleotides hybridize with the target nucleic acids and are used to prime the reaction.
- the primers can comprise sequence that does not hybridize to the sequence of the amplification target (or its complement) to aid with duplex stability or, for ex-ample, to incorporate a convenient restriction site. Typically, such sequence will flank the desired Neisserial sequence.
- thermostable polymerase creates copies of target nucleic acids from the primers using the original target nucleic acids as a template. After a threshold amount of target nucleic acids are generated by the polymerase, they can be detected by more traditional methods, such as Southern blots. When using the Southern blot method, the labelled probe will hybridize to the Neisserial sequence (or its complement).
- mRNA or cDNA can be detected by traditional blotting techniques described in Sambrook et al [supra].
- mRNA, or cDNA generated from mRNA using a polymerase enzyme can be purified and separated using gel electrophoresis. The nucleic acids on the gel are then blotted onto a solid support, such as nitrocellulose. The solid support is exposed to a labelled probe and then washed to remove any unhybridized probe. Next, the duplexes containing the labeled probe are detected. Typically, the probe is labelled with a radioactive moiety.
- Figures 1-20 show biochemical data obtained in the Examples, and also sequence analysis, for ORFs 37, 5, 2, 15, 22, 28, 32, 4, 61, 76, 89, 97, 106, 138, 23, 25, 27, 79, 85 and 132.
- Ml and M2 are molecular weight markers. Arrows indicate the position of the main recombinant product or, in Western blots, the position of the main N. meningitidis immunoreactive band.
- TP indicates N. meningitidis total protein extract
- OMV indicates N. meningitidis outer membrane vesicle preparation.
- nucleic acid sequences which have been identified in N. meningitidis, along with their putative translation products, and also those of N.gonorrhoeae. Not all of the nucleic acid sequences are complete ie. they encode less than the full-length wild-type protein.
- results of biochemical analysis (expression, purification, ELISA, FACS etc.)
- the ex>amples typically include details of sequence identity between species and strains. Proteins that are similar in sequence are generally similar in both structure and function, and the sequence identity often indicates a common evolutionary origin. Comparison with sequences of proteins of known function is widely used as a guide for the assignment of putative protein function to a new sequence and has proved particularly useful in whole-genome analyses.
- nucleotide sequences eg. position 495 in SEQ ID 11
- represent ambiguities which arose during alignment of independent sequencing reactions some of the nucleotide sequences in the examples are derived from combining the results of two or more experiments).
- Nucleotide sequences were scanned in all six reading frames to predict the presence of hydrophobic domains using an algorithm based on the statistical studies of Esposti et al. [Critical evaluation of the hydropathy of membrane proteins (1990) Ewr J Biochem 190:207-219]. These domains represent potential transmembrane regions or hydrophobic leader sequences.
- Open reading frames were predicted from fragmented nucleotide sequences using the program ORFFIND ⁇ R (NCBI).
- Underlined amino acid sequences indicate possible transmembrane domains or leader sequences in the ORFs, as predicted by the PSORT algorithm (http://www.psort.nibb.ac.jp). Functional domains were also predicted using the MOTLFS program (GCG Wisconsin & PROSIT ⁇ ).
- Various tests can be used to assess the in vivo immunogencity of the proteins identified in the examples.
- the proteins can be expressed recombinantly and used to screen patient sera by immunoblot. A positive reaction between the protein and patient serum indicates that the patient has previously mounted an immune response to the protein in question ie. the protein is -an immunogen. This method can also be used to identify immunodominant proteins.
- the recombinant protein can also be conveniently used to prepare antibodies eg. in a mouse. These can be used for direct confirmation that a protein is located on the cell-surface. Labelled antibody (eg. fluorescent labelling for FACS) can be incubated with intact bacteria and the presence of label on the bacterial surface confirms the location of the protein.
- Labelled antibody eg. fluorescent labelling for FACS
- N. meningitidis strain 2996 was grown to exponential phase in 100ml of GC medium, harvested by centrifugation, and resuspended in 5ml buffer (20% Sucrose, 50mM Tris-HCl, 50mM EDTA, pH8). After 10 minutes incubation on ice, the bacteria were lysed by adding 10ml lysis solution (50mM NaCI, 1% Na-Sarkosyl, 50 ⁇ g/ml Proteinase K), and the suspension was incubated at 37°C for 2 hours. Two phenol extractions (equilibrated to pH 8) and one ChCl 3 /isoamylalcohol (24:1) extraction were performed.
- DNA was precipitated by addition of 0.3M sodium acetate and 2 volumes ethanol, and was collected by centrifugation. The pellet was washed once with 70% ethanol and redissolved in 4ml buffer (lOmM Tris-HCl, ImM EDTA, pH 8). The DNA concentration was measured by reading the OD at 260 nm.
- Synthetic oligonucleotide primers were designed on the basis of the coding sequence of each ORF, using (a) the meningococcus B sequence when available, or (b) the gonococcus/meningococcus A sequence, adapted to the codon preference usage of meningococcus as necessary. Any predicted signal peptides were omitted, by deducing the 5 '-end amplification primer sequence immediately downstream from the predicted leader sequence.
- the 5' primers included two restriction enzyme recognition sites (BamHl-Ndel, BamHl-Nhel, or EcoRL-Nhel, depending on the gene's own restriction pattern); the 3' primers included a Xhol restriction site.
- This procedure was established in order to direct the cloning of each amplification product (corresponding to each ORF) into two different expression systems: pGEX-KG (using either BamHl-Xhol or EcoRl-Xhol), and pET21b+ (using either Ndel-Xhol or Nhel-Xho ⁇ ).
- 3'-end primer tail CCCGCTCGAG (Xhol)
- ORF 76 was cloned in the pTRC expression vector and expressed as an amino-terminus His-tag fusion. In this particular case, the predicted signal peptide was included in the final product. Nhel- BamHl restriction sites were incorporated using primers:
- the primers included nucleotides which hybridizeed to the sequence to be amplified.
- the number of hybridizing nucleotides depended on the melting temperature of the whole primer, and was determined for each primer using the formulae:
- T m 4 (G+C)+ 2 (A+T) (tail excluded)
- T m 64.9 + 0.41 (% GC) - 600/N (whole primer)
- the average melting temperature of the selected oligos were 65-70°C for the whole oligo and 50-55°C for the hybridising region alone.
- Table I shows the forward and reverse primers used for each amplification.
- the sequence of the primer does not exactly match the sequence in the ORF.
- the gonococcal sequences could thus be used as the basis for primer design, altered to take account of codon preference.
- codons were changed: ATA ⁇ ATT; TCG ⁇ TCT; CAG ⁇ CAA; AAG ⁇ AAA; GAG ⁇ GAA; CGA ⁇ CGC; CGG ⁇ CGC; GGG ⁇ GGC. Italicised nucleotides in Table I indicate such a change. It will be appreciated that, once the complete sequence has been identified, this approach is generally no longer necessary.
- Oligos were synthesized by a Perkin Elmer 394 DNA/RNA Synthesizer, eluted from the columns in 2ml NH 4 OH, and deprotected by 5 hours incubation at 56°C. The oligos were precipitated by addition of 0.3M Na- Acetate and 2 volumes ethanol. The samples were then centrifuged and the pellets resuspended in either lOO ⁇ l or 1ml of water. OD 260 was determined using a Perkin Elmer Lambda Bio spectophotometer and the concentration was determined and adjusted to 2-10pmol/ ⁇ l.
- the standard PCR protocol was as follows: 50-200ng of genomic DNA were used as a template in the presence of 20-40 ⁇ M of each oligo, 400-800 ⁇ M dNTPs solution, 1 x PCR buffer (including 1.5mM MgCl 2 ), 2.5 units TaqI DNA polymerase (using Perkin-Elmer AmpliTaQ, GIBCO Platinum, Pwo DNA polymerase, or Tahara Shuzo Taq polymerase).
- PCR was optimsed by the addition of lO ⁇ l DMSO or 50 ⁇ l 2M betaine.
- each sample underwent a double-step amplification: the first 5 cycles were performed using as the hybridization temperature the one of the oligos excluding the restriction enzymes tail, followed by 30 cycles performed according to the hybridization temperature of the whole length oligos. The cycles were followed by a final 10 minute extension step at 72°C.
- the elongation time varied according to the length of the ORF to be amplified.
- the amplifications were performed using either a 9600 or a 2400 Perkin Elmer GeneAmp PCR System. To check the results, 1/10 of the amplification volume was loaded onto a 1-1.5% agarose gel and the size of each amplified fragment compared with a DNA molecular weight marker.
- the amplified DNA was either loaded directly on a 1 % agarose gel or first precipitated with ethanol and resuspended in a suitable volume to be loaded on a 1% agarose gel.
- the DNA fragment corresponding to the right size band was then eluted and purified from gel, using the Qiagen Gel Extraction Kit, following the instructions of the manufacturer.
- the fmal volume of the DNA fragment was 30 ⁇ l or 50 ⁇ l of either water or lOmM Tris, pH 8.5.
- the purified DNA corresponding to the amplified fragment was split into 2 aliquots and double- digested with:
- Each purified DNA fragment was incubated (37°C for 3 hours to overnight) with 20 units of each restriction enzyme (New England Biolabs ) in a either 30 or 40 ⁇ l final volume in the presence of the appropriate buffer.
- the digestion product was then purified using the QIAquick PCR purification kit, following the manufacturer's instructions, and eluted in a final volume of 30 or 50 ⁇ l of either water or lOmM Tris-HCl, pH 8.5. The final DNA concentration was determined by 1% agarose gel electrophoresis in the presence of titrated molecular weight marker.
- lO ⁇ g plasmid was double-digested with 50 units of each restriction enzyme in 200 ⁇ l reaction volume in the presence of appropriate buffer by overnight incubation at 37°C. After loading the whole digestion on a 1% agarose gel, the band corresponding to the digested vector was purified from the gel using the Qiagen QIAquick Gel Extraction Kit and the DNA was eluted in 50 ⁇ l of lOmM Tris-HCl, pH 8.5. The DNA concentration was evaluated by measuring OD 260 of the sample, and adjusted to 50 ⁇ g/ ⁇ l. l ⁇ l of plasmid was used for each cloning procedure.
- the vector pGEX-His is a modified pGEX-2T vector carrying a region encoding six histidine residues upstream to the thrombin cleavage site and containing the multiple cloning site of the vector pTRC99 (Pharmacia) .
- a molar ratio of 3:1 fragment/vector was ligated using 0.5 ⁇ l of NEB T4 DNA ligase (400 units/ ⁇ l), in the presence of the buffer supplied by the manufacturer. The reaction was incubated at room temperature for 3 hours. In some experiments, ligation was performed using the Boheringer "Rapid Ligation Kit", following the manufacturer's instructions.
- E. coli DH5 competent cells were incubated with the ligase reaction solution for 40 minutes on ice, then at 37°C for 3 minutes, then, after adding 800 ⁇ l LB broth, again at 37°C for 20 minutes. The cells were then centrifuged at maximum speed in .an Eppendorf microfuge .and resuspended in approximately 200 ⁇ l of the supernatant. The suspension was then plated on LB ampicillin (lOOmg/ml ).
- the screening of the recombinant clones was performed by growing 5 randomly-chosen colonies overnight at 37°C in either 2ml (pGEX or pTC clones) or 5ml (pET clones) LB broth + lOO ⁇ g/ml ampicillin. The cells were then pelletted and the DNA extracted using the Qiagen QIAprep Spin Miniprep Kit, following the manufacturer's instructions, to a final volume of 30 ⁇ l.
- the double-digested PCR product was ligated into double-digested vector using EcoRl-Pstl cloning sites or, for ORFs 115 & 127, EcoRl-SaR or, for ORF 122, SaR-Pstl.
- the recombin-ant plasmids were introduced in the E.coli host W3110. Individual clones were grown overnight at 37°C in L-broth with 50 ⁇ l/ml ampicillin.
- Each ORF cloned into the expression vector w.as transformed into the strain suitable for expression of the recombinant protein product l ⁇ l of each construct was used to tr.ansform 30 ⁇ l of E.coli BL21 (pGEX vector), E.coli TOP 10 (pTRC vector) ox E.coli BL21-DE3 (pET vector), as described above.
- pGEX vector E.coli TOP 10
- pET vector ox E.coli BL21-DE3
- the protein expression was induced by addition of ImM LPTG, whereas in the case of pGEX system the final concentration of IPTG was 0.2mM. After 3 hours incubation at 30°C, the final concentration of the sample was checked by OD. In order to check expression, 1ml of each sample was removed, centrifuged in a microfuge, the pellet resuspended in PBS, and analysed by 12% SDS-PAGE with Coomassie Blue staining. The whole sample was centrifuged at 6000g and the pellet resuspended in PBS for further use.
- a single colony was grown overnight at 37°C on LB+Amp agar plate.
- the bacteria were inoculated into 20ml of LB+Amp liquid colture in a water bath shaker and grown overnight.
- Bacteria were diluted 1:30 into 600ml of fresh medium and allowed to grow at the optimal temperature (20-37°C) to OD 550 0.8-1.
- Protein expression was induced with 0.2mM LPTG followed by three hours incubation. The culture was centrifuged at 8000rpm at 4°C. The supernatant was discarded and the bacterial pellet was resuspended in 7.5ml cold PBS.
- the cells were disrupted by sonication on ice for 30 sec at 40W using a Branson sonifier B-15, frozen and thawed twice and centrifuged again.
- the supernatant was collected and mixed with 150 ⁇ l Glutatione-Sepharose 4B resin (Ph.armacia) (previously washed with PBS) and incubated at room temperature for 30 minutes.
- the sample was centrifuged at 700 for 5 minutes at 4°C.
- the resin was washed twice with 10ml cold PBS for 10 minutes, resuspended in 1ml cold PBS, and loaded on a disposable column.
- the resin was washed twice with 2ml cold PBS until the flow-through reached OD 280 of 0.02-0.06.
- the GST-fusion protein was eluted by addition of 700 ⁇ l cold Glutathione elution buffer (lOmM reduced glutathione, 50mM Tris-HCl) and fractions collected until the OD 280 was 0.1. 21 ⁇ l of each fraction were loaded on a 12% SDS gel using either Biorad SDS-PAGE Molecular weight standard broad range (Ml) (200, 116.25, 97.4, 66.2, 45, 31, 21.5, 14.4, 6.5 kDa) or Amersham Rainbow Marker (M2) (220, 66, 46, 30, 21.5, 14.3 kDa) as standards. As the MW of GST is 26kDa, this value must be added to the MW of each GST-fusion protein.
- Ml Biorad SDS-PAGE Molecular weight standard broad range
- M2 Amersham Rainbow Marker
- pellets of 3ml cultures were resuspended in buffer Ml [500 ⁇ l PBS pH 7.2].
- 25 ⁇ l lysozyme (lOmg/ml) was added and the bacteria were incubated for 15 min at 4°C.
- the pellets were sonicated for 30 sec at 40W using a Branson sonifier B-15, frozen and thawed twice and then separated again into pellet and supernatant by a centrifugation step.
- the supernatant was collected and the pellet was resuspended in buffer M2 [8M urea, 0.5M NaCI, 20mM imidazole and 0.1M NaH 2 PO 4 ] and incubated for 3 to 4 hours at 4°C. After centrifugation, the supernatant was collected and the pellet was resuspended in buffer M3 [6M guanidinium-HCl, 0.5M NaCI, 20mM imidazole and 0.1M NaH 2 PO 4 ] overnight at 4°C. The supernatants from all steps were analysed by SDS-PAGE.
- ORFs 113, 119 and 120 The proteins expressed from ORFs 113, 119 and 120 were found to be soluble in PBS, whereas ORFs 111, 122, 126 and 129 need urea and ORFs 125 and 127 need guanidium-HCl for their solubilization.
- a single colony was grown overnight at 37°C on a LB + Amp agar plate.
- the bacteria were inoculated into 20ml of LB+Amp liquid culture and incubated overnight in a water bath shaker. Bacteria were diluted 1:30 into 600ml fresh medium and allowed to grow at the optimal temperature (20-37°C) to OD 550 0.6-0.8. Protein expression was induced by addition of ImM LPTG and the culture further incubated for three hours.
- the culture was centrifuged at 8000rpm at 4°C, the supernatant was discarded and the bacterial pellet was resuspended in 7.5ml of either (i) cold buffer A (300mM NaCI, 50mM phosphate buffer, lOmM imidazole, pH 8) for soluble proteins or (ii) buffer B (urea 8M, lOmM Tris-HCl, lOOmM phosphate buffer, pH 8.8) for insoluble proteins.
- cold buffer A 300mM NaCI, 50mM phosphate buffer, lOmM imidazole, pH 8) for soluble proteins
- buffer B urea 8M, lOmM Tris-HCl, lOOmM phosphate buffer, pH 8.8 for insoluble proteins.
- the cells were disrupted by sonication on ice for 30 sec at 40W using a Branson sonifier B-15, frozen and thawed two times and centrifuged again.
- the supernatant was stored at -20°C, while the pellets were resuspended in 2ml buffer C (6M guanidine hydrochloride, lOOmM phosphate buffer, lOmM Tris-HCl, pH 7.5) and treated in a homogenizer for 10 cycles. The product was centrifuged at 13000rpm for 40 minutes.
- 2ml buffer C 6M guanidine hydrochloride, lOOmM phosphate buffer, lOmM Tris-HCl, pH 7.5
- the resin was washed with either (i) 2ml cold 20mM imidazole buffer (300mM NaCI, 50mM phosphate buffer, 20mM imidazole, pH 8) or (ii) buffer D (urea 8M, lOmM Tris-HCl, lOOmM phosphate buffer, pH 6.3) until the flow-through reached the O.D 280 of 0.02-0.06.
- the His-fusion protein was eluted by addition of 700 ⁇ l of either (i) cold elution buffer A (300mM NaCI, 50mM phosphate buffer, 250mM imidazole, pH 8) or (ii) elution buffer B (urea 8M, lOmM Tris-HCl, lOOmM phosphate buffer, pH 4.5) and fractions collected until the O.D 280 was 0.1. 21 ⁇ l of each fraction were loaded on a 12% SDS gel.
- cold elution buffer A 300mM NaCI, 50mM phosphate buffer, 250mM imidazole, pH 8)
- elution buffer B urea 8M, lOmM Tris-HCl, lOOmM phosphate buffer, pH 4.5
- dialysis buffer I 10% glycerol, 0.5M arginine, 50mM phosphate buffer, 5mM reduced glutathione, 0.5mM oxidised glutathione, 2M urea, pH 8.8) and dialysed against the same buffer at 4°C for 12- 14 hours.
- the protein was further dialysed against dialysis buffer II (10% glycerol, 0.5M arginine, 50mM phosphate buffer, 5mM reduced glutathione, 0.5mM oxidised glutathione, pH 8.8) for 12-14 hours at 4°C. Protein concentration was evaluated using the formula:
- 500ml of bacterial cultures were induced and the fusion proteins were obtained soluble in buffer Ml, M2 or M3 using the procedure described above.
- the crude extract of the bacteria was loaded onto a Ni-NTA superflow column (Quiagen) equilibrated with buffer Ml, M2 or M3 depending on the solubilization buffer of the fusion proteins. Unbound material was eluted by washing the column with the same buffer.
- the specific protein was eluted with the corresponding buffer containing 500mM imidazole and dialysed against the corresponding buffer without imidazole. After each run the columns were sanitized by washing with at least two column volumes of 0.5 M sodium hydroxide and reequilibrated before the next use.
- the acapsulated MenB M7 strain was plated on chocolate agar plates and incubated overnight at 37°C. Bacterial colonies were collected from the agar plates using a sterile dracon swab and inoculated into 7ml of Mueller-Hinton Broth (Difco) containing 0.25% Glucose. Bacterial growth was monitored every 30 minutes by following OD 620 . The bacteria were let to grow until the OD reached the value of 0.3-0.4. The culture was centrifuged for 10 minutes at lOOOOrpm.
- the acapsulated MenB M7 strain was plated on chocolate agar plates and incubated overnight at 37°C. Bacterial colonies were collected from the agar plates using a sterile dracon swab and inoculated into 4 tubes containing 8ml each Mueller-Hinton Broth (Difco) containing 0.25% glucose. Bacterial growth was monitored every 30 minutes by following OD 620 . The bacteria were let to grow until the OD reached the value of 0.35-0.5. The culture was centrifuged for 10 minutes at 4000rpm. The supernatant was discarded and the pellet was resuspended in blocking buffer (1% BSA, 0.4% NaN 3 ) and centrifuged for 5 minutes at 4000rpm.
- blocking buffer 1% BSA, 0.4% NaN 3
- Bacteria were grown overnight on 5 GC plates, harvested with a loop and resuspended in 10 ml 20mM Tris-HCl. Heat inactivation was performed at 56°C for 30 minutes and the bacteria disrupted by sonication for 10 minutes on ice (50% duty cycle, 50% output). Unbroken cells were removed by centrifugation at 5000g for 10 minutes and the total cell envelope fraction recovered by centrifugation at 50000g at 4°C for 75 minutes. To extract cytoplasmic membrane proteins from the crude outer membranes, the whole fraction was resuspended in 2% sarkosyl (Sigma) and incubated at room temperature for 20 minutes.
- 2% sarkosyl Sigma
- the suspension was centrifuged at lOOOOg for 10 minutes to remove aggregates, and the supernatant further ultracentrifuged at 50000g for 75 minutes to pellet the outer membranes.
- the outer membranes were resuspended in lOmM Tris-HCl, pH8 and the protein concentration measured by the Bio-Rad Protein assay, using BSA as a standard.
- Bacteria were grown overnight on a GC plate, harvested with a loop and resuspended in 1ml of 20mM Tris-HCl. Heat inactivation was performed at 56°C for 30 minutes.
- Purified proteins 500ng/lane
- outer membrane vesicles 5 ⁇ g
- total cell extracts 25 ⁇ g
- MenB strain 2996 were loaded on 15% SDS-PAGE and transferred to a nitrocellulose membrane.
- the transfer was performed for 2 hours at 150mA at 4°C, in transferring buffer (0.3 % Tris base, 1.44 % glycine, 20% methanol).
- the membrane was saturated by overnight incubation at 4°C in saturation buffer (10% skimmed milk, 0.1% Triton XlOO in PBS).
- the membrane was washed twice with washing buffer (3% skimmed milk, 0.1% Triton XlOO in PBS) and incubated for 2 hours at 37°C with mice sera diluted 1 :200 in washing buffer.
- the membrane was washed twice and incubated for 90 minutes with a 1 :2000 dilution of horseradish peroxidase labelled anti- mouse Ig.
- the membrane was washed twice with 0.1%) Triton XlOO in PBS and developed with the Opti-4CN Substrate Kit (Bio-Rad). The reaction was stopped by adding water.
- MC58 strain was grown overnight at 37°C on chocolate agar plates. 5-7 colonies were collected and used to inoculate 7ml Mueller-Hinton broth. The suspension was incubated at 37°C on a nutator and let to grow until OD 620 was 0.5-0.8. The culture was aliquoted into sterile 1.5ml Eppendorf tubes and centrifuged for 20 minutes at maximum speed in a microfuge. The pellet was washed once in Gey's buffer (Gibco) and resuspended in the same buffer to an OD 620 of 0.5, diluted 1 :20000 in Gey's buffer and stored at 25°C.
- Gey's buffer Gibco
- mice sera 50 ⁇ l of Gey's buffer/1% BSA was added to each well of a 96-well tissue culture plate.
- 25 ⁇ l of the previously described bacterial suspension were added to each well.
- 25 ⁇ l of either heat-inactivated (56°C waterbath for 30 minutes) or normal baby rabbit complement were added to each well.
- 22 ⁇ l of each sample/well were plated on Mueller-Hinton agar plates (time 0).
- the 96-well plate was incubated for 1 hour at 37°C with rotation and then 22 ⁇ l of each sample/well were plated on Mueller-Hinton agar plates (time 1). After overnight incubation the colonies corresponding to time 0 and time 1 hour were counted.
- Table II (page 493) gives a summary of the cloning, expression and prurification results.
- Example 1 The following partial DNA sequence was identified in N. meningitidis ⁇ SEQ ID 1>:
- ORF37 The originally-identified partial strain B sequence (ORF37) shows 68.0% identity over a 75aa overlap with ORF37a:
- ORF37 The originally-identified partial strain B sequence (ORF37) shows 64.9% identity over a 1 llaa overlap with ORF37ng: orf37.pep MKQTVXMLAAALIALGLNRPVWXDDVSDFRENLXAAAQGNAAAQYNLGAMYXQRTRVRRD 60
- I I II I : II II orf37ng LALAQQWLGKAC
- I I I I I I I I :: I I I I I I I I I I I I orf37ng QNGDQNSCDNDQRLKAGYX
- ORF37-1 (l lkDa) was cloned in pET and pGex vectors and expressed in E.coli, as described above. The products of protein expression and purification were analyzed by SDS-PAGE. Figure IA shows the results of affinity purification of the GST-fusion protein, and Figure IB shows the results of expression of the His-fusion in E.coli. Purified GST-fusion protein was used to immunise mice, whose sera were used for ELISA (positive result), FACS analysis ( Figure IC), .and a bactericidal assay ( Figure ID). These experiments confirm that ORF37-1 is a surface-exposed protein, and that it is a useful immunogen.
- Figure IE shows plots of hydrophilicity, antigenic index, and AMPHI regions for ORF37-1.
- SEQ LD 9 shows 99.2% identity over a ll 8aa overlap with a predicted ORF from N. gonorrhoeae: 20 30 40 50 60 70 yrbd GAAAVAFLAFRVAGGAAFGGSDKTYAVYADFGDIGGLKVNAPVKSAGVLVGRVGAIGLDP
- the complete yrbd H.influenzae sequence has a leader sequence and it is expected that the full- length homologous N. meningitidis protein will also have one. This suggests that it is either a membrane protein, a secreted protein, or a surface protein and that the protein, or one of its epitopes, could be a useful antigen for vaccines or diagnostics.
- ORF3 shows 93.0% identity over a 286aa overlap with an ORF (ORF3a) from strain A of N meningitidis:
- I I I I: I I I I I I I I I I I I I I I I I I I I I I I I I I II I I I I : I I
- ORF3a nucleotide sequence ⁇ SEQ LD 15> is:
- ORF3-1 shows 94.6% identity in 410 aa overlap with ORF3a:
- ORF3 shows 86.3% identity over a 286aa overlap with a predicted ORF (ORF3.ng) from N gonorrhoeae: orf3 ILIYLIRK ⁇ LGSPVFFFQERPGKDGKPFKMVKFR 34 : I I I I I I I I I I I I I :: I I I I I I I I I I I I I I I I orf3ng MSKAVKRLFDIIASASGLIVLSPVFLVLIYLIRK ⁇ KGSPVFFIRERPGKDGKPFKMVKFR 60 orf3 SMRDGLYSDGIPLPDGERLTPFGKKLRAASXDELPELW ⁇ ILKGEMSLVGPRPLLMQYLPL 94
- ORF3ng shows significant homology with a hypothetical protein from B. subtilis: gnl
- ell86113 (Z99121) similar to capsular polysaccharide biosynthesis [Bacillus subtilis] Length 202
- AAAGTCCTCG ATTTTTCCGA TTTGGAAGTG CGCGACGCGA TGATTACGCG 201 CAGCCGTATG AACGTTTTAA AAGAAAACGA CAGCATCGAG CGCATCACCG
- I I I I II I I I I I I I I I I I I I I :: I I I I I I I I I I I I I : I I I I I I I I I I I III : I I I orf5a EDEFDEDESADNIHAVSAERWRIHAATEIEDINAFFGTEYSSEEADTIGGXGHSGIGTPA
- the originally-identified partial strain B sequence shows 83.1% identity over a 135aa overlap with the partial gonococcal sequence (ORF5ng): orf5 NHMAIVIDEYGGTSGLVTFEDIIEQIVGEI 30
- ORF5 62 INTFFGTEYSIEEADTI 78
- I I tlyc_haein TIGGLIMQTFGYLPKRGEEIILKNLQFKVTSADSRRLIQLRVTVPDEHLAEMNNVDEKSE 240 250 260 270 280 290 Homology with a hypothetical secreted protein from E.coli:
- ORF5a shows homology to a hypothetical secreted protein from E.coli: sp
- ORF5-1 (30.7kDa) was cloned in the pGex vector and expressed in E.coli, as described above. The products of protein expression and purification were analyzed by SDS-PAGE. Figure 2A shows the results of affinity purification of the GST-fusion protein. Purified GST-fusion protein was used to immunise mice, whose sera were used for Western blot analysis ( Figure IB). These experiments confirm that ORF5-1 is a surface-exposed protein, and that it is a useful immunogen.
- ORF7 116 EKETGHEAXXDHVASVFVNRLKIGMRLQTXXSVIYGMGAAYKGKIRKADLRRDTPYNTYT 175
- the complete length YCEG protein has sequence: 1 MKKFLIAILL LILILAGVAS FSYYKMTEFV KTPVNVQADE LLTIERGTTS
- ORF7 shows 95.2% identity over a 187aa overlap with an ORF (ORF7a) from strain A of N meningitidis:
- a leader peptide is underlined.
- ORF7a and ORF7-1 show 98.8% identity in 331 aa overlap:
- ORF7 shows 94.7% identity over a 187aa overlap with a predicted ORF (ORF7.ng) from N. gonorrhoeae: orf7 MRGGRPDSVTVQIIEGSRFSHMRKVIDATPDIGHDTKGWSNEKLMAEVAPDAFSGNPEGQ 60
- An ORF7ng nucleotide sequence ⁇ SEQ LD 35> is predicted to encode a protein having amino acid sequence ⁇ SEQ ID 36>: 1 MRGGRPDSVT VQIIEGSRFS HMRKVIDATP DIGHDTKGWS NEKLMAEVAP
- ORF7ng-l and ORF7-1 show 98.0% identity in 298 aa overlap:
- IMM I II II I M I I I I I II II I I: I I I I I I I I I I I I I I I I I I I I I M I I II II I orf7ng-l LNEAWAGRQDGLPYKNPYEMLIMASLIEKETGHEADRDHVASVFVNRLKIGMRLQTDPSV
- ORF7ng-l shows significant homology with a hypothetical E.coli protein: sp
- H.influenzae YCEG protein possesses a possible leader sequence
- the proteins from N meningitidis and N.gonorrhoeae, and their epitopes could be useful antigens for vaccines or diagnostics, or for raising antibodies.
- ORF9 shows 89.8% identity over a 166aa overlap with an ORF (ORF9a) from strain A of N meningitidis:
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- Communicable Diseases (AREA)
- General Chemical & Material Sciences (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Oncology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Genetics & Genomics (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (13)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP98946675A EP1029052B1 (en) | 1997-11-06 | 1998-10-09 | Neisserial antigens |
| CA002308606A CA2308606A1 (en) | 1997-11-06 | 1998-10-09 | Neisserial antigens |
| HK00105869.7A HK1027126B (en) | 1997-11-06 | 1998-10-09 | Neisserial antigens |
| JP2000520572A JP4472866B2 (ja) | 1997-11-06 | 1998-10-09 | ナイセリア抗原 |
| HK01103903.9A HK1033337B (en) | 1997-11-06 | 1998-10-09 | Neisserial antigens |
| DE69841807T DE69841807D1 (de) | 1997-11-06 | 1998-10-09 | Neisseriale antigene |
| AU93637/98A AU9363798A (en) | 1997-11-06 | 1998-10-09 | Neisserial antigens |
| AT98946675T ATE476508T1 (de) | 1997-11-06 | 1998-10-09 | Neisseriale antigene |
| BRPI9813930-4A BR9813930A (pt) | 1997-11-06 | 1998-10-09 | antìgeno neisserial |
| US09/303,518 US6914131B1 (en) | 1998-10-09 | 1999-04-30 | Neisserial antigens |
| US10/864,684 US7655245B2 (en) | 1997-11-06 | 2004-06-08 | Neisserial antigens |
| US12/653,954 US8293251B2 (en) | 1997-11-06 | 2009-12-18 | Neisserial antigens |
| US13/593,464 US20130064846A1 (en) | 1997-11-06 | 2012-08-23 | Neisserial antigens |
Applications Claiming Priority (14)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| GB9723516.2 | 1997-11-06 | ||
| GBGB9723516.2A GB9723516D0 (enExample) | 1997-11-06 | 1997-11-06 | |
| GB9724190.5 | 1997-11-14 | ||
| GBGB9724190.5A GB9724190D0 (enExample) | 1997-11-14 | 1997-11-14 | |
| GBGB9724386.9A GB9724386D0 (enExample) | 1997-11-18 | 1997-11-18 | |
| GB9724386.9 | 1997-11-18 | ||
| GBGB9725158.1A GB9725158D0 (enExample) | 1997-11-27 | 1997-11-27 | |
| GB9725158.1 | 1997-11-27 | ||
| GBGB9726147.3A GB9726147D0 (en) | 1997-12-10 | 1997-12-10 | Antigens |
| GB9726147.3 | 1997-12-10 | ||
| GBGB9800759.4A GB9800759D0 (enExample) | 1998-01-14 | 1998-01-14 | |
| GB9800759.4 | 1998-01-14 | ||
| GB9819016.8 | 1998-09-01 | ||
| GBGB9819016.8A GB9819016D0 (enExample) | 1998-09-01 | 1998-09-01 |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US09/303,518 Continuation-In-Part US6914131B1 (en) | 1997-11-06 | 1999-04-30 | Neisserial antigens |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO1999024578A2 true WO1999024578A2 (en) | 1999-05-20 |
| WO1999024578A3 WO1999024578A3 (en) | 2000-03-02 |
Family
ID=27562941
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB1998/001665 Ceased WO1999024578A2 (en) | 1997-11-06 | 1998-10-09 | Neisserial antigens |
Country Status (10)
| Country | Link |
|---|---|
| EP (3) | EP1900818A3 (enExample) |
| JP (3) | JP4472866B2 (enExample) |
| CN (1) | CN1263854C (enExample) |
| AT (1) | ATE476508T1 (enExample) |
| AU (1) | AU9363798A (enExample) |
| BR (1) | BR9813930A (enExample) |
| CA (2) | CA2671261A1 (enExample) |
| CY (1) | CY1110880T1 (enExample) |
| DE (1) | DE69841807D1 (enExample) |
| WO (1) | WO1999024578A2 (enExample) |
Cited By (128)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000011182A1 (en) * | 1998-08-18 | 2000-03-02 | Smithkline Beecham Biologicals S.A. | Basb024 outer membrane protein of neisseria meningitidis |
| WO2000003003A3 (en) * | 1998-07-10 | 2000-04-13 | Univ Nottingham | Screening of neisserial vaccine candidates and vaccines against pathogenic neisseria |
| EP1071783A2 (en) * | 1998-04-24 | 2001-01-31 | SMITHKLINE BEECHAM BIOLOGICALS s.a. | Basb006 polynucleotide(s) and polypeptides from neisseria meningitis |
| WO2001009332A3 (en) * | 1999-07-30 | 2001-03-22 | Smithkline Beecham Biolog | Immunogenic polypeptides derived from moraxella catarrhalis and uses thereof |
| WO2000071725A3 (en) * | 1999-05-19 | 2001-06-28 | Chiron Spa | Combination neisserial compositions |
| WO2001052885A1 (en) | 2000-01-17 | 2001-07-26 | Chiron Spa | Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins |
| WO2000071574A3 (en) * | 1999-05-19 | 2002-01-24 | Chiron Spa | Antigenic neisserial peptides |
| WO2001085772A3 (en) * | 2000-05-08 | 2002-03-28 | Microscience Ltd | Virulence genes, proteins, and their use |
| WO2000066741A3 (en) * | 1999-04-30 | 2002-06-13 | Chiron Spa | Conserved neisserial antigens |
| WO2002016601A3 (en) * | 2000-08-24 | 2003-01-23 | Omnigene Bioproducts Inc | Microorganisms and assays for the identification of antibiotics |
| WO2003028656A2 (en) | 2001-10-03 | 2003-04-10 | Chiron Corporation | Adjuvant compositions |
| JP2003514868A (ja) * | 1999-11-29 | 2003-04-22 | カイロン エセ.ピー.アー. | 血清型BおよびC由来のNeisseriameningitidis抗原、ならびにさらなる抗原を含む組成物 |
| WO2002060936A3 (en) * | 2001-01-31 | 2003-07-31 | Univ Iowa Res Found | Vaccine and compositions for the prevention and treatment of neisserial infections |
| JP2003525049A (ja) * | 2000-02-28 | 2003-08-26 | カイロン エセ.ピー.アー. | ナイセリア属のタンパク質のハイブリッド発現 |
| WO2003070909A2 (en) | 2002-02-20 | 2003-08-28 | Chiron Corporation | Microparticles with adsorbed polypeptide-containing molecules |
| WO2002083723A3 (en) * | 2001-04-12 | 2003-10-23 | Glaxosmithkline Biolog Sa | Polypeptides from h. influenzae homologous to a surface-exposed protein of neisseria meningitidis |
| WO2003047619A3 (en) * | 2001-12-04 | 2003-10-23 | Chiron Srl | Adjuvanted antigenic meningococcal compositions |
| JP2005508156A (ja) * | 2001-09-06 | 2005-03-31 | カイロン ソチエタ ア レスポンサビリタ リミタータ | ナイセリアタンパク質のハイブリッドおよびタンデム発現 |
| US6936261B2 (en) | 2000-07-27 | 2005-08-30 | Children's Hospital & Research Center At Oakland | Vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis |
| JP2005526697A (ja) * | 2001-10-03 | 2005-09-08 | カイロン コーポレイション | アジュバント化されたMeningococcus組成物 |
| WO2005102384A2 (en) | 2004-04-22 | 2005-11-03 | Chiron Srl | Immunising against meningococcal serogroup y using proteins |
| EP1741784A1 (en) | 1999-11-29 | 2007-01-10 | Chiron SRL | 85kDa neisserial antigen |
| US7241867B2 (en) * | 2003-03-06 | 2007-07-10 | Children's Hospital, Inc. | Polypeptide encoded by a nucleotide sequence of a nontypeable strain of Haemophilus influenzae genome |
| US7261901B2 (en) | 2001-01-31 | 2007-08-28 | University Of Iowa Research Foundation | Vaccine and compositions for the prevention and treatment of neisserial infections |
| WO2007110602A1 (en) * | 2006-03-28 | 2007-10-04 | The University Of Nottingham | Immunogenic compositions |
| WO2008001224A2 (en) | 2006-06-29 | 2008-01-03 | Novartis Ag | Polypeptides from neisseria meningitidis |
| EP2025754A2 (en) | 2001-05-15 | 2009-02-18 | ID Biomedical Corporation | Moraxella (Branhamella) catarrhalis antigens |
| WO2009034473A2 (en) | 2007-09-12 | 2009-03-19 | Novartis Ag | Gas57 mutant antigens and gas57 antibodies |
| US7544777B2 (en) | 1997-12-10 | 2009-06-09 | Csl Limited, A.C.N. | Porphorymonas gingivalis polypeptides and nucleotides |
| EP2088197A2 (en) | 2000-10-02 | 2009-08-12 | ID Biomedical Corporation | Haemophilus influenzae antigens and corresponding DNA fragments |
| WO2009111337A1 (en) | 2008-03-03 | 2009-09-11 | Irm Llc | Compounds and compositions as tlr activity modulators |
| US7655245B2 (en) | 1997-11-06 | 2010-02-02 | Novartis Ag | Neisserial antigens |
| US7662588B2 (en) | 1998-10-22 | 2010-02-16 | The University Of Montana | Omp85 proteins of Neisseria gonorrhoeae and Neisseria meningitidis, compositions containing same and methods of use thereof |
| US7662399B2 (en) | 1999-01-22 | 2010-02-16 | Glaxosmithkline Biologicals S.A. | BASB054 polypeptides |
| US7666988B1 (en) | 1999-03-12 | 2010-02-23 | Glaxosmithkline Biologicals S.A. | BASB082 Polypeptides |
| EP2168597A1 (en) | 2001-07-26 | 2010-03-31 | Novartis Vaccines and Diagnostics S.r.l. | Vaccines comprising aluminium adjuvants and histidine |
| EP2179729A1 (en) | 2003-06-02 | 2010-04-28 | Novartis Vaccines and Diagnostics, Inc. | Immunogenic compositions based on microparticles comprising adsorbed toxoid and a polysaccharide-containing antigen |
| WO2010049806A1 (en) | 2008-10-27 | 2010-05-06 | Novartis Ag | Purification method |
| WO2010078556A1 (en) | 2009-01-05 | 2010-07-08 | Epitogenesis Inc. | Adjuvant compositions and methods of use |
| WO2010079464A1 (en) | 2009-01-12 | 2010-07-15 | Novartis Ag | Cna_b domain antigens in vaccines against gram positive bacteria |
| US7763589B2 (en) | 1996-09-17 | 2010-07-27 | Novartis Vaccines And Diagnostics, Inc. | Compositions and methods for treating intracellular diseases |
| US7785608B2 (en) | 2002-08-30 | 2010-08-31 | Wyeth Holdings Corporation | Immunogenic compositions for the prevention and treatment of meningococcal disease |
| EP2248822A2 (en) | 2001-07-27 | 2010-11-10 | Novartis Vaccines and Diagnostics S.r.l. | Meningococcus adhesins |
| WO2010136897A2 (en) | 2009-05-28 | 2010-12-02 | Novartis Ag | Expression of recombinant proteins |
| EP2258365A1 (en) | 2003-03-28 | 2010-12-08 | Novartis Vaccines and Diagnostics, Inc. | Use of organic compounds for immunopotentiation |
| EP2258389A1 (en) | 2002-08-30 | 2010-12-08 | Novartis Vaccines and Diagnostics S.r.l. | Improved bacterial outer membrane vesicles |
| EP2258717A2 (en) | 2002-11-22 | 2010-12-08 | Novartis Vaccines and Diagnostics S.r.l. | Variant form of meningococcal NadA |
| WO2010144734A1 (en) | 2009-06-10 | 2010-12-16 | Novartis Ag | Benzonaphthyridine-containing vaccines |
| EP2263688A1 (en) | 2001-06-20 | 2010-12-22 | Novartis AG | Neisseria meningitidis combination vaccines |
| EP2263687A1 (en) | 2002-12-27 | 2010-12-22 | Novartis Vaccines&Diagnostics, Inc. | Immunogenic compositions containing phospholipid |
| EP2267036A1 (en) | 2003-10-02 | 2010-12-29 | Novartis Vaccines and Diagnostics S.r.l. | Hypo- and Hyper-Acetylated Meningococcal Capsular Saccharides |
| EP2267005A1 (en) | 2003-04-09 | 2010-12-29 | Novartis Vaccines and Diagnostics S.r.l. | ADP-ribosylating toxin from Listeria monocytogenes |
| EP2270177A1 (en) | 2001-03-27 | 2011-01-05 | Novartis Vaccines and Diagnostics S.r.l. | Streptococcus pneumoniae proteins and nucleic acids |
| EP2270056A2 (en) | 2005-02-01 | 2011-01-05 | Novartis Vaccines and Diagnostics S.r.l. | Purification of streptococcal capsular polysaccharide |
| WO2011008400A2 (en) | 2009-06-16 | 2011-01-20 | Novartis Ag | High-throughput complement-mediated antibody-dependent and opsonic bactericidal assays |
| EP2277896A1 (en) | 2000-10-27 | 2011-01-26 | Novartis Vaccines and Diagnostics S.r.l. | Nucleic acids and proteins from streptococcus groups A & B |
| EP2277538A1 (en) | 2003-10-02 | 2011-01-26 | Novartis Vaccines and Diagnostics S.r.l. | Combined meningitis vaccines |
| EP2279746A2 (en) | 2002-11-15 | 2011-02-02 | Novartis Vaccines and Diagnostics S.r.l. | Surface proteins in neisseria meningitidis |
| EP2289546A2 (en) | 2003-01-30 | 2011-03-02 | Novartis Vaccines and Diagnostics S.r.l. | Injectable vaccines against multiple meningococcal serogroups |
| WO2011026111A1 (en) | 2009-08-31 | 2011-03-03 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Oral delivery of a vaccine to the large intestine to induce mucosal immunity |
| WO2011024072A2 (en) | 2009-08-27 | 2011-03-03 | Novartis Ag | Hybrid polypeptides including meningococcal fhbp sequences |
| WO2011027222A2 (en) | 2009-09-02 | 2011-03-10 | Novartis Ag | Immunogenic compositions including tlr activity modulators |
| EP2298796A2 (en) | 2001-03-27 | 2011-03-23 | Novartis Vaccines and Diagnostics S.r.l. | Staphylococcus aureus proteins and nucleic acids |
| EP2298795A1 (en) | 2005-02-18 | 2011-03-23 | Novartis Vaccines and Diagnostics, Inc. | Immunogens from uropathogenic escherichia coli |
| EP2305299A1 (en) | 2001-05-31 | 2011-04-06 | Novartis Vaccines and Diagnostics, Inc. | Chimeric alphavirus replicon particles |
| WO2011049677A1 (en) | 2009-09-02 | 2011-04-28 | Irm Llc | Compounds and compositions as tlr activity modulators |
| WO2011051917A1 (en) | 2009-10-30 | 2011-05-05 | Novartis Ag | Purification of staphylococcus aureus type 5 and type 8 capsular saccharides |
| WO2011051893A1 (en) | 2009-10-27 | 2011-05-05 | Novartis Ag | Modified meningococcal fhbp polypeptides |
| WO2011057148A1 (en) | 2009-11-05 | 2011-05-12 | Irm Llc | Compounds and compositions as tlr-7 activity modulators |
| EP2335723A1 (en) | 2001-12-12 | 2011-06-22 | Novartis Vaccines and Diagnostics S.r.l. | Immunisation against chlamydia trachomatis |
| WO2011084549A1 (en) | 2009-12-15 | 2011-07-14 | Novartis Ag | Homogeneous suspension of immunopotentiating compounds and uses thereof |
| EP2351579A1 (en) | 2002-10-11 | 2011-08-03 | Novartis Vaccines and Diagnostics S.r.l. | Polypeptide vaccines for broad protection against hypervirulent meningococcal lineages |
| EP2351772A1 (en) | 2005-02-18 | 2011-08-03 | Novartis Vaccines and Diagnostics, Inc. | Proteins and nucleic acids from meningitis/sepsis-associated Escherichia coli |
| EP2357184A1 (en) | 2006-03-23 | 2011-08-17 | Novartis AG | Imidazoquinoxaline compounds as immunomodulators |
| EP2357000A1 (en) | 2005-10-18 | 2011-08-17 | Novartis Vaccines and Diagnostics, Inc. | Mucosal and systemic immunizations with alphavirus replicon particles |
| EP2360175A2 (en) | 2005-11-22 | 2011-08-24 | Novartis Vaccines and Diagnostics, Inc. | Norovirus and Sapovirus virus-like particles (VLPs) |
| EP2368570A2 (en) | 2006-01-18 | 2011-09-28 | University Of Chicago | Compositions and methods related to staphylococcal bacterium proteins |
| WO2011119759A1 (en) | 2010-03-23 | 2011-09-29 | Irm Llc | Compounds (cystein based lipopeptides) and compositions as tlr2 agonists used for treating infections, inflammations, respiratory diseases etc. |
| WO2011127360A1 (en) | 2010-04-08 | 2011-10-13 | University Of Pittsburgh-Of The Commonwealth System Of Higher Education | B-cell antigen presenting cell assay |
| EP2385127A1 (en) | 2005-11-25 | 2011-11-09 | Novartis Vaccines and Diagnostics S.r.l. | Chimeric, hybrid and tandem polypeptides of meningococcal NMB1870 |
| WO2011138636A1 (en) | 2009-09-30 | 2011-11-10 | Novartis Ag | Conjugation of staphylococcus aureus type 5 and type 8 capsular polysaccharides |
| WO2011149564A1 (en) | 2010-05-28 | 2011-12-01 | Tetris Online, Inc. | Interactive hybrid asynchronous computer game infrastructure |
| EP2395013A2 (en) | 2000-01-25 | 2011-12-14 | The University of Queensland | Proteins comprising conserved regions of Neisseria meningitidis surface antigen NhhA |
| EP2261341A3 (en) * | 1998-05-01 | 2012-01-04 | Novartis Vaccines and Diagnostics, Inc. | Neisseria meningitidis antigens and compositions |
| US8101194B2 (en) | 2001-10-11 | 2012-01-24 | Wyeth Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
| US8129500B2 (en) | 1997-12-10 | 2012-03-06 | Csl Limited | Porphyromonas gingivalis polypeptides and nucleotides |
| WO2012035519A1 (en) | 2010-09-16 | 2012-03-22 | Novartis Ag | Immunogenic compositions |
| EP2433647A2 (en) | 2005-01-27 | 2012-03-28 | Children's Hospital & Research Center at Oakland | GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis |
| EP2462949A2 (en) | 2007-10-19 | 2012-06-13 | Novartis AG | Meningococcal vaccine formulations |
| EP2468299A2 (en) | 2003-04-30 | 2012-06-27 | Novartis Vaccines and Diagnostics, Inc. | Compositions for inducing immune responses |
| WO2012085668A2 (en) | 2010-12-24 | 2012-06-28 | Novartis Ag | Compounds |
| WO2012095684A1 (en) * | 2011-01-10 | 2012-07-19 | Inserm ( Institut National De La Sante Et De La Recherche Medicale) | Methods for the screening of substances useful for the prevention and treatment of neisseria infections |
| US8283114B2 (en) | 2003-03-06 | 2012-10-09 | Nationwide Children's Hospital, Inc. | Genes of an otitis media isolate of nontypeable Haemophilus influenzae |
| EP2537857A2 (en) | 2007-12-21 | 2012-12-26 | Novartis AG | Mutant forms of streptolysin O |
| EP2548895A1 (en) | 2007-01-11 | 2013-01-23 | Novartis AG | Modified saccharides |
| EP2583678A2 (en) | 2004-06-24 | 2013-04-24 | Novartis Vaccines and Diagnostics, Inc. | Small molecule immunopotentiators and assays for their detection |
| EP2586790A2 (en) | 2006-08-16 | 2013-05-01 | Novartis AG | Immunogens from uropathogenic Escherichia coli |
| WO2013068949A1 (en) | 2011-11-07 | 2013-05-16 | Novartis Ag | Carrier molecule comprising a spr0096 and a spr2021 antigen |
| EP2612679A1 (en) | 2004-07-29 | 2013-07-10 | Novartis Vaccines and Diagnostics, Inc. | Immunogenic compositions for gram positive bacteria such as streptococcus agalactiae |
| JP2013530993A (ja) * | 2010-07-02 | 2013-08-01 | アンジオケム インコーポレーテッド | 治療用コンジュゲートのための短く且つd−アミノ酸を含有するポリペプチドおよびその使用 |
| US8574597B2 (en) | 2006-12-22 | 2013-11-05 | Wyeth Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
| EP2659912A2 (en) | 2007-07-17 | 2013-11-06 | Novartis AG | Conjugate purification |
| US8637249B2 (en) | 2008-11-14 | 2014-01-28 | Gen-Probe Incorporated | Compositions, kits and methods for detection of Campylobacter nucleic acid |
| WO2014118305A1 (en) | 2013-02-01 | 2014-08-07 | Novartis Ag | Intradermal delivery of immunological compositions comprising toll-like receptor agonists |
| US8986710B2 (en) | 2012-03-09 | 2015-03-24 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| EP2886551A2 (en) | 2008-02-21 | 2015-06-24 | Novartis AG | Meningococcal fhbp polypeptides |
| EP3067048A1 (en) | 2007-12-07 | 2016-09-14 | Novartis Ag | Compositions for inducing immune responses |
| US9556240B2 (en) | 2010-08-23 | 2017-01-31 | Wyeth Llc | Stable formulations of Neisseria meningitidis rLP2086 antigens |
| WO2017144359A1 (en) | 2016-02-22 | 2017-08-31 | Boehringer Ingelheim Vetmedica Gmbh | Method for the immobilization of biomolecules |
| US9757443B2 (en) | 2010-09-10 | 2017-09-12 | Wyeth Llc | Non-lipidated variants of Neisseria meningitidis ORF2086 antigens |
| WO2017175082A1 (en) | 2016-04-05 | 2017-10-12 | Gsk Vaccines S.R.L. | Immunogenic compositions |
| US9802987B2 (en) | 2013-03-08 | 2017-10-31 | Pfizer Inc. | Immunogenic fusion polypeptides |
| US9822150B2 (en) | 2013-09-08 | 2017-11-21 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| US9855324B2 (en) | 2012-10-03 | 2018-01-02 | Glaxosmithkline Biologicals Sa | Immunogenic compositions |
| US10179167B2 (en) | 2010-09-10 | 2019-01-15 | Glaxosmithkline Biologicals S.A. | Developments in meningococcal outer membrane vesicles |
| US10183070B2 (en) | 2017-01-31 | 2019-01-22 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| WO2019018744A1 (en) | 2017-07-21 | 2019-01-24 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | IMMUNOGENIC COMPOSITIONS OF NEISSERIA MENINGITIDIS |
| US10196429B2 (en) | 2012-03-09 | 2019-02-05 | Pfizer Inc. | Neisseria meningitidis composition and methods thereof |
| EP3498302A1 (en) | 2005-02-01 | 2019-06-19 | Novartis Vaccines and Diagnostics S.r.l. | Conjugation of streptococcal capsular saccharides to carrier proteins |
| US10376573B2 (en) | 2012-06-14 | 2019-08-13 | Glaxosmithkline Biologicals Sa | Vaccines for serogroup X meningococcus |
| WO2019157509A1 (en) | 2018-02-12 | 2019-08-15 | Inimmune Corporation | Toll-like receptor ligands |
| US10561720B2 (en) | 2011-06-24 | 2020-02-18 | EpitoGenesis, Inc. | Pharmaceutical compositions, comprising a combination of select carriers, vitamins, tannins and flavonoids as antigen-specific immuno-modulators |
| WO2020086408A1 (en) | 2018-10-26 | 2020-04-30 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | A high-yield perfusion-based transient gene expression bioprocess |
| US10888611B2 (en) | 2015-02-19 | 2021-01-12 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| US10967045B2 (en) | 1998-11-02 | 2021-04-06 | Secretary of State for Health and Social Care | Multicomponent meningococcal vaccine |
| WO2022096596A1 (en) | 2020-11-04 | 2022-05-12 | Eligo Bioscience | Cutibacterium acnes recombinant phages, method of production and uses thereof |
| WO2025006737A1 (en) | 2023-06-30 | 2025-01-02 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Genetically detoxified mutant of neisseria and outer membrane vesicle (omv) vaccine |
| US12383611B2 (en) | 2019-09-27 | 2025-08-12 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
Families Citing this family (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ES2283012T3 (es) | 1996-01-04 | 2007-10-16 | Novartis Vaccines And Diagnostics, Inc. | Bacterioferritina de helicobacter pylori. |
Family Cites Families (138)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US2386796A (en) | 1942-08-05 | 1945-10-16 | Bond Crown & Cork Co | Extruding device |
| DE2855719A1 (de) | 1978-12-22 | 1980-07-10 | Siemens Ag | Zahnaerztliche handstueckanordnung |
| US4336336A (en) | 1979-01-12 | 1982-06-22 | President And Fellows Of Harvard College | Fused gene and method of making and using same |
| AU545912B2 (en) | 1980-03-10 | 1985-08-08 | Cetus Corporation | Cloned heterologous jive products in bacillies |
| ZA811368B (en) | 1980-03-24 | 1982-04-28 | Genentech Inc | Bacterial polypedtide expression employing tryptophan promoter-operator |
| NZ199722A (en) | 1981-02-25 | 1985-12-13 | Genentech Inc | Dna transfer vector for expression of exogenous polypeptide in yeast;transformed yeast strain |
| ES8306797A1 (es) | 1981-04-29 | 1983-06-01 | Biogen Nv | Un metodo para producir un polipeptido. |
| US4551433A (en) | 1981-05-18 | 1985-11-05 | Genentech, Inc. | Microbial hybrid promoters |
| US4405712A (en) | 1981-07-01 | 1983-09-20 | The United States Of America As Represented By The Department Of Health And Human Services | LTR-Vectors |
| US4603112A (en) | 1981-12-24 | 1986-07-29 | Health Research, Incorporated | Modified vaccinia virus |
| US4769330A (en) | 1981-12-24 | 1988-09-06 | Health Research, Incorporated | Modified vaccinia virus and methods for making and using the same |
| CA1341116C (en) | 1983-02-22 | 2000-10-17 | Rae Lyn Burke | Yeast expression systems with vectors having gapdh or pyk promoters and synthesis or foreign protein |
| US4876197A (en) | 1983-02-22 | 1989-10-24 | Chiron Corporation | Eukaryotic regulatable transcription |
| JPS59166086A (ja) | 1983-03-09 | 1984-09-19 | Teruhiko Beppu | 新規な発現型プラスミドとそれらを用いて仔牛プロキモシン遺伝子を大腸菌内で発現させる方法 |
| US4546083A (en) | 1983-04-22 | 1985-10-08 | Stolle Research & Development Corporation | Method and device for cell culture growth |
| US4588684A (en) | 1983-04-26 | 1986-05-13 | Chiron Corporation | a-Factor and its processing signals |
| JPS59205983A (ja) | 1983-04-28 | 1984-11-21 | ジエネツクス・コ−ポレイシヨン | 異種遺伝子を原核微生物で発現させる方法 |
| US4663280A (en) | 1983-05-19 | 1987-05-05 | Public Health Research Institute Of The City Of New York | Expression and secretion vectors and method of constructing vectors |
| EP0127839B1 (en) | 1983-05-27 | 1992-07-15 | THE TEXAS A&M UNIVERSITY SYSTEM | Method for producing a recombinant baculovirus expression vector |
| US4689406A (en) | 1983-08-10 | 1987-08-25 | Amgen | Enhancement of microbial expression of polypeptides |
| US4870008A (en) | 1983-08-12 | 1989-09-26 | Chiron Corporation | Secretory expression in eukaryotes |
| JPS6054685A (ja) | 1983-09-02 | 1985-03-29 | Suntory Ltd | 改良発現ベクタ−およびその利用 |
| EP0136907A3 (en) | 1983-10-03 | 1986-12-30 | Genentech, Inc. | A xenogeneic expression control system, a method of using it, expression vectors containing it, cells transformed thereby and heterologous proteins produced therefrom |
| ZA848495B (en) | 1984-01-31 | 1985-09-25 | Idaho Res Found | Production of polypeptides in insect cells |
| US4880734A (en) | 1984-05-11 | 1989-11-14 | Chiron Corporation | Eukaryotic regulatable transcription |
| EP0164556B1 (en) | 1984-05-11 | 1994-03-02 | Chiron Corporation | Enhanced yeast transcription employing hybrid promoter region constructs |
| US5288641A (en) | 1984-06-04 | 1994-02-22 | Arch Development Corporation | Herpes Simplex virus as a vector |
| CA1282721C (en) | 1984-06-04 | 1991-04-09 | Bernard Roizman | Herpes simplex virus as a vector |
| US4738921A (en) | 1984-09-27 | 1988-04-19 | Eli Lilly And Company | Derivative of the tryptophan operon for expression of fused gene products |
| US4745056A (en) | 1984-10-23 | 1988-05-17 | Biotechnica International, Inc. | Streptomyces secretion vector |
| US4837148A (en) | 1984-10-30 | 1989-06-06 | Phillips Petroleum Company | Autonomous replication sequences for yeast strains of the genus pichia |
| US4762915A (en) | 1985-01-18 | 1988-08-09 | Liposome Technology, Inc. | Protein-liposome conjugates |
| US4797368A (en) | 1985-03-15 | 1989-01-10 | The United States Of America As Represented By The Department Of Health And Human Services | Adeno-associated virus as eukaryotic expression vector |
| US4683202A (en) | 1985-03-28 | 1987-07-28 | Cetus Corporation | Process for amplifying nucleic acid sequences |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| EP0196056B1 (en) | 1985-03-28 | 1991-05-22 | Chiron Corporation | Improved expression using fused genes providing for protein product |
| US4865974A (en) | 1985-09-20 | 1989-09-12 | Cetus Corporation | Bacterial methionine N-terminal peptidase |
| US4777127A (en) | 1985-09-30 | 1988-10-11 | Labsystems Oy | Human retrovirus-related products and methods of diagnosing and treating conditions associated with said retrovirus |
| JPS6296086A (ja) | 1985-10-21 | 1987-05-02 | Agency Of Ind Science & Technol | 複合プラスミド |
| US5139941A (en) | 1985-10-31 | 1992-08-18 | University Of Florida Research Foundation, Inc. | AAV transduction vectors |
| US5091309A (en) | 1986-01-16 | 1992-02-25 | Washington University | Sindbis virus vectors |
| US4861719A (en) | 1986-04-25 | 1989-08-29 | Fred Hutchinson Cancer Research Center | DNA constructs for retrovirus packaging cell lines |
| EP0244042B1 (en) | 1986-05-02 | 1994-08-17 | Gist-Brocades N.V. | Secretory signal selection vectors for extracellular protein synthesis in bacilli |
| JP2612874B2 (ja) | 1986-10-02 | 1997-05-21 | マサチユセツツ・インスチチユート・オブ・テクノロジー | タンパク質の代謝的安定性を調節する方法 |
| JPS63123383A (ja) | 1986-11-11 | 1988-05-27 | Mitsubishi Kasei Corp | ハイブリツドプロモ−タ−、発現調節dna配列および発現ベクタ− |
| GB8702816D0 (en) | 1987-02-07 | 1987-03-11 | Al Sumidaie A M K | Obtaining retrovirus-containing fraction |
| US5219740A (en) | 1987-02-13 | 1993-06-15 | Fred Hutchinson Cancer Research Center | Retroviral gene transfer into diploid fibroblasts for gene therapy |
| DK175243B1 (da) | 1987-03-23 | 2004-07-19 | Zymogenetics Inc | Ekspressionsvektor, der er i stand til at styre ekspression af heterologe gener eller cDNA i gær, gærværtscelle samt fremgangsmåde til öget produktion af proteiner i gærværtsceller |
| US4980289A (en) | 1987-04-27 | 1990-12-25 | Wisconsin Alumni Research Foundation | Promoter deficient retroviral vector |
| WO1989001973A2 (en) | 1987-09-02 | 1989-03-09 | Applied Biotechnology, Inc. | Recombinant pox virus for immunization against tumor-associated antigens |
| DK463887D0 (da) | 1987-09-07 | 1987-09-07 | Novo Industri As | Gaerleader |
| EP0633318A1 (en) | 1987-09-11 | 1995-01-11 | Whitehead Institute For Biomedical Research | Transduced fibroblasts and uses therefor |
| US4929555A (en) | 1987-10-19 | 1990-05-29 | Phillips Petroleum Company | Pichia transformation |
| WO1989004669A1 (en) | 1987-11-18 | 1989-06-01 | Chiron Corporation | Nanbv diagnostics and vaccines |
| WO1989005349A1 (en) | 1987-12-09 | 1989-06-15 | The Australian National University | Method of combating viral infections |
| CA1340772C (en) | 1987-12-30 | 1999-09-28 | Patricia Tekamp-Olson | Expression and secretion of heterologous protiens in yeast employing truncated alpha-factor leader sequences |
| US4973551A (en) | 1988-01-15 | 1990-11-27 | Merck & Co., Inc. | Vector for the expression of fusion proteins and protein immunogens |
| CH684094A5 (de) | 1988-03-21 | 1994-07-15 | Viagene Inc | Rekombinante Retroviren. |
| US5662896A (en) | 1988-03-21 | 1997-09-02 | Chiron Viagene, Inc. | Compositions and methods for cancer immunotherapy |
| US5591624A (en) | 1988-03-21 | 1997-01-07 | Chiron Viagene, Inc. | Retroviral packaging cell lines |
| US5206152A (en) | 1988-04-08 | 1993-04-27 | Arch Development Corporation | Cloning and expression of early growth regulatory protein genes |
| US5422120A (en) | 1988-05-30 | 1995-06-06 | Depotech Corporation | Heterovesicular liposomes |
| AP129A (en) | 1988-06-03 | 1991-04-17 | Smithkline Biologicals S A | Expression of retrovirus gag protein eukaryotic cells |
| WO1990002806A1 (en) | 1988-09-01 | 1990-03-22 | Whitehead Institute For Biomedical Research | Recombinant retroviruses with amphotropic and ecotropic host ranges |
| US5217879A (en) | 1989-01-12 | 1993-06-08 | Washington University | Infectious Sindbis virus vectors |
| WO1990007936A1 (en) | 1989-01-23 | 1990-07-26 | Chiron Corporation | Recombinant therapies for infection and hyperproliferative disorders |
| EP0448650A4 (en) | 1989-02-01 | 1992-05-13 | The General Hospital Corporation | Herpes simplex virus type i expression vector |
| JP3140757B2 (ja) | 1989-02-06 | 2001-03-05 | デイナ・フアーバー・キヤンサー・インステイテユート | パッケージング欠陥hivプロウイルス、細胞系及びその使用 |
| WO1990011361A1 (en) | 1989-03-17 | 1990-10-04 | E.I. Du Pont De Nemours And Company | External regulation of gene expression |
| DE69034078T2 (de) | 1989-03-21 | 2004-04-01 | Vical, Inc., San Diego | Expression von exogenen Polynukleotidsequenzen in Wirbeltieren |
| US5703055A (en) | 1989-03-21 | 1997-12-30 | Wisconsin Alumni Research Foundation | Generation of antibodies through lipid mediated DNA delivery |
| HU212924B (en) | 1989-05-25 | 1996-12-30 | Chiron Corp | Adjuvant formulation comprising a submicron oil droplet emulsion |
| DE4091460T1 (enExample) | 1989-08-15 | 1992-06-25 | ||
| EP1645635A3 (en) | 1989-08-18 | 2010-07-07 | Oxford Biomedica (UK) Limited | Replication defective recombinant retroviruses expressing a palliative |
| US5585362A (en) | 1989-08-22 | 1996-12-17 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy |
| US5166057A (en) | 1989-08-28 | 1992-11-24 | The Mount Sinai School Of Medicine Of The City University Of New York | Recombinant negative strand rna virus expression-systems |
| GB8919607D0 (en) | 1989-08-30 | 1989-10-11 | Wellcome Found | Novel entities for cancer therapy |
| AU7007491A (en) | 1990-02-02 | 1991-08-08 | Schweiz. Serum- & Impfinstitut Bern | Cdna corresponding to the genome of negative-strand rna viruses, and process for the production of infectious negative-strand rna viruses |
| ZA911974B (en) | 1990-03-21 | 1994-08-22 | Res Dev Foundation | Heterovesicular liposomes |
| CA2039921A1 (en) | 1990-04-16 | 1991-10-17 | Xandra O. Breakefield | Transfer and expression of gene sequences into central nervous system cells using herpes simplex virus mutants with deletions in genes for viral replication |
| AU7906691A (en) | 1990-05-23 | 1991-12-10 | United States of America, as represented by the Secretary, U.S. Department of Commerce, The | Adeno-associated virus (aav)-based eucaryotic vectors |
| US5149655A (en) | 1990-06-21 | 1992-09-22 | Agracetus, Inc. | Apparatus for genetic transformation |
| EP0467714A1 (en) | 1990-07-19 | 1992-01-22 | Merck & Co. Inc. | The class II protein of the outer membrane of neisseria meningitidis |
| JPH06500923A (ja) | 1990-09-21 | 1994-01-27 | カイロン コーポレイション | パッケージング細胞 |
| WO1992007945A1 (en) | 1990-10-30 | 1992-05-14 | Dana Farber Cancer Institute | Cell type specific alteration of levels of gene products in neural cells |
| US5173414A (en) | 1990-10-30 | 1992-12-22 | Applied Immune Sciences, Inc. | Production of recombinant adeno-associated virus vectors |
| SE9003978D0 (sv) | 1990-12-13 | 1990-12-13 | Henrik Garoff | Dna expressionssystem baserade paa ett virus replikon |
| CA2098849C (en) | 1990-12-20 | 2007-07-10 | Ralph R. Weichselbaum | Control of gene expression by ionizing radiation |
| DK0648271T3 (da) | 1991-08-20 | 2003-07-21 | Us Gov Health & Human Serv | Adenovirusmedieret overførsel af gener til mave-/tarmkanal |
| FR2681786A1 (fr) | 1991-09-27 | 1993-04-02 | Centre Nat Rech Scient | Vecteurs recombinants d'origine virale, leur procede d'obtention et leur utilisation pour l'expression de polypeptides dans des cellules musculaires. |
| IL103059A0 (en) | 1991-09-30 | 1993-02-21 | Boehringer Ingelheim Int | Conjugates for introducing nucleic acid into higher eucaryotic cells |
| NZ244306A (en) | 1991-09-30 | 1995-07-26 | Boehringer Ingelheim Int | Composition for introducing nucleic acid complexes into eucaryotic cells, complex containing nucleic acid and endosomolytic agent, peptide with endosomolytic domain and nucleic acid binding domain and preparation |
| US5252479A (en) | 1991-11-08 | 1993-10-12 | Research Corporation Technologies, Inc. | Safe vector for gene therapy |
| WO1993010218A1 (en) | 1991-11-14 | 1993-05-27 | The United States Government As Represented By The Secretary Of The Department Of Health And Human Services | Vectors including foreign genes and negative selective markers |
| GB9125623D0 (en) | 1991-12-02 | 1992-01-29 | Dynal As | Cell modification |
| EP0625049A4 (en) | 1992-01-23 | 1995-07-12 | Vical Inc | EX VIVO GENTRANSFER. |
| FR2688514A1 (fr) | 1992-03-16 | 1993-09-17 | Centre Nat Rech Scient | Adenovirus recombinants defectifs exprimant des cytokines et medicaments antitumoraux les contenant. |
| EP0650370A4 (en) | 1992-06-08 | 1995-11-22 | Univ California | METHODS AND COMPOSITIONS TARGETED ON SPECIFIC TISSUES. |
| WO1993025698A1 (en) | 1992-06-10 | 1993-12-23 | The United States Government As Represented By The | Vector particles resistant to inactivation by human serum |
| GB2269175A (en) | 1992-07-31 | 1994-02-02 | Imperial College | Retroviral vectors |
| NZ256018A (en) | 1992-09-25 | 1997-07-27 | Rhone Poulenc Rorer Sa | Recombinant adenoviral vectors and their use in directing expression and transcription of selected nucleotide sequences in cells of the central nervous system |
| ATE307212T1 (de) | 1992-11-18 | 2005-11-15 | Arch Dev Corp | Adenovirus-gelenkter gen-transfer zum herz-und glatten vaskulären muskel |
| EP1024198A3 (en) | 1992-12-03 | 2002-05-29 | Genzyme Corporation | Pseudo-adenoviral vectors for the gene therapy of haemophiliae |
| US5478745A (en) | 1992-12-04 | 1995-12-26 | University Of Pittsburgh | Recombinant viral vector system |
| US5348358A (en) | 1993-02-22 | 1994-09-20 | Selick David A | Contact lens insertion tool |
| DE4311651A1 (de) | 1993-04-08 | 1994-10-13 | Boehringer Ingelheim Int | Virus für den Transport von Fremd-DNA in höhere eukaryotische Zellen |
| ES2188612T3 (es) | 1993-04-22 | 2003-07-01 | Skyepharma Inc | Liposomas multivesiculares de ciclodextrina para encapsular compuestos farmacologicos y metodos para su uso. |
| CA2162271A1 (en) | 1993-05-26 | 1994-12-08 | Robert Kotin | Fusion proteins containing adeno-associated virus rep protein and bacterial protein |
| FR2705686B1 (fr) | 1993-05-28 | 1995-08-18 | Transgene Sa | Nouveaux adénovirus défectifs et lignées de complémentation correspondantes. |
| JP3532566B2 (ja) | 1993-06-24 | 2004-05-31 | エル. グラハム,フランク | 遺伝子治療のためのアデノウイルスベクター |
| BR9405507A (pt) | 1993-07-13 | 1999-05-25 | Rhone Poulenc Rorer Sa | Adenovirus recombinante defeituoso linhagem celular e composição farmaceutica |
| EP0722493A1 (en) | 1993-07-27 | 1996-07-24 | THE WISTAR INSTITUTE OF ANATOMY & BIOLOGY | Modified dna virus vectors and uses therefor |
| US5631236A (en) | 1993-08-26 | 1997-05-20 | Baylor College Of Medicine | Gene therapy for solid tumors, using a DNA sequence encoding HSV-Tk or VZV-Tk |
| US5362865A (en) | 1993-09-02 | 1994-11-08 | Monsanto Company | Enhanced expression in plants using non-translated leader sequences |
| CA2158937C (en) | 1993-09-15 | 2006-01-03 | Thomas W. Dubensky, Jr. | Recombinant alphavirus vectors |
| FR2710536B1 (fr) | 1993-09-29 | 1995-12-22 | Transgene Sa | Usage anti-cancéreux d'un vecteur viral comportant un gène modulateur de la réponse immunitaire et/ou inflammatoire. |
| CA2171109A1 (en) | 1993-10-01 | 1995-04-13 | Zvi Ram | Gene therapy of the nervous system |
| DE69435223D1 (de) | 1993-10-25 | 2009-09-03 | Canji Inc | Rekombinanter Adenoviren-Vektor und Verfahren zur Verwendung |
| CN1099868C (zh) | 1993-11-16 | 2003-01-29 | 斯卡法玛公司 | 具有控制释放活性成分作用的囊 |
| US5693506A (en) | 1993-11-16 | 1997-12-02 | The Regents Of The University Of California | Process for protein production in plants |
| FR2712603B1 (fr) | 1993-11-18 | 1996-02-09 | Centre Nat Rech Scient | Virus recombinants, préparation et utilisation en thérapie génique. |
| JPH07241786A (ja) | 1994-03-08 | 1995-09-19 | Fanuc Ltd | 産業用ロボットの制御装置 |
| US6780406B1 (en) | 1994-03-21 | 2004-08-24 | The Regents Of The University Of Michigan | Inhibition of vascular smooth muscle cell proliferation administering a thymidine kinase gene |
| US7252989B1 (en) | 1994-04-04 | 2007-08-07 | Board Of Regents, The University Of Texas System | Adenovirus supervector system |
| WO1995029993A1 (en) | 1994-04-28 | 1995-11-09 | The University Of Michigan | Gene delivery vector using plasmid dna packaged into an adenovirus and a packaging cell line |
| EP0772689B1 (en) | 1994-05-09 | 2007-12-19 | Oxford Biomedica (UK) Limited | Retroviral vectors having a reduced recombination rate |
| EP0784690B1 (en) | 1994-06-10 | 2006-08-16 | Genvec, Inc. | Complementary adenoviral vector systems and cell lines |
| FR2723588B1 (fr) | 1994-08-12 | 1996-09-20 | Rhone Poulenc Rorer Sa | Adenovirus comprenant un gene codant pour la glutathion peroxydase |
| US6121037A (en) * | 1994-10-18 | 2000-09-19 | Stojiljkovic; Igor | Bacterial hemoglobin receptor genes |
| IL117483A (en) | 1995-03-17 | 2008-03-20 | Bernard Brodeur | MENINGITIDIS NEISSERIA shell protein is resistant to proteinase K. |
| US6265567B1 (en) * | 1995-04-07 | 2001-07-24 | University Of North Carolina At Chapel Hill | Isolated FrpB nucleic acid molecule |
| AU5741996A (en) | 1995-05-22 | 1996-12-11 | Chiron Corporation | Position-specific integration of vector constructs into eukaryotic genomes mediated by a chimeric integrase protein |
| DE19534579C2 (de) * | 1995-09-18 | 2000-06-08 | Max Planck Gesellschaft | Nucleinsäure-Moleküle codierend Proteine, die die Adhäsion von Neisseria-Zellen an humane Zellen vermitteln |
| US5753235A (en) | 1996-02-15 | 1998-05-19 | Heska Corporation | Recombinant canine herpesviruses |
| US5980898A (en) | 1996-11-14 | 1999-11-09 | The United States Of America As Represented By The U.S. Army Medical Research & Material Command | Adjuvant for transcutaneous immunization |
| GB9808866D0 (en) * | 1998-04-24 | 1998-06-24 | Smithkline Beecham Biolog | Novel compounds |
| DE69937419T2 (de) * | 1998-05-01 | 2008-07-24 | Novartis Vaccines and Diagnostics, Inc., Emeryville | Neisseria Meningitidis Antigene und Zusammenstellungen |
| WO2010065473A2 (en) | 2008-12-01 | 2010-06-10 | Applied Materials, Inc. | Gas distribution blocker apparatus |
-
1998
- 1998-10-09 DE DE69841807T patent/DE69841807D1/de not_active Expired - Lifetime
- 1998-10-09 BR BRPI9813930-4A patent/BR9813930A/pt not_active Application Discontinuation
- 1998-10-09 EP EP07075379A patent/EP1900818A3/en not_active Withdrawn
- 1998-10-09 CA CA002671261A patent/CA2671261A1/en not_active Abandoned
- 1998-10-09 EP EP98946675A patent/EP1029052B1/en not_active Expired - Lifetime
- 1998-10-09 CA CA002308606A patent/CA2308606A1/en not_active Abandoned
- 1998-10-09 WO PCT/IB1998/001665 patent/WO1999024578A2/en not_active Ceased
- 1998-10-09 JP JP2000520572A patent/JP4472866B2/ja not_active Expired - Fee Related
- 1998-10-09 EP EP10179785A patent/EP2278006A3/en not_active Withdrawn
- 1998-10-09 AU AU93637/98A patent/AU9363798A/en not_active Abandoned
- 1998-10-09 AT AT98946675T patent/ATE476508T1/de not_active IP Right Cessation
- 1998-10-09 CN CNB988128446A patent/CN1263854C/zh not_active Expired - Fee Related
-
2005
- 2005-10-03 JP JP2005290551A patent/JP2006089488A/ja not_active Withdrawn
-
2009
- 2009-10-26 JP JP2009245980A patent/JP2010046089A/ja not_active Withdrawn
-
2010
- 2010-11-04 CY CY20101100997T patent/CY1110880T1/el unknown
Cited By (255)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7763589B2 (en) | 1996-09-17 | 2010-07-27 | Novartis Vaccines And Diagnostics, Inc. | Compositions and methods for treating intracellular diseases |
| US7655245B2 (en) | 1997-11-06 | 2010-02-02 | Novartis Ag | Neisserial antigens |
| US8293251B2 (en) | 1997-11-06 | 2012-10-23 | Novartis Ag | Neisserial antigens |
| US7544777B2 (en) | 1997-12-10 | 2009-06-09 | Csl Limited, A.C.N. | Porphorymonas gingivalis polypeptides and nucleotides |
| US8129500B2 (en) | 1997-12-10 | 2012-03-06 | Csl Limited | Porphyromonas gingivalis polypeptides and nucleotides |
| EP2360260A1 (en) * | 1998-04-24 | 2011-08-24 | GlaxoSmithKline Biologicals SA | BASB006 polynucleotide(s) and polypeptides from Neisseria meningitis |
| EP1071783A2 (en) * | 1998-04-24 | 2001-01-31 | SMITHKLINE BEECHAM BIOLOGICALS s.a. | Basb006 polynucleotide(s) and polypeptides from neisseria meningitis |
| US7419824B2 (en) | 1998-04-24 | 2008-09-02 | Glaxosmithkline Biologicals, S.A,. | BASB006 polypeptides from Neisseria meningitidis and immunogenic compositions thereof |
| US6696062B1 (en) * | 1998-04-24 | 2004-02-24 | Smithkline Beecham Biologicals S.A. | BASB006 polypeptides from Neisseria meningitidis and immunogenic compositions thereof |
| EP2261339A3 (en) * | 1998-05-01 | 2012-01-11 | Novartis Vaccines and Diagnostics, Inc. | Neisseria meningitidis antigens and compositions |
| EP2261341A3 (en) * | 1998-05-01 | 2012-01-04 | Novartis Vaccines and Diagnostics, Inc. | Neisseria meningitidis antigens and compositions |
| US9139621B2 (en) | 1998-05-01 | 2015-09-22 | Glaxosmithkline Biologicals Sa | Neisseria meningitidis antigens and compositions |
| WO2000003003A3 (en) * | 1998-07-10 | 2000-04-13 | Univ Nottingham | Screening of neisserial vaccine candidates and vaccines against pathogenic neisseria |
| WO2000011182A1 (en) * | 1998-08-18 | 2000-03-02 | Smithkline Beecham Biologicals S.A. | Basb024 outer membrane protein of neisseria meningitidis |
| US7662588B2 (en) | 1998-10-22 | 2010-02-16 | The University Of Montana | Omp85 proteins of Neisseria gonorrhoeae and Neisseria meningitidis, compositions containing same and methods of use thereof |
| US7794733B2 (en) | 1998-10-22 | 2010-09-14 | The University Of Montana | Omp85 proteins of Neisseria gonorrhoeae and Neisseria meningitidis, compositions containing same and methods of use thereof |
| US10967045B2 (en) | 1998-11-02 | 2021-04-06 | Secretary of State for Health and Social Care | Multicomponent meningococcal vaccine |
| US7662399B2 (en) | 1999-01-22 | 2010-02-16 | Glaxosmithkline Biologicals S.A. | BASB054 polypeptides |
| US7666988B1 (en) | 1999-03-12 | 2010-02-23 | Glaxosmithkline Biologicals S.A. | BASB082 Polypeptides |
| EP2270169A3 (en) * | 1999-03-12 | 2011-06-15 | GlaxoSmithKline Biologicals SA | Neisseria meningitidis antigenic polypeptides, corresponding polynucleotides and protective antibodies |
| US8217159B2 (en) | 1999-03-12 | 2012-07-10 | Glaxosmithkline Biologicals S.A. | BASB082 polynucleotides |
| US8580279B2 (en) | 1999-03-12 | 2013-11-12 | Glaxosmithkline Biologicals S.A. | Compounds |
| US7604810B2 (en) | 1999-04-30 | 2009-10-20 | Novartis Vaccines And Diagnostics Srl | Conserved Neisserial antigens |
| EP2278007A1 (en) | 1999-04-30 | 2011-01-26 | Novartis Vaccines and Diagnostics S.r.l. | Conserved neisserial antigens |
| US7368261B1 (en) | 1999-04-30 | 2008-05-06 | Novartis Vaccines And Diagnostics Srl | Conserved Neisserial antigens |
| WO2000066741A3 (en) * | 1999-04-30 | 2002-06-13 | Chiron Spa | Conserved neisserial antigens |
| EP2290083A1 (en) | 1999-04-30 | 2011-03-02 | Novartis Vaccines and Diagnostics S.r.l. | Conserved neisserial antigens |
| US9169301B2 (en) | 1999-04-30 | 2015-10-27 | Glaxosmithkline Biologicals Sa | Conserved Neisserial antigens |
| AU2009200865B2 (en) * | 1999-05-19 | 2012-11-08 | Glaxosmithkline Biologicals S.A. | Combination Neisserial compositions |
| EP2251424A1 (en) | 1999-05-19 | 2010-11-17 | Novartis Vaccines and Diagnostics S.r.l. | Antigenic neisserial peptides |
| EP2258851A1 (en) | 1999-05-19 | 2010-12-08 | Novartis Vaccines and Diagnostics S.r.l. | Combination neisserial compositions |
| WO2000071725A3 (en) * | 1999-05-19 | 2001-06-28 | Chiron Spa | Combination neisserial compositions |
| US7862827B2 (en) | 1999-05-19 | 2011-01-04 | Novartis Vaccines And Diagnostics Srl | Combination neisserial compositions |
| EP1860191A3 (en) * | 1999-05-19 | 2008-02-13 | Novartis Vaccines and Diagnostics S.r.l. | Combination neisserial compositions |
| EP2270172A1 (en) | 1999-05-19 | 2011-01-05 | Novartis Vaccines and Diagnostics S.r.l. | Combination neisserial compositions |
| EP2270174A1 (en) | 1999-05-19 | 2011-01-05 | Novartis Vaccines and Diagnostics S.r.l. | Combination neisserial compositions |
| WO2000071574A3 (en) * | 1999-05-19 | 2002-01-24 | Chiron Spa | Antigenic neisserial peptides |
| EP2270173A1 (en) | 1999-05-19 | 2011-01-05 | Novartis Vaccines and Diagnostics S.r.l. | Combination neisserial compositions |
| EP1767641A1 (en) | 1999-05-19 | 2007-03-28 | Novartis Vaccines and Diagnostics S.r.l. | Antigenic neisserial peptides |
| WO2001009332A3 (en) * | 1999-07-30 | 2001-03-22 | Smithkline Beecham Biolog | Immunogenic polypeptides derived from moraxella catarrhalis and uses thereof |
| EP2289599A3 (en) * | 1999-11-29 | 2012-04-04 | Novartis AG | Compositions comprising neisseria meningitidis antigens from serogroups B and C |
| EP2289599A2 (en) | 1999-11-29 | 2011-03-02 | Novartis Vaccines and Diagnostics S.r.l. | Compositions comprising neisseria meningitidis antigens from serogroups B and C |
| US9636393B2 (en) | 1999-11-29 | 2017-05-02 | Glaxosmithkline Biologicals Sa | Compositions comprising Neisseria meningitidis antigens from serogroups B and C |
| JP2011093942A (ja) * | 1999-11-29 | 2011-05-12 | Novartis Vaccines & Diagnostics Srl | 血清型BおよびC由来のNeisseriameningitidis抗原、ならびにさらなる抗原を含む組成物 |
| JP2003514868A (ja) * | 1999-11-29 | 2003-04-22 | カイロン エセ.ピー.アー. | 血清型BおよびC由来のNeisseriameningitidis抗原、ならびにさらなる抗原を含む組成物 |
| EP1741784A1 (en) | 1999-11-29 | 2007-01-10 | Chiron SRL | 85kDa neisserial antigen |
| US7700119B2 (en) | 1999-11-29 | 2010-04-20 | Novartis Vaccines And Diagnostics Srl | 85kDa neisserial antigen |
| EP2275129A2 (en) | 2000-01-17 | 2011-01-19 | Novartis Vaccines and Diagnostics S.r.l. | Outer membrane vesicle (OMV) vaccine comprising N. meningitidis serogroup B outer membrane proteins |
| EP2281570A2 (en) | 2000-01-17 | 2011-02-09 | Novartis Vaccines and Diagnostics S.r.l. | Outer membrane vesicle (OMV) vaccine comprising n. meningitidis serogroup B outer membrane proteins |
| WO2001052885A1 (en) | 2000-01-17 | 2001-07-26 | Chiron Spa | Outer membrane vesicle (omv) vaccine comprising n. meningitidis serogroup b outer membrane proteins |
| EP2281570A3 (en) * | 2000-01-17 | 2012-05-09 | Novartis Vaccines and Diagnostics S.r.l. | Outer membrane vesicle (OMV) vaccine comprising n. meningitidis serogroup B outer membrane proteins |
| US8273360B2 (en) | 2000-01-17 | 2012-09-25 | Novartis Ag | Outer membrane vesicle (OMV) vaccine comprising N. meningitidis serogroup B outer membrane proteins |
| EP2395013A2 (en) | 2000-01-25 | 2011-12-14 | The University of Queensland | Proteins comprising conserved regions of Neisseria meningitidis surface antigen NhhA |
| US9267163B2 (en) | 2000-02-28 | 2016-02-23 | Glaxosmithkline Biologicals Sa | Hybrid expression of neisserial proteins |
| JP2003525049A (ja) * | 2000-02-28 | 2003-08-26 | カイロン エセ.ピー.アー. | ナイセリア属のタンパク質のハイブリッド発現 |
| EP2270031A2 (en) | 2000-02-28 | 2011-01-05 | Novartis Vaccines and Diagnostics S.r.l. | Heterologous expression of neisserial proteins |
| US7803387B2 (en) | 2000-02-28 | 2010-09-28 | Novartis Vaccines And Diagnostics Srl | Heterologous expression of Neisserial proteins |
| EP1790660A2 (en) | 2000-02-28 | 2007-05-30 | Novartis Vaccines and Diagnostics S.r.l. | Heterologous expression of neisserial proteins |
| US8703914B2 (en) | 2000-02-28 | 2014-04-22 | Novartis Ag | Heterologous expression of neisserial proteins |
| EP2270031A3 (en) * | 2000-02-28 | 2011-02-16 | Novartis Vaccines and Diagnostics S.r.l. | Heterologous expression of neisserial proteins |
| CN101906413A (zh) * | 2000-02-28 | 2010-12-08 | 启龙有限公司 | 奈瑟球菌蛋白质的异源表达 |
| JP4846160B2 (ja) * | 2000-02-28 | 2011-12-28 | ノバルティス ヴァクシンズ アンド ダイアグノスティクス エスアールエル | ナイセリア属のタンパク質のハイブリッド発現 |
| US8114960B2 (en) | 2000-02-28 | 2012-02-14 | Novartis Ag | Heterologous expression of Neisserial proteins |
| AU2001239488B2 (en) * | 2000-02-28 | 2006-01-19 | Glaxosmithkline Biologicals S.A. | Heterologous expression of neisserial proteins |
| EP1947187A1 (en) | 2000-02-28 | 2008-07-23 | Novartis Vaccines and Diagnostics S.r.l. | Hybrid expression of neisserial proteins |
| EP2270030A2 (en) | 2000-02-28 | 2011-01-05 | Novartis Vaccines and Diagnostics S.r.l. | Heterologous expression of Neisserial proteins |
| WO2001085772A3 (en) * | 2000-05-08 | 2002-03-28 | Microscience Ltd | Virulence genes, proteins, and their use |
| JP2003532404A (ja) * | 2000-05-08 | 2003-11-05 | マイクロサイエンス リミテッド | ビルレンス遺伝子、タンパク質およびそれらの使用 |
| US8980285B2 (en) | 2000-07-27 | 2015-03-17 | Children's Hospital & Research Center At Oakland | Vaccines for broad spectrum protection against Neisseria meningitidis |
| US6936261B2 (en) | 2000-07-27 | 2005-08-30 | Children's Hospital & Research Center At Oakland | Vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis |
| WO2002016601A3 (en) * | 2000-08-24 | 2003-01-23 | Omnigene Bioproducts Inc | Microorganisms and assays for the identification of antibiotics |
| EP2088197A2 (en) | 2000-10-02 | 2009-08-12 | ID Biomedical Corporation | Haemophilus influenzae antigens and corresponding DNA fragments |
| EP2284183A1 (en) | 2000-10-27 | 2011-02-16 | Novartis Vaccines and Diagnostics S.r.l. | Nucleic acids and proteins from streptococcus groups A and B |
| EP2284182A1 (en) | 2000-10-27 | 2011-02-16 | Novartis Vaccines and Diagnostics S.r.l. | Nucleic acids and proteins from streptococcus groups A and B |
| EP2277896A1 (en) | 2000-10-27 | 2011-01-26 | Novartis Vaccines and Diagnostics S.r.l. | Nucleic acids and proteins from streptococcus groups A & B |
| EP2277895A1 (en) | 2000-10-27 | 2011-01-26 | Novartis Vaccines and Diagnostics S.r.l. | Nucleic acids and proteins from streptococcus groups A & B |
| EP2896629A1 (en) | 2000-10-27 | 2015-07-22 | Novartis Vaccines and Diagnostics S.r.l. | Nucleic acids and proteins from streptococcus group A & B |
| EP2277894A1 (en) | 2000-10-27 | 2011-01-26 | Novartis Vaccines and Diagnostics S.r.l. | Nucleic acids and proteins from streptococcus groups A & B |
| EP2284181A1 (en) | 2000-10-27 | 2011-02-16 | Novartis Vaccines and Diagnostics S.r.l. | Nucleic acids and proteins from streptococcus groups A and B |
| US7250172B2 (en) | 2001-01-31 | 2007-07-31 | University Of Iowa Research Foundation | Vaccine and compositions for the prevention and treatment of neisserial infections |
| US7261901B2 (en) | 2001-01-31 | 2007-08-28 | University Of Iowa Research Foundation | Vaccine and compositions for the prevention and treatment of neisserial infections |
| WO2002060936A3 (en) * | 2001-01-31 | 2003-07-31 | Univ Iowa Res Found | Vaccine and compositions for the prevention and treatment of neisserial infections |
| EP2270177A1 (en) | 2001-03-27 | 2011-01-05 | Novartis Vaccines and Diagnostics S.r.l. | Streptococcus pneumoniae proteins and nucleic acids |
| EP2278008A2 (en) | 2001-03-27 | 2011-01-26 | Novartis Vaccines and Diagnostics S.r.l. | Streptococcus pneumoniae proteins and nucleic acids |
| EP2270175A1 (en) | 2001-03-27 | 2011-01-05 | Novartis Vaccines and Diagnostics S.r.l. | Streptococcus pneumoniae proteins and nucleic acids |
| EP2270176A1 (en) | 2001-03-27 | 2011-01-05 | Novartis Vaccines and Diagnostics S.r.l. | Streptococcus pneumoniae proteins and nucleic acids |
| EP2298796A2 (en) | 2001-03-27 | 2011-03-23 | Novartis Vaccines and Diagnostics S.r.l. | Staphylococcus aureus proteins and nucleic acids |
| EP2314697A1 (en) | 2001-03-27 | 2011-04-27 | Novartis Vaccines and Diagnostics S.r.l. | Streptococcus pneumoniae proteins and nucleic acids |
| EP2278009A1 (en) | 2001-03-27 | 2011-01-26 | Novartis Vaccines and Diagnostics S.r.l. | Streptococcus pneumoniae proteins and nucleic acids |
| EP2278010A1 (en) | 2001-03-27 | 2011-01-26 | Novartis Vaccines and Diagnostics S.r.l. | Streptococcus pneumoniae proteins and nucleic acids |
| WO2002083723A3 (en) * | 2001-04-12 | 2003-10-23 | Glaxosmithkline Biolog Sa | Polypeptides from h. influenzae homologous to a surface-exposed protein of neisseria meningitidis |
| EP2025754A2 (en) | 2001-05-15 | 2009-02-18 | ID Biomedical Corporation | Moraxella (Branhamella) catarrhalis antigens |
| EP2305299A1 (en) | 2001-05-31 | 2011-04-06 | Novartis Vaccines and Diagnostics, Inc. | Chimeric alphavirus replicon particles |
| EP2332573A1 (en) | 2001-05-31 | 2011-06-15 | Novartis Vaccines and Diagnostics, Inc. | Chimeric alphavirus replicon particles |
| EP2263688A1 (en) | 2001-06-20 | 2010-12-22 | Novartis AG | Neisseria meningitidis combination vaccines |
| EP2277536A2 (en) | 2001-06-20 | 2011-01-26 | Novartis AG | Purification of bacterial capsular polysaccharides |
| EP2277539A2 (en) | 2001-06-20 | 2011-01-26 | Novartis AG | Neisseria meningitidis conjugate combination vaccine |
| EP2277537A2 (en) | 2001-06-20 | 2011-01-26 | Novartis AG | Neisseria meningitidis conjugate combination vaccine |
| EP2255827A1 (en) | 2001-07-26 | 2010-12-01 | Novartis Vaccines and Diagnostics S.r.l. | Vaccines comprising aluminium adjuvants and histidine |
| EP2266605A1 (en) | 2001-07-26 | 2010-12-29 | Novartis Vaccines and Diagnostics S.r.l. | Vaccines comprising aluminium adjuvants and histidine |
| EP2168597A1 (en) | 2001-07-26 | 2010-03-31 | Novartis Vaccines and Diagnostics S.r.l. | Vaccines comprising aluminium adjuvants and histidine |
| EP2248822A2 (en) | 2001-07-27 | 2010-11-10 | Novartis Vaccines and Diagnostics S.r.l. | Meningococcus adhesins |
| US9011869B2 (en) | 2001-09-06 | 2015-04-21 | Glaxosmithkline Biologicals Sa | Hybrid and tandem expression of Neisserial proteins |
| JP2005508156A (ja) * | 2001-09-06 | 2005-03-31 | カイロン ソチエタ ア レスポンサビリタ リミタータ | ナイセリアタンパク質のハイブリッドおよびタンデム発現 |
| EP2327719A1 (en) | 2001-09-06 | 2011-06-01 | Novartis Vaccines and Diagnostics S.r.l. | Hybrid and tandem expression of neisserial proteins |
| EP2829549A2 (en) | 2001-09-06 | 2015-01-28 | Novartis Vaccines and Diagnostics S.r.l. | Hybrid and tandem expression of neisserial derived proteins |
| US8980277B2 (en) | 2001-09-06 | 2015-03-17 | Novartis Ag | Hybrid and tandem expression of neisserial proteins |
| EP2360176A2 (en) | 2001-09-06 | 2011-08-24 | Novartis Vaccines and Diagnostics S.r.l. | Hybrid and tandem expression of neisserial derived proteins |
| JP2010252807A (ja) * | 2001-09-06 | 2010-11-11 | Chiron Srl | ナイセリアタンパク質のハイブリッドおよびタンデム発現 |
| RU2475495C2 (ru) * | 2001-09-06 | 2013-02-20 | Новартис Вэксинс Энд Диагностикс С.Р.Л. | Гибридная и тандемная экспрессия белков нейссерий |
| JP2005350486A (ja) * | 2001-09-06 | 2005-12-22 | Chiron Srl | ナイセリアタンパク質のハイブリッドおよびタンデム発現 |
| JP2005526697A (ja) * | 2001-10-03 | 2005-09-08 | カイロン コーポレイション | アジュバント化されたMeningococcus組成物 |
| WO2003028656A2 (en) | 2001-10-03 | 2003-04-10 | Chiron Corporation | Adjuvant compositions |
| US10300122B2 (en) | 2001-10-11 | 2019-05-28 | Wyeth Holdings Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
| US8101194B2 (en) | 2001-10-11 | 2012-01-24 | Wyeth Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
| US9168293B2 (en) | 2001-10-11 | 2015-10-27 | Wyeth Holdings Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
| US11116829B2 (en) | 2001-10-11 | 2021-09-14 | Wyeth Holdings Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
| US9757444B2 (en) | 2001-10-11 | 2017-09-12 | Wyeth Holdings Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
| US9132182B2 (en) | 2001-10-11 | 2015-09-15 | Wyeth Holdings Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
| US9107873B2 (en) | 2001-10-11 | 2015-08-18 | Wyeth Holdings Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
| US8563007B1 (en) | 2001-10-11 | 2013-10-22 | Wyeth Holdings Corporation | Immunogenic compositions for the prevention and treatment of meningococcal disease |
| US9623101B2 (en) | 2001-10-11 | 2017-04-18 | Wyeth Holdings Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
| WO2003047619A3 (en) * | 2001-12-04 | 2003-10-23 | Chiron Srl | Adjuvanted antigenic meningococcal compositions |
| EP2335723A1 (en) | 2001-12-12 | 2011-06-22 | Novartis Vaccines and Diagnostics S.r.l. | Immunisation against chlamydia trachomatis |
| EP2335724A1 (en) | 2001-12-12 | 2011-06-22 | Novartis Vaccines and Diagnostics S.r.l. | Immunisation against chlamydia trachomatis |
| WO2003070909A2 (en) | 2002-02-20 | 2003-08-28 | Chiron Corporation | Microparticles with adsorbed polypeptide-containing molecules |
| EP2258390A1 (en) | 2002-08-30 | 2010-12-08 | Novartis Vaccines and Diagnostics S.r.l. | Improved bacterial outer membrane vesicles |
| US7785608B2 (en) | 2002-08-30 | 2010-08-31 | Wyeth Holdings Corporation | Immunogenic compositions for the prevention and treatment of meningococcal disease |
| EP2258389A1 (en) | 2002-08-30 | 2010-12-08 | Novartis Vaccines and Diagnostics S.r.l. | Improved bacterial outer membrane vesicles |
| EP2258388A1 (en) | 2002-08-30 | 2010-12-08 | Novartis Vaccines and Diagnostics S.r.l. | Improved bacterial outer membrane vesicles |
| US8663656B2 (en) | 2002-10-11 | 2014-03-04 | Novartis Ag | Polypeptide-vaccines for broad protection against hypervirulent meningococcal lineages |
| EP2353608A1 (en) | 2002-10-11 | 2011-08-10 | Novartis Vaccines and Diagnostics S.r.l. | Polypeptide-vaccines for broad protection against hypervirulent meningococcal lineages |
| EP2351579A1 (en) | 2002-10-11 | 2011-08-03 | Novartis Vaccines and Diagnostics S.r.l. | Polypeptide vaccines for broad protection against hypervirulent meningococcal lineages |
| EP2279746A2 (en) | 2002-11-15 | 2011-02-02 | Novartis Vaccines and Diagnostics S.r.l. | Surface proteins in neisseria meningitidis |
| EP2258717A2 (en) | 2002-11-22 | 2010-12-08 | Novartis Vaccines and Diagnostics S.r.l. | Variant form of meningococcal NadA |
| EP2261239A2 (en) | 2002-11-22 | 2010-12-15 | Novartis Vaccines and Diagnostics S.r.l. | Multiple variants of meningococcal protein NMB1870 |
| EP2258716A2 (en) | 2002-11-22 | 2010-12-08 | Novartis Vaccines and Diagnostics S.r.l. | Multiple variants of meningococcal protein NMB1870 |
| EP2263687A1 (en) | 2002-12-27 | 2010-12-22 | Novartis Vaccines&Diagnostics, Inc. | Immunogenic compositions containing phospholipid |
| EP2289546A2 (en) | 2003-01-30 | 2011-03-02 | Novartis Vaccines and Diagnostics S.r.l. | Injectable vaccines against multiple meningococcal serogroups |
| US7241867B2 (en) * | 2003-03-06 | 2007-07-10 | Children's Hospital, Inc. | Polypeptide encoded by a nucleotide sequence of a nontypeable strain of Haemophilus influenzae genome |
| US8283114B2 (en) | 2003-03-06 | 2012-10-09 | Nationwide Children's Hospital, Inc. | Genes of an otitis media isolate of nontypeable Haemophilus influenzae |
| EP2258365A1 (en) | 2003-03-28 | 2010-12-08 | Novartis Vaccines and Diagnostics, Inc. | Use of organic compounds for immunopotentiation |
| EP2267005A1 (en) | 2003-04-09 | 2010-12-29 | Novartis Vaccines and Diagnostics S.r.l. | ADP-ribosylating toxin from Listeria monocytogenes |
| EP2468299A2 (en) | 2003-04-30 | 2012-06-27 | Novartis Vaccines and Diagnostics, Inc. | Compositions for inducing immune responses |
| EP2179729A1 (en) | 2003-06-02 | 2010-04-28 | Novartis Vaccines and Diagnostics, Inc. | Immunogenic compositions based on microparticles comprising adsorbed toxoid and a polysaccharide-containing antigen |
| EP2267036A1 (en) | 2003-10-02 | 2010-12-29 | Novartis Vaccines and Diagnostics S.r.l. | Hypo- and Hyper-Acetylated Meningococcal Capsular Saccharides |
| EP2277538A1 (en) | 2003-10-02 | 2011-01-26 | Novartis Vaccines and Diagnostics S.r.l. | Combined meningitis vaccines |
| US10195264B2 (en) | 2004-04-22 | 2019-02-05 | Glaxosmithkline Biologicals S.A. | Immunising against meningococcal serogroup Y using proteins |
| WO2005102384A2 (en) | 2004-04-22 | 2005-11-03 | Chiron Srl | Immunising against meningococcal serogroup y using proteins |
| EP2583678A2 (en) | 2004-06-24 | 2013-04-24 | Novartis Vaccines and Diagnostics, Inc. | Small molecule immunopotentiators and assays for their detection |
| EP2612679A1 (en) | 2004-07-29 | 2013-07-10 | Novartis Vaccines and Diagnostics, Inc. | Immunogenic compositions for gram positive bacteria such as streptococcus agalactiae |
| US11801293B2 (en) | 2005-01-27 | 2023-10-31 | Children's Hospital & Research Center At Oakland | GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis |
| US10046043B2 (en) | 2005-01-27 | 2018-08-14 | Children's Hospital & Research Center At Oakland | GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis |
| US9034345B2 (en) | 2005-01-27 | 2015-05-19 | Children's Hospital & Research Center Oakland | GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis |
| EP2433647A2 (en) | 2005-01-27 | 2012-03-28 | Children's Hospital & Research Center at Oakland | GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis |
| US10478484B2 (en) | 2005-01-27 | 2019-11-19 | Children's Hospital & Research Center At Oakland | GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis |
| US8968748B2 (en) | 2005-01-27 | 2015-03-03 | Children's Hospital & Research Center Oakland | GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis |
| US10857221B2 (en) | 2005-01-27 | 2020-12-08 | Children's Hospital & Research Center At Oakland | GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis |
| US9452208B2 (en) | 2005-01-27 | 2016-09-27 | Children's Hospital & Research Center Oakland | GNA1870-based vesicle vaccines for broad spectrum protection against diseases caused by Neisseria meningitidis |
| EP3498302A1 (en) | 2005-02-01 | 2019-06-19 | Novartis Vaccines and Diagnostics S.r.l. | Conjugation of streptococcal capsular saccharides to carrier proteins |
| EP2270056A2 (en) | 2005-02-01 | 2011-01-05 | Novartis Vaccines and Diagnostics S.r.l. | Purification of streptococcal capsular polysaccharide |
| EP2351772A1 (en) | 2005-02-18 | 2011-08-03 | Novartis Vaccines and Diagnostics, Inc. | Proteins and nucleic acids from meningitis/sepsis-associated Escherichia coli |
| EP2298795A1 (en) | 2005-02-18 | 2011-03-23 | Novartis Vaccines and Diagnostics, Inc. | Immunogens from uropathogenic escherichia coli |
| EP2357000A1 (en) | 2005-10-18 | 2011-08-17 | Novartis Vaccines and Diagnostics, Inc. | Mucosal and systemic immunizations with alphavirus replicon particles |
| EP2360175A2 (en) | 2005-11-22 | 2011-08-24 | Novartis Vaccines and Diagnostics, Inc. | Norovirus and Sapovirus virus-like particles (VLPs) |
| EP3346009A1 (en) | 2005-11-25 | 2018-07-11 | GlaxoSmithKline Biologicals S.A. | Chimeric, hybrid and tandem polypeptides of meningococcal nmb1870 |
| EP2385126A1 (en) | 2005-11-25 | 2011-11-09 | Novartis Vaccines and Diagnostics S.r.l. | Chimeric, hybrid and tandem polypeptides of meningococcal NMB1870 |
| EP2385127A1 (en) | 2005-11-25 | 2011-11-09 | Novartis Vaccines and Diagnostics S.r.l. | Chimeric, hybrid and tandem polypeptides of meningococcal NMB1870 |
| EP2368570A2 (en) | 2006-01-18 | 2011-09-28 | University Of Chicago | Compositions and methods related to staphylococcal bacterium proteins |
| EP2368569A2 (en) | 2006-01-18 | 2011-09-28 | University Of Chicago | Compositions and methods related to staphylococcal bacterium proteins |
| EP2357184A1 (en) | 2006-03-23 | 2011-08-17 | Novartis AG | Imidazoquinoxaline compounds as immunomodulators |
| WO2007110602A1 (en) * | 2006-03-28 | 2007-10-04 | The University Of Nottingham | Immunogenic compositions |
| WO2008001224A2 (en) | 2006-06-29 | 2008-01-03 | Novartis Ag | Polypeptides from neisseria meningitidis |
| EP2586790A2 (en) | 2006-08-16 | 2013-05-01 | Novartis AG | Immunogens from uropathogenic Escherichia coli |
| US8574597B2 (en) | 2006-12-22 | 2013-11-05 | Wyeth Llc | Immunogenic compositions for the prevention and treatment of meningococcal disease |
| EP2548895A1 (en) | 2007-01-11 | 2013-01-23 | Novartis AG | Modified saccharides |
| EP2659912A2 (en) | 2007-07-17 | 2013-11-06 | Novartis AG | Conjugate purification |
| US9463250B2 (en) | 2007-07-17 | 2016-10-11 | Glaxosmithkline Biologicals Sa | Conjugate purification |
| WO2009034473A2 (en) | 2007-09-12 | 2009-03-19 | Novartis Ag | Gas57 mutant antigens and gas57 antibodies |
| EP2462949A2 (en) | 2007-10-19 | 2012-06-13 | Novartis AG | Meningococcal vaccine formulations |
| EP3067048A1 (en) | 2007-12-07 | 2016-09-14 | Novartis Ag | Compositions for inducing immune responses |
| EP2537857A2 (en) | 2007-12-21 | 2012-12-26 | Novartis AG | Mutant forms of streptolysin O |
| EP3263591A1 (en) | 2008-02-21 | 2018-01-03 | GlaxoSmithKline Biologicals S.A. | Meningococcal fhbp polypeptides |
| EP2886551A2 (en) | 2008-02-21 | 2015-06-24 | Novartis AG | Meningococcal fhbp polypeptides |
| WO2009111337A1 (en) | 2008-03-03 | 2009-09-11 | Irm Llc | Compounds and compositions as tlr activity modulators |
| WO2010049806A1 (en) | 2008-10-27 | 2010-05-06 | Novartis Ag | Purification method |
| US10829824B2 (en) | 2008-11-14 | 2020-11-10 | Gen-Probe Incorporated | Compositions, kits and methods for detection of campylobacter nucleic acid |
| US8637249B2 (en) | 2008-11-14 | 2014-01-28 | Gen-Probe Incorporated | Compositions, kits and methods for detection of Campylobacter nucleic acid |
| US9175353B2 (en) | 2008-11-14 | 2015-11-03 | Gen-Probe Incorporated | Compositions, kits and methods for detection of campylobacter nucleic acid |
| US9180184B2 (en) | 2009-01-05 | 2015-11-10 | EpitoGenesis, Inc. | Adjuvant compositions and methods of use |
| US8425922B2 (en) | 2009-01-05 | 2013-04-23 | EpitoGenesis, Inc. | Adjuvant compositions and methods of use |
| WO2010078556A1 (en) | 2009-01-05 | 2010-07-08 | Epitogenesis Inc. | Adjuvant compositions and methods of use |
| WO2010079464A1 (en) | 2009-01-12 | 2010-07-15 | Novartis Ag | Cna_b domain antigens in vaccines against gram positive bacteria |
| WO2010136897A2 (en) | 2009-05-28 | 2010-12-02 | Novartis Ag | Expression of recombinant proteins |
| WO2010144734A1 (en) | 2009-06-10 | 2010-12-16 | Novartis Ag | Benzonaphthyridine-containing vaccines |
| WO2011008400A2 (en) | 2009-06-16 | 2011-01-20 | Novartis Ag | High-throughput complement-mediated antibody-dependent and opsonic bactericidal assays |
| WO2011024072A2 (en) | 2009-08-27 | 2011-03-03 | Novartis Ag | Hybrid polypeptides including meningococcal fhbp sequences |
| EP3017828A1 (en) | 2009-08-27 | 2016-05-11 | GlaxoSmithKline Biologicals SA | Hybrid polypeptides including meningococcal fhbp sequences |
| WO2011026111A1 (en) | 2009-08-31 | 2011-03-03 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Oral delivery of a vaccine to the large intestine to induce mucosal immunity |
| WO2011049677A1 (en) | 2009-09-02 | 2011-04-28 | Irm Llc | Compounds and compositions as tlr activity modulators |
| WO2011027222A2 (en) | 2009-09-02 | 2011-03-10 | Novartis Ag | Immunogenic compositions including tlr activity modulators |
| WO2011138636A1 (en) | 2009-09-30 | 2011-11-10 | Novartis Ag | Conjugation of staphylococcus aureus type 5 and type 8 capsular polysaccharides |
| WO2011051893A1 (en) | 2009-10-27 | 2011-05-05 | Novartis Ag | Modified meningococcal fhbp polypeptides |
| EP3199177A1 (en) | 2009-10-30 | 2017-08-02 | GlaxoSmithKline Biologicals S.A. | Purification of staphylococcus aureus type 5 and type 8 capsular saccharides |
| WO2011051917A1 (en) | 2009-10-30 | 2011-05-05 | Novartis Ag | Purification of staphylococcus aureus type 5 and type 8 capsular saccharides |
| WO2011057148A1 (en) | 2009-11-05 | 2011-05-12 | Irm Llc | Compounds and compositions as tlr-7 activity modulators |
| WO2011084549A1 (en) | 2009-12-15 | 2011-07-14 | Novartis Ag | Homogeneous suspension of immunopotentiating compounds and uses thereof |
| US9408907B2 (en) | 2009-12-15 | 2016-08-09 | Glaxosmithkline Biologicals Sa | Homogenous suspension of immunopotentiating compounds and uses thereof |
| US10046048B2 (en) | 2009-12-15 | 2018-08-14 | Glaxosmithkline Biologicals S.A. | Homogenous suspension of immunopotentiating compounds and uses thereof |
| WO2011119759A1 (en) | 2010-03-23 | 2011-09-29 | Irm Llc | Compounds (cystein based lipopeptides) and compositions as tlr2 agonists used for treating infections, inflammations, respiratory diseases etc. |
| EP3730943A1 (en) | 2010-04-08 | 2020-10-28 | University of Pittsburgh - Of the Commonwealth System of Higher Education | B-cell antigen presenting cell assay |
| EP3242135A1 (en) | 2010-04-08 | 2017-11-08 | University of Pittsburgh - Of the Commonwealth System of Higher Education | B-cell antigen presenting cell assay |
| WO2011127360A1 (en) | 2010-04-08 | 2011-10-13 | University Of Pittsburgh-Of The Commonwealth System Of Higher Education | B-cell antigen presenting cell assay |
| WO2011149564A1 (en) | 2010-05-28 | 2011-12-01 | Tetris Online, Inc. | Interactive hybrid asynchronous computer game infrastructure |
| JP2013530993A (ja) * | 2010-07-02 | 2013-08-01 | アンジオケム インコーポレーテッド | 治療用コンジュゲートのための短く且つd−アミノ酸を含有するポリペプチドおよびその使用 |
| US9556240B2 (en) | 2010-08-23 | 2017-01-31 | Wyeth Llc | Stable formulations of Neisseria meningitidis rLP2086 antigens |
| US9757443B2 (en) | 2010-09-10 | 2017-09-12 | Wyeth Llc | Non-lipidated variants of Neisseria meningitidis ORF2086 antigens |
| US10512681B2 (en) | 2010-09-10 | 2019-12-24 | Wyeth Llc | Non-lipidated variants of Neisseria meningitidis ORF2086 antigens |
| US10179167B2 (en) | 2010-09-10 | 2019-01-15 | Glaxosmithkline Biologicals S.A. | Developments in meningococcal outer membrane vesicles |
| US11077180B2 (en) | 2010-09-10 | 2021-08-03 | Wyeth Llc | Non-lipidated variants of Neisseria meningitidis ORF2086 antigens |
| WO2012035519A1 (en) | 2010-09-16 | 2012-03-22 | Novartis Ag | Immunogenic compositions |
| WO2012085668A2 (en) | 2010-12-24 | 2012-06-28 | Novartis Ag | Compounds |
| WO2012095684A1 (en) * | 2011-01-10 | 2012-07-19 | Inserm ( Institut National De La Sante Et De La Recherche Medicale) | Methods for the screening of substances useful for the prevention and treatment of neisseria infections |
| US10561720B2 (en) | 2011-06-24 | 2020-02-18 | EpitoGenesis, Inc. | Pharmaceutical compositions, comprising a combination of select carriers, vitamins, tannins and flavonoids as antigen-specific immuno-modulators |
| WO2013068949A1 (en) | 2011-11-07 | 2013-05-16 | Novartis Ag | Carrier molecule comprising a spr0096 and a spr2021 antigen |
| US10550159B2 (en) | 2012-03-09 | 2020-02-04 | Pfizer Inc. | Neisseria meningitidis composition and methods thereof |
| US9724402B2 (en) | 2012-03-09 | 2017-08-08 | Pfizer Inc. | Neisseria meningitidis composition and methods thereof |
| US11472850B2 (en) | 2012-03-09 | 2022-10-18 | Pfizer Inc. | Neisseria meningitidis composition and methods thereof |
| US8986710B2 (en) | 2012-03-09 | 2015-03-24 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| US9561269B2 (en) | 2012-03-09 | 2017-02-07 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| US10196429B2 (en) | 2012-03-09 | 2019-02-05 | Pfizer Inc. | Neisseria meningitidis composition and methods thereof |
| US10829521B2 (en) | 2012-03-09 | 2020-11-10 | Pfizer Inc. | Neisseria meningitidis composition and methods thereof |
| US10376573B2 (en) | 2012-06-14 | 2019-08-13 | Glaxosmithkline Biologicals Sa | Vaccines for serogroup X meningococcus |
| US9855324B2 (en) | 2012-10-03 | 2018-01-02 | Glaxosmithkline Biologicals Sa | Immunogenic compositions |
| US9827190B2 (en) | 2013-02-01 | 2017-11-28 | Glaxosmithkline Biologicals Sa | Intradermal delivery of immunological compositions comprising toll-like receptor 7 agonists |
| WO2014118305A1 (en) | 2013-02-01 | 2014-08-07 | Novartis Ag | Intradermal delivery of immunological compositions comprising toll-like receptor agonists |
| US9802987B2 (en) | 2013-03-08 | 2017-10-31 | Pfizer Inc. | Immunogenic fusion polypeptides |
| US9822150B2 (en) | 2013-09-08 | 2017-11-21 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| US10899802B2 (en) | 2013-09-08 | 2021-01-26 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| US11680087B2 (en) | 2013-09-08 | 2023-06-20 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| US10888611B2 (en) | 2015-02-19 | 2021-01-12 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| WO2017144359A1 (en) | 2016-02-22 | 2017-08-31 | Boehringer Ingelheim Vetmedica Gmbh | Method for the immobilization of biomolecules |
| WO2017175082A1 (en) | 2016-04-05 | 2017-10-12 | Gsk Vaccines S.R.L. | Immunogenic compositions |
| US10183070B2 (en) | 2017-01-31 | 2019-01-22 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| US10543267B2 (en) | 2017-01-31 | 2020-01-28 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| US11730800B2 (en) | 2017-01-31 | 2023-08-22 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| US10813989B2 (en) | 2017-01-31 | 2020-10-27 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| WO2019018744A1 (en) | 2017-07-21 | 2019-01-24 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | IMMUNOGENIC COMPOSITIONS OF NEISSERIA MENINGITIDIS |
| WO2019157509A1 (en) | 2018-02-12 | 2019-08-15 | Inimmune Corporation | Toll-like receptor ligands |
| EP4410802A2 (en) | 2018-02-12 | 2024-08-07 | Inimmune Corporation | Toll-like receptor ligands |
| WO2020086408A1 (en) | 2018-10-26 | 2020-04-30 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | A high-yield perfusion-based transient gene expression bioprocess |
| US12383611B2 (en) | 2019-09-27 | 2025-08-12 | Pfizer Inc. | Neisseria meningitidis compositions and methods thereof |
| WO2022096596A1 (en) | 2020-11-04 | 2022-05-12 | Eligo Bioscience | Cutibacterium acnes recombinant phages, method of production and uses thereof |
| WO2022096590A1 (en) | 2020-11-04 | 2022-05-12 | Eligo Bioscience | Phage-derived particles for in situ delivery of dna payload into c. acnes population |
| WO2025006737A1 (en) | 2023-06-30 | 2025-01-02 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Genetically detoxified mutant of neisseria and outer membrane vesicle (omv) vaccine |
Also Published As
| Publication number | Publication date |
|---|---|
| CN1286727A (zh) | 2001-03-07 |
| CN1263854C (zh) | 2006-07-12 |
| EP1029052A2 (en) | 2000-08-23 |
| WO1999024578A3 (en) | 2000-03-02 |
| EP1900818A2 (en) | 2008-03-19 |
| EP1029052B1 (en) | 2010-08-04 |
| BR9813930A (pt) | 2006-12-19 |
| CA2308606A1 (en) | 1999-05-20 |
| DE69841807D1 (de) | 2010-09-16 |
| JP2010046089A (ja) | 2010-03-04 |
| HK1027126A1 (en) | 2001-01-05 |
| HK1033337A1 (en) | 2001-08-24 |
| ATE476508T1 (de) | 2010-08-15 |
| JP2003522514A (ja) | 2003-07-29 |
| EP2278006A3 (en) | 2011-03-02 |
| CA2671261A1 (en) | 1999-05-20 |
| CY1110880T1 (el) | 2015-06-10 |
| EP2278006A2 (en) | 2011-01-26 |
| JP4472866B2 (ja) | 2010-06-02 |
| EP1900818A3 (en) | 2008-06-11 |
| AU9363798A (en) | 1999-05-31 |
| JP2006089488A (ja) | 2006-04-06 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US8293251B2 (en) | Neisserial antigens | |
| JP4472866B2 (ja) | ナイセリア抗原 | |
| US7714121B2 (en) | Meningococcal antigens | |
| CA2330838C (en) | Neisseria meningitidis antigens and compositions | |
| AU780308B2 (en) | Neisseria genomic sequences and methods of their use | |
| US7504111B2 (en) | Gonococcal proteins and nucleic acids | |
| US7612192B2 (en) | Neisseria genomic sequences and methods of their use | |
| CN1824675B (zh) | 奈瑟球菌抗原 | |
| MXPA00004363A (en) | Neisserial antigens | |
| AU2003235364B2 (en) | Neisseria meningitidis antigens and compositions | |
| HK1033337B (en) | Neisserial antigens | |
| AU2005200246A1 (en) | Neisseria genomic sequences and methods of their use |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 98812844.6 Country of ref document: CN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 09303518 Country of ref document: US |
|
| AK | Designated states |
Kind code of ref document: A2 Designated state(s): AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GD GE GH GM HR HU ID IL IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG US UZ VN YU ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A2 Designated state(s): GH GM KE LS MW SD SZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| DFPE | Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101) | ||
| AK | Designated states |
Kind code of ref document: A3 Designated state(s): AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GD GE GH GM HR HU ID IL IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK SL TJ TM TR TT UA UG US UZ VN YU ZW |
|
| AL | Designated countries for regional patents |
Kind code of ref document: A3 Designated state(s): GH GM KE LS MW SD SZ UG ZW AM AZ BY KG KZ MD RU TJ TM AT BE CH CY DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG CI CM GA GN GW ML MR NE SN TD TG |
|
| ENP | Entry into the national phase |
Ref document number: 2308606 Country of ref document: CA Ref document number: 2308606 Country of ref document: CA Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: PA/a/2000/004363 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1998946675 Country of ref document: EP |
|
| WWP | Wipo information: published in national office |
Ref document number: 1998946675 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: DE Ref legal event code: 8642 |
|
| ENP | Entry into the national phase |
Ref document number: PI9813930 Country of ref document: BR |