US20190255165A1 - Fusion Comprising A Cell Penetrating Peptide, A Multi Epitope And A TLR Peptide Agonist For Treatment Of Cancer - Google Patents
Fusion Comprising A Cell Penetrating Peptide, A Multi Epitope And A TLR Peptide Agonist For Treatment Of Cancer Download PDFInfo
- Publication number
- US20190255165A1 US20190255165A1 US16/331,398 US201716331398A US2019255165A1 US 20190255165 A1 US20190255165 A1 US 20190255165A1 US 201716331398 A US201716331398 A US 201716331398A US 2019255165 A1 US2019255165 A1 US 2019255165A1
- Authority
- US
- United States
- Prior art keywords
- complex
- seq
- peptide
- epitopes
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 285
- 108010051109 Cell-Penetrating Peptides Proteins 0.000 title claims abstract description 117
- 102000020313 Cell-Penetrating Peptides Human genes 0.000 title claims abstract description 117
- 229940122985 Peptide agonist Drugs 0.000 title claims abstract description 96
- 238000011282 treatment Methods 0.000 title claims abstract description 28
- 201000011510 cancer Diseases 0.000 title abstract description 126
- 230000004927 fusion Effects 0.000 title description 3
- 239000000427 antigen Substances 0.000 claims abstract description 338
- 108091007433 antigens Proteins 0.000 claims abstract description 334
- 102000036639 antigens Human genes 0.000 claims abstract description 334
- 102000002689 Toll-like receptor Human genes 0.000 claims abstract description 144
- 108020000411 Toll-like receptor Proteins 0.000 claims abstract description 144
- 230000000890 antigenic effect Effects 0.000 claims abstract description 142
- 229960005486 vaccine Drugs 0.000 claims abstract description 35
- 230000002265 prevention Effects 0.000 claims abstract description 16
- 239000000203 mixture Substances 0.000 claims abstract description 13
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract 6
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 295
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 228
- 150000001413 amino acids Chemical class 0.000 claims description 199
- 239000012634 fragment Substances 0.000 claims description 119
- 108090000623 proteins and genes Proteins 0.000 claims description 104
- -1 βhCG Proteins 0.000 claims description 103
- 210000004027 cell Anatomy 0.000 claims description 99
- 102000004169 proteins and genes Human genes 0.000 claims description 99
- 108010002687 Survivin Proteins 0.000 claims description 98
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 claims description 88
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 claims description 88
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 claims description 88
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 87
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 claims description 74
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 claims description 74
- 102100034256 Mucin-1 Human genes 0.000 claims description 73
- 108010008707 Mucin-1 Proteins 0.000 claims description 72
- 206010009944 Colon cancer Diseases 0.000 claims description 70
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 70
- 102100022144 Achaete-scute homolog 2 Human genes 0.000 claims description 65
- 101150105104 Kras gene Proteins 0.000 claims description 62
- 229920001184 polypeptide Polymers 0.000 claims description 57
- 102000007482 Interleukin-13 Receptor alpha2 Subunit Human genes 0.000 claims description 49
- 108010085418 Interleukin-13 Receptor alpha2 Subunit Proteins 0.000 claims description 49
- 239000000556 agonist Substances 0.000 claims description 49
- 101710117112 UDP-N-acetylglucosamine-peptide N-acetylglucosaminyltransferase 110 kDa subunit Proteins 0.000 claims description 46
- SSOORFWOBGFTHL-OTEJMHTDSA-N (4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[(2S)-2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-5-carbamimidamido-1-[[(2S)-5-carbamimidamido-1-[[(1S)-4-carbamimidamido-1-carboxybutyl]amino]-1-oxopentan-2-yl]amino]-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-[[(2S)-2-[[(2S)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino]-5-oxopentanoic acid Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SSOORFWOBGFTHL-OTEJMHTDSA-N 0.000 claims description 43
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 claims description 42
- 102100037920 Insulin-like growth factor 2 mRNA-binding protein 3 Human genes 0.000 claims description 42
- 108091008605 VEGF receptors Proteins 0.000 claims description 41
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 claims description 41
- 101100452137 Homo sapiens IGF2BP3 gene Proteins 0.000 claims description 40
- 101000801539 Homo sapiens Mitochondrial import receptor subunit TOM34 Proteins 0.000 claims description 40
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 claims description 40
- 102100033583 Mitochondrial import receptor subunit TOM34 Human genes 0.000 claims description 40
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 claims description 40
- 210000004443 dendritic cell Anatomy 0.000 claims description 40
- 102100029520 E3 ubiquitin-protein ligase TRIM31 Human genes 0.000 claims description 38
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 claims description 38
- 101000634974 Homo sapiens E3 ubiquitin-protein ligase TRIM31 Proteins 0.000 claims description 38
- 125000006850 spacer group Chemical group 0.000 claims description 37
- 102100038916 Caspase-5 Human genes 0.000 claims description 36
- 238000012737 microarray-based gene expression Methods 0.000 claims description 35
- 238000012243 multiplex automated genomic engineering Methods 0.000 claims description 35
- 101000741072 Homo sapiens Caspase-5 Proteins 0.000 claims description 34
- 150000007523 nucleic acids Chemical class 0.000 claims description 29
- 241000283070 Equus zebra Species 0.000 claims description 27
- 102000039446 nucleic acids Human genes 0.000 claims description 27
- 108020004707 nucleic acids Proteins 0.000 claims description 27
- 230000000149 penetrating effect Effects 0.000 claims description 26
- 239000003814 drug Substances 0.000 claims description 25
- 101000669447 Homo sapiens Toll-like receptor 4 Proteins 0.000 claims description 23
- 102100024333 Toll-like receptor 2 Human genes 0.000 claims description 23
- 102100039360 Toll-like receptor 4 Human genes 0.000 claims description 23
- 229940079593 drug Drugs 0.000 claims description 23
- 238000000034 method Methods 0.000 claims description 23
- 101000831567 Homo sapiens Toll-like receptor 2 Proteins 0.000 claims description 22
- 210000000612 antigen-presenting cell Anatomy 0.000 claims description 18
- 210000004899 c-terminal region Anatomy 0.000 claims description 15
- 108090001030 Lipoproteins Proteins 0.000 claims description 14
- 102000004895 Lipoproteins Human genes 0.000 claims description 14
- 108020004414 DNA Proteins 0.000 claims description 12
- 150000002632 lipids Chemical class 0.000 claims description 11
- 229930186217 Glycolipid Natural products 0.000 claims description 10
- 239000002955 immunomodulating agent Substances 0.000 claims description 10
- 229920001282 polysaccharide Polymers 0.000 claims description 10
- 239000005017 polysaccharide Substances 0.000 claims description 10
- 229910052700 potassium Inorganic materials 0.000 claims description 8
- 108091032973 (ribonucleotides)n+m Proteins 0.000 claims description 7
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 claims description 7
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 claims description 7
- 201000009813 cataract 31 multiple types Diseases 0.000 claims description 7
- 101000669460 Homo sapiens Toll-like receptor 5 Proteins 0.000 claims description 6
- 102100039357 Toll-like receptor 5 Human genes 0.000 claims description 6
- 229940126586 small molecule drug Drugs 0.000 claims description 6
- 239000003053 toxin Substances 0.000 claims description 6
- 231100000765 toxin Toxicity 0.000 claims description 6
- 108700012359 toxins Proteins 0.000 claims description 6
- HVCOBJNICQPDBP-UHFFFAOYSA-N 3-[3-[3,5-dihydroxy-6-methyl-4-(3,4,5-trihydroxy-6-methyloxan-2-yl)oxyoxan-2-yl]oxydecanoyloxy]decanoic acid;hydrate Chemical compound O.OC1C(OC(CC(=O)OC(CCCCCCC)CC(O)=O)CCCCCCC)OC(C)C(O)C1OC1C(O)C(O)C(O)C(C)O1 HVCOBJNICQPDBP-UHFFFAOYSA-N 0.000 claims description 5
- 102000040430 polynucleotide Human genes 0.000 claims description 4
- 108091033319 polynucleotide Proteins 0.000 claims description 4
- 239000002157 polynucleotide Substances 0.000 claims description 4
- 102000053602 DNA Human genes 0.000 claims description 3
- 230000006023 anti-tumor response Effects 0.000 claims description 3
- 108020004459 Small interfering RNA Proteins 0.000 claims description 2
- 108020004999 messenger RNA Proteins 0.000 claims description 2
- 230000001105 regulatory effect Effects 0.000 claims description 2
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 claims 29
- 102000000763 Survivin Human genes 0.000 claims 24
- 101000901109 Homo sapiens Achaete-scute homolog 2 Proteins 0.000 claims 15
- 229940123309 Immune checkpoint modulator Drugs 0.000 claims 10
- 239000002246 antineoplastic agent Substances 0.000 claims 9
- 229940127089 cytotoxic agent Drugs 0.000 claims 9
- 108091028043 Nucleic acid sequence Proteins 0.000 claims 2
- 239000001963 growth medium Substances 0.000 claims 2
- 108020004491 Antisense DNA Proteins 0.000 claims 1
- 108020005544 Antisense RNA Proteins 0.000 claims 1
- 108090000994 Catalytic RNA Proteins 0.000 claims 1
- 102000053642 Catalytic RNA Human genes 0.000 claims 1
- 239000012270 PD-1 inhibitor Substances 0.000 claims 1
- 239000012668 PD-1-inhibitor Substances 0.000 claims 1
- 239000003816 antisense DNA Substances 0.000 claims 1
- 239000013592 cell lysate Substances 0.000 claims 1
- 230000006037 cell lysis Effects 0.000 claims 1
- 239000002299 complementary DNA Substances 0.000 claims 1
- 239000003184 complementary RNA Substances 0.000 claims 1
- 239000003937 drug carrier Substances 0.000 claims 1
- 230000002708 enhancing effect Effects 0.000 claims 1
- 150000004676 glycans Chemical class 0.000 claims 1
- 230000000977 initiatory effect Effects 0.000 claims 1
- 229940121655 pd-1 inhibitor Drugs 0.000 claims 1
- 108091092562 ribozyme Proteins 0.000 claims 1
- 235000001014 amino acid Nutrition 0.000 description 187
- 229940024606 amino acid Drugs 0.000 description 185
- 235000018102 proteins Nutrition 0.000 description 93
- 102100021663 Baculoviral IAP repeat-containing protein 5 Human genes 0.000 description 74
- 102100022019 Pregnancy-specific beta-1-glycoprotein 2 Human genes 0.000 description 59
- 101710165189 Achaete-scute homolog 2 Proteins 0.000 description 50
- 102100031929 UDP-N-acetylglucosamine-peptide N-acetylglucosaminyltransferase 110 kDa subunit Human genes 0.000 description 47
- 102000000440 Melanoma-associated antigen Human genes 0.000 description 36
- 108050008953 Melanoma-associated antigen Proteins 0.000 description 36
- 210000001744 T-lymphocyte Anatomy 0.000 description 25
- 239000003431 cross linking reagent Substances 0.000 description 24
- 108091054437 MHC class I family Proteins 0.000 description 20
- 125000005647 linker group Chemical group 0.000 description 19
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 17
- 239000002158 endotoxin Substances 0.000 description 17
- 239000003446 ligand Substances 0.000 description 17
- 229920006008 lipopolysaccharide Polymers 0.000 description 17
- 108091054438 MHC class II family Proteins 0.000 description 15
- 201000010099 disease Diseases 0.000 description 15
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 15
- 230000006870 function Effects 0.000 description 14
- 238000006467 substitution reaction Methods 0.000 description 13
- 241000282414 Homo sapiens Species 0.000 description 12
- 102000043129 MHC class I family Human genes 0.000 description 12
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 description 12
- 241000700605 Viruses Species 0.000 description 12
- 230000001580 bacterial effect Effects 0.000 description 12
- 238000009169 immunotherapy Methods 0.000 description 12
- 210000004881 tumor cell Anatomy 0.000 description 12
- 108010028921 Lipopeptides Proteins 0.000 description 11
- 229940022399 cancer vaccine Drugs 0.000 description 11
- 230000028993 immune response Effects 0.000 description 11
- 230000003834 intracellular effect Effects 0.000 description 11
- 239000004971 Cross linker Substances 0.000 description 10
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 10
- 102000043131 MHC class II family Human genes 0.000 description 10
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 10
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 10
- 239000002671 adjuvant Substances 0.000 description 10
- 210000000987 immune system Anatomy 0.000 description 10
- 244000052769 pathogen Species 0.000 description 10
- 230000004048 modification Effects 0.000 description 9
- 238000012986 modification Methods 0.000 description 9
- 229940023041 peptide vaccine Drugs 0.000 description 9
- 150000004804 polysaccharides Chemical class 0.000 description 9
- 102000001301 EGF receptor Human genes 0.000 description 8
- 108060006698 EGF receptor Proteins 0.000 description 8
- 108010040721 Flagellin Proteins 0.000 description 8
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 8
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 8
- 210000000170 cell membrane Anatomy 0.000 description 8
- 238000004132 cross linking Methods 0.000 description 8
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 8
- 210000004379 membrane Anatomy 0.000 description 8
- 239000012528 membrane Substances 0.000 description 8
- 230000035772 mutation Effects 0.000 description 8
- 230000001717 pathogenic effect Effects 0.000 description 8
- 239000012071 phase Substances 0.000 description 8
- 229940023143 protein vaccine Drugs 0.000 description 8
- 102000005962 receptors Human genes 0.000 description 8
- 108020003175 receptors Proteins 0.000 description 8
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 8
- 238000002255 vaccination Methods 0.000 description 8
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 7
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 7
- 238000013459 approach Methods 0.000 description 7
- 238000009566 cancer vaccine Methods 0.000 description 7
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 7
- 230000007246 mechanism Effects 0.000 description 7
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 7
- 238000010647 peptide synthesis reaction Methods 0.000 description 7
- 230000003389 potentiating effect Effects 0.000 description 7
- 230000004083 survival effect Effects 0.000 description 7
- 210000001519 tissue Anatomy 0.000 description 7
- 238000010361 transduction Methods 0.000 description 7
- 230000026683 transduction Effects 0.000 description 7
- JWDFQMWEFLOOED-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSC1=CC=CC=N1 JWDFQMWEFLOOED-UHFFFAOYSA-N 0.000 description 6
- 241000894006 Bacteria Species 0.000 description 6
- 102000011022 Chorionic Gonadotropin Human genes 0.000 description 6
- 108010062540 Chorionic Gonadotropin Proteins 0.000 description 6
- 108010067306 Fibronectins Proteins 0.000 description 6
- 101000763579 Homo sapiens Toll-like receptor 1 Proteins 0.000 description 6
- 102100027010 Toll-like receptor 1 Human genes 0.000 description 6
- 230000004075 alteration Effects 0.000 description 6
- 230000001413 cellular effect Effects 0.000 description 6
- 238000002512 chemotherapy Methods 0.000 description 6
- 230000008878 coupling Effects 0.000 description 6
- 238000010168 coupling process Methods 0.000 description 6
- 238000005859 coupling reaction Methods 0.000 description 6
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 6
- 230000001404 mediated effect Effects 0.000 description 6
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 6
- DAZSWUUAFHBCGE-KRWDZBQOSA-N n-[(2s)-3-methyl-1-oxo-1-pyrrolidin-1-ylbutan-2-yl]-3-phenylpropanamide Chemical compound N([C@@H](C(C)C)C(=O)N1CCCC1)C(=O)CCC1=CC=CC=C1 DAZSWUUAFHBCGE-KRWDZBQOSA-N 0.000 description 6
- 230000008569 process Effects 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 230000008685 targeting Effects 0.000 description 6
- 238000002560 therapeutic procedure Methods 0.000 description 6
- 230000005945 translocation Effects 0.000 description 6
- 230000003612 virological effect Effects 0.000 description 6
- AASYSXRGODIQGY-UHFFFAOYSA-N 1-[1-(2,5-dioxopyrrol-1-yl)hexyl]pyrrole-2,5-dione Chemical group O=C1C=CC(=O)N1C(CCCCC)N1C(=O)C=CC1=O AASYSXRGODIQGY-UHFFFAOYSA-N 0.000 description 5
- 150000008574 D-amino acids Chemical class 0.000 description 5
- 102100030708 GTPase KRas Human genes 0.000 description 5
- 150000008575 L-amino acids Chemical class 0.000 description 5
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 5
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 5
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 5
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 5
- 102100035748 Squamous cell carcinoma antigen recognized by T-cells 3 Human genes 0.000 description 5
- 101710185775 Squamous cell carcinoma antigen recognized by T-cells 3 Proteins 0.000 description 5
- 101800001271 Surface protein Proteins 0.000 description 5
- 230000003213 activating effect Effects 0.000 description 5
- 230000004913 activation Effects 0.000 description 5
- 125000000539 amino acid group Chemical group 0.000 description 5
- 230000001093 anti-cancer Effects 0.000 description 5
- 230000021615 conjugation Effects 0.000 description 5
- 238000011161 development Methods 0.000 description 5
- 230000018109 developmental process Effects 0.000 description 5
- 108020001507 fusion proteins Proteins 0.000 description 5
- 229940084986 human chorionic gonadotropin Drugs 0.000 description 5
- 230000001965 increasing effect Effects 0.000 description 5
- 230000003993 interaction Effects 0.000 description 5
- 201000001441 melanoma Diseases 0.000 description 5
- 150000003141 primary amines Chemical class 0.000 description 5
- 102000008467 protein O-GlcNAc transferase activity proteins Human genes 0.000 description 5
- 230000000638 stimulation Effects 0.000 description 5
- 238000002626 targeted therapy Methods 0.000 description 5
- 229940022511 therapeutic cancer vaccine Drugs 0.000 description 5
- 230000032258 transport Effects 0.000 description 5
- LLXVXPPXELIDGQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)benzoate Chemical compound C=1C=CC(N2C(C=CC2=O)=O)=CC=1C(=O)ON1C(=O)CCC1=O LLXVXPPXELIDGQ-UHFFFAOYSA-N 0.000 description 4
- LKKMLIBUAXYLOY-UHFFFAOYSA-N 3-Amino-1-methyl-5H-pyrido[4,3-b]indole Chemical compound N1C2=CC=CC=C2C2=C1C=C(N)N=C2C LKKMLIBUAXYLOY-UHFFFAOYSA-N 0.000 description 4
- 108700031308 Antennapedia Homeodomain Proteins 0.000 description 4
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 description 4
- 206010012735 Diarrhoea Diseases 0.000 description 4
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- 201000006107 Familial adenomatous polyposis Diseases 0.000 description 4
- 102100037362 Fibronectin Human genes 0.000 description 4
- 208000032612 Glial tumor Diseases 0.000 description 4
- 206010018338 Glioma Diseases 0.000 description 4
- 102000003886 Glycoproteins Human genes 0.000 description 4
- 108090000288 Glycoproteins Proteins 0.000 description 4
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 description 4
- 101000889345 Homo sapiens Cancer/testis antigen 2 Proteins 0.000 description 4
- 101000584612 Homo sapiens GTPase KRas Proteins 0.000 description 4
- 241000725303 Human immunodeficiency virus Species 0.000 description 4
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 4
- 102100031413 L-dopachrome tautomerase Human genes 0.000 description 4
- 101710093778 L-dopachrome tautomerase Proteins 0.000 description 4
- 102000035195 Peptidases Human genes 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- 101710149951 Protein Tat Proteins 0.000 description 4
- 241000725643 Respiratory syncytial virus Species 0.000 description 4
- 201000003176 Severe Acute Respiratory Syndrome Diseases 0.000 description 4
- 108010081667 aflibercept Proteins 0.000 description 4
- 230000000259 anti-tumor effect Effects 0.000 description 4
- 230000005809 anti-tumor immunity Effects 0.000 description 4
- 230000015572 biosynthetic process Effects 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 208000029664 classic familial adenomatous polyposis Diseases 0.000 description 4
- 150000001875 compounds Chemical class 0.000 description 4
- 238000013461 design Methods 0.000 description 4
- 238000005516 engineering process Methods 0.000 description 4
- 125000000524 functional group Chemical group 0.000 description 4
- 230000002068 genetic effect Effects 0.000 description 4
- 230000013595 glycosylation Effects 0.000 description 4
- 238000006206 glycosylation reaction Methods 0.000 description 4
- 230000036039 immunity Effects 0.000 description 4
- 230000006698 induction Effects 0.000 description 4
- 230000005923 long-lasting effect Effects 0.000 description 4
- 238000012423 maintenance Methods 0.000 description 4
- 230000026731 phosphorylation Effects 0.000 description 4
- 238000006366 phosphorylation reaction Methods 0.000 description 4
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 4
- 108040002385 protein O-GlcNAc transferase activity proteins Proteins 0.000 description 4
- 230000011664 signaling Effects 0.000 description 4
- 125000003396 thiol group Chemical group [H]S* 0.000 description 4
- 150000003573 thiols Chemical class 0.000 description 4
- FXYPGCIGRDZWNR-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-[[3-(2,5-dioxopyrrolidin-1-yl)oxy-3-oxopropyl]disulfanyl]propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSCCC(=O)ON1C(=O)CCC1=O FXYPGCIGRDZWNR-UHFFFAOYSA-N 0.000 description 3
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 3
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide Chemical compound CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 3
- UPAQRWMRKQCLSD-HTIIIDOHSA-N 2,3-dipalmitoyl-S-glycerylcysteine Chemical compound CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCC UPAQRWMRKQCLSD-HTIIIDOHSA-N 0.000 description 3
- WEVYNIUIFUYDGI-UHFFFAOYSA-N 3-[6-[4-(trifluoromethoxy)anilino]-4-pyrimidinyl]benzamide Chemical compound NC(=O)C1=CC=CC(C=2N=CN=C(NC=3C=CC(OC(F)(F)F)=CC=3)C=2)=C1 WEVYNIUIFUYDGI-UHFFFAOYSA-N 0.000 description 3
- 108091007065 BIRCs Proteins 0.000 description 3
- 101100314454 Caenorhabditis elegans tra-1 gene Proteins 0.000 description 3
- 102100039510 Cancer/testis antigen 2 Human genes 0.000 description 3
- 108010076667 Caspases Proteins 0.000 description 3
- 102000011727 Caspases Human genes 0.000 description 3
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 description 3
- 206010009900 Colitis ulcerative Diseases 0.000 description 3
- 206010052358 Colorectal cancer metastatic Diseases 0.000 description 3
- 108010060123 Conjugate Vaccines Proteins 0.000 description 3
- 102000004127 Cytokines Human genes 0.000 description 3
- 108090000695 Cytokines Proteins 0.000 description 3
- QOSSAOTZNIDXMA-UHFFFAOYSA-N Dicylcohexylcarbodiimide Chemical compound C1CCCCC1N=C=NC1CCCCC1 QOSSAOTZNIDXMA-UHFFFAOYSA-N 0.000 description 3
- 102100026245 E3 ubiquitin-protein ligase RNF43 Human genes 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 241000233866 Fungi Species 0.000 description 3
- 102000002812 Heat-Shock Proteins Human genes 0.000 description 3
- 108010004889 Heat-Shock Proteins Proteins 0.000 description 3
- 102100037907 High mobility group protein B1 Human genes 0.000 description 3
- 101000692702 Homo sapiens E3 ubiquitin-protein ligase RNF43 Proteins 0.000 description 3
- 102000055031 Inhibitor of Apoptosis Proteins Human genes 0.000 description 3
- 102000004877 Insulin Human genes 0.000 description 3
- 108090001061 Insulin Proteins 0.000 description 3
- 102000003816 Interleukin-13 Human genes 0.000 description 3
- 108090000176 Interleukin-13 Proteins 0.000 description 3
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 description 3
- 229930012538 Paclitaxel Natural products 0.000 description 3
- 206010035664 Pneumonia Diseases 0.000 description 3
- 102100035703 Prostatic acid phosphatase Human genes 0.000 description 3
- 239000004365 Protease Substances 0.000 description 3
- 108010029485 Protein Isoforms Proteins 0.000 description 3
- 102000001708 Protein Isoforms Human genes 0.000 description 3
- 101710173694 Short transient receptor potential channel 2 Proteins 0.000 description 3
- 230000005867 T cell response Effects 0.000 description 3
- 108091023040 Transcription factor Proteins 0.000 description 3
- 102000040945 Transcription factor Human genes 0.000 description 3
- 102000003425 Tyrosinase Human genes 0.000 description 3
- 108060008724 Tyrosinase Proteins 0.000 description 3
- 201000006704 Ulcerative Colitis Diseases 0.000 description 3
- 108010067390 Viral Proteins Proteins 0.000 description 3
- 125000003295 alanine group Chemical group N[C@@H](C)C(=O)* 0.000 description 3
- 230000030741 antigen processing and presentation Effects 0.000 description 3
- 230000006907 apoptotic process Effects 0.000 description 3
- 125000004429 atom Chemical group 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000027455 binding Effects 0.000 description 3
- 210000004369 blood Anatomy 0.000 description 3
- 239000008280 blood Substances 0.000 description 3
- 238000002619 cancer immunotherapy Methods 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 239000000562 conjugate Substances 0.000 description 3
- 229940031670 conjugate vaccine Drugs 0.000 description 3
- 230000001268 conjugating effect Effects 0.000 description 3
- 230000006378 damage Effects 0.000 description 3
- 238000003745 diagnosis Methods 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 229940088598 enzyme Drugs 0.000 description 3
- 150000002148 esters Chemical class 0.000 description 3
- 102000037865 fusion proteins Human genes 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 230000006054 immunological memory Effects 0.000 description 3
- 230000001976 improved effect Effects 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 230000015788 innate immune response Effects 0.000 description 3
- 229940125396 insulin Drugs 0.000 description 3
- 239000002502 liposome Substances 0.000 description 3
- 239000006166 lysate Substances 0.000 description 3
- 125000005439 maleimidyl group Chemical group C1(C=CC(N1*)=O)=O 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 125000003729 nucleotide group Chemical group 0.000 description 3
- 229960001592 paclitaxel Drugs 0.000 description 3
- 229960001972 panitumumab Drugs 0.000 description 3
- 244000045947 parasite Species 0.000 description 3
- 230000002093 peripheral effect Effects 0.000 description 3
- NMHMNPHRMNGLLB-UHFFFAOYSA-N phloretic acid Chemical compound OC(=O)CCC1=CC=C(O)C=C1 NMHMNPHRMNGLLB-UHFFFAOYSA-N 0.000 description 3
- 230000004481 post-translational protein modification Effects 0.000 description 3
- 108010043671 prostatic acid phosphatase Proteins 0.000 description 3
- 230000009145 protein modification Effects 0.000 description 3
- 238000001243 protein synthesis Methods 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 239000007790 solid phase Substances 0.000 description 3
- 108010088201 squamous cell carcinoma-related antigen Proteins 0.000 description 3
- JJAHTWIKCUJRDK-UHFFFAOYSA-N succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate Chemical compound C1CC(CN2C(C=CC2=O)=O)CCC1C(=O)ON1C(=O)CCC1=O JJAHTWIKCUJRDK-UHFFFAOYSA-N 0.000 description 3
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 3
- 230000014616 translation Effects 0.000 description 3
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 3
- 230000034512 ubiquitination Effects 0.000 description 3
- 238000010798 ubiquitination Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- RAVVEEJGALCVIN-AGVBWZICSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-5-amino-2-[[(2s)-2-[[(2s)-2-[[(2s)-6-amino-2-[[(2s)-6-amino-2-[[(2s)-2-[[2-[[(2s)-2-amino-3-(4-hydroxyphenyl)propanoyl]amino]acetyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]hexanoyl]amino]hexanoyl]amino]-5-(diamino Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCN=C(N)N)NC(=O)CNC(=O)[C@@H](N)CC1=CC=C(O)C=C1 RAVVEEJGALCVIN-AGVBWZICSA-N 0.000 description 2
- YHVHQZYJGWGAKN-ZUWUZHNASA-N (3s,6s,9r,12s)-6-(4-aminobutyl)-12-benzyl-9-(1h-indol-3-ylmethyl)-3-[(1r)-1-phenylmethoxyethyl]-1,4,7,10,13-pentazacycloicosane-2,5,8,11,14-pentone Chemical compound O([C@H](C)[C@H]1C(NCCCCCCC(=O)N[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H](CC=2C3=CC=CC=C3NC=2)C(=O)N[C@@H](CCCCN)C(=O)N1)=O)CC1=CC=CC=C1 YHVHQZYJGWGAKN-ZUWUZHNASA-N 0.000 description 2
- DIYPCWKHSODVAP-UHFFFAOYSA-N 1-[3-(2,5-dioxopyrrol-1-yl)benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1=CC=CC(N2C(C=CC2=O)=O)=C1 DIYPCWKHSODVAP-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- ZGXJTSGNIOSYLO-UHFFFAOYSA-N 88755TAZ87 Chemical compound NCC(=O)CCC(O)=O ZGXJTSGNIOSYLO-UHFFFAOYSA-N 0.000 description 2
- 208000030507 AIDS Diseases 0.000 description 2
- 108700028369 Alleles Proteins 0.000 description 2
- 102000052587 Anaphase-Promoting Complex-Cyclosome Apc3 Subunit Human genes 0.000 description 2
- 108700004606 Anaphase-Promoting Complex-Cyclosome Apc3 Subunit Proteins 0.000 description 2
- 102000004149 Annexin A2 Human genes 0.000 description 2
- 108090000668 Annexin A2 Proteins 0.000 description 2
- 206010059313 Anogenital warts Diseases 0.000 description 2
- 108700042778 Antimicrobial Peptides Proteins 0.000 description 2
- 102000044503 Antimicrobial Peptides Human genes 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- 108091008875 B cell receptors Proteins 0.000 description 2
- 102100035526 B melanoma antigen 1 Human genes 0.000 description 2
- 206010006187 Breast cancer Diseases 0.000 description 2
- 208000026310 Breast neoplasm Diseases 0.000 description 2
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 2
- 101150108242 CDC27 gene Proteins 0.000 description 2
- 102100025597 Caspase-4 Human genes 0.000 description 2
- 101710090338 Caspase-4 Proteins 0.000 description 2
- 101710090333 Caspase-5 Proteins 0.000 description 2
- 208000011231 Crohn disease Diseases 0.000 description 2
- 101710200374 Crotamine Proteins 0.000 description 2
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 2
- 229930105110 Cyclosporin A Natural products 0.000 description 2
- 108010036949 Cyclosporine Proteins 0.000 description 2
- 241000701022 Cytomegalovirus Species 0.000 description 2
- 101100216227 Dictyostelium discoideum anapc3 gene Proteins 0.000 description 2
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 2
- 206010061818 Disease progression Diseases 0.000 description 2
- 102100030340 Ephrin type-A receptor 2 Human genes 0.000 description 2
- 102100031940 Epithelial cell adhesion molecule Human genes 0.000 description 2
- 101710087998 Eumenine mastoparan-AF Proteins 0.000 description 2
- 102000012673 Follicle Stimulating Hormone Human genes 0.000 description 2
- 108010079345 Follicle Stimulating Hormone Proteins 0.000 description 2
- 102100040578 G antigen 7 Human genes 0.000 description 2
- 101710113436 GTPase KRas Proteins 0.000 description 2
- 206010064571 Gene mutation Diseases 0.000 description 2
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 2
- 108010015899 Glycopeptides Proteins 0.000 description 2
- 102000002068 Glycopeptides Human genes 0.000 description 2
- 102100028972 HLA class I histocompatibility antigen, A alpha chain Human genes 0.000 description 2
- 108010075704 HLA-A Antigens Proteins 0.000 description 2
- 241000590002 Helicobacter pylori Species 0.000 description 2
- 208000005176 Hepatitis C Diseases 0.000 description 2
- 208000008051 Hereditary Nonpolyposis Colorectal Neoplasms Diseases 0.000 description 2
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 description 2
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 description 2
- 101000874316 Homo sapiens B melanoma antigen 1 Proteins 0.000 description 2
- 101000920667 Homo sapiens Epithelial cell adhesion molecule Proteins 0.000 description 2
- 101000893968 Homo sapiens G antigen 7 Proteins 0.000 description 2
- 101000578784 Homo sapiens Melanoma antigen recognized by T-cells 1 Proteins 0.000 description 2
- 101001057156 Homo sapiens Melanoma-associated antigen C2 Proteins 0.000 description 2
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 description 2
- 101000880770 Homo sapiens Protein SSX2 Proteins 0.000 description 2
- 101000831496 Homo sapiens Toll-like receptor 3 Proteins 0.000 description 2
- 101000992235 Homo sapiens UDP-N-acetylglucosamine-peptide N-acetylglucosaminyltransferase 110 kDa subunit Proteins 0.000 description 2
- 241000701074 Human alphaherpesvirus 2 Species 0.000 description 2
- 108700000788 Human immunodeficiency virus 1 tat peptide (47-57) Proteins 0.000 description 2
- 241000701806 Human papillomavirus Species 0.000 description 2
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 2
- 101710126182 Insulin-like growth factor 2 mRNA-binding protein 3 Proteins 0.000 description 2
- 102000004388 Interleukin-4 Human genes 0.000 description 2
- 108090000978 Interleukin-4 Proteins 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-N L-arginine Chemical compound OC(=O)[C@@H](N)CCCN=C(N)N ODKSFYDXXFIFQN-BYPYZUCNSA-N 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- 102000009151 Luteinizing Hormone Human genes 0.000 description 2
- 108010073521 Luteinizing Hormone Proteins 0.000 description 2
- 201000005027 Lynch syndrome Diseases 0.000 description 2
- 208000017140 MUTYH-related attenuated familial adenomatous polyposis Diseases 0.000 description 2
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 2
- 102100027252 Melanoma-associated antigen C2 Human genes 0.000 description 2
- 108010036176 Melitten Proteins 0.000 description 2
- 206010027480 Metastatic malignant melanoma Diseases 0.000 description 2
- 108010063954 Mucins Proteins 0.000 description 2
- 102000015728 Mucins Human genes 0.000 description 2
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 2
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 2
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 2
- 241000588650 Neisseria meningitidis Species 0.000 description 2
- 108010077850 Nuclear Localization Signals Proteins 0.000 description 2
- 208000002606 Paramyxoviridae Infections Diseases 0.000 description 2
- 102100037686 Protein SSX2 Human genes 0.000 description 2
- 241000702670 Rotavirus Species 0.000 description 2
- 108020004682 Single-Stranded DNA Proteins 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 241000193990 Streptococcus sp. 'group B' Species 0.000 description 2
- 230000024932 T cell mediated immunity Effects 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- 101710192266 Tegument protein VP22 Proteins 0.000 description 2
- 102000011923 Thyrotropin Human genes 0.000 description 2
- 108010061174 Thyrotropin Proteins 0.000 description 2
- 102100024324 Toll-like receptor 3 Human genes 0.000 description 2
- 108700015934 Triose-phosphate isomerases Proteins 0.000 description 2
- 102100033598 Triosephosphate isomerase Human genes 0.000 description 2
- 241000700647 Variola virus Species 0.000 description 2
- 102000009524 Vascular Endothelial Growth Factor A Human genes 0.000 description 2
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 2
- 241000710886 West Nile virus Species 0.000 description 2
- 229920000392 Zymosan Polymers 0.000 description 2
- 230000033289 adaptive immune response Effects 0.000 description 2
- 229960002833 aflibercept Drugs 0.000 description 2
- 150000001412 amines Chemical class 0.000 description 2
- 229960002749 aminolevulinic acid Drugs 0.000 description 2
- 230000005975 antitumor immune response Effects 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 235000009697 arginine Nutrition 0.000 description 2
- 150000001540 azides Chemical class 0.000 description 2
- 108010081355 beta 2-Microglobulin Proteins 0.000 description 2
- 229960000397 bevacizumab Drugs 0.000 description 2
- 230000004071 biological effect Effects 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 210000004204 blood vessel Anatomy 0.000 description 2
- 210000002421 cell wall Anatomy 0.000 description 2
- 230000007969 cellular immunity Effects 0.000 description 2
- 230000004700 cellular uptake Effects 0.000 description 2
- 229960005395 cetuximab Drugs 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 238000012412 chemical coupling Methods 0.000 description 2
- 238000010382 chemical cross-linking Methods 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- PEFQQQGFYPMQLH-WFQFKEFWSA-N crotamin Chemical compound C([C@H]1C(=O)N2CCC[C@H]2C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(N[C@@H]2C(=O)N[C@@H](CC(C)C)C(=O)N3CCC[C@H]3C(=O)N3CCC[C@H]3C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=3C=CC=CC=3)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H]3CSSC[C@H](NC(=O)[C@H](CC=4NC=NC=4)NC(=O)CNC(=O)CNC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=4NC=NC=4)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)CC=4C=CC(O)=CC=4)CSSC[C@@H](C(=O)N[C@@H](CSSC2)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CO)C(=O)NCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC=2C4=CC=CC=C4NC=2)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=2C4=CC=CC=C4NC=2)NC(=O)[C@H](CCCNC(N)=N)NC3=O)C(=O)N1)=O)[C@@H](C)CC)C1=CC=CC=C1 PEFQQQGFYPMQLH-WFQFKEFWSA-N 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- 230000001086 cytosolic effect Effects 0.000 description 2
- ZLFRJHOBQVVTOJ-UHFFFAOYSA-N dimethyl hexanediimidate Chemical compound COC(=N)CCCCC(=N)OC ZLFRJHOBQVVTOJ-UHFFFAOYSA-N 0.000 description 2
- 230000005750 disease progression Effects 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 230000013020 embryo development Effects 0.000 description 2
- 230000012202 endocytosis Effects 0.000 description 2
- 230000017188 evasion or tolerance of host immune response Effects 0.000 description 2
- 229940028334 follicle stimulating hormone Drugs 0.000 description 2
- 230000002538 fungal effect Effects 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- 238000012268 genome sequencing Methods 0.000 description 2
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 2
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Chemical compound NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 2
- 229940037467 helicobacter pylori Drugs 0.000 description 2
- 208000002672 hepatitis B Diseases 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 230000001771 impaired effect Effects 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 210000005061 intracellular organelle Anatomy 0.000 description 2
- 230000002427 irreversible effect Effects 0.000 description 2
- 229940043355 kinase inhibitor Drugs 0.000 description 2
- 210000004901 leucine-rich repeat Anatomy 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- 208000014018 liver neoplasm Diseases 0.000 description 2
- 238000011068 loading method Methods 0.000 description 2
- 229940040129 luteinizing hormone Drugs 0.000 description 2
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 201000004792 malaria Diseases 0.000 description 2
- VDXZNPDIRNWWCW-JFTDCZMZSA-N melittin Chemical compound NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(N)=O)CC1=CNC2=CC=CC=C12 VDXZNPDIRNWWCW-JFTDCZMZSA-N 0.000 description 2
- 208000021039 metastatic melanoma Diseases 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 229950006780 n-acetylglucosamine Drugs 0.000 description 2
- 239000002773 nucleotide Substances 0.000 description 2
- 210000003463 organelle Anatomy 0.000 description 2
- 230000003071 parasitic effect Effects 0.000 description 2
- 239000002245 particle Substances 0.000 description 2
- MCYTYTUNNNZWOK-LCLOTLQISA-N penetratin Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCCNC(N)=N)[C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CC=CC=C1 MCYTYTUNNNZWOK-LCLOTLQISA-N 0.000 description 2
- 108010043655 penetratin Proteins 0.000 description 2
- 230000035515 penetration Effects 0.000 description 2
- 239000000816 peptidomimetic Substances 0.000 description 2
- 229910000073 phosphorus hydride Inorganic materials 0.000 description 2
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 2
- 230000001323 posttranslational effect Effects 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000037452 priming Effects 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 235000019419 proteases Nutrition 0.000 description 2
- 229960002633 ramucirumab Drugs 0.000 description 2
- 102000016914 ras Proteins Human genes 0.000 description 2
- 230000007115 recruitment Effects 0.000 description 2
- FNHKPVJBJVTLMP-UHFFFAOYSA-N regorafenib Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=C(F)C(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 FNHKPVJBJVTLMP-UHFFFAOYSA-N 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 230000009291 secondary effect Effects 0.000 description 2
- 150000003384 small molecules Chemical class 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 101150082315 spas-1 gene Proteins 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- KZNICNPSHKQLFF-UHFFFAOYSA-N succinimide Chemical compound O=C1CCC(=O)N1 KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 description 2
- 229960002317 succinimide Drugs 0.000 description 2
- 238000001356 surgical procedure Methods 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 238000009121 systemic therapy Methods 0.000 description 2
- 230000001225 therapeutic effect Effects 0.000 description 2
- 125000000341 threoninyl group Chemical group [H]OC([H])(C([H])([H])[H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 108091006106 transcriptional activators Proteins 0.000 description 2
- 108091005703 transmembrane proteins Proteins 0.000 description 2
- 102000035160 transmembrane proteins Human genes 0.000 description 2
- 108010062760 transportan Proteins 0.000 description 2
- PBKWZFANFUTEPS-CWUSWOHSSA-N transportan Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(N)=O)[C@@H](C)CC)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)CN)[C@@H](C)O)C1=CC=C(O)C=C1 PBKWZFANFUTEPS-CWUSWOHSSA-N 0.000 description 2
- 201000008827 tuberculosis Diseases 0.000 description 2
- 230000004614 tumor growth Effects 0.000 description 2
- 241000712461 unidentified influenza virus Species 0.000 description 2
- 239000002435 venom Substances 0.000 description 2
- 231100000611 venom Toxicity 0.000 description 2
- 210000001048 venom Anatomy 0.000 description 2
- VRDGQQTWSGDXCU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 2-iodoacetate Chemical compound ICC(=O)ON1C(=O)CCC1=O VRDGQQTWSGDXCU-UHFFFAOYSA-N 0.000 description 1
- SYYLQNPWAPHRFV-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(3-methyldiazirin-3-yl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCC1(C)N=N1 SYYLQNPWAPHRFV-UHFFFAOYSA-N 0.000 description 1
- BQWBEDSJTMWJAE-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[(2-iodoacetyl)amino]benzoate Chemical compound C1=CC(NC(=O)CI)=CC=C1C(=O)ON1C(=O)CCC1=O BQWBEDSJTMWJAE-UHFFFAOYSA-N 0.000 description 1
- GKSPIZSKQWTXQG-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[1-(pyridin-2-yldisulfanyl)ethyl]benzoate Chemical compound C=1C=C(C(=O)ON2C(CCC2=O)=O)C=CC=1C(C)SSC1=CC=CC=N1 GKSPIZSKQWTXQG-UHFFFAOYSA-N 0.000 description 1
- PMJWDPGOWBRILU-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCC(C=C1)=CC=C1N1C(=O)C=CC1=O PMJWDPGOWBRILU-UHFFFAOYSA-N 0.000 description 1
- WCMOHMXWOOBVMZ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-[3-(2,5-dioxopyrrol-1-yl)propanoylamino]hexanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCNC(=O)CCN1C(=O)C=CC1=O WCMOHMXWOOBVMZ-UHFFFAOYSA-N 0.000 description 1
- QYEAAMBIUQLHFQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 6-[3-(pyridin-2-yldisulfanyl)propanoylamino]hexanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCNC(=O)CCSSC1=CC=CC=N1 QYEAAMBIUQLHFQ-UHFFFAOYSA-N 0.000 description 1
- INNTZVXVIZIYBF-PXSLIBMESA-N (2S)-6-amino-2-[[(2S)-6-amino-2-[[(2S)-6-amino-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2R)-3-[2,3-di(hexadecanoyloxy)propylsulfanyl]-2-(hexadecanoylamino)propanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]hexanoyl]amino]hexanoyl]amino]hexanoic acid trihydrochloride Chemical compound Cl.Cl.Cl.CCCCCCCCCCCCCCCC(=O)N[C@@H](CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(O)=O INNTZVXVIZIYBF-PXSLIBMESA-N 0.000 description 1
- DQJCDTNMLBYVAY-ZXXIYAEKSA-N (2S,5R,10R,13R)-16-{[(2R,3S,4R,5R)-3-{[(2S,3R,4R,5S,6R)-3-acetamido-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}-5-(ethylamino)-6-hydroxy-2-(hydroxymethyl)oxan-4-yl]oxy}-5-(4-aminobutyl)-10-carbamoyl-2,13-dimethyl-4,7,12,15-tetraoxo-3,6,11,14-tetraazaheptadecan-1-oic acid Chemical compound NCCCC[C@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)CC[C@H](C(N)=O)NC(=O)[C@@H](C)NC(=O)C(C)O[C@@H]1[C@@H](NCC)C(O)O[C@H](CO)[C@H]1O[C@H]1[C@H](NC(C)=O)[C@@H](O)[C@H](O)[C@@H](CO)O1 DQJCDTNMLBYVAY-ZXXIYAEKSA-N 0.000 description 1
- GPWYBXDQHZIBPR-AKGZTFGVSA-N (2r)-2-amino-3-(2,3-dihydroxypropylsulfanyl)propanoic acid Chemical group OC(=O)[C@@H](N)CSCC(O)CO GPWYBXDQHZIBPR-AKGZTFGVSA-N 0.000 description 1
- PZFZLRNAOHUQPH-DJBVYZKNSA-N (2r)-3-[(2r)-2,3-di(hexadecanoyloxy)propyl]sulfanyl-2-(hexadecanoylamino)propanoic acid Chemical compound CCCCCCCCCCCCCCCC(=O)N[C@H](C(O)=O)CSC[C@H](OC(=O)CCCCCCCCCCCCCCC)COC(=O)CCCCCCCCCCCCCCC PZFZLRNAOHUQPH-DJBVYZKNSA-N 0.000 description 1
- AHOKKYCUWBLDST-QYULHYBRSA-N (2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[(2s)-2-[[2-[[(2s)-2-[[(2s,3s)-2-[[(2s)-2,6-diaminohexanoyl]amino]-3-methylpentanoyl]amino]-3-phenylpropanoyl]amino]acetyl]amino]-3-hydroxypropanoyl]amino]-4-methylpentanoyl]amino]propanoyl]amino]-3-phenylpropanoyl]amino Chemical compound C([C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)[C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=CC=C1 AHOKKYCUWBLDST-QYULHYBRSA-N 0.000 description 1
- YXTKHLHCVFUPPT-YYFJYKOTSA-N (2s)-2-[[4-[(2-amino-5-formyl-4-oxo-1,6,7,8-tetrahydropteridin-6-yl)methylamino]benzoyl]amino]pentanedioic acid;(1r,2r)-1,2-dimethanidylcyclohexane;5-fluoro-1h-pyrimidine-2,4-dione;oxalic acid;platinum(2+) Chemical compound [Pt+2].OC(=O)C(O)=O.[CH2-][C@@H]1CCCC[C@H]1[CH2-].FC1=CNC(=O)NC1=O.C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 YXTKHLHCVFUPPT-YYFJYKOTSA-N 0.000 description 1
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 1
- VILFTWLXLYIEMV-UHFFFAOYSA-N 1,5-difluoro-2,4-dinitrobenzene Chemical compound [O-][N+](=O)C1=CC([N+]([O-])=O)=C(F)C=C1F VILFTWLXLYIEMV-UHFFFAOYSA-N 0.000 description 1
- WEYNBWVKOYCCQT-UHFFFAOYSA-N 1-(3-chloro-4-methylphenyl)-3-{2-[({5-[(dimethylamino)methyl]-2-furyl}methyl)thio]ethyl}urea Chemical compound O1C(CN(C)C)=CC=C1CSCCNC(=O)NC1=CC=C(C)C(Cl)=C1 WEYNBWVKOYCCQT-UHFFFAOYSA-N 0.000 description 1
- RVRLFABOQXZUJX-UHFFFAOYSA-N 1-[1-(2,5-dioxopyrrol-1-yl)ethyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1C(C)N1C(=O)C=CC1=O RVRLFABOQXZUJX-UHFFFAOYSA-N 0.000 description 1
- SGVWDRVQIYUSRA-UHFFFAOYSA-N 1-[2-[2-(2,5-dioxopyrrol-1-yl)ethyldisulfanyl]ethyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1CCSSCCN1C(=O)C=CC1=O SGVWDRVQIYUSRA-UHFFFAOYSA-N 0.000 description 1
- FERLGYOHRKHQJP-UHFFFAOYSA-N 1-[2-[2-[2-(2,5-dioxopyrrol-1-yl)ethoxy]ethoxy]ethyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1CCOCCOCCN1C(=O)C=CC1=O FERLGYOHRKHQJP-UHFFFAOYSA-N 0.000 description 1
- WHEOHCIKAJUSJC-UHFFFAOYSA-N 1-[2-[bis[2-(2,5-dioxopyrrol-1-yl)ethyl]amino]ethyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1CCN(CCN1C(C=CC1=O)=O)CCN1C(=O)C=CC1=O WHEOHCIKAJUSJC-UHFFFAOYSA-N 0.000 description 1
- IPJGAEWUPXWFPL-UHFFFAOYSA-N 1-[3-(2,5-dioxopyrrol-1-yl)phenyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1C1=CC=CC(N2C(C=CC2=O)=O)=C1 IPJGAEWUPXWFPL-UHFFFAOYSA-N 0.000 description 1
- WXXSHAKLDCERGU-UHFFFAOYSA-N 1-[4-(2,5-dioxopyrrol-1-yl)butyl]pyrrole-2,5-dione Chemical compound O=C1C=CC(=O)N1CCCCN1C(=O)C=CC1=O WXXSHAKLDCERGU-UHFFFAOYSA-N 0.000 description 1
- FPKVOQKZMBDBKP-UHFFFAOYSA-N 1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 FPKVOQKZMBDBKP-UHFFFAOYSA-N 0.000 description 1
- NWHAVGHJSKQCHH-UHFFFAOYSA-N 1-[6-(2,5-dioxopyrrol-1-yl)hexanoyloxy]-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)CCCCCN1C(=O)C=CC1=O NWHAVGHJSKQCHH-UHFFFAOYSA-N 0.000 description 1
- UPNUQQDXHCUWSG-UHFFFAOYSA-N 1-[6-(4-azido-2-nitroanilino)hexanoyloxy]-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)CCCCCNC1=CC=C(N=[N+]=[N-])C=C1[N+]([O-])=O UPNUQQDXHCUWSG-UHFFFAOYSA-N 0.000 description 1
- KHAWDEWNXJIVCJ-UHFFFAOYSA-N 1-fluoro-4-(4-fluoro-3-nitrophenyl)sulfonyl-2-nitrobenzene Chemical compound C1=C(F)C([N+](=O)[O-])=CC(S(=O)(=O)C=2C=C(C(F)=CC=2)[N+]([O-])=O)=C1 KHAWDEWNXJIVCJ-UHFFFAOYSA-N 0.000 description 1
- SYEKJCKNTHYWOJ-UHFFFAOYSA-N 2-(2,5-dioxopyrrolidin-1-yl)-2-sulfobutanedioic acid;ethane-1,2-diol Chemical compound OCCO.OC(=O)CC(S(O)(=O)=O)(C(O)=O)N1C(=O)CCC1=O.OC(=O)CC(S(O)(=O)=O)(C(O)=O)N1C(=O)CCC1=O SYEKJCKNTHYWOJ-UHFFFAOYSA-N 0.000 description 1
- VYMHBQQZUYHXSS-UHFFFAOYSA-N 2-(3h-dithiol-3-yl)pyridine Chemical group C1=CSSC1C1=CC=CC=N1 VYMHBQQZUYHXSS-UHFFFAOYSA-N 0.000 description 1
- PELJUXRZJGLQNN-UHFFFAOYSA-N 2-(3h-dithiol-3-yl)pyridine;1-hydroperoxyperoxydecane;1-hydroxypyrrolidine-2,5-dione Chemical compound ON1C(=O)CCC1=O.C1=CSSC1C1=CC=CC=N1.CCCCCCCCCCOOOO PELJUXRZJGLQNN-UHFFFAOYSA-N 0.000 description 1
- KVLGZJYDZKSTAJ-UHFFFAOYSA-N 2-(3h-dithiol-3-yl)pyridine;1-hydroperoxyperoxytetratriacontane;1-hydroxypyrrolidine-2,5-dione Chemical compound ON1C(=O)CCC1=O.C1=CSSC1C1=CC=CC=N1.CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCOOOO KVLGZJYDZKSTAJ-UHFFFAOYSA-N 0.000 description 1
- QMOQBVOBWVNSNO-UHFFFAOYSA-N 2-[[2-[[2-[(2-azaniumylacetyl)amino]acetyl]amino]acetyl]amino]acetate Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(O)=O QMOQBVOBWVNSNO-UHFFFAOYSA-N 0.000 description 1
- RLFPCLMBTQOMLI-UHFFFAOYSA-N 2-iodo-n-[2-[(2-iodoacetyl)amino]ethyl]acetamide Chemical compound ICC(=O)NCCNC(=O)CI RLFPCLMBTQOMLI-UHFFFAOYSA-N 0.000 description 1
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 1
- NITXODYAMWZEJY-UHFFFAOYSA-N 3-(pyridin-2-yldisulfanyl)propanehydrazide Chemical compound NNC(=O)CCSSC1=CC=CC=N1 NITXODYAMWZEJY-UHFFFAOYSA-N 0.000 description 1
- ULKDIPSSLZFIQU-UHFFFAOYSA-N 3-[(2-bromoacetyl)amino]propanoic acid Chemical compound OC(=O)CCNC(=O)CBr ULKDIPSSLZFIQU-UHFFFAOYSA-N 0.000 description 1
- QQHITEBEBQNARV-UHFFFAOYSA-N 3-[[2-carboxy-2-(2,5-dioxopyrrolidin-1-yl)-2-sulfoethyl]disulfanyl]-2-(2,5-dioxopyrrolidin-1-yl)-2-sulfopropanoic acid Chemical compound O=C1CCC(=O)N1C(S(O)(=O)=O)(C(=O)O)CSSCC(S(O)(=O)=O)(C(O)=O)N1C(=O)CCC1=O QQHITEBEBQNARV-UHFFFAOYSA-N 0.000 description 1
- SVMCPPLCIXHWBS-UHFFFAOYSA-N 3-amino-2,6-dichlorobenzoic acid Chemical compound NC1=CC=C(Cl)C(C(O)=O)=C1Cl SVMCPPLCIXHWBS-UHFFFAOYSA-N 0.000 description 1
- RHKWIGHJGOEUSM-UHFFFAOYSA-N 3h-imidazo[4,5-h]quinoline Chemical class C1=CN=C2C(N=CN3)=C3C=CC2=C1 RHKWIGHJGOEUSM-UHFFFAOYSA-N 0.000 description 1
- ZMRMMAOBSFSXLN-UHFFFAOYSA-N 4-[4-(2,5-dioxopyrrol-1-yl)phenyl]butanehydrazide Chemical compound C1=CC(CCCC(=O)NN)=CC=C1N1C(=O)C=CC1=O ZMRMMAOBSFSXLN-UHFFFAOYSA-N 0.000 description 1
- QLHLYJHNOCILIT-UHFFFAOYSA-N 4-o-(2,5-dioxopyrrolidin-1-yl) 1-o-[2-[4-(2,5-dioxopyrrolidin-1-yl)oxy-4-oxobutanoyl]oxyethyl] butanedioate Chemical compound O=C1CCC(=O)N1OC(=O)CCC(=O)OCCOC(=O)CCC(=O)ON1C(=O)CCC1=O QLHLYJHNOCILIT-UHFFFAOYSA-N 0.000 description 1
- 102100030310 5,6-dihydroxyindole-2-carboxylic acid oxidase Human genes 0.000 description 1
- 101710163881 5,6-dihydroxyindole-2-carboxylic acid oxidase Proteins 0.000 description 1
- BRJHNRIXCCGTKK-UHFFFAOYSA-N 8,11-diimino-2,2-dioxo-1,5,7-trioxa-2lambda6-thiacycloundecan-6-one Chemical compound C1(CCC(OC(=O)OCCS(=O)(=O)O1)=N)=N BRJHNRIXCCGTKK-UHFFFAOYSA-N 0.000 description 1
- 230000005730 ADP ribosylation Effects 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 102100021305 Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 Human genes 0.000 description 1
- 102100035886 Adenine DNA glycosylase Human genes 0.000 description 1
- 241000702423 Adeno-associated virus - 2 Species 0.000 description 1
- 101710137115 Adenylyl cyclase-associated protein 1 Proteins 0.000 description 1
- XZWXFWBHYRFLEF-FSPLSTOPSA-N Ala-His Chemical compound C[C@H](N)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 XZWXFWBHYRFLEF-FSPLSTOPSA-N 0.000 description 1
- 102000002572 Alpha-Globulins Human genes 0.000 description 1
- 108010068307 Alpha-Globulins Proteins 0.000 description 1
- 102100023635 Alpha-fetoprotein Human genes 0.000 description 1
- 208000004881 Amebiasis Diseases 0.000 description 1
- 206010001980 Amoebiasis Diseases 0.000 description 1
- 241001465677 Ancylostomatoidea Species 0.000 description 1
- 241000048021 Anterhynchium flavomarginatum micado Species 0.000 description 1
- 101710145634 Antigen 1 Proteins 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 1
- 101100288313 Arabidopsis thaliana KTI4 gene Proteins 0.000 description 1
- 101000719121 Arabidopsis thaliana Protein MEI2-like 1 Proteins 0.000 description 1
- IIFDPDVJAHQFSR-WHFBIAKZSA-N Asn-Glu Chemical compound NC(=O)C[C@H](N)C(=O)N[C@H](C(O)=O)CCC(O)=O IIFDPDVJAHQFSR-WHFBIAKZSA-N 0.000 description 1
- JHFNSBBHKSZXKB-VKHMYHEASA-N Asp-Gly Chemical compound OC(=O)C[C@H](N)C(=O)NCC(O)=O JHFNSBBHKSZXKB-VKHMYHEASA-N 0.000 description 1
- 102100022108 Aspartyl/asparaginyl beta-hydroxylase Human genes 0.000 description 1
- 241000295638 Australian bat lyssavirus Species 0.000 description 1
- 101150009389 BZLF1 gene Proteins 0.000 description 1
- 208000004429 Bacillary Dysentery Diseases 0.000 description 1
- 241000193738 Bacillus anthracis Species 0.000 description 1
- 108010027344 Basic Helix-Loop-Helix Transcription Factors Proteins 0.000 description 1
- 102000018720 Basic Helix-Loop-Helix Transcription Factors Human genes 0.000 description 1
- 108060000903 Beta-catenin Proteins 0.000 description 1
- 102000015735 Beta-catenin Human genes 0.000 description 1
- 241000724653 Borna disease virus Species 0.000 description 1
- 241001493154 Bunyamwera virus Species 0.000 description 1
- 208000006448 Buruli Ulcer Diseases 0.000 description 1
- 208000023081 Buruli ulcer disease Diseases 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-M Butyrate Chemical compound CCCC([O-])=O FERIUCNNQQJTOY-UHFFFAOYSA-M 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Natural products CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 1
- 102100040840 C-type lectin domain family 7 member A Human genes 0.000 description 1
- 102000049320 CD36 Human genes 0.000 description 1
- 108010045374 CD36 Antigens Proteins 0.000 description 1
- 210000001239 CD8-positive, alpha-beta cytotoxic T lymphocyte Anatomy 0.000 description 1
- 101150117862 CPP1 gene Proteins 0.000 description 1
- 229940045513 CTLA4 antagonist Drugs 0.000 description 1
- 101100005789 Caenorhabditis elegans cdk-4 gene Proteins 0.000 description 1
- 241001493160 California encephalitis virus Species 0.000 description 1
- 241000282836 Camelus dromedarius Species 0.000 description 1
- 206010007048 Campylobacter gastroenteritis Diseases 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 108090000565 Capsid Proteins Proteins 0.000 description 1
- 102100035904 Caspase-1 Human genes 0.000 description 1
- 108090000426 Caspase-1 Proteins 0.000 description 1
- 102100026548 Caspase-8 Human genes 0.000 description 1
- 108090000538 Caspase-8 Proteins 0.000 description 1
- 102000004178 Cathepsin E Human genes 0.000 description 1
- 108090000611 Cathepsin E Proteins 0.000 description 1
- 208000003163 Cavernous Hemangioma Diseases 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 241001502567 Chikungunya virus Species 0.000 description 1
- 241000606153 Chlamydia trachomatis Species 0.000 description 1
- 206010008631 Cholera Diseases 0.000 description 1
- 102100035167 Coiled-coil domain-containing protein 54 Human genes 0.000 description 1
- 206010069729 Collateral circulation Diseases 0.000 description 1
- 206010048832 Colon adenoma Diseases 0.000 description 1
- 208000035473 Communicable disease Diseases 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 241000711573 Coronaviridae Species 0.000 description 1
- 229940046168 CpG oligodeoxynucleotide Drugs 0.000 description 1
- 108091029430 CpG site Proteins 0.000 description 1
- 208000000307 Crimean Hemorrhagic Fever Diseases 0.000 description 1
- 201000003075 Crimean-Congo hemorrhagic fever Diseases 0.000 description 1
- 241000150230 Crimean-Congo hemorrhagic fever orthonairovirus Species 0.000 description 1
- 108050006400 Cyclin Proteins 0.000 description 1
- DZLQXIFVQFTFJY-BYPYZUCNSA-N Cys-Gly-Gly Chemical compound SC[C@H](N)C(=O)NCC(=O)NCC(O)=O DZLQXIFVQFTFJY-BYPYZUCNSA-N 0.000 description 1
- 102000005927 Cysteine Proteases Human genes 0.000 description 1
- 108010005843 Cysteine Proteases Proteins 0.000 description 1
- 230000005778 DNA damage Effects 0.000 description 1
- 231100000277 DNA damage Toxicity 0.000 description 1
- 230000033616 DNA repair Effects 0.000 description 1
- 229940021995 DNA vaccine Drugs 0.000 description 1
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 1
- 108700020911 DNA-Binding Proteins Proteins 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- 208000001490 Dengue Diseases 0.000 description 1
- 206010012310 Dengue fever Diseases 0.000 description 1
- 241000725619 Dengue virus Species 0.000 description 1
- 102100040606 Dermatan-sulfate epimerase Human genes 0.000 description 1
- 101710127030 Dermatan-sulfate epimerase Proteins 0.000 description 1
- YXHKONLOYHBTNS-UHFFFAOYSA-N Diazomethane Chemical compound C=[N+]=[N-] YXHKONLOYHBTNS-UHFFFAOYSA-N 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 241000150528 Dobrava-Belgrade orthohantavirus Species 0.000 description 1
- 102100037070 Doublecortin domain-containing protein 2 Human genes 0.000 description 1
- 102100028570 Drebrin-like protein Human genes 0.000 description 1
- 241000255601 Drosophila melanogaster Species 0.000 description 1
- 241001520695 Duvenhage lyssavirus Species 0.000 description 1
- 108050002772 E3 ubiquitin-protein ligase Mdm2 Proteins 0.000 description 1
- 102000012199 E3 ubiquitin-protein ligase Mdm2 Human genes 0.000 description 1
- 102000012804 EPCAM Human genes 0.000 description 1
- 101150084967 EPCAM gene Proteins 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 208000030820 Ebola disease Diseases 0.000 description 1
- 206010014596 Encephalitis Japanese B Diseases 0.000 description 1
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 description 1
- 101100007583 Entamoeba histolytica CPP2 gene Proteins 0.000 description 1
- 108010013369 Enteropeptidase Proteins 0.000 description 1
- 102100029727 Enteropeptidase Human genes 0.000 description 1
- 101800001467 Envelope glycoprotein E2 Proteins 0.000 description 1
- 108010055196 EphA2 Receptor Proteins 0.000 description 1
- 108010055179 EphA4 Receptor Proteins 0.000 description 1
- 101710116743 Ephrin type-A receptor 2 Proteins 0.000 description 1
- 102100021616 Ephrin type-A receptor 4 Human genes 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 241000579695 European bat 1 lyssavirus Species 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 108010049003 Fibrinogen Proteins 0.000 description 1
- 102000008946 Fibrinogen Human genes 0.000 description 1
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 1
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 1
- 102100028043 Fibroblast growth factor 3 Human genes 0.000 description 1
- 108090000382 Fibroblast growth factor 6 Proteins 0.000 description 1
- 102100028075 Fibroblast growth factor 6 Human genes 0.000 description 1
- 102000016359 Fibronectins Human genes 0.000 description 1
- 241000192125 Firmicutes Species 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 102000005698 Frizzled receptors Human genes 0.000 description 1
- 108010045438 Frizzled receptors Proteins 0.000 description 1
- 102100035233 Furin Human genes 0.000 description 1
- 108090001126 Furin Proteins 0.000 description 1
- 102100039717 G antigen 1 Human genes 0.000 description 1
- 102100039699 G antigen 4 Human genes 0.000 description 1
- 102100039698 G antigen 5 Human genes 0.000 description 1
- 101710092267 G antigen 5 Proteins 0.000 description 1
- 102100039713 G antigen 6 Human genes 0.000 description 1
- 101710092269 G antigen 6 Proteins 0.000 description 1
- 241000531123 GB virus C Species 0.000 description 1
- 102000013446 GTP Phosphohydrolases Human genes 0.000 description 1
- 108091006109 GTPases Proteins 0.000 description 1
- 208000022555 Genital disease Diseases 0.000 description 1
- 208000031448 Genomic Instability Diseases 0.000 description 1
- SSHIXEILTLPAQT-WHFBIAKZSA-N Gln-Asp Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(O)=O SSHIXEILTLPAQT-WHFBIAKZSA-N 0.000 description 1
- PABVKUJVLNMOJP-WHFBIAKZSA-N Glu-Cys Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CS)C(O)=O PABVKUJVLNMOJP-WHFBIAKZSA-N 0.000 description 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- JLXVRFDTDUGQEE-YFKPBYRVSA-N Gly-Arg Chemical compound NCC(=O)N[C@H](C(O)=O)CCCN=C(N)N JLXVRFDTDUGQEE-YFKPBYRVSA-N 0.000 description 1
- IDOGEHIWMJMAHT-BYPYZUCNSA-N Gly-Gly-Cys Chemical compound NCC(=O)NCC(=O)N[C@@H](CS)C(O)=O IDOGEHIWMJMAHT-BYPYZUCNSA-N 0.000 description 1
- BCCRXDTUTZHDEU-VKHMYHEASA-N Gly-Ser Chemical compound NCC(=O)N[C@@H](CO)C(O)=O BCCRXDTUTZHDEU-VKHMYHEASA-N 0.000 description 1
- 206010018612 Gonorrhoea Diseases 0.000 description 1
- 241000606768 Haemophilus influenzae Species 0.000 description 1
- 206010061192 Haemorrhagic fever Diseases 0.000 description 1
- 241000150562 Hantaan orthohantavirus Species 0.000 description 1
- 241000713158 Hazara virus Species 0.000 description 1
- 102100021888 Helix-loop-helix protein 1 Human genes 0.000 description 1
- 241000711549 Hepacivirus C Species 0.000 description 1
- 102000008055 Heparan Sulfate Proteoglycans Human genes 0.000 description 1
- 229920002971 Heparan sulfate Polymers 0.000 description 1
- 241000700721 Hepatitis B virus Species 0.000 description 1
- 208000028782 Hereditary disease Diseases 0.000 description 1
- 206010051922 Hereditary non-polyposis colorectal cancer syndrome Diseases 0.000 description 1
- 208000017095 Hereditary nonpolyposis colon cancer Diseases 0.000 description 1
- 208000007514 Herpes zoster Diseases 0.000 description 1
- 241000224421 Heterolobosea Species 0.000 description 1
- 239000005057 Hexamethylene diisocyanate Substances 0.000 description 1
- 108700005087 Homeobox Genes Proteins 0.000 description 1
- 108010048671 Homeodomain Proteins Proteins 0.000 description 1
- 102000009331 Homeodomain Proteins Human genes 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101001042227 Homo sapiens Acyl-CoA:lysophosphatidylglycerol acyltransferase 1 Proteins 0.000 description 1
- 101001000351 Homo sapiens Adenine DNA glycosylase Proteins 0.000 description 1
- 101000971171 Homo sapiens Apoptosis regulator Bcl-2 Proteins 0.000 description 1
- 101000901030 Homo sapiens Aspartyl/asparaginyl beta-hydroxylase Proteins 0.000 description 1
- 101100165850 Homo sapiens CA9 gene Proteins 0.000 description 1
- 101000737052 Homo sapiens Coiled-coil domain-containing protein 54 Proteins 0.000 description 1
- 101000954709 Homo sapiens Doublecortin domain-containing protein 2 Proteins 0.000 description 1
- 101000915399 Homo sapiens Drebrin-like protein Proteins 0.000 description 1
- 101000886137 Homo sapiens G antigen 1 Proteins 0.000 description 1
- 101000886678 Homo sapiens G antigen 2D Proteins 0.000 description 1
- 101000886136 Homo sapiens G antigen 4 Proteins 0.000 description 1
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 1
- 101000897691 Homo sapiens Helix-loop-helix protein 1 Proteins 0.000 description 1
- 101000985516 Homo sapiens Hermansky-Pudlak syndrome 5 protein Proteins 0.000 description 1
- 101001025337 Homo sapiens High mobility group protein B1 Proteins 0.000 description 1
- 101001053708 Homo sapiens Inhibitor of growth protein 2 Proteins 0.000 description 1
- 101001077604 Homo sapiens Insulin receptor substrate 1 Proteins 0.000 description 1
- 101000614481 Homo sapiens Kidney-associated antigen 1 Proteins 0.000 description 1
- 101001051093 Homo sapiens Low-density lipoprotein receptor Proteins 0.000 description 1
- 101001134060 Homo sapiens Melanocyte-stimulating hormone receptor Proteins 0.000 description 1
- 101001036689 Homo sapiens Melanoma-associated antigen B5 Proteins 0.000 description 1
- 101001036675 Homo sapiens Melanoma-associated antigen B6 Proteins 0.000 description 1
- 101001057159 Homo sapiens Melanoma-associated antigen C3 Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 1
- 101001133081 Homo sapiens Mucin-2 Proteins 0.000 description 1
- 101000604197 Homo sapiens Neuronatin Proteins 0.000 description 1
- 101001114052 Homo sapiens P antigen family member 4 Proteins 0.000 description 1
- 101000874141 Homo sapiens Probable ATP-dependent RNA helicase DDX43 Proteins 0.000 description 1
- 101000779418 Homo sapiens RAC-alpha serine/threonine-protein kinase Proteins 0.000 description 1
- 101001109419 Homo sapiens RNA-binding protein NOB1 Proteins 0.000 description 1
- 101001062222 Homo sapiens Receptor-binding cancer antigen expressed on SiSo cells Proteins 0.000 description 1
- 101000857677 Homo sapiens Runt-related transcription factor 1 Proteins 0.000 description 1
- 101000821981 Homo sapiens Sarcoma antigen 1 Proteins 0.000 description 1
- 101000665137 Homo sapiens Scm-like with four MBT domains protein 1 Proteins 0.000 description 1
- 101001059454 Homo sapiens Serine/threonine-protein kinase MARK2 Proteins 0.000 description 1
- 101000824971 Homo sapiens Sperm surface protein Sp17 Proteins 0.000 description 1
- 101000648624 Homo sapiens TATA element modulatory factor Proteins 0.000 description 1
- 101000712669 Homo sapiens TGF-beta receptor type-2 Proteins 0.000 description 1
- 101000669406 Homo sapiens Toll-like receptor 6 Proteins 0.000 description 1
- 101000669402 Homo sapiens Toll-like receptor 7 Proteins 0.000 description 1
- 101000648075 Homo sapiens Trafficking protein particle complex subunit 1 Proteins 0.000 description 1
- 101000851018 Homo sapiens Vascular endothelial growth factor receptor 1 Proteins 0.000 description 1
- 101000851007 Homo sapiens Vascular endothelial growth factor receptor 2 Proteins 0.000 description 1
- 101000851030 Homo sapiens Vascular endothelial growth factor receptor 3 Proteins 0.000 description 1
- 241000714260 Human T-lymphotropic virus 1 Species 0.000 description 1
- 241000714259 Human T-lymphotropic virus 2 Species 0.000 description 1
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 1
- 241000701085 Human alphaherpesvirus 3 Species 0.000 description 1
- 241000701041 Human betaherpesvirus 7 Species 0.000 description 1
- 241000711467 Human coronavirus 229E Species 0.000 description 1
- 241001428935 Human coronavirus OC43 Species 0.000 description 1
- 241001502974 Human gammaherpesvirus 8 Species 0.000 description 1
- 241000701027 Human herpesvirus 6 Species 0.000 description 1
- 241000713340 Human immunodeficiency virus 2 Species 0.000 description 1
- 241000342334 Human metapneumovirus Species 0.000 description 1
- 206010020751 Hypersensitivity Diseases 0.000 description 1
- 101710123134 Ice-binding protein Proteins 0.000 description 1
- 101710082837 Ice-structuring protein Proteins 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- 241001500351 Influenzavirus A Species 0.000 description 1
- 241001500350 Influenzavirus B Species 0.000 description 1
- 102100024067 Inhibitor of growth protein 2 Human genes 0.000 description 1
- 102100025087 Insulin receptor substrate 1 Human genes 0.000 description 1
- 108050002021 Integrator complex subunit 2 Proteins 0.000 description 1
- 108010014726 Interferon Type I Proteins 0.000 description 1
- 102000002227 Interferon Type I Human genes 0.000 description 1
- 102100020793 Interleukin-13 receptor subunit alpha-2 Human genes 0.000 description 1
- 101710112634 Interleukin-13 receptor subunit alpha-2 Proteins 0.000 description 1
- RRHGJUQNOFWUDK-UHFFFAOYSA-N Isoprene Chemical group CC(=C)C=C RRHGJUQNOFWUDK-UHFFFAOYSA-N 0.000 description 1
- 201000005807 Japanese encephalitis Diseases 0.000 description 1
- 241000710842 Japanese encephalitis virus Species 0.000 description 1
- 241000712890 Junin mammarenavirus Species 0.000 description 1
- 241001113666 Khasan virus Species 0.000 description 1
- 101710134365 Kinesin-like protein KIF2A Proteins 0.000 description 1
- 102100023426 Kinesin-like protein KIF2A Human genes 0.000 description 1
- FADYJNXDPBKVCA-UHFFFAOYSA-N L-Phenylalanyl-L-lysin Natural products NCCCCC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FADYJNXDPBKVCA-UHFFFAOYSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 1
- 239000002138 L01XE21 - Regorafenib Substances 0.000 description 1
- 206010023927 Lassa fever Diseases 0.000 description 1
- 241000712902 Lassa mammarenavirus Species 0.000 description 1
- 241000222722 Leishmania <genus> Species 0.000 description 1
- 208000004554 Leishmaniasis Diseases 0.000 description 1
- 206010024238 Leptospirosis Diseases 0.000 description 1
- 241000710769 Louping ill virus Species 0.000 description 1
- 102100024640 Low-density lipoprotein receptor Human genes 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- 241000712899 Lymphocytic choriomeningitis mammarenavirus Species 0.000 description 1
- JPNRPAJITHRXRH-BQBZGAKWSA-N Lys-Asn Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CC(N)=O JPNRPAJITHRXRH-BQBZGAKWSA-N 0.000 description 1
- 241001082241 Lythrum hyssopifolia Species 0.000 description 1
- 108010010995 MART-1 Antigen Proteins 0.000 description 1
- 241000701076 Macacine alphaherpesvirus 1 Species 0.000 description 1
- 241000712898 Machupo mammarenavirus Species 0.000 description 1
- 229920000057 Mannan Polymers 0.000 description 1
- 241000711937 Marburg marburgvirus Species 0.000 description 1
- 241001115401 Marburgvirus Species 0.000 description 1
- 101710118867 Maurocalcin Proteins 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- 241000712079 Measles morbillivirus Species 0.000 description 1
- 241000256853 Megascolia flavifrons Species 0.000 description 1
- 102100034216 Melanocyte-stimulating hormone receptor Human genes 0.000 description 1
- 102100039475 Melanoma-associated antigen B5 Human genes 0.000 description 1
- 102100039483 Melanoma-associated antigen B6 Human genes 0.000 description 1
- 102100027248 Melanoma-associated antigen C3 Human genes 0.000 description 1
- 208000024556 Mendelian disease Diseases 0.000 description 1
- 201000009906 Meningitis Diseases 0.000 description 1
- 108090000015 Mesothelin Proteins 0.000 description 1
- 102000003735 Mesothelin Human genes 0.000 description 1
- DZMGFGQBRYWJOR-YUMQZZPRSA-N Met-Pro Chemical compound CSCC[C@H](N)C(=O)N1CCC[C@H]1C(O)=O DZMGFGQBRYWJOR-YUMQZZPRSA-N 0.000 description 1
- 241000725171 Mokola lyssavirus Species 0.000 description 1
- 241000700560 Molluscum contagiosum virus Species 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 241000713333 Mouse mammary tumor virus Species 0.000 description 1
- 102100023123 Mucin-16 Human genes 0.000 description 1
- 102100034263 Mucin-2 Human genes 0.000 description 1
- 208000005647 Mumps Diseases 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101000933115 Mus musculus Caspase-4 Proteins 0.000 description 1
- 241000187917 Mycobacterium ulcerans Species 0.000 description 1
- 206010066289 Mycobacterium ulcerans infection Diseases 0.000 description 1
- 241000204031 Mycoplasma Species 0.000 description 1
- 108060008487 Myosin Proteins 0.000 description 1
- 102000003505 Myosin Human genes 0.000 description 1
- 108010084333 N-palmitoyl-S-(2,3-bis(palmitoyloxy)propyl)cysteinyl-seryl-lysyl-lysyl-lysyl-lysine Proteins 0.000 description 1
- 102000012064 NLR Proteins Human genes 0.000 description 1
- 208000001894 Nasopharyngeal Neoplasms Diseases 0.000 description 1
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 1
- 102100038816 Neuronatin Human genes 0.000 description 1
- 108010051791 Nuclear Antigens Proteins 0.000 description 1
- 102000019040 Nuclear Antigens Human genes 0.000 description 1
- 108010077991 O-GlcNAc transferase Proteins 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 241000702259 Orbivirus Species 0.000 description 1
- 101710116435 Outer membrane protein Proteins 0.000 description 1
- 241000283898 Ovis Species 0.000 description 1
- 102100023240 P antigen family member 4 Human genes 0.000 description 1
- 108060006580 PRAME Proteins 0.000 description 1
- 102000036673 PRAME Human genes 0.000 description 1
- 102100034640 PWWP domain-containing DNA repair factor 3A Human genes 0.000 description 1
- 108050007154 PWWP domain-containing DNA repair factor 3A Proteins 0.000 description 1
- 206010033701 Papillary thyroid cancer Diseases 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 108010067902 Peptide Library Proteins 0.000 description 1
- 108010013639 Peptidoglycan Proteins 0.000 description 1
- 201000005702 Pertussis Diseases 0.000 description 1
- FADYJNXDPBKVCA-STQMWFEESA-N Phe-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CC=CC=C1 FADYJNXDPBKVCA-STQMWFEESA-N 0.000 description 1
- GKZIWHRNKRBEOH-HOTGVXAUSA-N Phe-Phe Chemical compound C([C@H]([NH3+])C(=O)N[C@@H](CC=1C=CC=CC=1)C([O-])=O)C1=CC=CC=C1 GKZIWHRNKRBEOH-HOTGVXAUSA-N 0.000 description 1
- FSXRLASFHBWESK-HOTGVXAUSA-N Phe-Tyr Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=CC=C1 FSXRLASFHBWESK-HOTGVXAUSA-N 0.000 description 1
- 102100021768 Phosphoserine aminotransferase Human genes 0.000 description 1
- 206010035148 Plague Diseases 0.000 description 1
- 241000223960 Plasmodium falciparum Species 0.000 description 1
- 241000223801 Plasmodium knowlesi Species 0.000 description 1
- 241000223821 Plasmodium malariae Species 0.000 description 1
- 241001505293 Plasmodium ovale Species 0.000 description 1
- 241000223810 Plasmodium vivax Species 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 108091036414 Polyinosinic:polycytidylic acid Proteins 0.000 description 1
- 241001505332 Polyomavirus sp. Species 0.000 description 1
- 241000710884 Powassan virus Species 0.000 description 1
- 108700011066 PreScission Protease Proteins 0.000 description 1
- 102100035724 Probable ATP-dependent RNA helicase DDX43 Human genes 0.000 description 1
- 101710114165 Progranulin Proteins 0.000 description 1
- 102100037632 Progranulin Human genes 0.000 description 1
- 102100036691 Proliferating cell nuclear antigen Human genes 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 241000150258 Prospect Hill orthohantavirus Species 0.000 description 1
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 102000012515 Protein kinase domains Human genes 0.000 description 1
- 108050002122 Protein kinase domains Proteins 0.000 description 1
- 241000150264 Puumala orthohantavirus Species 0.000 description 1
- 102100033810 RAC-alpha serine/threonine-protein kinase Human genes 0.000 description 1
- 101150040459 RAS gene Proteins 0.000 description 1
- 101150076031 RAS1 gene Proteins 0.000 description 1
- 108030001238 RING-type E3 ubiquitin transferases Proteins 0.000 description 1
- 102000034442 RING-type E3 ubiquitin transferases Human genes 0.000 description 1
- 102000009572 RNA Polymerase II Human genes 0.000 description 1
- 108010009460 RNA Polymerase II Proteins 0.000 description 1
- 102000044126 RNA-Binding Proteins Human genes 0.000 description 1
- 108700020471 RNA-Binding Proteins Proteins 0.000 description 1
- 102100022491 RNA-binding protein NOB1 Human genes 0.000 description 1
- 206010037742 Rabies Diseases 0.000 description 1
- 241000711798 Rabies lyssavirus Species 0.000 description 1
- 102100029165 Receptor-binding cancer antigen expressed on SiSo cells Human genes 0.000 description 1
- 102100023606 Retinoic acid receptor alpha Human genes 0.000 description 1
- 208000000705 Rift Valley Fever Diseases 0.000 description 1
- 241000713124 Rift Valley fever virus Species 0.000 description 1
- 241000710801 Rubivirus Species 0.000 description 1
- 102100025373 Runt-related transcription factor 1 Human genes 0.000 description 1
- 108010038122 S-(2,3-bis(palmitoyloxy)propyl)cysteine Proteins 0.000 description 1
- 108050003189 SH2B adapter protein 1 Proteins 0.000 description 1
- 241001222774 Salmonella enterica subsp. enterica serovar Minnesota Species 0.000 description 1
- 241001135555 Sandfly fever Sicilian virus Species 0.000 description 1
- 102100021466 Sarcoma antigen 1 Human genes 0.000 description 1
- 102100038689 Scm-like with four MBT domains protein 1 Human genes 0.000 description 1
- 101000910357 Scorpio palmatus Maurocalcin Proteins 0.000 description 1
- 241000150278 Seoul orthohantavirus Species 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- UJTZHGHXJKIAOS-WHFBIAKZSA-N Ser-Gln Chemical compound OC[C@H](N)C(=O)N[C@H](C(O)=O)CCC(N)=O UJTZHGHXJKIAOS-WHFBIAKZSA-N 0.000 description 1
- LZLREEUGSYITMX-JQWIXIFHSA-N Ser-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CO)N)C(O)=O)=CNC2=C1 LZLREEUGSYITMX-JQWIXIFHSA-N 0.000 description 1
- 102100028904 Serine/threonine-protein kinase MARK2 Human genes 0.000 description 1
- 206010040550 Shigella infections Diseases 0.000 description 1
- 101710173693 Short transient receptor potential channel 1 Proteins 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 241000150288 Sin Nombre orthohantavirus Species 0.000 description 1
- 108091027967 Small hairpin RNA Proteins 0.000 description 1
- 208000001203 Smallpox Diseases 0.000 description 1
- 241000710888 St. Louis encephalitis virus Species 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- 241000193998 Streptococcus pneumoniae Species 0.000 description 1
- 241001505901 Streptococcus sp. 'group A' Species 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 241001115376 Sudan ebolavirus Species 0.000 description 1
- 241000701093 Suid alphaherpesvirus 1 Species 0.000 description 1
- 108090000054 Syndecan-2 Proteins 0.000 description 1
- 108010008038 Synthetic Vaccines Proteins 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 230000027526 T cell tolerance induction Effects 0.000 description 1
- 101150057140 TACSTD1 gene Proteins 0.000 description 1
- 108010032166 TARP Proteins 0.000 description 1
- 102100028866 TATA element modulatory factor Human genes 0.000 description 1
- 239000012317 TBTU Substances 0.000 description 1
- 108700019889 TEL-AML1 fusion Proteins 0.000 description 1
- 108010034610 TG4010 Proteins 0.000 description 1
- 102100033455 TGF-beta receptor type-2 Human genes 0.000 description 1
- 108091005735 TGF-beta receptors Proteins 0.000 description 1
- 102100033082 TNF receptor-associated factor 3 Human genes 0.000 description 1
- 101150033985 TPI gene Proteins 0.000 description 1
- 101150032817 TPI1 gene Proteins 0.000 description 1
- 241000712908 Tacaribe mammarenavirus Species 0.000 description 1
- 241001115374 Tai Forest ebolavirus Species 0.000 description 1
- 206010043376 Tetanus Diseases 0.000 description 1
- 210000000447 Th1 cell Anatomy 0.000 description 1
- 210000000068 Th17 cell Anatomy 0.000 description 1
- 210000004241 Th2 cell Anatomy 0.000 description 1
- DSGIVWSDDRDJIO-ZXXMMSQZSA-N Thr-Thr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(O)=O DSGIVWSDDRDJIO-ZXXMMSQZSA-N 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 208000004006 Tick-borne encephalitis Diseases 0.000 description 1
- 241000710771 Tick-borne encephalitis virus Species 0.000 description 1
- 108010060818 Toll-Like Receptor 9 Proteins 0.000 description 1
- 108010060888 Toll-like receptor 2 Proteins 0.000 description 1
- 102100039387 Toll-like receptor 6 Human genes 0.000 description 1
- 102100039390 Toll-like receptor 7 Human genes 0.000 description 1
- 102100033117 Toll-like receptor 9 Human genes 0.000 description 1
- 241000711517 Torovirus Species 0.000 description 1
- 241000713154 Toscana virus Species 0.000 description 1
- 102100025256 Trafficking protein particle complex subunit 1 Human genes 0.000 description 1
- 102000004357 Transferases Human genes 0.000 description 1
- 108090000992 Transferases Proteins 0.000 description 1
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 1
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 1
- 102000016715 Transforming Growth Factor beta Receptors Human genes 0.000 description 1
- LVTKHGUGBGNBPL-UHFFFAOYSA-N Trp-P-1 Chemical compound N1C2=CC=CC=C2C2=C1C(C)=C(N)N=C2C LVTKHGUGBGNBPL-UHFFFAOYSA-N 0.000 description 1
- 241000223104 Trypanosoma Species 0.000 description 1
- 241000150289 Tula orthohantavirus Species 0.000 description 1
- 208000034784 Tularaemia Diseases 0.000 description 1
- 108010040002 Tumor Suppressor Proteins Proteins 0.000 description 1
- 102000001742 Tumor Suppressor Proteins Human genes 0.000 description 1
- 102100040418 Tumor protein D52 Human genes 0.000 description 1
- 101710190247 Tumor protein D52 Proteins 0.000 description 1
- 206010064390 Tumour invasion Diseases 0.000 description 1
- 101710107540 Type-2 ice-structuring protein Proteins 0.000 description 1
- 208000037386 Typhoid Diseases 0.000 description 1
- 102100027244 U4/U6.U5 tri-snRNP-associated protein 1 Human genes 0.000 description 1
- 101710155955 U4/U6.U5 tri-snRNP-associated protein 1 Proteins 0.000 description 1
- LFTYTUAZOPRMMI-CFRASDGPSA-N UDP-N-acetyl-alpha-D-glucosamine Chemical compound O1[C@H](CO)[C@@H](O)[C@H](O)[C@@H](NC(=O)C)[C@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 LFTYTUAZOPRMMI-CFRASDGPSA-N 0.000 description 1
- 208000025865 Ulcer Diseases 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 206010046865 Vaccinia virus infection Diseases 0.000 description 1
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 1
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 description 1
- 102100033179 Vascular endothelial growth factor receptor 3 Human genes 0.000 description 1
- 241000711973 Vesicular stomatitis Indiana virus Species 0.000 description 1
- 102000013814 Wnt Human genes 0.000 description 1
- 108050003627 Wnt Proteins 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 208000003152 Yellow Fever Diseases 0.000 description 1
- 241000710772 Yellow fever virus Species 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- 241001115400 Zaire ebolavirus Species 0.000 description 1
- FMGQSPLVSTYWJK-UHFFFAOYSA-N [N-]=[N+]=[N-].CC Chemical compound [N-]=[N+]=[N-].CC FMGQSPLVSTYWJK-UHFFFAOYSA-N 0.000 description 1
- CLZISMQKJZCZDN-UHFFFAOYSA-N [benzotriazol-1-yloxy(dimethylamino)methylidene]-dimethylazanium Chemical compound C1=CC=C2N(OC(N(C)C)=[N+](C)C)N=NC2=C1 CLZISMQKJZCZDN-UHFFFAOYSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 230000004721 adaptive immunity Effects 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 210000001789 adipocyte Anatomy 0.000 description 1
- 238000009098 adjuvant therapy Methods 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 108010070944 alanylhistidine Proteins 0.000 description 1
- 235000013334 alcoholic beverage Nutrition 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- 230000007815 allergy Effects 0.000 description 1
- VREFGVBLTWBCJP-UHFFFAOYSA-N alprazolam Chemical compound C12=CC(Cl)=CC=C2N2C(C)=NN=C2CN=C1C1=CC=CC=C1 VREFGVBLTWBCJP-UHFFFAOYSA-N 0.000 description 1
- 229940037003 alum Drugs 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 230000006229 amino acid addition Effects 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 230000019552 anatomical structure morphogenesis Effects 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 230000002424 anti-apoptotic effect Effects 0.000 description 1
- 230000014102 antigen processing and presentation of exogenous peptide antigen via MHC class I Effects 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 230000008090 antitumoral immunity Effects 0.000 description 1
- 238000003782 apoptosis assay Methods 0.000 description 1
- 230000010516 arginylation Effects 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 108010047857 aspartylglycine Proteins 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 229940120638 avastin Drugs 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 102000015736 beta 2-Microglobulin Human genes 0.000 description 1
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical group NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 230000008512 biological response Effects 0.000 description 1
- NXVYSVARUKNFNF-NXEZZACHSA-N bis(2,5-dioxopyrrolidin-1-yl) (2r,3r)-2,3-dihydroxybutanedioate Chemical compound O=C([C@H](O)[C@@H](O)C(=O)ON1C(CCC1=O)=O)ON1C(=O)CCC1=O NXVYSVARUKNFNF-NXEZZACHSA-N 0.000 description 1
- LNQHREYHFRFJAU-UHFFFAOYSA-N bis(2,5-dioxopyrrolidin-1-yl) pentanedioate Chemical compound O=C1CCC(=O)N1OC(=O)CCCC(=O)ON1C(=O)CCC1=O LNQHREYHFRFJAU-UHFFFAOYSA-N 0.000 description 1
- VYLDEYYOISNGST-UHFFFAOYSA-N bissulfosuccinimidyl suberate Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)CCCCCCC(=O)ON1C(=O)C(S(O)(=O)=O)CC1=O VYLDEYYOISNGST-UHFFFAOYSA-N 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 108010025307 buforin II Proteins 0.000 description 1
- 244000309464 bull Species 0.000 description 1
- 230000009400 cancer invasion Effects 0.000 description 1
- 229940095731 candida albicans Drugs 0.000 description 1
- TWFZGCMQGLPBSX-UHFFFAOYSA-N carbendazim Chemical compound C1=CC=C2NC(NC(=O)OC)=NC2=C1 TWFZGCMQGLPBSX-UHFFFAOYSA-N 0.000 description 1
- 150000001718 carbodiimides Chemical class 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 150000007942 carboxylates Chemical class 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 230000021164 cell adhesion Effects 0.000 description 1
- 230000022131 cell cycle Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 210000003855 cell nucleus Anatomy 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000004640 cellular pathway Effects 0.000 description 1
- 230000002490 cerebral effect Effects 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 229940038705 chlamydia trachomatis Drugs 0.000 description 1
- 201000002758 colorectal adenoma Diseases 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 239000002872 contrast media Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 231100000517 death Toxicity 0.000 description 1
- 108010025838 dectin 1 Proteins 0.000 description 1
- 238000012350 deep sequencing Methods 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 229940124447 delivery agent Drugs 0.000 description 1
- 230000017858 demethylation Effects 0.000 description 1
- 238000010520 demethylation reaction Methods 0.000 description 1
- 229940029030 dendritic cell vaccine Drugs 0.000 description 1
- 208000025729 dengue disease Diseases 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- FRTGEIHSCHXMTI-UHFFFAOYSA-N dimethyl octanediimidate Chemical compound COC(=N)CCCCCCC(=N)OC FRTGEIHSCHXMTI-UHFFFAOYSA-N 0.000 description 1
- LRPQMNYCTSPGCX-UHFFFAOYSA-N dimethyl pimelimidate Chemical compound COC(=N)CCCCCC(=N)OC LRPQMNYCTSPGCX-UHFFFAOYSA-N 0.000 description 1
- FSXRLASFHBWESK-UHFFFAOYSA-N dipeptide phenylalanyl-tyrosine Natural products C=1C=C(O)C=CC=1CC(C(O)=O)NC(=O)C(N)CC1=CC=CC=C1 FSXRLASFHBWESK-UHFFFAOYSA-N 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- ZWIBGKZDAWNIFC-UHFFFAOYSA-N disuccinimidyl suberate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCCC(=O)ON1C(=O)CCC1=O ZWIBGKZDAWNIFC-UHFFFAOYSA-N 0.000 description 1
- 230000002222 downregulating effect Effects 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 210000001671 embryonic stem cell Anatomy 0.000 description 1
- 206010014599 encephalitis Diseases 0.000 description 1
- 239000012645 endogenous antigen Substances 0.000 description 1
- 210000001163 endosome Anatomy 0.000 description 1
- 230000000688 enterotoxigenic effect Effects 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 229940082789 erbitux Drugs 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 230000008175 fetal development Effects 0.000 description 1
- 229940012952 fibrinogen Drugs 0.000 description 1
- 229940126864 fibroblast growth factor Drugs 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 238000000799 fluorescence microscopy Methods 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- JYEFSHLLTQIXIO-SMNQTINBSA-N folfiri regimen Chemical compound FC1=CNC(=O)NC1=O.C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1.C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 JYEFSHLLTQIXIO-SMNQTINBSA-N 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- GIVLTTJNORAZON-HDBOBKCLSA-N ganglioside GM2 (18:0) Chemical compound O[C@@H]1[C@@H](O)[C@H](OC[C@H](NC(=O)CCCCCCCCCCCCCCCCC)[C@H](O)\C=C\CCCCCCCCCCCCC)O[C@H](CO)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@]2(O[C@H]([C@H](NC(C)=O)[C@@H](O)C2)[C@H](O)[C@H](O)CO)C(O)=O)[C@@H](O[C@H]2[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](CO)O1 GIVLTTJNORAZON-HDBOBKCLSA-N 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 210000004392 genitalia Anatomy 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 230000001279 glycosylating effect Effects 0.000 description 1
- 108010084264 glycyl-glycyl-cysteine Proteins 0.000 description 1
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 1
- 108010001064 glycyl-glycyl-glycyl-glycine Proteins 0.000 description 1
- 208000001786 gonorrhea Diseases 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 229940047650 haemophilus influenzae Drugs 0.000 description 1
- 201000011066 hemangioma Diseases 0.000 description 1
- 208000005252 hepatitis A Diseases 0.000 description 1
- 201000010284 hepatitis E Diseases 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 238000005734 heterodimerization reaction Methods 0.000 description 1
- RRAMGCGOFNQTLD-UHFFFAOYSA-N hexamethylene diisocyanate Chemical compound O=C=NCCCCCCN=C=O RRAMGCGOFNQTLD-UHFFFAOYSA-N 0.000 description 1
- FUZZWVXGSFPDMH-UHFFFAOYSA-M hexanoate Chemical compound CCCCCC([O-])=O FUZZWVXGSFPDMH-UHFFFAOYSA-M 0.000 description 1
- 230000028996 humoral immune response Effects 0.000 description 1
- 230000009997 humoral pathway Effects 0.000 description 1
- 229940099552 hyaluronan Drugs 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- KIUKXJAPPMFGSW-MNSSHETKSA-N hyaluronan Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)C1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H](C(O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-MNSSHETKSA-N 0.000 description 1
- 150000007857 hydrazones Chemical class 0.000 description 1
- 150000002430 hydrocarbons Chemical group 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 150000002463 imidates Chemical group 0.000 description 1
- 229960002751 imiquimod Drugs 0.000 description 1
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 238000011502 immune monitoring Methods 0.000 description 1
- 230000000899 immune system response Effects 0.000 description 1
- 238000003365 immunocytochemistry Methods 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 230000002584 immunomodulator Effects 0.000 description 1
- 229960001438 immunostimulant agent Drugs 0.000 description 1
- 239000003022 immunostimulating agent Substances 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 230000003116 impacting effect Effects 0.000 description 1
- 238000002513 implantation Methods 0.000 description 1
- 230000008676 import Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 201000001371 inclusion conjunctivitis Diseases 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 210000002074 inflammatory monocyte Anatomy 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 239000000976 ink Substances 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- GURKHSYORGJETM-WAQYZQTGSA-N irinotecan hydrochloride (anhydrous) Chemical compound Cl.C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 GURKHSYORGJETM-WAQYZQTGSA-N 0.000 description 1
- 239000012948 isocyanate Substances 0.000 description 1
- 150000002513 isocyanates Chemical class 0.000 description 1
- MJRDGTVDJKACQZ-VKHMYHEASA-N l-photo-leucine Chemical compound OC(=O)[C@@H](N)CC1(C)N=N1 MJRDGTVDJKACQZ-VKHMYHEASA-N 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 150000002605 large molecules Chemical class 0.000 description 1
- 231100000518 lethal Toxicity 0.000 description 1
- 230000001665 lethal effect Effects 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 210000005210 lymphoid organ Anatomy 0.000 description 1
- 102000033952 mRNA binding proteins Human genes 0.000 description 1
- 108091000373 mRNA binding proteins Proteins 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 210000003794 male germ cell Anatomy 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 210000001161 mammalian embryo Anatomy 0.000 description 1
- LUEWUZLMQUOBSB-GFVSVBBRSA-N mannan Chemical class O[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@@H](O[C@@H]2[C@H](O[C@@H](O[C@H]3[C@H](O[C@@H](O)[C@@H](O)[C@H]3O)CO)[C@@H](O)[C@H]2O)CO)[C@H](O)[C@H]1O LUEWUZLMQUOBSB-GFVSVBBRSA-N 0.000 description 1
- 108010077372 mast cell degranulating peptide Proteins 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- QMBRLNFAEHGOLY-UHFFFAOYSA-N mcd peptide Chemical compound N1C(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CCCCN)NC(=O)C(N)C(C)CC)CSSCC(C(=O)NCC(=O)NC(CCCCN)C(=O)NC(CC(N)=O)C(N)=O)NC(=O)C(C(C)CC)NC(=O)C(CCCCN)NC(=O)C(CCCNC(N)=N)NC(=O)C(NC(=O)C(C(C)CC)NC(=O)C(CC2N=CN=C2)NC(=O)C2CCCN2C(=O)C(CCCCN)NC(=O)C(C(C)CC)NC(=O)C(C(C)C)NC2=O)CSSCC1C(=O)NC(CCCCN)C(=O)NC(CCCNC(N)=N)C(=O)NC2CC1C=NC=N1 QMBRLNFAEHGOLY-UHFFFAOYSA-N 0.000 description 1
- 235000013372 meat Nutrition 0.000 description 1
- 230000015654 memory Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- TWXDDNPPQUTEOV-FVGYRXGTSA-N methamphetamine hydrochloride Chemical compound Cl.CN[C@@H](C)CC1=CC=CC=C1 TWXDDNPPQUTEOV-FVGYRXGTSA-N 0.000 description 1
- MBAXWTVHCRPVFW-UHFFFAOYSA-N methyl 3-[(3-imino-3-methoxypropyl)disulfanyl]propanimidate Chemical compound COC(=N)CCSSCCC(=N)OC MBAXWTVHCRPVFW-UHFFFAOYSA-N 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 210000003470 mitochondria Anatomy 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 229940051875 mucins Drugs 0.000 description 1
- 208000010805 mumps infectious disease Diseases 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- 230000007498 myristoylation Effects 0.000 description 1
- QCQYVCMYGCHVMR-AAZUGDAUSA-N n-[(2r,3r,4s,5r)-4,5,6-trihydroxy-1-oxo-3-[(2r,3r,4s,5r,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyhexan-2-yl]acetamide Chemical compound CC(=O)N[C@@H](C=O)[C@H]([C@@H](O)[C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O QCQYVCMYGCHVMR-AAZUGDAUSA-N 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 230000014399 negative regulation of angiogenesis Effects 0.000 description 1
- 230000006654 negative regulation of apoptotic process Effects 0.000 description 1
- 230000018901 negative regulation of programmed cell death Effects 0.000 description 1
- 230000009826 neoplastic cell growth Effects 0.000 description 1
- 210000003061 neural cell Anatomy 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- YZUUTMGDONTGTN-UHFFFAOYSA-N nonaethylene glycol Chemical compound OCCOCCOCCOCCOCCOCCOCCOCCOCCO YZUUTMGDONTGTN-UHFFFAOYSA-N 0.000 description 1
- 230000002560 nonimmunologic effect Effects 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 239000007764 o/w emulsion Substances 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 229920001542 oligosaccharide Polymers 0.000 description 1
- 150000002482 oligosaccharides Chemical class 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 150000002923 oximes Chemical class 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- MXHCPCSDRGLRER-UHFFFAOYSA-N pentaglycine Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(=O)NCC(O)=O MXHCPCSDRGLRER-UHFFFAOYSA-N 0.000 description 1
- 239000000863 peptide conjugate Substances 0.000 description 1
- 229940038309 personalized vaccine Drugs 0.000 description 1
- 108010073025 phenylalanylphenylalanine Proteins 0.000 description 1
- 150000003905 phosphatidylinositols Chemical class 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 230000028742 placenta development Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229940118768 plasmodium malariae Drugs 0.000 description 1
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 description 1
- 108010011110 polyarginine Proteins 0.000 description 1
- 229940115272 polyinosinic:polycytidylic acid Drugs 0.000 description 1
- 239000003910 polypeptide antibiotic agent Substances 0.000 description 1
- 208000015768 polyposis Diseases 0.000 description 1
- 230000002980 postoperative effect Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000013823 prenylation Effects 0.000 description 1
- 238000004393 prognosis Methods 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 229940034080 provenge Drugs 0.000 description 1
- 230000006340 racemization Effects 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 108010014186 ras Proteins Proteins 0.000 description 1
- 235000020989 red meat Nutrition 0.000 description 1
- 229960004836 regorafenib Drugs 0.000 description 1
- 210000003289 regulatory T cell Anatomy 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 108091008726 retinoic acid receptors α Proteins 0.000 description 1
- 238000007363 ring formation reaction Methods 0.000 description 1
- 201000005404 rubella Diseases 0.000 description 1
- 235000002020 sage Nutrition 0.000 description 1
- 201000004409 schistosomiasis Diseases 0.000 description 1
- 239000002795 scorpion venom Substances 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 201000005113 shigellosis Diseases 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 239000002924 silencing RNA Substances 0.000 description 1
- 229960000714 sipuleucel-t Drugs 0.000 description 1
- 239000004055 small Interfering RNA Substances 0.000 description 1
- VUFNRPJNRFOTGK-UHFFFAOYSA-M sodium;1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 VUFNRPJNRFOTGK-UHFFFAOYSA-M 0.000 description 1
- HHSGWIABCIVPJT-UHFFFAOYSA-M sodium;1-[4-[(2-iodoacetyl)amino]benzoyl]oxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].O=C1C(S(=O)(=O)[O-])CC(=O)N1OC(=O)C1=CC=C(NC(=O)CI)C=C1 HHSGWIABCIVPJT-UHFFFAOYSA-M 0.000 description 1
- 230000000392 somatic effect Effects 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 229940090374 stivarga Drugs 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 1
- 238000005556 structure-activity relationship Methods 0.000 description 1
- 125000001273 sulfonato group Chemical group [O-]S(*)(=O)=O 0.000 description 1
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 1
- 229960001796 sunitinib Drugs 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 125000005931 tert-butyloxycarbonyl group Chemical group [H]C([H])([H])C(OC(*)=O)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 150000007970 thio esters Chemical class 0.000 description 1
- ATGUDZODTABURZ-UHFFFAOYSA-N thiolan-2-ylideneazanium;chloride Chemical compound Cl.N=C1CCCS1 ATGUDZODTABURZ-UHFFFAOYSA-N 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 208000030045 thyroid gland papillary carcinoma Diseases 0.000 description 1
- 239000003970 toll like receptor agonist Substances 0.000 description 1
- 206010044325 trachoma Diseases 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 238000011277 treatment modality Methods 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 210000002993 trophoblast Anatomy 0.000 description 1
- 229940030325 tumor cell vaccine Drugs 0.000 description 1
- 230000037455 tumor specific immune response Effects 0.000 description 1
- 239000000225 tumor suppressor protein Substances 0.000 description 1
- 230000007306 turnover Effects 0.000 description 1
- 201000008297 typhoid fever Diseases 0.000 description 1
- 231100000397 ulcer Toxicity 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 229940124931 vaccine adjuvant Drugs 0.000 description 1
- 239000012646 vaccine adjuvant Substances 0.000 description 1
- 229940124856 vaccine component Drugs 0.000 description 1
- 208000007089 vaccinia Diseases 0.000 description 1
- 201000000627 variola minor Diseases 0.000 description 1
- 208000014016 variola minor infection Diseases 0.000 description 1
- 229940124676 vascular endothelial growth factor receptor Drugs 0.000 description 1
- 230000004862 vasculogenesis Effects 0.000 description 1
- 239000013603 viral vector Substances 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 229940051021 yellow-fever virus Drugs 0.000 description 1
- 229940036061 zaltrap Drugs 0.000 description 1
- 229960002760 ziv-aflibercept Drugs 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001129—Molecules with a "CD" designation not provided for elsewhere
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/34—Antigenic peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001103—Receptors for growth factors
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001103—Receptors for growth factors
- A61K39/001106—Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ErbB4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001103—Receptors for growth factors
- A61K39/001109—Vascular endothelial growth factor receptors [VEGFR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001116—Receptors for cytokines
- A61K39/001119—Receptors for interleukins [IL]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001148—Regulators of development
- A61K39/00115—Apoptosis related proteins, e.g. survivin or livin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001148—Regulators of development
- A61K39/00115—Apoptosis related proteins, e.g. survivin or livin
- A61K39/001151—Apoptosis related proteins, e.g. survivin or livin p53
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001152—Transcription factors, e.g. SOX or c-MYC
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001166—Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001169—Tumor associated carbohydrates
- A61K39/00117—Mucins, e.g. MUC-1
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/00118—Cancer antigens from embryonic or fetal origin
- A61K39/001182—Carcinoembryonic antigen [CEA]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001184—Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
- A61K39/001186—MAGE
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/00119—Melanoma antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/385—Haptens or antigens, bound to carriers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/19—Dendritic cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/20—Cellular immunotherapy characterised by the effect or the function of the cells
- A61K40/24—Antigen-presenting cells [APC]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4238—Regulators of development
- A61K40/424—Apoptosis related proteins, e.g. survivin or livin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4242—Transcription factors, e.g. SOX or c-MYC
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4264—Cancer antigens from embryonic or fetal origin
- A61K40/4266—Carcinoembryonic antigen [CEA]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4271—Melanoma antigens
- A61K40/4273—Glycoprotein 100 [Gp100]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4277—Fusion proteins originating from gene translocation in cancer cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55516—Proteins; Peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/572—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/58—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
- A61K2039/585—Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6031—Proteins
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/64—Medicinal preparations containing antigens or antibodies characterised by the architecture of the carrier-antigen complex, e.g. repetition of carrier-antigen units
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/80—Vaccine for a specifically defined cancer
- A61K2039/82—Colon
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2121/00—Preparations for use in therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/50—Colon
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2300/00—Mixtures or combinations of active ingredients, wherein at least one active ingredient is fully defined in groups A61K31/00 - A61K41/00
Definitions
- the present invention relates to the field of vaccination, in particular to vaccines for the prevention and/or treatment of colorectal cancer (CRC).
- CRC colorectal cancer
- CRC Colorectal cancer
- FAP like MAP (MUTYH-associated polyposis) (Sieber, O. M., et al., Multiple colorectal adenomas, classic adenomatous polyposis, and germ - line mutations in MYH . N Engl J Med, 2003. 348(9): p. 791-9) or Lynch syndrome (Lynch, H. T., et al., Genetics, natural history, tumor spectrum, and pathology of hereditary nonpolyposis colorectal cancer: an updated review . Gastroenterology, 1993. 104(5): p.
- stage 1 the CRC patient's survival time depends on disease development stage. Patients with early stages (Stage 0, I and II) have good prognosis (more than 75%). Stages III have a more heterogeneous survival rate (from 90% down to 50%) depending on the tumor invasion on peripheral tissues. Finally, only stage IV is showing a fast and significant effect on the patient survival time: Only about 10% of patients are surviving more than 60 months after diagnosis.
- VEGF vascular endothelial growth factor
- EGFR Merck-Serono cetuximab/Erbitux®
- Amgen's EGFR monoclonal antibody panitumumab/Vectibix®
- Bayer's small molecule kinase inhibitor Regorafenib Basarga®
- the VEGF monoclonal antibody Ramucirumab from Eli Lilly may be used.
- radiation may be used to relieve symptoms such as pain.
- CTLs tumor-specific cytotoxic T lymphocytes
- cancer vaccines showed very limited clinical efficacy so far. Indeed, at the end of 2011, amongst the 300 hundred ongoing cancer vaccine clinical trials, only 19 phase III trials were reported ( globaldat, 2012). Amongst them, there are NeuVax, a peptide vaccine for breast cancer, Stimuvax, a liposome based vaccine for Non-Small Cell Lung Carcinoma (NSCLC) and breast cancer, TG4010, a vaccinia-based vaccine for NSCLC and GSK1572932A, an adjuvanted liposome for NSCLC. These four cancer vaccines are based on different technologies and have in common that they are targeting one single antigen.
- Therapeutic cancer vaccines can be divided into two principal categories: personalized (autologous) and standardized vaccines, and further classified depending on the technology platform.
- Current personalized vaccines include tumor lysate vaccines as well as dendritic cells based vaccine (hereinafter cell based).
- cell based dendritic cells based vaccine
- antigen loading can occur either with a pulse using tumor lysates, or transfection with RNA extracted from the tumors.
- the antigens are tumor specific or associated, but are not clearly defined.
- Dendritic cells can also be loaded with defined antigens either with peptide pulse or using a protein such as the Prostatic Acid Phosphatase (PAP) used to engineer the Provenge® vaccine.
- PAP Prostatic Acid Phosphatase
- subunits vaccines protein or peptides
- APCs cell-based therapy
- T cells T cells
- CARs CARs
- lysates subunits vaccines
- subunits vaccines protein or peptides
- the antigens are fully defined allowing for better immune-monitoring and reducing the risk of unwanted effects of vaccine component.
- EGFR epidermal growth factor receptor
- VEGF vascular endothelial growth factor
- Adoptive cell transfer (ACT) therapy clinical trials for CRC have unfortunately returned poor results so far. Indeed the limited patient population for both non-engineered and engineered T-cells treatments seems being a major hurdle. Similarly, secondary effect observed on patients treated with T-cells fused with chimeric antigen receptors (CARs), failed to demonstrate ACT as a safe and efficient treatment (Koido, S., et al., Immunotherapy for colorectal cancer . World) Gastroenterol, 2013. 19(46): p. 8531-42; Xiang, B., et al., Colorectal cancer immunotherapy . Discov Med, 2013. 15(84): p. 301-8). Thus added to usual ACT drawbacks in terms of feasibility and cost and immune response memory seems blocking ACT option for the time being.
- a therapeutic cancer vaccine is administrated to cancer patients to strengthen the capability of their immune system to recognize and kill the tumor cells.
- the main goal of a therapeutic cancer vaccine is to generate killer T cells (also called cytotoxic T lymphocytes) specific for the tumor cells.
- the vaccine must contain molecules called antigens that are also present in the tumor and that need to be delivered to Antigen Presenting Cells (APCs), especially dendritic cells (DCs), to allow cancer immunity to be initiated.
- APCs Antigen Presenting Cells
- DCs dendritic cells
- the DCs process these tumor antigens into small peptides that are presented on cell surface expressed MHC class I or MHC class II molecules to T cells. Peptides that are then recognized by T cells and thereby induce their stimulation are called epitopes.
- MHC class I and MHC class II molecules allow activation of two classes of T cells, CD8 + cytotoxic T lymphocytes (CTLs) and CD4 + helper T (T h ) cells, respectively.
- CTLs cytotoxic T lymphocytes
- T h helper T cells
- co-stimulatory signal which is antigen non-specific and is provided by the interaction between co-stimulatory molecules expressed on the surface of APCs and the T cell. Therefore two major requirements for an efficient therapeutic cancer vaccine are the specificity of the tumor antigens and the ability to deliver them efficiently to DCs.
- induction of a tumor specific immune response thus requires three main steps: (i) an antigen must be delivered to dendritic cells, which will process it into epitopes, (ii) dendritic cells should receive a suitable activation signal, and (iii) activated tumor antigen-loaded dendritic cells must generate T-cell mediated immune responses in the lymphoid organs.
- multi-epitopic antigen delivery provides an advantage.
- protein based vaccines allow multi-epitopic antigen delivery to antigen presenting cells (APCs) such as dendritic cells (DCs) without the limitation of restriction to a single MHC allele.
- APCs antigen presenting cells
- DCs dendritic cells
- Another strength is long-lasting epitope presentation recently described in dendritic cells loaded with proteins (van Montfoort N, Camps M G, Khan S, Filippov D V, Weterings J J, Griffith J M, et al.
- Antigen storage compartments in mature dendritic cells facilitate prolonged cytotoxic T lymphocyte cross-priming capacity.
- proteins require uptake and processing by DCs to achieve MHC restricted presentation of their constituent epitopes. This reduces the risk of inducing peripheral tolerance as has been shown after vaccination with short peptides that do not have such stringent processing requirements (Toes R E, Offringa R, Blom R J, Melief C J, Kast W M. Peptide vaccination can lead to enhanced tumor growth through specific T-cell tolerance induction. Proceedings of the National Academy of Sciences of the United States of America 1996; 93(15):7855-60).
- peptide-pulsed DCs as vaccines have several limitations. For example, peptide degradation, rapid MHC class I turnover, and the disassociation of peptide from MHC class I molecules during the preparation and injection of DC/peptides may result in short half-lives of MHC class I/peptide complexes on the DC surface, leading to weak T-cell responses.
- Cell penetrating peptides are peptides of 8 to 40 residues that have the ability to cross the cell membrane and enter into most cell types (Copolovici D M, Langel K, Eriste E, Langel U. Cell-penetrating peptides: design, synthesis, and applications. ACS nano 2014; 8(3):1972-94, Milletti F.
- Cell-penetrating peptides classes, origin, and current landscape. Drug Discov Today 2012). Alternatively, they are also called protein transduction domain (PTDs) reflecting their origin as occurring in natural proteins.
- PTDs protein transduction domain
- Several potent CPPs have been identified from proteins, including the Tat protein of human immunodeficiency virus, the VP22 protein of herpes simplex virus, and fibroblast growth factor (Berry C C. Intracellular delivery of nanoparticles via the HIV-1 tat peptide. Nanomedicine. 2008; 3:357-365; Deshayes S, Morris M C, Divita G, Heitz F. Cell-penetrating peptides: Tools for intracellular delivery of therapeutics. Cell Mol Life Sci.
- T-cell activity elicited by DC/TAT-TRP2 was 3- to 10-fold higher than that induced by DUTRP2 (Wang H Y, Fu T, Wang G, Gang Z, Donna M P L, Yang J C, Restifo N P, Hwu P, Wang R F. Induction of CD4+ T cell-dependent antitumor immunity by TAT-mediated tumor antigen delivery into dendritic cells. J Clin Invest. 2002a; 109:1463-1470).
- subunits vaccines are poorly immunogenic. Therefore in the context of therapeutic cancer vaccine, a potent adjuvant is mandatory to be added to the vaccine in order to increase the level of co-stimulatory molecules on DCs and therefore augment the immune system's response to the target antigens.
- Adjuvants accomplish this task by mimicking conserved microbial components that are naturally recognized by the immune system. They include, lipopolysaccharide (LPS), components of bacterial cell walls, and nucleic acids such as double-stranded RNA (dsRNA), single-stranded DNA (ssDNA), and unmethylated CpG dinucleotide-containing DNA. Their presence together with the vaccine can greatly increase the innate immune response to the antigen.
- LPS lipopolysaccharide
- dsRNA double-stranded RNA
- ssDNA single-stranded DNA
- unmethylated CpG dinucleotide-containing DNA unmethylated CpG dinucleotide-containing DNA.
- this adjuvant should promote an adaptive immune response with CTLs and type polarized Th1 rather than a humoral immune response resulting in antibody production.
- Different adjuvants have been evaluated, with a limited number having gained regulatory approval for human use. These include Alum, MPL (monophosphoryl lipid A) and ASO 4 (Alum and MPL) in the US, and MF59 (oil-in-water emulsion), ASO 4 liposomes in Europe (Lim, Y. T., Vaccine adjuvant materials for cancer immunotherapy and control of infectious disease. Clin Exp Vaccine Res, 2015. 4(1): p. 54-8).
- TLR Toll Like Receptor
- TLR-3 poly I:C
- TLR-4 monophosphoryl lipid A
- MPL monophosphoryl lipid A
- TLR-5 flagellin
- TLR-7 imiquimod
- TLR-9 CpG
- TLR ligand-peptide conjugate vaccines toward clinical application. Adv Immunol. 2012; 114:177-201).
- TLR ligands for conjugate vaccine are the TLR2 agonist Pam2Cys and Pam3Cys (Fujita, Y. and H. Taguchi, Overview and outlook of Toll - like receptor ligand - antigen conjugate vaccines . Ther Deliv, 2012. 3(6): p. 749-60).
- T h cells are involved in the maintenance of long-lasting cellular immunity and tumor infiltration by T h cells is also an essential step for the recruitment and function of CD8 + CTLs.
- Immunological memory is essential to protect against tumor relapse.
- the term “comprise”, and variations such as “comprises” and “comprising”, will be understood to imply the inclusion of a stated member, integer or step but not the exclusion of any other non-stated member, integer or step.
- the term “consist of” is a particular embodiment of the term “comprise”, wherein any other non-stated member, integer or step is excluded. In the context of the present invention, the term “comprise” encompasses the term “consist of”.
- the term “comprising” thus encompasses “including” as well as “consisting” e.g., a composition “comprising” X may consist exclusively of X or may include something additional e.g., X+Y.
- the present invention provides a complex comprising:
- Such a complex for use according to the present invention provides simultaneous (i) stimulation of multi-epitopic cytotoxic T cell-mediated immunity, (ii) induction of T i , cells and (iii) promotion of immunological memory.
- a complex for use according to the present invention provides a potent vaccine, in particular having improved anti-tumor activity.
- the complex for use according to the present invention is a polypeptide or a protein, in particular a recombinant polypeptide or a recombinant protein, preferably a recombinant fusion protein or a recombinant fusion polypeptide.
- recombinant as used herein means that it (here: the polypeptide or the protein) does not occur naturally.
- the complex for use according to the present invention which is a recombinant polypeptide or a recombinant protein, typically comprises components a) to c), wherein components a) to c) are of different origins, i.e. do not naturally occur in this combination.
- peptide refers to peptide, oligopeptide, oligomer or protein including fusion protein, respectively, comprising at least two amino acids joined to each other preferably by a normal peptide bond, or, alternatively, by a modified peptide bond, such as for example in the cases of isosteric peptides.
- a peptide, polypeptide or protein can be composed of L-amino acids and/or D-amino acids.
- a peptide, polypeptide or protein is either (entirely) composed of L-amino acids or (entirely) of D-amino acids, thereby forming “retro-inverso peptide sequences”.
- the term “retro-inverso (peptide) sequences” refers to an isomer of a linear peptide sequence in which the direction of the sequence is reversed and the chirality of each amino acid residue is inverted (see e.g. Jameson et al., Nature, 368, 744-746 (1994); Brady et al., Nature, 368, 692-693 (1994)).
- peptide in particular, the terms “peptide”, “polypeptide”, “protein also include “peptidomimetics” which are defined as peptide analogs containing non-peptidic structural elements, which peptides are capable of mimicking or antagonizing the biological action(s) of a natural parent peptide.
- a peptidomimetic lacks classical peptide characteristics such as enzymatically scissile peptide bonds.
- a peptide, polypeptide or protein can comprise amino acids other than the 20 amino acids defined by the genetic code in addition to these amino acids, or it can be composed of amino acids other than the 20 amino acids defined by the genetic code.
- a peptide, polypeptide or protein in the context of the present invention can equally be composed of amino acids modified by natural processes, such as post-translational maturation processes or by chemical processes, which are well known to a person skilled in the art. Such modifications are fully detailed in the literature. These modifications can appear anywhere in the polypeptide: in the peptide skeleton, in the amino acid chain or even at the carboxy- or amino-terminal ends.
- a peptide or polypeptide can be branched following an ubiquitination or be cyclic with or without branching. This type of modification can be the result of natural or synthetic post-translational processes that are well known to a person skilled in the art.
- peptide in the context of the present invention in particular also include modified peptides, polypeptides and proteins.
- peptide, polypeptide or protein modifications can include acetylation, acylation, ADP-ribosylation, amidation, covalent fixation of a nucleotide or of a nucleotide derivative, covalent fixation of a lipid or of a lipidic derivative, the covalent fixation of a phosphatidylinositol, covalent or non-covalent cross-linking, cyclization, disulfide bond formation, demethylation, glycosylation including pegylation, hydroxylation, iodization, methylation, myristoylation, oxidation, proteolytic processes, phosphorylation, prenylation, racemization, seneloylation, sulfatation, amino acid addition such as arginylation or ubiquitination.
- the complex for use according to the present invention is a “classical” peptide, polypeptide or protein, whereby a “classical” peptide, polypeptide or protein is typically composed of amino acids selected from the 20 amino acids defined by the genetic code, linked to each other by a normal peptide bond.
- the complex for use according to the present invention is a polypeptide or a protein, it is preferred that it comprises at least 50, at least 60, at least 70, preferably at least 80, at least 90, more preferably at least 100, at least 110, even more preferably at least 120, at least 130, particularly preferably at least 140, or most preferably at least 150 amino acid residues.
- the CPP allows for efficient delivery, i.e. transport and loading, in particular of at least one antigen or antigenic epitope, into the antigen presenting cells (APCs), in particular into the dendritic cells (DCs) and thus to the dendritic cells' antigen processing machinery.
- APCs antigen presenting cells
- DCs dendritic cells
- CPPs cell penetrating peptides
- Cell penetrating peptides is generally used to designate short peptides that are able to transport different types of cargo molecules across plasma membrane, and, thus, facilitate cellular uptake of various molecular cargoes (from nanosize particles to small chemical molecules and large fragments of DNA).
- Cellular internalization of the cargo molecule linked to the cell penetrating peptide generally means transport of the cargo molecule across the plasma membrane and thus entry of the cargo molecule into the cell.
- the cargo molecule can, then, be released in the cytoplasm, directed to an intracellular organelle, or further presented at the cell surface.
- Cell penetrating ability, or internalization, of the cell penetrating peptide or complex comprising said cell penetrating peptide, according to the invention can be checked by standard methods known to one skilled in the art, including flow cytometry or fluorescence microscopy of live and fixed cells, immunocytochemistry of cells transduced with said peptide or complex, and Western blot.
- Cell penetrating peptides typically have an amino acid composition that either contains a high relative abundance of positively charged amino acids such as lysine or arginine or have a sequence that contains an alternating pattern of polar/charged amino acids and non-polar, hydrophobic amino acids. These two types of structures are referred to as polycationic or amphipathic, respectively.
- Cell-Penetrating peptides are of different sizes, amino acid sequences, and charges but all CPPs have a common characteristic that is the ability to translocate the plasma membrane and facilitate the delivery of various molecular cargoes to the cytoplasm or to an organelle of a cell.
- CPP translocation distinguish three main entry mechanisms: direct penetration in the membrane, endocytosis-mediated entry, and translocation through the formation of a transitory structure.
- CPP transduction is an area of ongoing research.
- Cell-penetrating peptides have found numerous applications in medicine as drug delivery agents in the treatment of different diseases including cancer and virus inhibitors, as well as contrast agents for cell labeling and imaging.
- cell penetrating peptides are peptides of 8 to 50 residues that have the ability to cross the cell membrane and enter into most cell types. Alternatively, they are also called protein transduction domain (PTDs) reflecting their origin as occurring in natural proteins. Frankel and Pabo simultaneously to Green and Lowenstein described the ability of the trans-activating transcriptional activator from the human immunodeficiency virus 1 (HIV-TAT) to penetrate into cells (Frankel, A. D. and C.O. Pabo, Cellular uptake of the tat protein from human immunodeficiency virus. Cell, 1988. 55(6): p. 1189-93).
- HAV-TAT human immunodeficiency virus 1
- the first 16-mer peptide CPP called Penetratin having the amino acid sequence RQIKIYFQNRRMKWKK (SEQ ID NO: 1) was characterized from the third helix of the homeodomain of Antennapedia (Derossi, D., et al., The third helix of the Antennapedia homeodomain translocates through biological membranes. J Biol Chem, 1994. 269(14): p. 10444-50), followed in 1998 by the identification of the minimal domain of TAT, having the amino acid sequence YGRKKRRQRRR (SEQ ID NO: 2) required for protein transduction (Vives, E., P. Brodin, and B.
- venoms e.g. melittin (Dempsey, C. E., The actions of melittin on membranes. Biochim Biophys Acta, 1990. 1031(2): p. 143-61), mastoporan (Konno, K., et al., Structure and biological activities of eumenine mastoparan-AF (EMP-AF), a new mast cell degranulating peptide in the venom of the solitary wasp (Anterhynchium flavomarginatum micado). Toxicon, 2000. 38(11): p.
- maurocalcin Esteve, E., et al., Transduction of the scorpion toxin maurocalcine into cells. Evidence that the toxin crosses the plasma membrane. J Biol Chem, 2005. 280(13): p. 12833-9
- crotamine Nascimento, F. D., et al., Crotamine mediates gene delivery into cells through the binding to heparan sulfate proteoglycans. J Biol Chem, 2007. 282(29): p. 21349-60
- buforin Kobayashi, S., et al., Membrane translocation mechanism of the antimicrobial peptide buforin 2. Biochemistry, 2004.
- CPPs were also designed including the poly-arginine (R8, R9, R10 and R12) (Futaki, S., et al., Arginine-rich peptides. An abundant source of membrane-permeable peptides having potential as carriers for intracellular protein delivery. Biol Chem, 2001. 276(8): p. 5836-40) or transportan (Pooga, M., et al., Cell penetration by transportan. FASEB J, 1998. 12(1): p. 67-77). Any of the above described CPPs may be used as cell penetrating peptide, i.e. as component a), in the complex for use according to the present invention.
- the component a), i.e. the CPP, in the complex for use according to the present invention may comprise the minimal domain of TAT, having the amino acid sequence YGRKKRRQRRR (SEQ ID NO: 2).
- the component a), i.e. the CPP, in the complex for use according to the present invention may comprise Penetratin having the amino acid sequence RQIKIYFQNRRMKWKK (SEQ ID NO: 1).
- CPPs which can be used as cell penetrating peptide, i.e. as component a), in the complex for use according to the present invention, are also disclosed in the review: Milletti, F., Cell-penetrating peptides: classes, origin, and current landscape. Drug Discov Today 17 (15-16): 850-60, 2012. In other words, the CPPs disclosed in Milletti, F., 2012, Cell-penetrating peptides: classes, origin, and current landscape. Drug Discov Today 17 (15-16): 850-60 can be used as cell penetrating peptide, i.e. as component a), in the complex for use according to the present invention.
- the cell penetrating peptide which is comprised by the complex for use according to the present invention
- the cell penetrating peptide which is comprised by the complex for use according to the present invention,
- ZEBRA also known as Zta, Z, EB1, or BZLF1 generally means the basic-leucine zipper (bZIP) transcriptional activator of the Epstein-Barr virus (EBV).
- bZIP basic-leucine zipper
- EBV Epstein-Barr virus
- the amino acid sequence of ZEBRA is disclosed under NCBI accession number YP_401673 and comprises 245 amino acids represented in SEQ ID NO: 3:
- such a CPP can deliver multi-epitopic peptides to dendritic cells (DCs), and subsequently to promote CTL and Th cell activation and anti-tumor function.
- DCs dendritic cells
- Such a CPP can thus efficiently deliver the complex for use according to the present invention to antigen presenting cells (APCs) and lead to multi-epitopic MHC class I and II restricted presentation.
- APCs antigen presenting cells
- MHC class I designates one of the two primary classes of the Major Histocompatibility Complex molecules.
- the MHC class I (also noted “MHC I”) molecules are found on every nucleated cell of the body.
- the function of MHC class I is to display an epitope to cytotoxic cells (CTLs).
- CTLs cytotoxic cells
- MHC class I molecules consist of two polypeptide chains, ⁇ - and ⁇ 2-microglobulin (b2m). Only the ⁇ chain is polymorphic and encoded by a HLA gene, while the b2m subunit is not polymorphic and encoded by the Beta-2 microglobulin gene.
- MHC class II designates the other primary class of the Major Histocompatibility Complex molecules.
- the MHC class II also noted “MHC II” molecules are found only on a few specialized cell types, including macrophages, dendritic cells and B cells, all of which are dedicated antigen-presenting cells (APCs).
- APCs dedicated antigen-presenting cells
- the sequence variant of a fragment of the minimal domain of ZEBRA as described above shares, in particular over the whole length, at least 70%, at least 75%, preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, particularly preferably at least 95%, most preferably at least 99% amino acid sequence identity with the fragment of the minimal domain of ZEBRA as described above without abrogating the cell penetrating ability of the cell penetrating peptide.
- a “fragment” of the minimal domain of ZEBRA as defined above is preferably to be understood as a truncated sequence thereof, i.e.
- an amino acid sequence which is N-terminally, C-terminally and/or intrasequentially truncated compared to the amino acid sequence of the native sequence.
- a “fragment” of the minimal domain of ZEBRA has preferably a length of 5 to 50 amino acids in total, preferably of 10 to 45 amino acids in total, more preferably of 15 to 45 amino acids in total.
- sequence variant refers to any alteration in a reference sequence.
- sequence variant includes nucleotide sequence variants and amino acid sequence variants.
- a reference sequence is any of the sequences listed in the “Table of Sequences and SEQ ID Numbers” (Sequence listing), i.e. SEQ ID NO: 1 to SEQ ID NO: 94.
- a sequence variant shares, in particular over the whole length of the sequence, at least 70%, at least 75%, preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, particularly preferably at least 95%, most preferably at least 99% sequence identity with a reference sequence, whereby sequence identity is calculated as described below.
- a sequence variant preserves the specific function of the reference sequence. Sequence identity is calculated as described below.
- an amino acid sequence variant has an altered sequence in which one or more of the amino acids in the reference sequence is deleted or substituted, or one or more amino acids are inserted into the sequence of the reference amino acid sequence.
- the amino acid sequence variant has an amino acid sequence which is at least 70%, at least 75%, preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, particularly preferably at least 95%, most preferably at least 99% identical to the reference sequence.
- variant sequences which are at least 90% identical have no more than 10 alterations, i.e. any combination of deletions, insertions or substitutions, per 100 amino acids of the reference sequence.
- an amino acid sequence “sharing a sequence identity” of at least, for example, 95% to a query amino acid sequence of the present invention is intended to mean that the sequence of the subject amino acid sequence is identical to the query sequence except that the subject amino acid sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence.
- up to 5% (5 of 100) of the amino acid residues in the subject sequence may be inserted or substituted with another amino acid or deleted, preferably within the above definitions of variants or fragments.
- nucleic acid sequences also applies similarly to nucleic acid sequences.
- a “% identity” of a first sequence may be determined with respect to a second sequence.
- these two sequences to be compared are aligned to give a maximum correlation between the sequences. This may include inserting “gaps” in either one or both sequences, to enhance the degree of alignment.
- a % identity may then be determined over the whole length of each of the sequences being compared (so-called global alignment), that is particularly suitable for sequences of the same or similar length, or over shorter, defined lengths (so-called local alignment), that is more suitable for sequences of unequal length.
- programs available in the Wisconsin Sequence Analysis Package, version 9.1 may be used to determine the % identity between two polynucleotides and the % identity and the % homology or identity between two polypeptide sequences.
- BESTFIT uses the “local homology” algorithm of (Smith and Waterman (1981), J. Mol. Biol. 147, 195-197.) and finds the best single region of similarity between two sequences.
- the fragments of the cell penetrating peptide according to the invention or the variants thereof as described above further retain said peptide's ability to present a cargo molecule such as antigens or antigenic epitopes at the surface of a cell, such as an antigen-presenting cell, in the context of MHC class I and/or MHC class II molecules.
- a cargo molecule such as antigens or antigenic epitopes at the surface of a cell, such as an antigen-presenting cell, in the context of MHC class I and/or MHC class II molecules.
- a cell penetrating peptide or complex comprising said cell penetrating peptide to present a cargo molecule such as antigens or antigenic epitopes at the surface of a cell in the context of MHC class I and/or MHC class II molecules can be checked by standard methods known to one skilled in the art, including capacity to stimulate proliferation and/or function of MHC-restricted CD4 + or CD8 + T cells with specificity for these epitopes.
- substitutions for one or more amino acids present in the referenced amino acid sequence should be made conservatively.
- conservative substitutions include substitution of one aliphatic residue for another, such as Ile, Val, Leu, or Ala for one another, or substitutions of one polar residue for another, such as between Lys and Arg; Glu and Asp; or Gln and Asn.
- Other such conservative substitutions for example, substitutions of entire regions having similar hydrophobicity properties, are well known (Kyte and Doolittle, 1982 , J. Mot. Biol. 157(0:105-134.
- Substitutions of one or more L-amino acids with one or more D-amino acids are to be considered as conservative substitutions in the context of the present invention.
- Exemplary amino acid substitutions are presented in Table 1 below:
- the preferred cell penetrating peptide which
- such a preferred cell penetrating peptide has an amino acid sequence comprising a sequence according to the following general formula (I):
- such a peptide, polypeptide or protein is either (entirely) composed of L-amino acids or (entirely) of D-amino acids, thereby forming “retro-inverso peptide sequences”.
- the term “retro-inverso (peptide) sequences” refers to an isomer of a linear peptide sequence in which the direction of the sequence is reversed and the chirality of each amino acid residue is inverted (see e.g. Jameson et al., Nature, 368, 744-746 (1994); Brady et at, Nature, 368, 692-693 (1994)).
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 1 is K.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 2 is R.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 3 is Y.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 4 is K.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 5 is N.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 6 is R.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 7 is V.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 8 is A.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 9 is S.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 10 is R.
- the cell penetrating !peptide according to the invention is as generically defined above by general formula (I), wherein X 11 is K.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 13 is R.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 14 is A.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 15 is K.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 16 is F.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein X 17 is K.
- the cell penetrating peptide according to the invention is as generically defined above by general formula (I), wherein the amino acid at position equivalent to position 12 relative to general formula (I) is a Ser (S).
- a cell penetrating peptide which has an amino acid sequence comprising or consisting of an amino acid sequence according to SEQ ID NO: 6 (CPP3/Z13), SEQ ID NO: 7 (CPP4/Z14), SEQ ID NO: 8 (CPP5/Z15), or SEQ ID NO: 11 (CPP8/Z18), or sequence variants thereof without abrogating said peptide's cell penetrating ability, preferably sequence variants having 0, 1, 2, 3, 4, or 5 amino acids substituted, deleted and/or added without abrogating said peptide's cell penetrating ability.
- a cell penetrating peptide is more preferred, which has an amino acid sequence comprising or consisting of an amino acid sequence according to SEQ ID NO: 6 (CPP3/Z13) or SEQ ID NO: 7 (CPP4/Z14) or sequence variants thereof without abrogating said peptide's cell penetrating ability, preferably sequence variants having 0, 1, 2, 3, 4, or 5 amino acids substituted, deleted and/or added without abrogating said peptide's cell penetrating ability.
- a cell penetrating peptide which has an amino acid sequence comprising or consisting of an amino acid sequence according to SEQ ID NO: 6 (CPP3/Z13) or sequence variants thereof without abrogating said peptide's cell penetrating ability, preferably sequence variants having 0, 1, 2, 3, 4, or 5 amino acids substituted, deleted and/or added without abrogating said peptide's cell penetrating ability.
- the cell penetrating peptide comprises or consists of a peptide having an amino acid sequence according to SEQ ID NO: 6 (CPP3/Z13) or a functional sequence variant thereof having at least 70% sequence identity, preferably at least 75% sequence identity, more preferably at least 80% sequence identity, even more preferably at least 85% sequence identity, still more preferably at least 90% sequence identity, particularly preferably at least 95% sequence identity, most preferably at least 99% sequence identity.
- a “functional sequence variant” is a sequence variant wherein said peptide's cell penetrating ability is maintained.
- the cell penetrating peptide according to the invention has an amino acid sequence comprising or consisting of SEQ ID NO: 6 (CPP3/Z13).
- the cell penetrating peptide according to the invention has an amino acid sequence comprising or consisting of SEQ ID NO: 7 (CPP4/Z14).
- the cell penetrating peptide according to the invention has an amino acid sequence comprising or consisting of SEQ ID NO: 8 (CPP5/Z15).
- the cell penetrating peptide according to the invention has an amino acid sequence comprising or consisting of SEQ ID NO: 11 (CPP8/Z18).
- the primary amino acid sequence of the cell penetrating peptide of the invention may further be post-translationally modified, such as by glycosylation or phosphorylation, without departing from the invention.
- the cell penetrating peptide according to the invention optionally further comprises, in addition to its amino acid sequence as described above, any one of, or any combination of:
- the cell penetrating peptide according to the invention is linked to an antigen or antigenic epitope and facilitates the cellular internalization of said antigen or antigenic epitope.
- the complex for use according to the present invention may comprise one single cell penetrating peptide or more than one cell penetrating peptides.
- the complex for use according to the present invention comprises no more than five cell penetrating peptides, more preferably the complex for use according to the present invention comprises no more than four cell penetrating peptides, even more preferably the complex for use according to the present invention comprises no more than three cell penetrating peptides, particularly preferably the complex for use according to the present invention comprises no more than two cell penetrating peptides and most preferably the complex for use according to the present invention comprises one single cell penetrating peptide.
- the complex for use according to the present invention comprises as component b) at least one antigen or antigenic epitope.
- an “antigen” is any structural substance which serves as a target for the receptors of an adaptive immune response, in particular as a target for antibodies, T cell receptors, and/or B cell receptors.
- An “epitope”, also known as “antigenic determinant”, is the part (or fragment) of an antigen that is recognized by the immune system, in particular by antibodies, T cell receptors, and/or B cell receptors.
- one antigen has at least one epitope, i.e. a single antigen has one or more epitopes.
- epitope is mainly used to designate T cell epitopes, which are presented on the surface of an antigen-presenting cell, where they are bound to Major Histocompatibility Complex (MHC).
- MHC Major Histocompatibility Complex
- T cell epitopes presented by MHC class I molecules are typically, but not exclusively, peptides between 8 and 11 amino acids in length, whereas MHC class II molecules present longer peptides, generally, but not exclusively, between 12 and 25 amino acids in length.
- the at least one antigen or antigenic epitope is selected from the group consisting of: (i) a peptide, a polypeptide, or a protein, (ii) a polysaccharide, (iii) a lipid, (iv) a lipoprotein or a lipopeptide, (v) a glycolipid, (vi) a nucleic acid, and (vii) a small molecule drug or a toxin.
- the at least one antigen or antigenic epitope may be a peptide, a protein, a polysaccharide, a lipid, a combination thereof including lipoproteins and glycolipids, a nucleic acid (e.g. DNA, siRNA, shRNA, antisense oligonucleotides, decoy DNA, plasmid), or a small molecule drug (e.g. cyclosporine A, paclitaxel, doxorubicin, methotrexate, 5-aminolevulinic acid), or any combination thereof in particular if more than one antigen or antigenic epitope is comprised by the inventive complex.
- a nucleic acid e.g. DNA, siRNA, shRNA, antisense oligonucleotides, decoy DNA, plasmid
- a small molecule drug e.g. cyclosporine A, paclitaxel, doxorubicin, methotrexate, 5-aminolevul
- the at least one antigen or antigenic epitope can comprise for example at least one, i.e. one or more, peptides, polypeptides or proteins linked together and/or at least one, i.e. one or more, nucleic acids, e.g. where each one encodes one peptide or polypeptide.
- the at least one antigen or antigenic epitope can be a combination of a protein, a lipid, and/or a polysaccharide including lipoproteins and glycolipids.
- the complex for use according to the present invention comprises more than one antigen or antigenic epitope
- it can comprise more than one peptide, polypeptide, or protein, more than one polysaccharide, more than one lipid, more than one lipoprotein, more than one glycolipid, more than one nucleic acid, more than one small molecule drug or toxin, or a combination thereof.
- the complex for use according to the invention comprises at least one antigen or antigenic epitope comprising one or more epitope(s) from a cancer/tumor-associated antigen, a cancer/tumor-specific antigen, and/or an antigenic protein from a pathogen, including viral, bacterial, fungal, protozoal and multicellular parasitic antigenic protein.
- a cancer/tumor-associated antigen e.g., a cancer/tumor-specific antigen
- an antigenic protein from a pathogen including viral, bacterial, fungal, protozoal and multicellular parasitic antigenic protein.
- the at least one antigen or antigenic epitope comprises or consists of (i) at least one pathogen epitope and/or (ii) at least one cancer/tumor epitope, in particular at least one tumor epitope.
- the at least one antigen or antigenic epitope comprises or consists of at least one cancer/tumor epitope, in particular at least one tumor epitope.
- the complex for use according to the present invention comprises only such antigen(s) or antigenic epitope(s), which are cancer/tumor-associated antigen(s), cancer/tumor-specific antigen(s) and/or cancer/tumor epitope(s); in particular, which are tumor-associated antigen(s), tumor-specific antigen(s), and/or tumor epitope(s).
- cancer epitope means an epitope from a cancer-associated antigen or from a cancer-specific antigen.
- tumor epitope means an epitope from a tumor-associated antigen or from a tumor-specific antigen.
- Such epitopes are typically specific (or associated) for a certain kind of cancer/tumor.
- cancer/tumor-associated (also cancer/tumor-related) antigens are antigens, which are expressed by both, cancer/tumor cells and normal cells. Accordingly, those antigens are normally present since birth (or even before). Accordingly, there is a chance that the immune system developed self-tolerance to those antigens.
- Cancer/tumor-specific antigens are antigens, which are expressed specifically by cancer/tumor cells, but not by normal cells. Cancer/tumor-specific antigens include in particular neoantigens. In general neoantigens are antigens, which were not present before and are, thus, “new” to the immune system. Neoantigens are typically due to somatic mutations. In the context of cancer/tumors, cancer/tumor-specific neoantigens were typically not present before the cancer/tumor developed and cancer/tumor-specific neoantigens are usually encoded by somatic gene mutations in the cancerous cells/tumor cells.
- cancer/tumor-specific antigens in particular neoantigens, are identified in a subject diagnosed with colorectal cancer by methods known to the skilled person, e.g., cancer genome sequencing. After identification, the respective cancer/tumor-specific neoantigens and/or cancer/tumor-specific neoantigenic epitopes are used in a complex for use according to the present invention.
- a complex for use according to the present invention comprises one or more cancer/tumor-associated epitopes and/or one or more cancer/tumor-associated antigens (but preferably no cancer/tumor-specific epitopes). It is also preferred that a complex for use according to the present invention comprises one or more cancer/tumor-specific epitopes and/or one or more cancer/tumor-specific antigens (but preferably no cancer/tumor-associated epitopes).
- a complex for use according to the present invention may also preferably comprise both, (i) one or more cancer/tumor-associated epitopes and/or one or more cancer/tumor-associated antigens and (ii) one or more cancer/tumor-specific epitopes and/or one or more cancer/tumor-specific antigens.
- the cancer/tumor with which the antigens or antigenic epitopes are associated or for which the antigens or antigenic epitopes are specific is colorectal cancer as described herein.
- the antigens are preferably CRC-associated or CRC-specific antigens and the epitopes are preferably CRC-associated or CRC-specific epitopes.
- Suitable cancer/tumor epitopes can be retrieved for example from cancer/tumor epitope databases, e.g. from van der Bruggen P, Stroobant V, Vigneron N, Van den Eynde B.
- Peptide database T cell-defined tumor antigens. Cancer Immun 2013; URL: http://www.cancerimmunity.org/peptide/, wherein human tumor antigens recognized by CD4+ or CD8+ T cells are classified into four major groups on the basis of their expression pattern, or from the database “Tantigen” (TANTIGEN version 1.0, Dec.
- cancer/tumor epitopes include e.g. TRP2-derived epitopes, glycoprotein 100 (gp100) melanoma antigen-derived epitopes, glycoprotein 70 (gp70) antigen-derived epitopes, survivin epitopes, IEa epitopes, IL13r ⁇ 2, Epha2 (ephrin type-A receptor 2), immunogenic fragments thereof, and fusions of such antigens and/or fragments.
- cancer/tumor epitopes include epitopes of neoantigens, such as, for example, a neoantigen from MC-38 tumor cell line as described by Yadav et al. Nature. 2014 Nov. 27; 515(7528):572-6.
- neoantigens are antigens, which are entirely absent from the normal human genome.
- neoantigens are of relevance to tumor control, as the quality of the T cell pool that is available for these antigens is not affected by central T cell tolerance.
- neoantigens may be based on individual tumor genomes. Potential neoantigens may be predicted by methods known to the skilled person, such as cancer genome sequencing or deep-sequencing technologies identifying mutations within the protein-coding part of the (cancer) genome.
- cancer/tumor-associated, in particular tumor-related, or tissue-specific antigens useful in a complex for use according to the present invention include, but are not limited to, the following antigens: Her-2/neu, SPAS-1, TRP-2, tyrosinase, Melan A/Mart-1, gplOO, BAGE, GAGE, GM2 ganglioside, kinesin 2, TATA element modulatory factor 1, tumor protein D52, MAGE D, ING2, HIP-55, TGF-1 anti-apoptotic factor, HOM-Mel-40/SSX2, epithelial antigen (LEA 135), DF31MUC1 antigen (Apostolopoulos et al., 1996 Immunol. Cell.
- EGP40 epithelial glycoprotein 40
- SCC squamous cell carcinoma antigen
- cathepsin E Mota et al., 1997, Am. J Pathol. 150: 1223-1229
- tyrosinase in melanoma Fishman et al., 1997 Cancer 79: 1461-1464
- PCNA cell nuclear antigen
- Vaccines (2002)1:49-63 CT9, CT10, Cyp-B, Dek-cain, DAM-6 (MAGE-B2), DAM-10 (MAGE-B1), EphA2 (Zantek et al., Cell Growth Differ. (1999) 10:629-38; Carles-Kinch et al., Cancer Res. (2002) 62:2840-7), EphA4 (Cheng at al., 2002, Cytokine Growth Factor Rev. 13:75-85), tumor associated Thomsen-Friedenreich antigen (Dahlenborg et al., 1997, Int.
- cancer/tumor-associated, in particular tumor-related, or tissue-specific antigen useful in a complex for use according to the present invention is the antigen ASCL2 (Achaete-scute homolog 2).
- ASCL2 Achaete-scute homolog 2
- Numerous other cancer antigens are well known in the art.
- the cancer/tumor antigen or the cancer/tumor epitope is a recombinant cancer/tumor antigen or a recombinant cancer/tumor epitope.
- a recombinant cancer/tumor antigen or a recombinant cancer/tumor epitope may be designed by introducing mutations that change (add, delete or substitute) particular amino acids in the overall amino acid sequence of the native cancer/tumor antigen or the native cancer/tumor epitope.
- the introduction of mutations does not alter the cancer/tumor antigen or the cancer/tumor epitope so much that it cannot be universally applied across a mammalian subject, and preferably a human or dog subject, but changes it enough that the resulting amino acid sequence breaks tolerance or is considered a foreign antigen in order to generate an immune response.
- Another manner may be creating a consensus recombinant cancer/tumor antigen or cancer/tumor epitope that has at least 85% and up to 99% amino acid sequence identity to its' corresponding native cancer/tumor antigen or native cancer/tumor epitope; preferably at least 90% and up to 98% sequence identity; more preferably at least 93% and up to 98% sequence identity; or even more preferably at least 95% and up to 98% sequence identity.
- the recombinant cancer/tumor antigen or the recombinant cancer/tumor epitope has 95%, 96%, 97%, 98%, or 99% amino acid sequence identity to its' corresponding native cancer/tumor antigen or cancer/tumor epitope.
- the native cancer/tumor antigen is the antigen normally associated with the particular cancer or cancer tumor.
- the consensus sequence of the cancer/tumor antigen can be across mammalian species or within subtypes of a species or across viral strains or serotypes. Some cancer/tumor antigen do not vary greatly from the wild type amino acid sequence of the cancer/tumor antigen.
- the aforementioned approaches can be combined so that the final recombinant cancer/tumor antigen or cancer/tumor epitope has a percent similarity to native cancer antigen amino acid sequence as discussed above.
- the amino acid sequence of an epitope of a cancer/tumor antigen as described herein is not mutated and, thus, identical to the reference epitope sequence.
- pathogen epitope means an epitope from an antigenic protein, an antigenic polysaccharide, an antigenic lipid, an antigenic lipoprotein or an antigenic glycolipid from a pathogen including viruses, bacteria, fungi, protozoa and multicellular parasites.
- Antigenic proteins, polysaccharides, lipids, lipoproteins or glycolipids from pathogens include, herewith, proteins, polysaccharides, lipids, lipoproteins and glycolipids, respectively, from pathogens responsible of diseases which can be a target for vaccination including, for instance, Amoebiasis, Anthrax, Buruli Ulcer ( Mycobacterium ulcerans ), Caliciviruses associated diarrhoea, Campylobacter diarrhoea, Cervical Cancer (Human papillomavirus), Chlamydia trachomatis associated genital diseases, Cholera, Crimean-Congo haemorrhagic fever, Dengue Fever, Diptheria, Ebola haemorrhagic fever, Enterotoxigenic Escherichia coli (ETEC) diarrhoea, Gastric Cancer ( Helicobacter pylori ), Gonorrhea, Group A Streptococcus associated diseases, Group
- the at least one antigen or antigenic epitope will be presented at the cell surface in an MHC class I and/or MHC class II context and/or in a CD1 context, whereby presentation at the cell surface in an MHC class I and/or MHC class II context is preferred.
- the phrase “epitope presentation in the MHC class I context” refers in particular to a CD8 + epitope lying in the groove of a MHC class I molecule at the surface of a cell.
- the phrase “epitope presentation in the MHC class II context” refers in particular to a CD4 + epitope lying in the groove of a MHC class II molecule at the surface of a cell.
- the phrase “epitope presentation in the CD1 context” refers in particular to a lipidic epitope lying in the groove of a cluster of differentiation 1 molecule at the surface of a cell.
- the complex for use according to the invention comprises a cell penetrating peptide and at least one antigen or antigenic epitope, and allows the transport and presentation of said epitopes at the cell surface of antigen presenting cells in an MHC class I and MHC class II context, and is, thus, useful in vaccination and immunotherapy.
- the complex for use according to the present invention comprises at least one antigen or antigenic epitope, which is at least one CD4 + epitope and/or at least one CD8 + epitope.
- CD4 + epitope or “CD4 + -restricted epitope”, as used herein, designate an epitope recognized by a CD4 + T cell, said epitope in particular consisting of an antigen fragment lying in the groove of a MHC class II molecule.
- a single CD4 + epitope comprised in the complex for use according to the present invention preferably consists of about 12-25 amino acids. It can also consist of, for example, about 8-25 amino acids or about 6-100 amino acids.
- CD8 + epitope or “CD8 + -restricted epitope”, as used herein, designate an epitope recognized by a CD8 + T cell, said epitope in particular consisting of an antigen fragment lying in the groove of a MHC class I molecule.
- a single CD8 + epitope comprised in the complex for use according to the present invention preferably consists of about 8-11 amino acids. It can also consist of, for example, about 8-15 amino acids or about 6-100 amino acids.
- the at least one antigen can comprise or the at least one antigenic epitope can consist of a CD4 + epitope and/or a CD8 + epitope corresponding to antigenic determinant(s) of a cancer/tumor-associated antigen, a cancer/tumor-specific antigen, or an antigenic protein from a pathogen. More preferably, the at least one antigen can comprise or the at least one antigenic epitope can consist of a CD4 + epitope and/or a CD8 + epitope corresponding to antigenic determinant(s) of a cancer/tumor-associated antigen or a cancer/tumor-specific antigen.
- the at least one antigen can comprise or the at least one antigenic epitope can consist of a CD4 + epitope and/or a CD8 + epitope corresponding to antigenic determinant(s) of a tumor-associated antigen or a tumor-specific antigen.
- the complex for use according to the present invention comprises at least two antigens or antigenic epitopes, wherein at least one antigen or antigenic epitope comprises or consists a CD4 + epitope and at least one antigen or antigenic epitope comprises or consists a CD8 + epitope.
- a complex for use according to the present invention comprising at least two antigens or antigenic epitopes, wherein at least one antigen or antigenic epitope comprises or consists of a CD4 + epitope and at least one antigen or antigenic epitope comprises or consists a CD8 + epitope, provides an integrated immune response allowing simultaneous priming of CTLs and T h cells and is thus preferable to immunity against only one CD8 + epitope or only one CD4 + epitope.
- the complex for use according to the present invention may preferably comprise an Ealpha-CD4 + epitope and a gp100-CD8 + epitope.
- the complex for use according to the present invention comprises at least two antigens or antigenic epitopes, wherein the at least two antigens or antigenic epitopes comprise or consist of at least two, e.g. 2, 3, 4, 5, 6, 7, 8, 9, or more, CD4 + epitopes and/or at least two, e.g. 2, 3, 4, 5, 6, 7, 8, 9, or more, CD8 + epitopes.
- the at least two antigens or antigenic epitopes are preferably different antigens or antigenic epitopes, more preferably the at least two antigens or antigenic epitopes are different from each other but relating to the same kind of tumor.
- a multi-antigenic vaccine will (i) avoid outgrowth of antigen-loss variants, (ii) target different tumor cells within a heterogeneous tumor mass and (iii) circumvent patient-to-patient tumor variability.
- the complex for use according to the present invention particularly preferably comprises at least four antigens or antigenic epitopes, in particular with at least two CD8 + epitopes and at least two CD4 + epitopes.
- Such a complex for use according to the present invention induces multi-epitopic CD8 CTLs and CD4 T h cells to function synergistically to counter tumor cells and promote efficient anti-tumor immunity. T h cells are also involved in the maintenance of long-lasting cellular immunity that was monitored after vaccination.
- Such a complex for use according to the present invention induces polyclonal, multi-epitopic immune responses and poly-functional CD8 + and CD4 + T cells, and thus efficacious anti-tumor activity.
- the complex for use according to the present invention comprises at least two antigens or antigenic epitopes, more preferably the complex for use according to the present invention comprises at least three antigens or antigenic epitopes, even more preferably the complex for use according to the present invention comprises at least four antigens or antigenic epitopes, particularly preferably the complex for use according to the present invention comprises at least five antigens or antigenic epitopes and most preferably the complex for use according to the present invention comprises at least six antigens or antigenic epitopes.
- the antigens or antigenic epitopes comprised by the complex for use according to the present invention may be the same or different, preferably the antigens or antigenic epitopes comprised by the complex for use according to the present invention are different from each other.
- the complex for use according to the present invention comprises at least one CD4 + epitope and at least one CD8 + epitope.
- the complex for use according to the present invention comprises more than one CD4 + epitope, e.g. two or more CD4 + epitopes from the same antigen or from different antigens, and preferably no CD8 + epitope. It is also preferred that the complex for use according to the present invention comprises more than one CD8 + epitope, e.g. two or more CD8 + epitopes from the same antigen or from different antigens, and preferably no CD4 + epitope. Most preferably, however, the complex for use according to the present invention comprises (i) at least one CD4 + epitope, e.g.
- CD4 + epitopes from the same antigen or from different antigens
- CD8 + epitope e.g. two or more CD8 + epitopes from the same antigen or from different antigens.
- the complex for use according to the present invention may preferably comprise a gp100-CD8 + epitope, an Ealpha-CD4 + epitope, and a further CD4 + epitope and a further CD8 + epitope.
- the complex for use according to the present invention may comprise a polypeptide or protein comprising a gp100-CD8 + epitope and an Ealpha-CD4 + epitope.
- such a polypeptide or protein comprised by the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 14 or sequence variants thereof as defined above:
- the complex for use according to the present invention may also comprise a gp70-CD8 + epitope and/or a gp70-CD4 + epitope.
- the complex for use according to the present invention may comprise a polypeptide or protein comprising a gp70-CD8 + epitope and/or a gp70-CD4 + epitope.
- such a polypeptide or protein comprised by the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 43 or sequence variants thereof as defined above:
- the complex for use according to the present invention may preferably comprise at least one survivin epitope, such as a survivin CD8 + epitope and/or a survivin CD4 + epitope. More preferably, the complex for use according to the present invention may comprise a polypeptide or protein comprising a survivin CD8 + epitope and/or a survivin CD4 + epitope. More preferably, the complex for use according to the present invention may comprise a polypeptide or protein comprising more than one survivin CD8 + epitope and/or more than one survivin CD4 + epitope, such as two different survivin CD8 + epitopes. For example, such a polypeptide or protein comprised by the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 44 or sequence variants thereof as defined above:
- the complex for use according to the present invention may preferably comprise an epitope from a neoantigen.
- the complex for use according to the present invention may comprise a polypeptide or protein comprising an epitope from a neoantigen, such as the neoantigen from MC-38 tumor cell line identified by Yadav et al. Nature. 2014 Nov. 27; 515(7528):572-6.
- a polypeptide or protein comprised by the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 42 or sequence variants thereof as defined above:
- the complex for use according to the present invention may preferably comprise more than one, e.g. two or three, epitopes from neoantigens.
- the complex for use according to the present invention may comprise a polypeptide or protein comprising more than one, e.g. two or three, epitopes from neoantigens, such as the neoantigens from MC-38 tumor cell line identified by Yadav et al. Nature. 2014 Nov. 27; 515(7528):572-6.
- a polypeptide or protein comprised by the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 63 or sequence variants thereof as defined above:
- the at least one antigen or antigenic epitope comprised by the complex for use according to the present invention is a peptide, polypeptide, or a protein.
- antigen or antigenic epitope of peptidic, polypeptidic, or proteic nature useful in the invention include cancer/tumor antigens or antigenic epitopes thereof, allergy antigens or antigenic epitopes thereof, auto-immune self-antigens or antigenic epitopes thereof, pathogenic antigens or antigenic epitopes thereof, and antigens or antigenic epitopes thereof from viruses, preferably from cytomegalovirus (CMV), orthopox variola virus, orthopox alastrim virus, parapox ovis virus, molluscum contagiosum virus, herpes simplex virus 1, herpes simplex virus 2, herpes B virus, varicella zoster virus, pseudorabies virus, human cytomegaly virus, human herpes virus 6, human herpes virus 7,
- CMV
- human immunodeficiency virus type 1 or human immunodeficiency virus type 2 influenza virus, Lassa virus, lymphocytic choriomeningitis virus, Tacaribe virus, Junin virus, Machupo virus, Borna disease virus, Bunyamwera virus, California encephalitis virus, Rift Valley fever virus, sand fly fever virus, Toscana virus, Crimean-Congo haemorrhagic fever virus, Hazara virus, Khasan virus, Hantaan virus, Seoul virus, Prospect Hill virus, Puumala virus, Dobrava Belgrade virus, Tula virus, sinari virus, Lake Victoria Marburg virus, Zaire Ebola virus, Sudan Ebola virus, Ivory Coast Ebola virus, influenza virus A, influenza virus B, influenza viruses C, parainfluenza virus, malaria parasite ( Plasmodium falciparum, Plasmodium vivax, Plasmodium ovale, Plasmodium malariae, Plasmodium knowlesi ), Marburg virus, meas
- epitopes as well as variants of antigens as defined above exhibit a sequence homology or identity of about 10%, in particular at least 10%, about 20%, in particular at least 20%, about 30%, in particular at least 30%, about 40%, in particular at least 40%, about 50%, in particular at least 50%, about 60%, in particular at least 60%, about 70%, in particular at least 70%, about 80%, in particular at least 80%, about 90% in particular at least 90%, at least 95% or at least 98% with one of the antigens or antigen sequences as shown or described above.
- epitopes and variants similarly applies as defined.
- antigens or antigenic epitopes in the category of peptide, polypeptide or protein include a combination of multiple glioma epitopes such as those described in Novellino et al. (2005, Cancer Immunol Immunother, 54(3):187-207), Vigneron et al. (2013 , Cancer Immun. 13:15).
- a single complex for use according to the present invention may also comprise only a subset, i.e. one or more of all of said glioma epitopes.
- different complexes according to the present invention comprise different subsets of all of said glioma epitopes, so that for example a vaccine according to the present invention comprising such different complexes according to the present invention comprises all of said glioma epitopes but distributed in the different complexes.
- a complex for use according to the invention may also comprise at least one antigen or antigenic epitope, wherein said antigen or antigenic epitope is a polysaccharide, a lipid, a lipoprotein, and/or a glycolipid, in particular a polysaccharidic, lipidic, lipoproteic, and/or glycolipidic epitope, which can be, for example, pathogen epitopes as defined herewith.
- said antigen or antigenic epitope is a polysaccharide, a lipid, a lipoprotein, and/or a glycolipid, in particular a polysaccharidic, lipidic, lipoproteic, and/or glycolipidic epitope, which can be, for example, pathogen epitopes as defined herewith.
- the complex for use according to the invention may comprise at least one antigen or antigenic epitope, wherein said antigen or antigenic epitope is polysaccharidic, lipidic, lipoproteic, and/or glycolipidic, including viral, bacterial, fungal, protozoal and multicellular parasitic antigens or antigenic epitopes.
- said epitopes will be presented at the cell surface in an MHC class I and/or MHC class II context.
- said lipidic epitopes will be presented at the cell surface in a CD1 (cluster of differentiation 1) context.
- the complex for use according to the present invention may also comprise at least one antigen or antigenic epitope, wherein said antigen or antigenic epitope is a small molecule drug or toxin.
- cargo molecules within the category of small molecule drugs or toxins useful in the invention include cyclosporine A, paclitaxel, doxorubicin, methotrexate, 5-aminolevulinic acid, diphtheria toxin, sunitinib and those molecules reviewed in De wit Amer (2010, Neuro Oncol, 12(3):304-16).
- the complex for use according to the present invention comprises at least one antigen or antigenic epitope, preferably the complex for use according to the present invention comprises more than one antigen or antigenic epitope, in particular 2, 3, 4, 5, 6, 7, 8, 9, 10 or more antigens or antigenic epitopes, more preferably the complex for use according to the present invention comprises (at least) two or three antigens or antigenic epitopes, even more preferably the complex for use according to the present invention comprises (at least) four or five antigens or antigenic epitopes.
- antigen or antigenic epitope is comprised by the complex for use according to the present invention it is understood that said antigen or antigenic epitope is in particular also covalently linked in the complex for use according to the present invention, e.g. to another antigen or antigenic epitope and/or to a component a), i.e. a cell penetrating peptide, and/or to a component c), i.e. a TLR peptide agonist.
- the various antigens or antigenic epitopes comprised by the complex for use according to the present invention may be the same or different.
- the various antigens or antigenic epitopes comprised by the complex for use according to the present invention are different from each other, thus providing a multi-antigenic and/or multi-epitopic complex.
- the more than one antigen or antigenic epitope in particular 2, 3, 4, 5, 6, 7, 8, 9, 10 or more antigens or antigenic epitopes, are positioned consecutively in the complex for use according to the present invention.
- all antigens and/or antigenic epitopes comprised by the complex are positioned in a stretch, which is neither interrupted by component a), i.e. a cell penetrating peptide, nor by component c), i.e. a TLR peptide agonist.
- component a) and component c) are positioned in the complex for example before or after such a stretch of all antigens and/or antigenic epitopes.
- the antigens and/or antigenic epitopes positioned consecutively in such a way may be linked to each other for example by a spacer or linker as described below, which is neither component a), i.e. a cell penetrating peptide, nor component c), i.e. a TLR peptide agonist.
- the complex for use according to the present invention comprises one or more epitopes of an antigen.
- the complex preferably comprises one or more epitopes of one or more antigens.
- the complex may comprise one or more epitopes of a first antigen and one or more epitopes of a second antigen; or the complex may comprise one or more epitopes of a first antigen, one or more epitopes of a second antigen, and one or more epitopes of a third antigen; or the complex may comprise one or more epitopes of a first antigen, one or more epitopes of a second antigen, one or more epitopes of a third antigen, and one or more epitopes of a fourth antigen; and so on.
- the complex comprises more than one epitope of one or more antigens; more preferably the antigenic epitopes of the same antigen are positioned consecutively (or overlapping) in the complex for use according to the present invention.
- all antigenic epitopes of the same antigen comprised by the complex are positioned in a stretch, which is neither interrupted by component a), i.e. a cell penetrating peptide, nor by component c), i.e. a TLR peptide agonist, nor by any other antigenic epitopes (i.e. epitopes from another antigen).
- the various antigens and/or antigenic epitopes may also be positioned in any other way in the complex for use according to the present invention, for example with component a) and/or component c) positioned in between two or more antigens and/or antigenic epitopes, i.e. with one or more antigens and/or antigenic epitopes positioned between component a) and component c) (or vice versa) and, optionally, one or more antigens and/or antigenic epitopes positioned at the respective other end of component a) and/or component c).
- a number of different antigens or antigenic epitopes relating to colorectal cancer may be advantageously comprised by a single complex for use according to the present invention.
- a number of different antigens or antigenic epitopes relating to colorectal cancer may be distributed to subsets of different antigens or antigenic epitopes, in particular subsets complementing each other in the context of colorectal cancer which are comprised by different complexes according to the present invention, whereby such different complexes comprising different subsets may advantageously be administered simultaneously, e.g. in a single vaccine, to a subject in need thereof.
- the complex for use according to the present invention comprises at least one tumor epitope, which is an epitope of an antigen selected from the group consisting of EpCAM, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, CEA, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART and IL13Ralpha2.
- an antigen selected from the group consisting of EpCAM, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, CEA, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART and IL13Ralpha2.
- the complex for use according to the present invention comprises at least one tumor epitope, which is an epitope of an antigen selected from the group consisting of ASCL2, EpCAM, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, CEA, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART and IL13Ralpha2.
- an antigen selected from the group consisting of ASCL2, EpCAM, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, CEA, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART and IL13Ralpha2.
- an antigen selected from the group consisting of ASCL2, EpCAM, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, CE
- the complex for use according to the present invention comprises at least one tumor antigen selected from the group consisting of EpCAM, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, CEA, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART and IL13Ralpha2, or a fragment thereof, or a sequence variant of a tumor antigen or a sequence variant of a fragment thereof.
- the tumor antigen selected from the group consisting of EpCAM, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, CEA, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART and IL13Ralpha2, or a fragment thereof, or a sequence variant of a tumor antigen or a sequence variant of a fragment thereof.
- the complex for use according to the present invention comprises at least one tumor antigen selected from the group consisting of ASCL2, EpCAM, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, CEA, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART and IL13Ralpha2, or a fragment thereof, or a sequence variant of a tumor antigen or a sequence variant of a fragment thereof.
- tumor antigen selected from the group consisting of ASCL2, EpCAM, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, CEA, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART and IL13Ralpha2, or a fragment thereof, or a sequence variant of a tumor antigen or a sequence variant of a fragment thereof.
- a “fragment” of an antigen comprises at least 10 consecutive amino acids of the antigen, preferably at least 15 consecutive amino acids of the antigen, more preferably at least 20 consecutive amino acids of the antigen, even more preferably at least 25 consecutive amino acids of the antigen and most preferably at least 30 consecutive amino acids of the antigen.
- a “sequence variant” is as defined above, namely a sequence variant has an (amino acid) sequence which is at least 70%, preferably at least 75%, more preferably at least 80%, even preferably at least 85%, still more preferably at least 90%, particularly preferably at least 95%, most preferably at least 99% identical to the reference sequence.
- a “functional” sequence variant means in the context of an antigen/antigen fragment/epitope, that the function of the epitope(s), e.g. comprised by the antigen (fragment), is not impaired or abolished.
- the amino acid sequence of the epitope(s), e.g. comprised by the cancer/tumor antigen (fragment) as described herein is not mutated and, thus, identical to the reference epitope sequence.
- cancer/tumor epitopes of those antigens are known from the literature or can be identified by using cancer/tumor epitope databases, e.g. from van der Bruggen P, Stroobant V, Vigneron N, Van den Eynde B.
- Peptide database T cell-defined tumor antigens. Cancer Immun 2013; URL: http://www.cancerimmunity.org/peptide/, wherein human tumor antigens recognized by CD4 + or CD8 + T cells are classified into four major groups on the basis of their expression pattern, or from the database “Tantigen” (TANTIGEN version 1.0, Dec. 1, 2009; developed by Bioinformatics Core at Cancer Vaccine Center, Dana-Farber Cancer Institute; URL: http://cvc.dfci.harvard.edu/tadb/).
- Ep-Cam is a glycoprotein mediating cellular adhesion.
- the amino acid sequence of EpCAM is shown in the following:
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 47 or a fragment or a variant thereof as described herein.
- a preferred EpCAM epitope which is preferably comprised by the complex for use according to the present invention, includes the following epitope (the epitope sequence shown in the following is a fragment of the above EpCAM sequence and is, thus, shown in the above EpCAM sequence underlined; the following epitope sequence may refer to one epitope or more than one (overlapping) epitopes):
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 48 or a fragment or a variant thereof as described herein.
- Her-2 belongs to the EGFR (epidermal growth factor receptor) family. Many HLA-A epitopes are known to the skilled person.
- the amino acid sequence of HER2 is shown in the following:
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 70 or a fragment or a variant thereof as described herein.
- suitable cancer/tumor epitopes of Her-2 are known from the literature or can be identified by using cancer/tumor epitope databases, e.g. from van der Bruggen P, Stroobant V, Vigneron N, Van den Eynde B.
- Peptide database T cell-defined tumor antigens.
- Cancer Immun 2013 http://www.cancerimmunity.org/peptide/, wherein human tumor antigens recognized by CD4+ or CD8+ T cells are classified into four major groups on the basis of their expression pattern, or from the database “Tantigen” (TANTIGEN version 1.0, Dec. 1, 2009; developed by Bioinformatics Core at Cancer Vaccine Center, Dana-Farber Cancer Institute; URL: http://cvc.dfci.harvard.edu/tadb/).
- MUC-1 is a human epithelial mucin, acting on cell adhesion.
- the amino acid sequence of MUC-1 is shown in the following:
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 49 or a fragment or a variant thereof as described herein.
- MUC-1 epitopes which are preferably comprised by the complex for use according to the present invention, include the following epitopes (the epitope sequences shown in the following are fragments of the above MUC-1 sequence and are, thus, shown in the above MUC-1 sequence underlined; each of the following epitope sequences may refer to one epitope or more than one (overlapping) epitopes):
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 50 and/or an amino acid sequence according to SEQ ID NO: 51.
- TOMM34 is involved in the import of precursor proteins into mitochondria. Many epitopes thereof are known to the skilled person.
- RNF43 is a RING-type E3 ubiquitin ligase and is predicted to contain a transmembrane domain, a protease-associated domain, an ectodomain, and a cytoplasmic RING domain. RNF43 is thought to negatively regulate Wnt signaling, and expression of RNF43 results in an increase in ubiquitination of frizzled receptors, an alteration in their subcellular distribution, resulting in reduced surface levels of these receptors. Many epitopes thereof are known to the skilled person.
- KOC1 also known as insulin-like growth factor 2 mRNA-binding protein 3 (IGF2BP3) is an mRNA binding protein. No expression data are however available.
- VEGF Vascular Endothelial Growth Factor
- VAGFR Vascular Endothelial Growth Factor Receptor
- VEGF Vascular endothelial growth factor
- VGF vascular permeability factor
- Human chorionic gonadotropin is a hormone produced by the embryo following implantation. Some cancerous tumors produce this hormone; therefore, elevated levels measured when the patient is not pregnant can lead to a cancer diagnosis.
- hCG is heterodimeric with an a (alpha) subunit identical to that of luteinizing hormone (LH), follicle-stimulating hormone (FSH), thyroid-stimulating hormone (TSH), and ⁇ (beta) subunit that is unique to hCG.
- LH luteinizing hormone
- FSH follicle-stimulating hormone
- TSH thyroid-stimulating hormone
- ⁇ (beta) subunit that is unique to hCG.
- the ⁇ -subunit of hCG gonadotropin (beta-hCG) contains 145 amino acids and is encoded by six highly homologous genes.
- Survivin also called baculoviral inhibitor of apoptosis repeat-containing 5 or BIRC5
- BIRC5 baculoviral inhibitor of apoptosis repeat-containing 5
- the survivin protein functions to inhibit caspase activation, thereby leading to negative regulation of apoptosis or programmed cell death.
- the amino acid sequence of survivin is shown in the following:
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 52 or a fragment or a variant thereof as described herein.
- a preferred survivin epitope which is preferably comprised by the complex for use according to the present invention, includes the following epitope (the epitope sequence shown in the following is a fragment of the above survivin sequence and is, thus, shown in the above survivin sequence underlined; the following epitope sequence may refer to one epitope or more than one (overlapping) epitopes):
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 53.
- the complex for use according to the present invention comprises an epitope of survivin. More preferably, the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 52, or a fragment thereof having a length of at least 10 amino acids (preferably at least 15 amino acids, more preferably at least 20 amino acids, even more preferably at least 25 amino acids and most preferably at least 30 amino acids), or a functional sequence variant thereof having at least 70% sequence identity (preferably at least 75%, more preferably at least 80%, even preferably at least 85%, still more preferably at least 90%, particularly preferably at least 95%, most preferably at least 99% sequence identity). Even more preferably, the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 53.
- the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 95 or a functional sequence variant thereof having at least 70% sequence identity (preferably at least 75%, more preferably at least 80%, even preferably at least 85%, still more preferably at least 90%, particularly preferably at least 95%, most preferably at least 99% sequence identity).
- CEA Carcina-Embryonic Antigen
- CEA is an intracellular adhesion glycoprotein.
- CEA is normally produced in gastrointestinal tissue during fetal development, but the production stops before birth. Therefore, CEA is usually present only at very low levels in the blood of healthy adults.
- the amino acid sequence of CEA is shown in the following:
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 54 or a fragment or a variant thereof as described herein.
- CEA epitopes which are preferably comprised by the complex for use according to the present invention, include the following epitopes (the epitope sequences shown in the following are fragments of the above CEA sequence and are, thus, shown in the above CEA sequence underlined; each of the following epitope sequences may refer to one epitope or more than one (overlapping) epitopes):
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 55 and/or an amino acid sequence according to SEQ ID NO: 56.
- the complex for use according to the present invention comprises an epitope of CEA. More preferably, the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 54, or a fragment thereof having a length of at least 10 amino acids (preferably at least 15 amino acids, more preferably at least 20 amino acids, even more preferably at least 25 amino acids and most preferably at least 30 amino acids), or a functional sequence variant thereof having at least 70% sequence identity (preferably at least 75%, more preferably at least 80%, even preferably at least 85%, still more preferably at least 90%, particularly preferably at least 95%, most preferably at least 99% sequence identity).
- the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 55 and/or a peptide having an amino acid sequence according to SEQ ID NO: 56.
- the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 96 or a functional sequence variant thereof having at least 70% sequence identity (preferably at least 75%, more preferably at least 80%, even preferably at least 85%, still more preferably at least 90%, particularly preferably at least 95%, most preferably at least 99% sequence identity).
- TGF ⁇ R2 Transforming Growth Factor Beta Receptor 2 (TGF ⁇ R2)
- TGF ⁇ receptors are single pass serine/threonine kinase receptors. They exist in several different isoforms.
- TGF ⁇ R2 is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation.
- P53 is a tumor suppressor protein having a role in preventing genome mutation.
- P53 has many mechanisms of anticancer function and plays a role in apoptosis, genomic stability, and inhibition of angiogenesis. In its anti-cancer role, p53 works through several mechanisms: it an activate DNA repair proteins when DNA has sustained damage; it can arrest growth by holding the cell cycle at the G1/S regulation point on DNA damage recognition; and it can initiate apoptosis.
- KRas also known as V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog and KRAS, performs an essential function in normal tissue signaling, and the mutation of a KRAS gene is an essential step in the development of many cancers.
- the KRAS protein is a GTPase and is an early player in many signal transduction pathways.
- KRAS is usually tethered to cell membranes because of the presence of an isoprene group on its C-terminus.
- the amino acid sequence of KRas is shown in the following:
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 57 or a fragment or a variant thereof as described herein.
- a preferred Kirsten Ras epitope which is preferably comprised by the complex for use according to the present invention, includes the following epitope (the epitope sequence shown in the following is a fragment of the above Kirsten Ras sequence and is, thus, shown in the above Kirsten Ras sequence underlined; the following epitope sequence may refer to one epitope or more than one (overlapping) epitopes):
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 58.
- OGT O-Linked N-Acetylglucosamine (GlcNAc) Transferase, O-GlcNAc transferase, OGTase, O-linked N-acetylglucosaminyltransferase, uridine diphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyltransferase, protein O-linked beta-N-acetylglucosamine transferase) is an enzyme with system name UDP-N-acetyl-D-glucosamine:protein-O-beta-N-acetyl-D-glucosaminyl transferase) is an enzyme with system name “UDP-N-acetyl-D-glucosamine:protein-O-beta-N-acetyl-D-glucosaminyl transferase”.
- OGT catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues of intracellular proteins.
- OGT is a part of a host of biological functions within the human body.
- OGT is involved in the resistance of insulin in muscle cells and adipocytes by inhibiting the Threonine 308 phosphorylation of AKT1, increasing the rate of IRS1 phosphorylation (at Serine 307 and Serine 632/635), reducing insulin signaling, and glycosylating components of insulin signals. Additionally, OGT catalyzes intracellular glycosylation of serine and threonine residues with the addition of N-acetylglucosamine.
- OGT alleles are vital for embryogenesis, and that OGT is necessary for intracellular glycosylation and embryonic stem cell vitality.
- OGT also catalyzes the posttranslational modification that modifies transcription factors and RNA polymerase II, however the specific function of this modification is mostly unknown.
- GASPS Caspase 5
- Caspase 5 is an enzyme that proteolytically cleaves other proteins at an aspartic acid residue, and belongs to a family of cysteine proteases called caspases. It is an inflammatory caspase, along with caspase 1, caspase 4 and the murine caspase 4 homolog caspase 11, and has a role in the immune system.
- COA-1 Colorectal Tumor-Associated Antigen-1
- COA-1 was identified in 2003 by Maccalli et al. (Maccalli, C., et al., Identification of a colorectal tumor - associated antigen ( COA -1) recognized by CD 4(+) T lymphocytes . Cancer Res, 2003. 63(20): p. 6735-43) as strongly expressed by colorectal and melanoma cells (no data available). Its mutation may interfere with the differential recognition of tumor and normal cells.
- the complex for use according to the present invention preferably comprises an antigen of the MAGE-family (a “MAGE” antigen) or an epitope thereof.
- MAGE-A3 and MAGE-D4 are preferred, and MAGE-A3 is particularly preferred.
- the normal function of MAGE-A3 in healthy cells is unknown.
- MAGE-A3 is a tumor-specific protein, and has been identified on many tumors.
- the amino acid sequence of MAGE-A3 is shown in the following:
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 59.
- a preferred MAGE-A3 epitope which is preferably comprised by the complex for use according to the present invention, includes the following epitope (the epitope sequence shown in the following is a fragment of the above MAGE-A3 sequence and is, thus, shown in the above MAGE-A3 sequence underlined; the following epitope sequence may refer to one epitope or more than one (overlapping) epitopes):
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 60.
- the complex for use according to the present invention preferably comprises an antigen of the SART-family (a “SART” antigen) or an epitope thereof; the complex for use according to the present invention more preferably comprises SART-3 or an epitope thereof.
- SART antigen of the SART-family
- Squamous cell carcinoma antigen recognized by T-cells 3 possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients.
- SART-3 is thought to be involved in the regulation of mRNA splicing.
- IL13Ralpha2 binds interleukin 13 (IL-13) with very high affinity (and can therefore sequester it) but does not allow IL-4 binding. It acts as a negative regulator of both IL-13 and IL-4, however the mechanism of this is still undetermined.
- the amino acid sequence of IL13Ralpha2 is shown in the following:
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 61 or a fragment or a variant thereof as described herein.
- a preferred IL13Ralpha2 epitope which is preferably comprised by the complex for use according to the present invention, includes the following epitope (the epitope sequence shown in the following is a fragment of the above IL13Ralpha2 sequence and is, thus, shown in the above IL13Ralpha2 sequence underlined; the following epitope sequence may refer to one epitope or more than one (overlapping) epitopes):
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 62.
- ASCL2 is a basic helix-loop-helix transcription factor essential for the maintenance of proliferating trophoblasts during placental development. ASCL2 was found to be a putative regulator of proliferation that is overexpressed in intestinal neoplasia.
- the amino acid sequence of ASCL2 is shown in the following:
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 92 or a fragment or a variant thereof as described herein.
- ASCL2 epitopes which are preferably comprised by the complex for use according to the present invention, include the following epitopes (the epitope sequences shown in the following are fragments of the above ASCL2 sequence and are, thus, shown in the above ASCL2 sequence underlined; each of the following epitope sequences may refer to one epitope or more than one (overlapping) epitopes):
- a preferred complex for use according to the present invention comprises an amino acid sequence according to SEQ ID NO: 93 and/or an amino acid sequence according to SEQ ID NO: 94.
- the complex for use according to the present invention comprises an epitope of ASCL2. More preferably, the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 92, or a fragment thereof having a length of at least 10 amino acids (preferably at least 15 amino acids, more preferably at least 20 amino acids, even more preferably at least 25 amino acids and most preferably at least 30 amino acids), or a functional sequence variant thereof having at least 70% sequence identity (preferably at least 75%, more preferably at least 80%, even preferably at least 85%, still more preferably at least 90%, particularly preferably at least 95%, most preferably at least 99% sequence identity).
- the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 93 and/or a peptide having an amino acid sequence according to SEQ ID NO: 94.
- the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 97 or a functional sequence variant thereof having at least 70% sequence identity (preferably at least 75%, more preferably at least 80%, even preferably at least 85%, still more preferably at least 90%, particularly preferably at least 95%, most preferably at least 99% sequence identity).
- the complex for use according to the present invention comprises at least one tumor epitope, which is an epitope of an antigen selected from the group consisting of EpCAM, MUC-1, survivin, CEA, KRas, MAGE-A3 and IL13Ralpha2, such as an epitope according to any of SEQ ID NOs 48, 50, 51, 53, 55, 56, 58, 60 and 62;
- the complex for use according to the present invention comprises at least one tumor epitope, which is an epitope of an antigen selected from the group consisting of EpCAM, MUC-1, survivin, CEA, KRas, MAGE-A3, IL13Ralpha2, and ASCL2, such as an epitope according to any of SEQ ID NOs 48, 50, 51, 53, 55, 56, 58, 60, 62, 93 and 94; more preferably the at least one tumor epitope is an epitope of an antigen selected from the group consisting of EpCAM, MUC-1, survivin, CE
- the complex for use according to the present invention comprises
- the complex for use according to the present invention comprises
- cancer/tumor epitope databases e.g. from van der Bruggen P, Stroobant V, Vigneron N, Van den Eynde B.
- Peptide database T cell-defined tumor antigens. Cancer Immun 2013; URL: http://www.cancerimmunity.org/peptide/, or from the database “Tantigen” (TANTIGEN version 1.0, Dec. 1, 2009; developed by Bioinformatics Core at Cancer Vaccine Center, Dana-Farber Cancer Institute; URL: http://cvc.dfci.harvard.edu/tadb/).
- a “sequence variant” is as defined above, namely a sequence variant has an (amino acid) sequence which is at least 70%, at least 75%, preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, particularly preferably at least 95%, most preferably at least 99% identical to the reference sequence.
- a “functional” sequence variant means in the context of an epitope, that the function as an epitope is not impaired or abolished.
- the amino acid sequence of an epitope of a cancer/tumor antigen as described herein is not mutated and, thus, identical to the reference epitope sequence.
- the complex for use according to the present invention comprises
- the complex for use according to the present invention comprises
- a “fragment” of an antigen comprises at least 10 consecutive amino acids of the antigen, preferably at least 15 consecutive amino acids of the antigen, more preferably at least 20 consecutive amino acids of the antigen, even more preferably at least 25 consecutive amino acids of the antigen and most preferably at least 30 consecutive amino acids of the antigen.
- a fragment of EpCAM comprises at least 10 consecutive amino acids of EpCAM (SEQ ID NO: 47), preferably at least 15 consecutive amino acids of EpCAM (SEQ ID NO: 47), more preferably at least 20 consecutive amino acids of EpCAM (SEQ ID NO: 47), even more preferably at least 25 consecutive amino acids of EpCAM (SEQ ID NO: 47) and most preferably at least 30 consecutive amino acids of EpCAM (SEQ ID NO: 47);
- a fragment of MUC-1 comprises at least 10 consecutive amino acids of MUC-1 (SEQ ID NO: 49), preferably at least 15 consecutive amino acids of MUC-1 (SEQ ID NO: 49), more preferably at least 20 consecutive amino acids of MUC-1 (SEQ ID NO: 49), even more preferably at least 25 consecutive amino acids of MUC-1 (SEQ ID NO: 49) and most preferably at least 30 consecutive amino acids of MUC-1 (SEQ ID NO: 49);
- a fragment of survivin comprises at least 10 consecutive amino acids of survivin (SEQ ID NO: 52), preferably at least 15 consecutive amino acids
- a fragment of ASCL2 comprises at least 10 consecutive amino acids of ASCL2 (SEQ ID NO: 92), preferably at least 15 consecutive amino acids of ASCL2 (SEQ ID NO: 92), more preferably at least 20 consecutive amino acids of ASCL2 (SEQ ID NO: 92), even more preferably at least 25 consecutive amino acids of ASCL2 (SEQ ID NO: 92) and most preferably at least 30 consecutive amino acids of ASCL2 (SEQ ID NO: 92).
- a functional sequence variant of such a fragment has an (amino acid) sequence, which is at least 70%, at least 75%, preferably at least 80%, more preferably at least 85%, even more preferably at least 90%, particularly preferably at least 95%, most preferably at least 99% identical to the reference sequence, and the epitope function of at least one, preferably all, epitope(s) comprised by the fragment is maintained.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, SART or IL13Ralpha2. More preferably, such a complex does not comprise any epitope of ASCL2, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, SART or IL13Ralpha2. More preferably, such a complex does not comprise any epitope of ASCL2, HER-2, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TGF ⁇ R2, p53, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2. More preferably, such a complex does not comprise any epitope of ASCL2, HER-2, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TGF ⁇ R2, p53, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, SART or IL13Ralpha2. More preferably, such a complex does not comprise any epitope of ASCL2, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of EpCAM, HER-2, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, CEA, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, SART or IL13Ralpha2. More preferably, such a complex does not comprise any epitope of ASCL2, EpCAM, HER-2, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, CEA, TGF ⁇ R2, p53, KRas, OGT, GASPS, COA-1, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2. More preferably, such a complex does not comprise any epitope of ASCL2, HER-2, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2. More preferably, such a complex does not comprise any epitope of ASCL2, HER-2, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- such a complex comprises
- CEA one or more epitopes of CEA (such as the epitope according to SEQ ID NO: 55 and/or the epitope according to SEQ ID NO: 56) or functional sequence variants thereof.
- Such a complex does preferably not comprise any epitope of HER-2, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2. More preferably, such a complex does not comprise any epitope of ASCL2, HER-2, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, EpCAM, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- the complex comprises in N- to C-terminal direction:
- Such a complex does preferably not comprise any epitope of HER-2, EpCAM, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2
- the complex comprises in N- to C-terminal direction:
- Such a complex does preferably not comprise any further antigen or further epitopes of antigens other than CEA, survivin and ASCL2, more preferably such a complex does not comprise any other (tumor) epitope.
- the C-terminus of (i) the peptide having an amino acid sequence according to SEQ ID NO: 54 or the fragment or variant thereof is directly linked to the N-terminus of (ii) the peptide having an amino acid sequence according to SEQ ID NO: 52 or the fragment or variant thereof; and the C-terminus of (ii) the peptide having an amino acid sequence according to SEQ ID NO: 52 or the fragment or variant thereof is directly linked to the N-terminus of (iii) the peptide having an amino acid sequence according to SEQ ID NO: 92 or the fragment or variant thereof.
- the complex comprises in N- to C-terminal direction:
- Such a complex does preferably not comprise any further antigen or further epitopes of antigens other than CEA, survivin and ASCL2, more preferably such a complex does not comprise any other (tumor) epitope.
- the C-terminus of (i) the peptide having an amino acid sequence according to SEQ ID NO: 96 or the variant thereof is directly linked to the N-terminus of (ii) the peptide having an amino acid sequence according to SEQ ID NO: 95 or the variant thereof; and the C-terminus of (ii) the peptide having an amino acid sequence according to SEQ ID NO: 95 or the variant thereof is directly linked to the N-terminus of (iii) the peptide having an amino acid sequence according to SEQ ID NO: 97 or the variant thereof.
- the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 98 or a functional sequence variant thereof having at least 70% sequence identity (preferably at least 75%, more preferably at least 80%, even preferably at least 85%, still more preferably at least 90%, particularly preferably at least 95%, most preferably at least 99% sequence identity).
- a complex does preferably not comprise any further antigen or further epitopes of antigens other than CEA, survivin and ASCL2, more preferably such a complex does not comprise any other (tumor) epitope.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2. More preferably, such a complex does not comprise any epitope of ASCL2, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, MUC-1, CEA, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, EpCAM, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, MUC-1, EpCAM, CEA, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of ASCL2, HER-2, EpCAM, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, CEA, TGF ⁇ R2, p53, KRas, OGT, GASPS, COA-1, MAGE, SART or IL13Ralpha2. More preferably, such a complex does not comprise any epitope of ASCL2, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, CEA, TGF ⁇ R2, p53, KRas, OGT, GASPS, COA-1, MAGE, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of EpCAM, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2. More preferably, such a complex does not comprise any epitope of ASCL2, EpCAM, HER-2, MUC-1, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TGF ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- such a complex comprises
- Such a complex does preferably not comprise any epitope of EpCAM, HER-2, MUC-1, CEA, TOMM34, RNF 43, KOC1, VEGFR, ⁇ hCG, survivin, TG ⁇ R2, p53, KRas, OGT, CASP5, COA-1, MAGE, SART or IL13Ralpha2.
- the TLR peptide agonist allows an increased targeting of the vaccine towards dendritic cells along with self-adjuvancity.
- Physical linkage of a TLR peptide agonist to the CPP and the at least one antigen or antigenic epitope according to the present invention in the complex for use according to the present invention provides an enhanced immune response by simultaneous stimulation of antigen presenting cells, in particular dendritic cells, that internalize, metabolize and display antigen(s).
- a “TLR peptide agonist” is an agonist of a Toll-like receptor (TLR), i.e. it binds to a TLR and activates the TLR, in particular to produce a biological response.
- TLR peptide agonist is a peptide, a polypeptide or a protein as defined above.
- the TLR peptide agonist comprises from 10 to 150 amino acids, more preferably from 15 to 130 amino acids, even more preferably from 20 to 120 amino acids, particularly preferably from 25 to 110 amino acids, and most preferably from 30 to 100 amino acids.
- TLRs Toll like receptors
- LRRs leucine-rich repeats
- Toll like receptors include TLRs1-10. Compounds capable of activating TLR receptors and modifications and derivatives thereof are well documented in the art.
- TLR1 may be activated by bacterial lipoproteins and acetylated forms thereof
- TLR2 may in addition be activated by Gram positive bacterial glycolipids, LPS, LP A, LTA, fimbriae, outer membrane proteins, heat shock proteins from bacteria or from the host, and Mycobacterial lipoarabinomannans.
- TLR3 may be activated by dsRNA, in particular of viral origin, or by the chemical compound poly(LC).
- TLR4 may be activated by Gram negative LPS, LTA, Heat shock proteins from the host or from bacterial origin, viral coat or envelope proteins, taxol or derivatives thereof, hyaluronan containing oligosaccharides and fibronectins.
- TLR5 may be activated with bacterial flagellae or flagellin.
- TLR6 may be activated by mycobacterial lipoproteins and group B streptococcus heat labile soluble factor (GBS-F) or staphylococcus modulins.
- TLR7 may be activated by imidazoquinolines.
- TLR9 may be activated by unmethylated CpG DNA or chromatin—lgG complexes.
- the TLR peptide agonist comprised by the complex for use according to the present invention is an agonist of TLR1, 2, 4, 5, 6, and/or 10.
- TLRs are expressed either on the cell surface (TLR1, 2, 4, 5, 6, and 10) or on membranes of intracellular organelles, such as endosomes (TLR3, 4, 7, 8, and 9).
- the natural ligands for the endosomal receptors turned out to be nucleic acid-based molecules (except for TLR4).
- the cell surface-expressed TLR1, 2, 4, 5, 6, and 10 recognize molecular patterns of extracellular microbes (Monie, T. P., Bryant, C. E., et al. 2009: Activating immunity: Lessons from the TLRs and NLRs. Trends Biochem. Sci. 34(11), 553-561).
- TLRs are expressed on several cell types but virtually all TLRs are expressed on DCs allowing these specialized cells to sense all possible pathogens and danger signals.
- the TLR peptide agonist comprised by the complex for use according to the present invention is more preferably a peptide agonist of TLR2, TLR4 and/or TLR5.
- the TLR peptide agonist is a TLR2 peptide agonist and/or a TLR4 peptide agonist.
- the TLR peptide agonist is a TLR4 peptide agonist.
- the TLR peptide agonist is one TLR peptide agonist, which is both, a TLR2 and a TLR4 agonist.
- TLR2 can detect a wide variety of ligands derived from bacteria, viruses, parasites, and fungi.
- the ligand specificity is often determined by the interaction of TLR2 with other TLRs, such as TLR1, 6, or 10, or non-TLR molecules, such as dectin-1, CD14, or CD36.
- TLR1 TLR1, 6, or 10
- non-TLR molecules such as dectin-1, CD14, or CD36.
- TLR2 can identify triacyl lipoproteins or lipopeptides from (myco)bacterial origin, such as Pam3CSK4 and peptidoglycan (PGA; Gay, N.)., and Gangloff, M. (2007): Structure and function of Toll receptors and their ligands. Annu. Rev. Biochem.
- TLR2 interacts with a broad and structurally diverse range of ligands, including molecules expressed by microbes and fungi.
- Multiple TLR2 agonists have been identified, including natural and synthetic lipopeptides (e.g. Mycoplasma fermentas macrophage-activating lipopeptide (MALP-2)), peptidoglycans (PG such as those from S. aureus ), lipopolysaccharides from various bacterial strains (LPS), polysaccharides (e.g. zymosan), glycosylphosphatidyl-inositol-anchored structures from gram positive bacteria (e.g.
- lipopeptides e.g. Mycoplasma fermentas macrophage-activating lipopeptide (MALP-2)
- PG peptidoglycans
- LPS lipopolysaccharides from various bacterial strains
- polysaccharides e.g. zymosan
- LTA lipoteichoic acid
- lipo-arabinomannan from mycobacteria and lipomannas from M. tuberculosis .
- Certain viral determinants may also trigger via TLR2 (Barbalat R, Lau L, Locksley R M, Barton G M. Toll-like receptor 2 on inflammatory monocytes induces type I interferon in response to viral but not bacterial ligands. Nat Immunol. 2009: 10(11):1200-7).
- Bacterial lipopeptides are structural components of cell walls. They consist of an acylated s-glycerylcysteine moiety to which a peptide can be conjugated via the cysteine residue.
- TLR2 agonists which are bacterial lipopeptides, include MALP-2 and it's synthetic analogue di-palmitoyl-S-glyceryl cysteine (Pam 2 Cys) or tri-palmitoyl-S-glyceryl cysteine (Pam 3 Cys).
- TLR4 Monophosphoryl Lipid A from Salmonella minnesota R595 (MPLA), lipopolysaccharides (LPS), mannans ( Candida albicans ), glycoinositolphospholipids ( Trypanosoma ), viral envelope proteins (RSV and MMTV) and endogenous antigens including fibrinogen and heat-shock proteins.
- MPLA Salmonella minnesota R595
- LPS lipopolysaccharides
- mannans Candida albicans
- GMV glycoinositolphospholipids
- RSV and MMTV viral envelope proteins
- endogenous antigens including fibrinogen and heat-shock proteins.
- Such agonists of TLR4 are for example described in Akira S, Uematsu S, Takeuchi O. Pathogen recognition and innate immunity. Cell. Feb. 24; 2006: 124(4):783-801 or in Kumar H, Kawai T, Akira S. Toll-like receptors and innate immunity. Bio
- LPS which is found in the outer membrane of gram negative bacteria, is the most widely studied of the TLR4 ligands. Suitable LPS-derived TLR4 agonist peptides are described for example in WO 2013/120073 (A1).
- TLR5 is triggered by a region of the flagellin molecule expressed by nearly all motile bacteria.
- flagellin, or peptides or proteins derived from flagellin and/or variants or fragments of flagellin are also suitable as TLR peptide agonists comprised by the complex for use according to the present invention.
- TLR peptide agonists thus include the TLR2 lipopeptide agonists MALP-2, Pam 2 Cys and Pam 3 Cys or modifications thereof, different forms of the TLR4 agonist LPS, e.g. N. meningitidis wild-type L3-LPS and mutant penta-acylated LpxL1-LPS, and the TLR5 agonist flagellin.
- the TLR peptide agonist comprised by the complex for use according to the present invention is neither a lipopeptide nor a lipoprotein, neither a glycopeptide nor a glycoprotein, more preferably, the TLR peptide agonist comprised by the complex for use according to the present invention is a classical peptide, polypeptide or protein as defined herein.
- a preferred TLR2 peptide agonist is annexin II or an immunomodulatory fragment thereof, which is described in detail in WO 2012/048190 A1 and U.S. patent application Ser. No. 13/033,1546, in particular a TLR2 peptide agonist comprising an amino acid sequence according to SEQ ID NO: 4 or SEQ ID NO: 7 of WO 2012/048190 A1 or fragments or variants thereof are preferred.
- TLR2 peptide agonist comprising or consisting of an amino acid sequence according to SEQ ID NO: 15 or a sequence variant thereof as described above is particularly preferred as component c), i.e. as the at least one TLR peptide agonist, comprised by the complex for use according to the present invention.
- TLR2 peptide agonist Anaxa SEQ ID NO: 15 STVHEILCKLSLEGDHSTPPSAYGSVKPYTNFDAE
- a particularly preferred functional sequence variant of the TLR peptide agonist according to SEQ ID NO: 15 is the TLR peptide agonist according to SEQ ID NO: 71:
- a TLR2 peptide agonist comprising or consisting of an amino acid sequence according to SEQ ID NO: 71 or a sequence variant thereof as described above is particularly preferred as component c), i.e. as the at least one TLR peptide agonist, comprised by the complex.
- the TLR peptide agonist in the complex most preferably comprises or consists of a peptide having an amino acid sequence according to SEQ ID NO: 71, or a functional sequence variant thereof having at least 70% sequence identity (preferably at least 75%, more preferably at least 80%, even preferably at least 85%, still more preferably at least 90%, particularly preferably at least 95%, most preferably at least 99% sequence identity).
- TLR peptides agonists are particularly preferred, which in particular correspond to motifs that bind to TLR4, in particular (i) peptides mimicking the natural LPS ligand (RS01: Gln-Glu-Ile-Asn-Ser-Ser-Tyr and RS09: Ala-Pro-Pro-His-Ala-Leu-Ser) and (ii) Fibronectin derived peptides.
- the cellular glycoprotein Fibronectin (FN) has multiple isoforms generated from a single gene by alternative splicing of three exons. One of these isoforms is the extra domain A (EDA), which interacts with TLR4.
- TLR peptide agonists comprise a fibronectin EDA domain or a fragment or variant thereof.
- suitable fibronectin EDA domains or a fragments or variants thereof are disclosed in EP 1 913 954 B1, EP 2 476 440 A1, US 2009/0220532 A1, and WO 2011/101332 A1.
- a TLR4 peptide agonist comprising or consisting of an amino acid sequence according to SEQ ID NO: 45 or a sequence variant thereof as described above is particularly preferred as component c), i.e. as the at least one TLR peptide agonist, comprised by the complex for use according to the present invention.
- TLR4 peptide agonist EDA SEQ ID NO: 45 NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIRELFPAP DGEDDTAELQGLRPGSEYTVSVVALHDDMESQPLIGIQST
- high-mobility group box 1 protein HMGB1
- peptide fragments thereof are assumed to be TLR4 agonists.
- TLR4 agonists such as TLR4 agonists.
- TLR4 agonist comprising or consisting of an amino acid sequence according to SEQ ID NO: 15 or 71 or a functional sequence variant thereof is particularly preferred as component c), i.e. as the at least one TLR peptide agonist, comprised by the complex.
- the complex for use according to the present invention comprises at least one TLR peptide agonist, preferably the complex for use according to the present invention comprises more than one TLR peptide agonist, in particular 2, 3, 4, 5, 6, 7, 8, 9, 10 or more TLR peptide agonists, more preferably the complex for use according to the present invention comprises (at least) two or three TLR peptide agonists, even more preferably the complex for use according to the present invention comprises (at least) four or five TLR peptide agonists. If more than one TLR peptide agonist is comprised by the complex for use according to the present invention it is understood that said TLR peptide agonist is in particular also covalently linked in the complex for use according to the present invention, e.g. to another TLR peptide agonist and/or to a component a), i.e. a cell penetrating peptide, and/or to a component b), i.e. an antigen or antigenic epitope.
- the complex for use according to the present invention comprises one single TLR peptide agonist.
- the complex for use according to the present invention comprises one single TLR peptide agonist and no further component having TLR agonist properties except the one single TLR peptide agonist as described.
- the various TLR peptide agonists comprised by the complex for use according to the present invention may be the same or different.
- the various TLR peptide agonists comprised by the complex for use according to the present invention are different from each other.
- the more than one antigen or antigenic epitope in particular 2, 3, 4, 5, 6, 7, 8, 9, 10 antigens or antigenic epitopes, or more TLR peptide agonists, in particular 2, 3, 4, 5, 6, 7, 8, 9, 10 TLR agonists, are positioned consecutively in the complex for use according to the present invention.
- all TLR peptide agonists comprised by the complex are positioned in a stretch, which is neither interrupted by component a), i.e. a cell penetrating peptide, nor by component b), i.e. at least one antigen or antigenic epitope.
- component a) and component b) are positioned in the complex for example before or after such a stretch of all TLR peptide agonists.
- the TLR peptide agonists positioned consecutively in such a way may be linked to each other for example by a spacer or linker as described below, which is neither component a), i.e. a cell penetrating peptide, nor component h), i.e. at least one antigen or antigenic epitope.
- the various TLR peptide agonists may also be positioned in any other way in the complex for use according to the present invention, for example with component a) and/or component b) positioned in between two or more TLR peptide agonists, i.e. with one or more TLR peptide agonist positioned between component a) and component b) (or vice versa) and, optionally, one or more TLR peptide agonists positioned at the respective other end of component a) and/or component b).
- TLR peptide agonists activating the same or different TLR receptors may be advantageously comprised by a single complex for use according to the present invention.
- a number of different TLR peptide agonists activating the same or different TLR receptors may be distributed to subsets of different TLR peptide agonists activating the same or different TLR receptors, which are comprised by different complexes according to the present invention, whereby such different complexes comprising different subsets may advantageously be administered simultaneously, e.g. in a single vaccine, to a subject in need thereof.
- components a), b) and c) are covalently linked, i.e. the linkage between two out of the three components a), b), and c) of the complex for use according to the present invention is a covalent linkage.
- two out of the three components a), b), and c) of the complex for use according to the present invention are covalently linked to each other (i.e. the “first” and the “second” component), and the third component out of the three components a), b), and c) is covalently linked either to the first component out of the three components a), b), and c) or to the second component out of the three components a), b), and c).
- a linear molecule is formed.
- each of the three components a), b), and c) is covalently linked to both of the other components out of the three components a), b), and c).
- a “covalent linkage” refers to a chemical bond that involves the sharing of electron pairs between atoms.
- a “covalent linkage” in particular involves a stable balance of attractive and repulsive forces between atoms when they share electrons. For many molecules, the sharing of electrons allows each atom to attain the equivalent of a full outer shell, corresponding to a stable electronic configuration.
- Covalent bonding includes many kinds of interactions, including for example ⁇ -bonding, ⁇ -bonding, metal-to-metal bonding, agostic interactions, and three-center two-electron bonds. Accordingly, the complex for use according to the present invention may also be referred to as “compound”, in particular it may be referred to as “molecule”.
- components a), b), and c) are covalently linked by chemical coupling in any suitable manner known in the art, such as cross-linking methods.
- any suitable manner known in the art such as cross-linking methods.
- many known chemical cross-linking methods are non-specific, i.e., they do not direct the point of coupling to any particular site on the components a), b), and c).
- the use of non-specific cross-linking agents may attack functional sites or sterically block active sites, rendering the fused components of the complex for use according to the present invention biologically inactive. It is referred to the knowledge of the skilled artisan to block potentially reactive groups by using appropriate protecting groups.
- Coupling specificity can be increased by direct chemical coupling to a functional group found only once or a few times in components a), b), and/or c), which functional group is to be cross-linked to the another of the components a), b), and c).
- the cystein thiol group may be used, if just one cystein residue is present in a certain component a), b), or c) of complex for use according to the present invention.
- a cross-linking reagent specific for primary amines will be selective for the amino terminus of the respective component.
- cross-linking may also be carried out via the side chain of a glutamic acid residue placed at the N-terminus of the peptide such that a amide bond can be generated through its side-chain. Therefore, it may be advantageous to link a glutamic acid residue to the N-terminus of a certain component a), b), or c).
- a cysteine residue is to be introduced into a certain component a), b), or c
- introduction at or near its N- or C-terminus is preferred.
- Conventional methods are available for such amino acid sequence alterations based on modifications of certain component a), b), or c) by either adding one or more additional amino acids, e.g.
- cystein residue to the translocation sequence or by substituting at least one residue of the translocation sequence(s) being comprised in the respective component.
- a cystein side chain is used for coupling purposes, a certain component a), b), or c) has preferably one cystein residue.
- Any second cystein residue should preferably be avoided and can, optionally, be replaced when they occur in the respective component comprised by the complex for use according to the present invention.
- a cysteine residue is replaced in the original sequence of a certain component a), b), or c), it is typically desirable to minimize resulting changes in the peptide folding of the respective component. Changes in folding are minimized when the replacement is chemically and sterically similar to cysteine. Therefore, serine is preferred as a replacement for cystein.
- Coupling of two out of the three components a), b), and c) can be accomplished via a coupling or conjugating agent including standard peptide synthesis coupling reagents such as HOBt, HBTU, DICI, TBTU.
- a coupling or conjugating agent including standard peptide synthesis coupling reagents such as HOBt, HBTU, DICI, TBTU.
- reagents for example, N-succinimidyl 3-(2-pyridyldithio)propionate (SPDP) or N,N′-(1,3-phenylene)bismaleimide; N,N′-ethylene-bis-(iodoacetamide) or other such reagent having 6 to 11 carbon methylene bridges; and 1,5-difluoro-2,4-dinitrobenzene.
- SPDP N-succinimidyl 3-(2-pyridyldithio)propionate
- N,N′-(1,3-phenylene)bismaleimide N,N′-ethylene-bis-(iodoacetamide) or other such reagent having 6 to 11 carbon methylene bridges
- 1,5-difluoro-2,4-dinitrobenzene 1,5-difluoro-2,4-dinitrobenzene.
- cross-linking agents useful for this purpose include: p,p′-difluoro-m,m′-dinitrodiphenylsulfone; dimethyl adipimidate; phenol-1,4-disulfonylchloride; hexamethylenediisocyanate or diisothiocyanate, or azophenyl-p-diisocyanate; glutaraldehyde and disdiazobenzidine.
- Cross-linking agents may be homobifunctional, i.e., having two functional groups that undergo the same reaction.
- a preferred homobifunctional cross-linking agent is bismaleimidohexane (BMH).
- BMH contains two maleimide functional groups, which react specifically with sulfhydryl-containing compounds under mild conditions (pH 6.5-7.7).
- the two maleimide groups are connected by a hydrocarbon chain. Therefore, BMH is useful for irreversible cross-linking of proteins (or polypeptides) that contain cysteine residues.
- Cross-linking agents may also be heterobifunctional. Heterobifunctional cross-linking agents have two different functional groups, for example an amine-reactive group and a thiol-reactive group, that will cross-link two proteins having free amines and thiols, respectively.
- heterobifunctional cross-linking agents are Succinimidyl-4-(N-maleimidomethyl)-cyclohexane-1-carboxylate (SMCC), m-maleimidobenzoyl-N-hydroxysuccinimide ester (MBS), and succinimide 4-(p-maleimidophenyhbutyrate (SMPB), an extended chain analog of MBS.
- SMCC Succinimidyl-4-(N-maleimidomethyl)-cyclohexane-1-carboxylate
- MBS m-maleimidobenzoyl-N-hydroxysuccinimide ester
- SMPB succinimide 4-(p-maleimidophenyhbutyrate
- cross-linking agents often have low solubility in water, a hydrophilic moiety, such as a sulfonate group, may be added to the cross-linking agent to improve its water solubility.
- Sulfo-MBS and sulfo-SMCC are examples of cross-linking agents modified for water solubility.
- Many cross-linking agents yield a conjugate that is essentially non-cleavable under cellular conditions. Therefore, some cross-linking agents contain a covalent bond, such as a disulfide, that is cleavable under cellular conditions.
- cleavable cross-linkers For example, Traut's reagent, dithiobis (succinimidylpropionate) (DSP), and N-succinimidyl 3-(2-pyridyldithio)propionate (SPDP) are well-known cleavable cross-linkers.
- DSP dithiobis
- SPDP N-succinimidyl 3-(2-pyridyldithio)propionate
- cleavable cross-linking agent permits the cell penetrating peptide, the at least one antigen or antigenic epitope and the at least one TLR peptide agonist comprised by the complex for use according to the present invention to separate from each other after delivery into the target cell.
- direct disulfide linkage may also be useful.
- Chemical cross-linking may also include the use of spacer arms.
- Spacer arms provide intramolecular flexibility or adjust intramolecular distances between conjugated moieties and thereby may help preserve biological activity.
- a spacer arm may be in the form of a protein (or polypeptide) moiety that includes spacer amino acids, e.g. proline.
- a spacer arm may be part of the cross-linking agent, such as in “long-chain SPDP” (Pierce Chem. Co., Rockford, Ill., cat. No. 21651 H). Numerous cross-linking agents, including the ones discussed above, are commercially available. Detailed instructions for their use are readily available from the commercial suppliers.
- Cross-linking agents for peptide or protein crosslinking include for example (i) amine-to-amine crosslinkers, e.g. homobifunctional amine-specific protein crosslinking reagents based on NHS-ester and imidoester reactive groups for selective conjugation of primary amines; available in short, long, cleavable, irreversible, membrane permeable, and cell surface varieties; (ii) sulfhydryl-to-carbohydrate crosslinkers, e.g.
- crosslinking reagents based on maleimide and hydrazide reactive groups for conjugation and formation of covalent cross' inks (iii) sulfhydryl-to-sulfhydryl crosslinkers, e.g. homobifunctional sulfhydryl-specific crosslinking reagents based on maleimide or pyridyldithiol reactive groups for selective covalent conjugation of protein and peptide thiols (reduced cysteines) to form stable thioether bonds; (iv) photoreactive crosslinkers, e.g.
- amine-to-sulfhydryl crosslinkers e.g. heterobifunctional protein crosslinking reagents for conjugation between primary amine (lysine) and sulfhydryl (cysteine) groups of proteins and other molecules; available with different lengths and types of spacer arms; and (vi) amine-to-amine crosslinkers, e.g. carboxyl-to-amine crosslinkers, e.g.
- Carbodiimide crosslinking reagents DCC and EDC (EDAC), for conjugating carboxyl groups (glutamate, aspartate, C-termini) to primary amines (lysine, N-termini) and also N-hydroxysuccinimide (NHS) for stable activation of carboxylates for amine-conjugation.
- carboxyl groups glutamate, aspartate, C-termini
- primary amines lysine, N-termini
- NHS N-hydroxysuccinimide
- crosslinkers in general which can be used in the complex for use according to the present invention, include N-( ⁇ -Maleimidoacetoxy)-succinimide ester, N-5-Azido-2-nitrobenzyloxy-succinimide, 1,4-Bis-Maleimidobutane, 1,4-Bis-Maleimmidyl-2,3-dihydroxy-butane, Bis-Maleimidohexane, Bis-Maleimidoethane, N-( ⁇ -Maleimidopropionic acid)hydrazide*TFA, N-( ⁇ -Maleimidopropyloxy)succinimide ester, 1,8-Bis-Maleimidodiethylene-glycol, 1,11-Bis-Maleimidotriethyleneglycol, Bis (Sulfosuccinimidyl)suberate, MS (sulfosuccinimidyl)glutarate-d0, Bis (s
- the linkage between two out of the three components a), b), and c) of the complex for use according to the present invention may be directly or indirectly, i.e. two components directly adjoin or they may be linked by an additional component of the complex, e.g. a spacer or a linker.
- a direct linkage may be realized preferably by an amide bridge, if the components to be linked have reactive amino or carboxy groups. More specifically, if the components to be linked are peptides, polypeptides or proteins, a peptide bond is preferred. Such a peptide bond may be formed using a chemical synthesis involving both components (an N-terminal end of one component and the C-terminal end of the other component) to be linked, or may be formed directly via a protein synthesis of the entire peptide sequence of both components, wherein both (protein or peptide) components are preferably synthesized in one step. Such protein synthesis methods include e.g., without being limited thereto, liquid phase peptide synthesis methods or solid peptide synthesis methods, e.g.
- solid peptide synthesis methods according to Merrifield, t-Boc solid-phase peptide synthesis, Fmoc solid-phase peptide synthesis, BOP (Benzotriazole-1-yl-oxy-tris-(dimethylamino)-phosphonium hexafluorophosphate) based solid-phase peptide synthesis, etc.
- BOP Benzotriazole-1-yl-oxy-tris-(dimethylamino)-phosphonium hexafluorophosphate
- ester or ether linkages are preferred.
- a linkage may occur via the side chains, e.g. by a disulfide bridge.
- Further components of other chemical nature e.g. the at least one antigen or antigenic epitope if it is not of peptidic nature, may be likewise attached to the components of peptidic nature, e.g. the cell penetrating peptide, the at least one TLR peptide agonist, and the at least one antigen or antigenic epitope if it is of peptidic nature.
- the linkage via a side chain will preferably be based on side chain amino, thiol or hydroxyl groups, e.g.
- a linkage of a peptidic main chain with a peptidic side chain of another component may also be via an isopeptide bond.
- An isopeptide bond is an amide bond that is not present on the main chain of a protein. The bond forms between the carboxyl terminus of one peptide or protein and the amino group of a lysine residue on another (target) peptide or protein.
- the complex for use according to the present invention may optionally comprise a spacer or linker, which are non-immunologic moieties, which are preferably cleavable, and which link component a) and b) and/or component a) and c), and/or component b) and c), and/or link consecutive antigens or antigenic epitopes, and/or link consecutive TLR peptide agonists, and/or link consecutive cell penetrating peptides, and/or which can be placed at the C-terminal part of components b) and/or c).
- a spacer or linker which are non-immunologic moieties, which are preferably cleavable, and which link component a) and b) and/or component a) and c), and/or component b) and c), and/or link consecutive antigens or antigenic epitopes, and/or link consecutive TLR peptide agonists, and/or link consecutive cell penetrating peptides
- a linker or spacer may preferably provide further functionalities in addition to linking of the components, and preferably being cleavable, more preferably naturally cleavable inside the target cell, e.g. by enzymatic cleavage.
- further functionalities do in particular not include any immunological functionalities.
- Examples of further functionalities, in particular regarding linkers in fusion proteins, can be found in Chen X. et al., 2013: Fusion Protein Linkers: Property, Design and Functionality. Adv Drug Deliv Rev. 65(10): 1357-1369, wherein for example also in vivo cleavable linkers are disclosed.
- linkers e.g. flexible linkers and rigid linkers, and linker designing tools and databases, which can be useful in the complex for use according to the present invention or to design a linker to be used in the complex for use according to the present invention.
- Said spacer may be peptidic or non-peptidic, preferably the spacer is peptidic.
- a peptidic spacer consists of about 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids, more preferably of about 1, 2, 3, 4, or 5 amino acids.
- the amino acid sequence of the peptidic spacer may be identical to that of the N-terminal or C-terminal flanking region of any of the components a), b), or c).
- a peptidic spacer can consist of non-natural amino acid sequences such as an amino acid sequence resulting from conservative amino acid substitutions of said natural flanking regions or sequences of known cleavage sites for proteases such as an enterokinase target site (amino acid sequence: DDDK, SEQ ID NO: 16), factor Xa target site (amino acid sequence: IEDGR, SEQ ID NO: 17), thrombin target site (amino acid sequence: LVPRGS, SEQ ID NO: 18), protease TEV target site (amino acid sequence: ENLYFQG, SEQ ID NO: 19), PreScission protease target site (amino acid sequence LEVLFQGP, SEQ ID NO: 20), polycationic amino acids, e.g.
- the peptidic spacer does not contain any Cys (C) residues.
- the linker sequence contains at least 20%, more preferably at least 40% and even more preferably at least 50% Gly or ⁇ -alanine residues, e.g. GlyGlyGlyGlyGly (SEQ ID NO: 22), GlyGlyGlyGly (SEQ ID NO: 23), GlyGlyGly, CysGlyGly or GlyGlyCys, etc.
- Appropriate linker sequences can be easily selected and prepared by a person skilled in the art. They may be composed of D and/or L amino acids. Further examples of a peptidic spacer include the amino acid sequences EQLE (SEQ ID NO: 24) or TEWT (SEQ ID NO: 25) or any conservative substitutions thereof.
- a non-peptidic spacer can include or may be an ester, a thioester, and a di-sulfide.
- the complex for use according to the invention may comprise a spacer or linker, in particular a peptidic spacer, placed between component a) and b) and/or between component a) and c), and/or between component b) and c).
- This peptidic spacer can be chosen by one skilled in the art so that it may be cut by the cell machinery once the complex comprising the cell penetrating peptide and the cargo molecule has been internalized.
- each of the antigens or antigenic epitopes and/or each of the TLR peptide agonists comprised in the complex of the invention can be either directly linked to each other or linked via spacers or linkers such as, e.g., a peptidic spacer consisting of a few amino acids.
- the complex for use according to the present invention comprises several antigens or antigenic epitopes or when the complex comprises several TLR peptide agonists
- some antigens or antigenic epitopes and/or some TLR peptide agonists comprised by the complex of the invention are directly linked to each other and some other antigens or antigenic epitopes and/or some other TLR peptide agonists are linked via spacers or linkers such as a peptidic spacer consisting of a few amino acids.
- two successive antigens or antigenic epitopes or two successive TLR peptide agonists comprised in the complex of the invention are linked to each other by spacers consisting of the natural flanking regions of said antigens or antigenic epitopes or of said TLR peptide agonists, respectively.
- the spacer used to link a first antigen/antigenic epitope or a first TLR peptide agonist to a second antigen/antigenic epitope or to a second TLR peptide agonist may consists of up to about 8 amino acids corresponding to up to about 4 amino acids of the N-terminal or C-terminal flanking region of the first antigen/antigenic epitope or the first TLR peptide agonist, followed by up to about 4 amino acids of the N-terminal or C-terminal flanking region of the second antigen/antigenic epitope or the second TLR peptide agonist.
- the spacer used to link a first antigen/antigenic epitope or a first TLR peptide agonist (“antigen/epitope/TLR peptide agonist 1”) to a second epitope (“antigen/epitope/TLR peptide agonist 2”) consists of about 8 amino acids corresponding to any possible combination ranging from: 0 flanking amino acid of antigen/epitope/TLR peptide agonist 1 and 8 flanking amino acids of antigen/epitope/TLR peptide agonist 2, to 8 flanking amino acids of antigen/epitope/TLR peptide agonist 1 and 0 flanking amino acid of antigen/epitope/TLR peptide agonist 2, i.e.
- the total of 8 amino acids constituting a spacer linking two consecutive antigen/epitope/TLR peptide agonist is not an absolute value and the spacer could also be composed of a total of, for instance, 3 amino acids, 4 amino acids, 5 amino acids, 6 amino acids, 7 amino acids, 9 amino acids or 10 amino acids.
- equivalent combinations as mentioned above are also an illustration of the invention in the situation where a spacer has less or more than 8 amino acids.
- the spacer used to link a first antigen/antigenic epitope or a first TLR peptide agonist (“antigen/epitope/TLR peptide agonist 1”) to a second antigen/antigenic epitope or to a second TLR peptide agonist, respectively, (“antigen/epitope/TLR peptide agonist 2”) consists of e.g. 1, 2, 3, 4, or 5 amino acids. More particularly, said spacer's amino acid sequence can correspond to the 4 amino acids of the N-terminal or C-terminal flanking region of antigen/epitope/TLR peptide agonist 1 or antigen/epitope/TLR peptide agonist 2.
- a spacer as described above may also be placed at the C-terminal part of the last antigen/epitope/TLR peptide agonist comprised in the complex for use according to the present invention.
- linkages between two of the three components a), b), and c) are well documented in the literature and can depend on the nature of the at least one antigen or antigenic epitope.
- linkages between two of the three components a), b), and c) can be achieved via cleavable disulphide linkages through total stepwise solid-phase synthesis or solution-phase or solid-phase fragment coupling, stable amide, thiazolidine, oxime and hydrazine linkage, disulphide linkage, stable thiomaleimide linkage, peptide bond (including peptide bonds between amino acids of a fusion protein), or electrostatic or hydrophobic interactions.
- the at least one antigen or antigenic epitope comprised by the complex for use according to the present invention as well as any optional spacer or linker comprised by the complex for use according to the present invention are of peptidic nature. More preferably, all components of the complex for use according to the present invention, e.g. the cell penetrating peptide, the at least one antigen or antigenic epitope, which is a peptide, polypeptide or protein, the at least one TLR peptide agonist and any optional peptidic linker or spacer are linked in the complex for use according to the present invention by a peptide bond.
- the complex for use according to the present invention is thus a peptide, polypeptide or protein, such as a fusion protein, e.g. a recombinant fusion protein.
- a complex comprising or consisting of an amino acid sequence according to SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 46, SEQ ID NO: 69, SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, SEQ ID NO: 86, or SEQ ID NO: 87; or a complex comprising or consisting of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least
- a complex comprising or consisting of an amino acid sequence according to SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 46, SEQ ID NO: 69, SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, SEQ ID NO: 86, SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91;
- a complex comprising or consisting of an amino acid sequence according to SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 46, or SEQ ID NO: 69; or a complex comprising or consisting of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with any of SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 46, or SEQ ID NO: 69 is preferred.
- a complex comprising or consisting of an amino acid sequence according to SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 33, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 or SEQ ID NO: 69 or a complex comprising or consisting of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with any of SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 33, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 or SEQ ID NO: 69 is more preferred.
- a complex comprising or consisting of an amino acid sequence according to SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 33, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 or SEQ ID NO: 69 or a complex comprising or consisting of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with any of SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 33, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 or SEQ ID NO: 69 is more preferred.
- a complex comprising or consisting of an amino acid sequence according to SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 33, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 or SEQ ID NO: 69 or a complex comprising or consisting of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with any of SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 33, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 or SEQ ID NO: 69 is more preferred.
- a complex comprising or consisting of an amino acid sequence according to SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, SEQ ID NO: 86, or SEQ ID NO: 87 or a complex comprising or consisting of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with any of SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78
- a complex comprising or consisting of an amino acid sequence according to SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 74, SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, SEQ ID NO: 78, SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, SEQ ID NO: 82, SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, SEQ ID NO: 86, SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90 or SEQ ID NO: 91 or a complex comprising or consisting of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with any of SEQ ID NO: 72, SEQ ID NO: 73, SEQ ID NO: 74,
- a complex comprising or consisting of an amino acid sequence according to SEQ ID NO: 28, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 or SEQ ID NO: 69 or a complex comprising or consisting of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 28, SEQ ID NO: 37, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 or SEQ ID NO: 69 is even more preferred.
- a complex comprising or consisting of an amino acid sequence according to SEQ ID NO: 28, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 or SEQ ID NO: 69 or a complex comprising or consisting of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 28, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 or SEQ ID NO: 69 is even more preferred.
- a complex comprising or consisting of an amino acid sequence according to SEQ ID NO: 28, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 or SEQ ID NO: 69 or a complex comprising or consisting of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 28, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 or SEQ ID NO: 69 is particularly preferred.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 72 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 72.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 73 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 73.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 74 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 74.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 75 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 75.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 76 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 76.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 77 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 77.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 78 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 78.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 79 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 79.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 80 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 80.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 81 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 81.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 82 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 82.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 83 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 83.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 84 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 84.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 85 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 85.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 86 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 86.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 87 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 87.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 88 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 88.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 89 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 89.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 90 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 90.
- the complex for use according to the present invention comprises or consists of an amino acid sequence according to SEQ ID NO: 91 or of an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with SEQ ID NO: 91.
- the complex for use according to the present invention comprises or consists of a polypeptide having an amino acid sequence according to SEQ ID NO: 89, or a functional sequence variant thereof having at least 50% sequence identity (preferably at least 60%, more preferably at least 70%, more preferably at least 75%, even more preferably at least 80%, even more preferably at least 85%, still more preferably at least 90%, particularly preferably at least 95% and most preferably at least 98% or 99% sequence identity).
- SEQ ID NO: 26 MHHHHHHNID RPKGLAFTDV DVDSIKIAWE SPQGQVSRYR VTYSSPEDGI RELFPAPDGEDDTAELQGLR PGSEYTVSVV ALHDDMESQP LIGIQSTKRY KNRVASRKSR AKFKQLLQHY REVAAAKSSE NDRLRLLLKE SLKISQAVHA AHAEINEAGR EVVGVGALKV PRNQDWLGVP RFAKFASFEA QGALANIAVD KANLDVEQLE SIINFEKLTE WTGS SEQ ID NO: 27: MHHHHHHSTV HEILCKLSLE GDHSTPPSAY GSVKPYTNFD AEKRYKNRVA SRKSRAKFKQ LLQHYREVAA AKSSENDRLR LLLKESLKIS QAVHAAHAEI NEAGREVVGV GALKVPRNQD WLGVPRFAKF ASFEAQGALA NIAVDKANLD VEQLESIINF EKL
- the complex for use according to the present invention comprises (or consists of) the following components:
- the present invention also provides a complex comprising:
- Preferred embodiments of such a complex according to the present invention correspond to preferred embodiments of the complex for use according to the present invention as described above.
- the complex according to the present invention preferably comprises a peptide having an amino acid sequence according to SEQ ID NO: 52, or a fragment thereof having a length of at least 10 amino acids, or a functional sequence variant thereof having at least 70% sequence identity, as described above. More preferably, the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 53. Even more preferably, the complex the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 95 or a functional sequence variant thereof having at least 70% sequence identity, as described above.
- the complex according to the present invention preferably comprises a peptide having an amino acid sequence according to SEQ ID NO: 54, or a fragment thereof having a length of at least 10 amino acids, or a functional sequence variant thereof having at least 70% sequence identity, as described above. More preferably, the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 55 and/or a peptide having an amino acid sequence according to SEQ ID NO: 56. Even more preferably, the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 96 or a functional sequence variant thereof having at least 70% sequence identity, as described above.
- the complex according to the present invention preferably comprises a peptide having an amino acid sequence according to SEQ ID NO: 92, or a fragment thereof having a length of at least 10 amino acids, or a functional sequence variant thereof having at least 70% sequence identity, as described above. More preferably, the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 93 and/or a peptide having an amino acid sequence according to SEQ ID NO: 94. Even more preferably, the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 97 or a functional sequence variant thereof having at least 70% sequence identity, as described above.
- the complex comprises in N- to C-terminal direction:
- the complex comprises in N- to C-terminal direction:
- the C-terminus of (i) the peptide having an amino acid sequence according to SEQ ID NO: 54 or the fragment or variant thereof as described above is directly linked to the N-terminus of (ii) the peptide having an amino acid sequence according to SEQ ID NO: 52 or the fragment or variant thereof as described above; and the C-terminus of (ii) the peptide having an amino acid sequence according to SEQ ID NO: 52 or the fragment or variant thereof as described above is directly linked to the N-terminus of (iii) the peptide having an amino acid sequence according to SEQ ID NO: 92 or the fragment or variant thereof as described above.
- the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 96 or a functional sequence variant thereof having at least 70% sequence identity as described above; a peptide having an amino acid sequence according to SEQ ID NO: 95 or a functional sequence variant thereof having at least 70% sequence identity as described above; and a peptide having an amino acid sequence according to SEQ ID NO: 97 or a functional sequence variant thereof having at least 70% sequence identity as described above.
- the complex comprises a peptide having an amino acid sequence according to SEQ ID NO: 98 or a functional sequence variant thereof having at least 70% sequence identity as described above.
- the complex is a recombinant polypeptide or a recombinant protein as described above.
- the cell penetrating peptide of the complex according to the present invention preferably corresponds to the cell penetrating peptide of the complex for use according to the present invention as described above. This applies in particular to preferred embodiments of the cell penetrating peptide.
- the TLR peptide agonist of the complex according to the present invention preferably corresponds to the TLR peptide agonist of the complex for use according to the present invention as described above. This applies in particular to preferred embodiments of the TSR peptide agonist.
- the complex according to the present invention comprises preferably in N- to C-terminal direction, the following components, as described above:
- the complex comprises or consists of a polypeptide having an amino acid sequence according to SEQ ID NO: 89, or a functional sequence variant thereof having at least 50% sequence (preferably at least 60%, more preferably at least 70%, more preferably at least 75%, even more preferably at least 80%, even more preferably at least 85%, still more preferably at least 90%, particularly preferably at least 95% and most preferably at least 98% or 99% sequence identity).
- the complex according to the present invention may be used in the prevention and/or treatment of colorectal cancer as described herein.
- the components a), b), and c) may be arranged in the complex for use according to the present invention in any way.
- the more than one cell penetrating peptide may be positioned in a non-consecutive manner, i.e. at least one antigen or antigenic epitope (component b)) and/or at least one TLR peptide agonist (component c)) may interrupt a stretch of consecutively positioned cell penetrating peptides and/or the cell penetrating peptides may be positioned with component b) and/or with component c) in an alternating manner.
- the more than one antigen or antigenic epitope may be positioned in a non-consecutive manner, i.e. at least one cell penetrating peptide (component a)) and/or at least one TLR peptide agonist (component c)) may interrupt a stretch of consecutively positioned antigens or antigenic epitopes and/or the antigens or antigenic epitopes may be positioned with component a) and/or with component c) in an alternating manner.
- the more than one TLR peptide agonist may be positioned in a non-consecutive manner, i.e.
- At least one cell penetrating peptide (component a)) and/or at least one antigen or antigenic epitope (component b)) may interrupt a stretch of consecutively positioned TLR peptide agonists and/or the TLR peptide agonists may be positioned with component a) and/or with component b) in an alternating manner.
- the more than one cell penetrating peptide is positioned in the complex for use according to the present invention in a consecutive manner and/or the more than one antigen or antigenic epitope is positioned in the complex for use according to the present invention in a consecutive manner and/or the more than one TLR peptide agonist is positioned in the complex for use according to the present invention in a consecutive manner.
- all single units of a certain component i.e. all cell penetrating peptides, all antigens or antigenic epitopes or all TLR peptide agonists, which are comprised by the complex are positioned in a stretch, which is not interrupted by any of the other two components.
- the other two components are positioned in the complex for example before or after such a stretch of all single units of said certain component.
- the single units of said certain component positioned consecutively in such a way may be linked to each other for example by a spacer or linker as described herein, which is not of the other two components.
- each of the components a), b), and c) is positioned in a consecutive manner.
- each component a), b), and c) typically comprises a single main chain and at least one side chain.
- main chain also “backbone chain”
- main chain refers to the main continuous chain of covalently bond atoms in a molecule.
- main chain typically comprises alpha-carbon atoms and nitrogen atoms of the constituent amino acids linked by the peptide bond.
- the backbone does not include the side chains.
- side chain also “pendant chain”
- side chains refers to a chemical group that is attached to a core part of the molecule called “main chain” or backbone.
- the side chains typically represent the (main) parts of the constituent amino acids, which are attached to the alpha-carbon atoms of the backbone.
- the components a), b), and c) may be covalently linked via a linker or spacer as described herein or they may be directly covalently linked.
- a linker or spacer Independently of whether a spacer or linker is used for covalent linkage or not, there are in principle four options of how two of the three components are linked to each other in the complex for use according to the present invention, namely:
- all three components a), b), and c) are linked via main-chain/main-chain linkage, thus resulting in particular in a main chain of the complex for use according to the present invention, which comprises the main chain of one or more cell penetrating peptide(s), the main chain of one or more antigen(s) or antigenic epitope(s), and the main chain of one or more TLR peptide agonist(s).
- the main chain of one or more cell penetrating peptide(s), the main chain of one or more antigen(s) or antigenic epitope(s), and the main chain of one or more TLR peptide agonist(s) constitute the main chain of the complex for use according to the present invention, optionally together with further components, for example linker(s), spacer(s), etc.
- the following arrangements of the components a), b), and c) are preferred, in particular if the at least one antigen or antigenic epitope is a peptide, polypeptide or protein, whereby said preferred arrangements are shown below in N-terminus ⁇ C-terminus direction of the main chain of the complex and wherein all three components a), b), and c) are linked via main-chain/main-chain linkage and may be optionally linked by a linker, a spacer or another additional component:
- the at least one antigen or antigenic epitope is positioned C-terminally of the cell penetrating peptide, whereby the cell penetrating peptide and the at least one antigen or antigenic epitope are optionally linked by a further component, e.g. a linker, a spacer, or by the at least one TLR peptide agonist. Accordingly, this corresponds to the arrangements ( ⁇ ), ( ⁇ ), and ( ⁇ ) from the arrangements shown above, i.e. from the above arrangements arrangements ( ⁇ ), ( ⁇ ), and ( ⁇ ) are more preferred.
- the at least one antigen or antigenic epitope is positioned C-terminally of the cell penetrating peptide, whereby the cell penetrating peptide and the at least one antigen or antigenic epitope are optionally linked by a further component, e.g. a linker, a spacer, but not by the at least one TLR peptide agonist. Accordingly, this corresponds to the arrangements ( ⁇ ) and ( ⁇ ) from the arrangements shown above, i.e. from the above arrangements arrangements ( ⁇ ) and ( ⁇ ) are even more preferred.
- the complex for use according to the present invention is a recombinant polypeptide or a recombinant protein and the components a) to c) are positioned in N-terminus ⁇ C-terminus direction of the main chain of said complex in the order:
- component a)-component b)-component c (a) component a)-component b)-component c); or ( ⁇ ) component c)-component a)-component b), wherein the components may be linked by a further component, in particular by a linker or a spacer.
- the at least one TLR agonist comprises or consists of at least one TLR2 agonist, for example:
- TLR2 peptide agonist may also be arranged at other positions in the complex, for example:
- the at least one TLR agonist comprises or consists of at least one TLR4 agonist, for example:
- TLR4 peptide agonist may also be arranged at other positions in the complex, for example:
- components a) and b) are linked via main-chain/main-chain linkage, resulting thus in the following arrangements of the components a) and b) in the complex, shown in N-terminus ⁇ C-terminus direction of the main chain of the complex, whereby the components a) and b) may be optionally linked by a further component, e.g. a linker, a spacer etc.:
- component c) i.e. the at least one TLR peptide agonist
- component c may then be arranged via main-chain/side-chain linkage, via side-chain/main-chain linkage or via side-chain/side chain linkage to either the cell penetrating peptide (a) or to the antigen/antigenic epitope (b) or, if present, to an additional component like a spacer or linker, which may be, for example, positioned between the cell penetrating peptide (a) and the antigen/antigenic epitope (b).
- components b) and c) are linked via main-chain/main-chain linkage, resulting thus in the following arrangements of the components b) and c) in the complex, shown in N-terminus ⁇ C-terminus direction of the main chain of the complex, whereby the components b) and c) may be optionally linked by a further component, e.g. a linker, a spacer etc.:
- component a i.e. the cell penetrating peptide
- component a may then be arranged via main-chain/side-chain linkage, via side-chain/main-chain linkage or via side-chain/side chain linkage to either the antigen/antigenic epitope (b) or to the TLR peptide agonist (c) or, if present, to an additional component like a spacer or linker, which may be, for example, positioned between the antigen/antigenic epitope (b) and the TLR peptide agonist (c).
- component a) may be linked—optionally via a spacer or a linker—via side-chain/main-chain linkage to component c), i.e. the side chain the cell penetrating peptide is covalently linked—optionally via a spacer or a linker—to the main chain of the at least one TLR peptide agonist;
- components a) and c) are linked via main-chain/main-chain linkage, resulting thus in the following arrangements of the components a) and b) in the complex, shown in N-terminus ⁇ C-terminus direction of the main chain of the complex, whereby the components a) and c) may be optionally linked by a further component, e.g. a linker, a spacer etc.:
- component b i.e. the at least one antigen or antigenic epitope
- component b may then be arranged via main-chain/side-chain linkage, via side-chain/main-chain linkage or via side-chain/side chain linkage to either the cell penetrating peptide (a) or to the TLR peptide agonist (c) or, if present, to an additional component like a spacer or linker, which may be, for example, positioned between the cell penetrating peptide (a) and the TLR peptide agonist (c).
- the present invention provides the complex as described above for use in the prevention and/or treatment of colorectal cancer.
- Colorectal cancer also known as “bowel cancer” is a cancer that comprises colon cancers and rectal cancers (CC). Both individual cancers have many features in common, but the cancer starting point. According to Siegel, R., C. Desantis, and A. Jemal, Colorectal cancer statistics, 2014. CA Cancer J Clin, 2014. 64(2): p. 104-17, in the United States between 2006 and 2010, the incidence by tumor site is slightly more important in the proximal colon (first and middle parts of the colon). With about 19 cases on 100,000 people, it represents 42% of the cases. It is followed by the rectal cancer, with 28% of the cases and the distal colon (bottom part of the colon) with an incidence of 10 cases on 100,000 people.
- colonal cancer includes (i) cancers of colon, such as cancers of cecum (including cancers the ileocecal valve), appendix, ascending colon, hepatic flexure, transverse colon, splenic flexure, descending colon, sigmoid colon (including cancers of sigmoid (flexure)) as well as cancers of overlapping sites of colon; (ii) cancers of rectosigmoid junction, such as cancers of colon and rectum and cancers of rectosigmoid; and (iii) cancers of rectum, such as cancers of rectal ampulla.
- cancers of colon such as cancers of cecum (including cancers the ileocecal valve), appendix, ascending colon, hepatic flexure, transverse colon, splenic flexure, descending colon, sigmoid colon (including cancers of sigmoid (flexure)) as well as cancers of overlapping sites of colon
- cancers of rectosigmoid junction such as cancers
- the colorectal cancer is a cancer of colon, such as a cancer of cecum (including cancer the ileocecal valve), cancer of appendix, cancer of ascending colon, cancer of hepatic flexure, cancer of transverse colon, cancer of splenic flexure, cancer of descending colon, cancer of sigmoid colon (including cancers of sigmoid (flexure)) or a combination thereof.
- a cancer of cecum including cancer the ileocecal valve
- cancer of appendix cancer of ascending colon
- cancer of hepatic flexure cancer of transverse colon
- cancer of splenic flexure cancer of descending colon
- cancer of sigmoid colon including cancers of sigmoid (flexure)
- the colorectal cancer is a cancer of rectosigmoid junction, such as (i) a cancer of colon and rectum or (ii) a cancer of rectosigmoid.
- the colorectal cancer is a cancer of rectum, such as a cancer of rectal ampulla.
- colorectal cancers include colorectal adenocarcinoma, colorectal stromal tumors, primary colorectal lymphoma, colorectal leiomyosarcoma, colorectal melanoma, colorectal squamous cell carcinoma and colorectal carcinoid tumors, such as, for example, carcinoid tumors of cecum, appendix, ascending colon, transverse colon, descending colon, sigmoid colon and/or rectum.
- colorectal cancers include colorectal adenocarcinoma, colorectal stromal tumors, primary colorectal lymphoma, colorectal leiomyosarcoma, colorectal melanoma, colorectal squamous cell carcinoma and colorectal carcinoid tumors, such as, for example, carcinoid tumors of cecum, appendix, ascending colon, transverse colon, descending colon, sigmoid colon and/or rectum. More preferably, the colorectal cancer is a colorectal adenocarcinoma or a colorectal carcinoid carcinoma. Even more preferably, the colorectal cancer is a colorectal adenocarcinoma.
- CRCs More than 95% of CRCs are adenocarcinomas.
- Colorectal adenocarcinomas typically start from glandular cells that make mucus to lubricate the colon or rectum.
- CRC typically starts in the innermost layer and can grow through some or all of the other layers. In rare cases, CRC could form in a polyp, which facilitates its growth into the wall of starting region. In advanced stage (stage III and IV), the cancer travels to nearby lymph nodes or to distant parts of the body through blood vessels.
- the TNM staging system includes the following stages for primary tumors (“T” stages): TX—Primary tumour cannot be assessed, T0—No evidence of primary tumour, Ta—Non-invasive papillary carcinoma, Tis—Carcinoma in situ: intraepithelial or invasion of lamina basement, T1—Tumour invades submucosa, T2—Tumour invades muscularis basement, T3—Tumour invades through the muscularis basement into the horrorectal tissues, T4a—Tumour penetrates to the surface of the visceral peritoneum and T4b—Tumour directly invades or is adherent to other organs or structures; following stages for lymph nodes (“N” stages): NX—Regional lymph nodes cannot be assessed, N0—No regional lymph node metastasis, N1—Metastasis in 1-3 regional lymph nodes with N1a—Metastasis in 1 regional lymph node, N1b—Metastasis in 2-3 regional lymph no
- Stage 0 T1s, N0, M0; Stage I: T1, N0, M0 or T2, N0, M0; Stage IIA: T3, N0, M0; Stage IIB: T4a, N0, M0; Stage 11C: T4b, N0, M0; Stage IIIA: T1-T2, N1/N1c, M0 or T1, N2a, M0; Stage IIIB: T3-T4a, N1/N1c, M0 or T2-T3, N2a, M0 or T1-T2, N2b, M0; Stage IIIC: T4a, N2a, M0 or T3-T4a, N2b, M0 or T4b, N1-N2, M0; Stage IVA: any T, any N, M1a and Stage IVB: any T, any N, M1b.
- Stage 0 the cancer has not grown beyond the inner layer of the colon or rectum; in Stage I the cancer has spread from the mucosa to the muscle layer; in Stage II the cancer has spread through the muscle layer to the serosa nearby organs; in Stage III the cancer has spread to nearby lymph node(s) or cancer cells have spread to tissues near the lymph nodes; and in Stage IV the cancer has spread through the blood and lymph nodes to other parts of the body.
- colorectal cancer includes all numerical stages as described above, and, thus, a preferred stage of colorectal cancer may be selected from the group consisting of Stage 0 (Tis, N0, M0), Stage I (T1, N0, M0 or T2, N0, M0), Stage IIA (T3, N0, M0), Stage IIB (T4a, N0, M0), Stage IIC (T4b, N0, M0), Stage IIIA (T1-T2, N1/N1c, M0 or T1, N2a, M0), Stage IIIB (T3-T4a, N1/N1c, M0 or T2-T3, N2a, M0 or T1-T2, N2b, M0), Stage IIIC (T4a, N2a, M0 or T3-T4a, N2b, M0 or T4b, N1-N2, M0), Stage IVA (any T, any N, M1a) and Stage IVB (any T, any N, M1b
- the colorectal cancer is selected from the group consisting of Stage I (T1, N0, M0 or T2, N0, M0), Stage HA (T3, N0, M0), Stage IIB (T4a, N0, M0), Stage IIC (T4b, N0, M0), Stage IIIA (T1-T2, N1/N1c, M0 or T1, N2a, M0), Stage IIIB (T3-T4a, N1/N1c, M0 or T2-T3, N2a, M0 or T1-T2, N2b, M0), Stage 111C (T4a, N2a, M0 or T3-T4a, N2b, M0 or T4b, N1-N2, M0), Stage IVA (any T, any N, M1a) and Stage IVB (any T, any N, M1b).
- Stage IVA any T, any N, M1a
- Stage IVB any T, any N, M1b
- the colorectal cancer is selected from the group consisting of Stage IIA (T3, N0, M0), Stage IIB (T4a, N0, M0), Stage IIC (T4b, N0, M0), Stage IIIA (T1-T2, N1/N1c, M0 or T1, N2a, M0), Stage IIIB (T3-T4a, N1/N1c, M0 or T2-T3, N2a, M0 or T1-T2, N2b, M0), Stage IIIC (T4a, N2a, M0 or T3-T4a, N2b, M0 or T4b, N1-N2, M0), Stage IVA (any T, any N, M1a) and Stage IVB (any T, any N, M1b).
- Stage IIA T3, N0, M0
- Stage IIB T4a, N0, M0
- Stage IIC T4b, N0, M0
- Stage IIIA T1-T2, N1/N1c, M0 or T
- the colorectal cancer is (i) Stage III colorectal cancer, such as Stage IIIA (T1-T2, N1/N1c, M0 or T1, N2a, M0), Stage IIIB (T3-T4a, N1/N1c, M0 or T2-T3, N2a, M0 or T1-T2, N2b, M0), or Stage IIIC (T4a, N2a, M0 or T3-T4a, N2b, M0 or T4b, N1-N2, M0), or (ii) Stage IV colorectal cancer, such as Stage IVA (any T, any N, M1a) and Stage IVB (any T, any N, M1b).
- Stage III colorectal cancer such as Stage IIIA (T1-T2, N1/N1c, M0 or T1, N2a, M0), Stage IIIB (T3-T4a, N1/N1c, M0 or T2-T3, N2a, M0 or T1-T2, N2b,
- the present invention provides a nucleic acid, in particular a nucleic acid molecule, encoding the complex as described herein, wherein the complex is a polypeptide or a protein, for use in the prevention and/or treatment of colorectal cancer.
- the present invention provides polynucleotides for use in the prevention and/or treatment of colorectal cancer, said polynucleotides encoding the complex as defined above.
- the present invention in particular provides a nucleic acid, in particular a nucleic acid molecule, comprising a polynucleotide, wherein the polynucleotide encodes the complex as described herein and wherein the complex is a polypeptide or a protein, for use in the prevention and/or treatment of colorectal cancer.
- the present invention also provides a nucleic acid, in particular a nucleic acid molecule, encoding the complex according to the present invention as described above, wherein the complex is a polypeptide or a protein.
- the present invention provides polynucleotides encoding the complex as defined above.
- the present invention in particular provides a nucleic acid, in particular a nucleic acid molecule, comprising a polynucleotide, wherein the polynucleotide encodes the complex according to the present invention as described herein and wherein the complex is a polypeptide or a protein.
- a nucleic acid may be used in the prevention and/or treatment of colorectal cancer.
- Nucleic acids preferably comprise single stranded, double stranded or partially double stranded nucleic acids, preferably selected from genomic DNA, cDNA, RNA, siRNA, antisense DNA, antisense RNA, ribozyme, complimentary RNA/DNA sequences with or without expression elements, a mini-gene, gene fragments, regulatory elements, promoters, and combinations thereof.
- nucleic acid (molecules) and/or polynucleotides include, e.g., a recombinant polynucleotide, a vector, an oligonucleotide, an RNA molecule such as an rRNA, an mRNA, an miRNA, an siRNA, or a tRNA, or a DNA molecule as described above.
- the nucleic acid (molecule) is a DNA molecule or an RNA molecule; preferably selected from genomic DNA; cDNA; siRNA; rRNA; mRNA; antisense DNA; antisense RNA; ribozyme; complimentary RNA and/or DNA sequences; RNA and/or DNA sequences with or without expression elements, regulatory elements, and/or promoters; a vector; and combinations thereof.
- the invention relates to a nucleic acid (for use) according to the present invention, said nucleic acid encoding a complex, which is in particular a polypeptide or protein, said complex comprising a cell penetrating peptide, at least one antigen or antigenic epitope, which is a polypeptide or protein, and at least one TLR peptide agonist, wherein the cell penetrating peptide, the at least one antigen or antigenic epitope, and the at least one TLR peptide agonist are covalently linked, optionally with peptidic spacer(s) or linker(s) as described herein.
- a complex which is in particular a polypeptide or protein
- said complex comprising a cell penetrating peptide, at least one antigen or antigenic epitope, which is a polypeptide or protein, and at least one TLR peptide agonist, wherein the cell penetrating peptide, the at least one antigen or antigenic epitope, and the at
- the more than one antigen or antigenic epitope which is a polypeptide or protein, is comprised by said complex, the more than one antigens or antigenic epitopes are also covalently linked, optionally with peptidic spacer(s) or linker(s) as described herein.
- the more than one TLR peptide agonist is comprised by said complex, the more than one TLR peptide agonists are also covalently linked, optionally with peptidic spacer(s) or linker(s) as described herein.
- the nucleic acid (for use) according to the present invention encodes a complex which is a (recombinant) fusion protein comprising (a) a cell penetrating peptide as described above, (b) at least one, preferably at least two, more preferably at least three, even more preferably at least four, particularly preferably at least five, most preferably at least six antigens or antigenic epitopes as described above, preferably arranged in a consecutive manner as described above and (c) at least one TLR agonist as described above.
- a complex which is a (recombinant) fusion protein comprising (a) a cell penetrating peptide as described above, (b) at least one, preferably at least two, more preferably at least three, even more preferably at least four, particularly preferably at least five, most preferably at least six antigens or antigenic epitopes as described above, preferably arranged in a consecutive manner as described above and (c) at least one TLR agonist as described above.
- the nucleic acid (molecule) encodes an exemplified complex as described herein or a functional sequence variant thereof. Accordingly, the nucleic acid (molecule) most preferably comprises a polynucleotide encoding an amino acid sequence according to any of SEQ ID NOs: 26-28, 33-34, 37-41, 46, 69, or 72-87 or an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with any of SEQ ID NOs: 26-28, 33-34, 37-41, 46, 69, or 72-87.
- the nucleic acid (molecule) most preferably comprises a polynucleotide encoding an amino acid sequence according to any of SEQ ID NOs: 26-28, 33-34, 37-41, 46, 69, or 72-91 or an amino acid sequence sharing at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% or at least 98% sequence identity with any of SEQ ID NOs: 26-28, 33-34, 37-41, 46, 69, or 72-91.
- the nucleic acid (molecule) according to the present invention comprises a polynucleotide encoding an amino acid sequence according to SEQ ID NO: 89, or a functional sequence variant thereof having at least 50% sequence identity (preferably at least 60%, more preferably at least 70%, more preferably at least 75%, even more preferably at least 80%, even more preferably at least 85%, still more preferably at least 90%, particularly preferably at least 95% and most preferably at least 98% or 99% sequence identity).
- the present invention provides a vector, preferably for use in the prevention and/or treatment of colorectal cancer, in particular a recombinant vector, comprising a nucleic acid as described above.
- vector refers to a nucleic acid molecule, preferably to an artificial nucleic acid molecule, i.e. a nucleic acid molecule which does not occur in nature.
- a vector in the context of the present invention is suitable for incorporating or harboring a desired nucleic acid sequence.
- Such vectors may be storage vectors, expression vectors, cloning vectors, transfer vectors etc.
- a storage vector is a vector which allows the convenient storage of a nucleic acid molecule.
- the vector may comprise a sequence corresponding, e.g., to a desired complex according to the present invention.
- An expression vector may be used for production of expression products such as RNA, e.g.
- an expression vector may comprise sequences needed for transcription of a sequence stretch of the vector, such as a promoter sequence.
- a cloning vector is typically a vector that contains a cloning site, which may be used to incorporate nucleic acid sequences into the vector.
- a cloning vector may be, e.g., a plasmid vector or a bacteriophage vector.
- a transfer vector may be a vector which is suitable for transferring nucleic acid molecules into cells or organisms, for example, viral vectors.
- a vector in the context of the present invention may be, e.g., an RNA vector or a DNA vector.
- a vector is a DNA molecule.
- a vector in the sense of the present application comprises a cloning site, a selection marker, such as an antibiotic resistance factor, and a sequence suitable for multiplication of the vector, such as an origin of replication.
- a vector in the context of the present application is a plasmid vector.
- a vector in the context of the present application is an expression vector.
- Cells transformed with a vector as described above, preferably for use in the prevention and/or treatment of colorectal cancer, are also included within the scope of the invention.
- examples of such cells include, but are not limited to, bacterial cells, e.g. E. coli , and eukaryotic cells, e.g., yeast cells, animal cells or plant cells.
- the cells are mammalian, e.g., human, CHO, HEK293T, PER.C6, NS0, myeloma or hybridoma cells.
- the present invention also relates to a cell expressing the complex (for use) according to the present invention; or comprising the vector (for use) according to the present invention.
- a cell may be transfected with a vector as described above, preferably with an expression vector.
- transfection refers to the introduction of nucleic acid molecules, such as DNA or RNA (e.g. mRNA) molecules, into cells, preferably into eukaryotic cells.
- RNA e.g. mRNA
- transfection encompasses any method known to the skilled person for introducing nucleic acid molecules into cells, preferably into eukaryotic cells, such as into mammalian cells. Such methods encompass, for example, electroporation, lipofection, e.g.
- the introduction is non-viral.
- chromosomes can be used, including without limitation chromosomes, episomes, and derived viruses.
- the vector as described above, in particular the recombinant vector used can be derived from bacterial plasmids, transposons, yeast episomes, insertion elements, yeast chromosome elements, viruses such as baculovirus, papilloma viruses such as SV40, vaccinia viruses, adenoviruses, fox pox viruses, pseudorabies viruses, retroviruses.
- such vectors in particular recombinant vectors, can equally be cosmid or phagemid derivatives.
- the nucleotide sequence in particular the nucleic acid according to the present invention, may be inserted in the recombinant expression vector by methods well known to a person skilled in the art such as, for example, those described in MOLECULAR CLONING: A LABORATORY MANUAL, Sambrook et al., 4th Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 2001.
- the vector in particular the recombinant vector, may also include nucleotide sequences that control the regulation of the expression, in particular of the nucleic acid (for use) according to the present invention, as well as nucleotide sequences permitting the expression, the transcription, and the translation, in particular of the nucleic acid (for use) according to the present invention. Typically, these sequences are selected according to the host cells used.
- an appropriate secretion signal can be integrated in the vector (for use) according to the present invention, in particular in a recombinant vector, so that the polypeptide or protein encoded by the nucleic acid (for use) according to the present invention, will be directed, for example towards the lumen of the endoplasmic reticulum, towards the periplasmic space, on the membrane or towards the extracellular environment.
- the choice of an appropriate secretion signal may facilitate subsequent protein purification.
- the present invention provides a host cell. preferably for use in the prevention and/or treatment of colorectal cancer, the host cell comprising a vector, in particular a recombinant vector, as described herein.
- the introduction of the vector, in particular the recombinant vector, into a host cell can be carried out according to methods that are well known to a person skilled in the art, such as those described in BASIC METHODS IN MOLECULAR BIOLOGY, Davis et al., 2nd ed., McGraw-Hill Professional Publishing, 1995, and MOLECULAR CLONING: A LABORATORY MANUAL, supra, including for example transfection as described above, e.g. by calcium phosphate, by DEAE dextran, or by cationic lipids; microinjection, electroporation, transduction or infection.
- the host cell can be, for example, bacterial cells such as E. coli , cells of fungi such as yeast cells and cells of Aspergillus, Streptomyces , insect cells, and/or any cell line, e.g. Chinese Hamster Ovary cells (CHO), C127 mouse cell line, BHK cell line of Syrian hamster cells, Human Embryonic Kidney 293 (HEK 293) cells.
- the host cell (for use) according to the present invention is mammalian, e.g., human, CHO, HEK293T, PER.C6, NS0, myeloma or hybridoma cells.
- Dendritic cells and dendritic cell lines are particularly preferred as a host cell.
- the choice of a culture medium depends in particular on the choice of the cell type and/or the cell line, whereby the skilled person is aware of suitable culture media, which are appropriate for a selected cell type and/or cell line.
- the host cells can be used, for example, to express a polypeptide or protein, in particular the complex (for use) according to the present invention, on the basis of the vector and/or the nucleic acid as described herein. After purification by standard methods, the expressed polypeptide or protein, in particular the complex (for use) according to the present invention, can be used as described herein.
- the present invention also provides a method for preparing the complex as defined herein, in particular wherein the complex is a polypeptide or protein. Said method comprises the steps of:
- the complex obtained by such a method according to the present invention is preferably a complex (for use) according to the present invention as described herein.
- kits and/or reagents may be used, for example BugBusterTM from Novagen.
- the method for preparing the complex as defined herein further comprises the following step:
- the method for preparing the complex as defined herein further comprises the following step:
- the complex as defined herein may also be prepared by synthetic chemistry methods, for example by solid-phase peptide synthesis.
- Purification of those peptides or proteins may be carried out by means of any technique known in the art for protein/peptide purification.
- Exemplary techniques include ion-exchange chromatography, hydrophobic interaction chromatography, and immunoaffinity methods.
- the present invention also provides a method for preparing the complex as defined herein comprising the steps of:
- the complex chemically synthesized in step (i) and purified in step (ii) comprises an amino acid sequences as described herein for a cell penetrating peptide, an amino acid sequence as described herein for a TLR peptide agonist, and, optionally if the at least one antigen and/or antigenic epitope is a peptide or a protein, an amino acid sequence as described herein for an antigen or antigenic epitope.
- the present invention also provides a method for preparing the complex as defined herein, wherein
- the present invention relates to a cell loaded with the complex as defined herein, preferably for use in the prevention and/or treatment of colorectal cancer.
- the cells loaded with the complex as defined herein are cells from a subject to be treated, in particular isolated cells from a subject to be treated, i.e. cells isolated from a subject to be treated.
- the term “subject” refers in particular to mammals.
- mammals contemplated by the present invention include human, primates, domesticated animals such as cattle, sheep, pigs, horses, laboratory rodents and the like. More preferably, the term “subject” refers to a human subject.
- treatment and “treating” and the like generally mean obtaining a desired pharmacological and physiological effect.
- the effect may be prophylactic in terms of preventing or partially preventing a disease, a symptom or a condition thereof and/or may be therapeutic in terms of a partial or complete cure of a disease, a condition, a symptom or an adverse effect attributed to the disease.
- treatment covers any treatment of a disease in a mammal, in particular in a human, and includes: (a) preventing the disease from occurring in a subject who may be predisposed to the disease but the outbreak of the disease has not yet occurred and/or the disease has not yet been diagnosed in this subject, for example a preventive early asymptomatic intervention; (b) inhibiting the disease, i.e., arresting or slowing down its development; or (c) relieving the disease, i.e., causing an at least partial regression of the disease and/or of at least one of its symptoms or conditions such as improvement or remediation of damage.
- prevention of a disease or disorder includes the prevention of the appearance or development of a cancer in an individual identified as at risk of developing said cancer, for instance due to past occurrence of said cancer in the circle of the individual's relatives, and prevention of infection with tumor promoting pathogens such as, for example, Epstein-Barr virus (EBV), Human papillomavirus (HPV), Hepatitis B virus (HBV), Hepatitis C virus (HCV), Human Herpes virus 8 (HHV8), human T-cell leukemia virus type 1 (HTLV-1), Merkel cell polyomavirus (MCV) and Helicobacter pylori .
- prevention/treatment of a cancer is the stabilization or delay of an already diagnosed cancer in an individual
- the cell loaded with the complex as defined herein is an antigen-presenting cell (APC).
- the antigen presenting cell is selected from the group consisting of a dendritic cell (DC), a macrophage and a B-cell.
- DC dendritic cell
- B-cell dendritic cells, in particular dendritic cells (conventional and/or plasmacytoid) isolated from a subject to be treated, are more preferred.
- antigen-presenting cells in particular dendritic cells
- methods to isolate antigen-presenting cells, in particular dendritic cells, from a subject include harvesting monocytes or hematopoietic stem cells from bone marrow, cord blood, or peripheral blood. They also include the use of embryonic stem (ES) cells and induced pluripotent stem cells (iPS).
- ES embryonic stem
- iPS induced pluripotent stem cells
- Antigen presenting cells, in particular dendritic cells or their precursors can be enriched by methods including elutriation and magnetic bead based separation, which may involve enrichment for CD14 + precursor cells.
- Methods to load the complex as defined herein into the cells preferably into the above-mentioned antigen presenting cells, more preferably into dendritic cells, and further to prepare such cells before administration to a subject are known to one skilled in the art.
- preparation of dendritic cells can include their culture or differentiation using cytokines that may include for example GM-CSF and IL-4.
- Dendritic cell lines may also be employed.
- Loading of the complex of the invention into the cells, preferably into APC, more preferably into the dendritic cells can involve co-incubation of the complex of the invention with the cells in culture, making use of the intrinsic properties of the cell penetrating peptide comprised by the complex as defined herein (i.e.
- Further culture of the cells, e.g. the dendritic cells, thus loaded to induce efficient maturation can include addition of cytokines including IL-1 ⁇ , IL-6, TNF ⁇ , PGE2, IFN ⁇ , and adjuvants which may include poly-IC, poly-ICLC (i.e. a synthetic complex of carboxymethylcellulose, polyinosinic-polycytidylic acid, and poly-L-lysine double-stranded RNA), and further TLR agonists and NLR (nucleotide-binding oligomerization domain-like receptors) agonists.
- cytokines including IL-1 ⁇ , IL-6, TNF ⁇ , PGE2, IFN ⁇
- adjuvants which may include poly-IC, poly-ICLC (i.e. a synthetic complex of carboxymethylcellulose, polyinosinic-polycytidylic acid, and poly-L-lysine double-stranded RNA), and further TLR agonists and NLR
- a method for preparing cells, in particular antigen presenting cells, loaded with the complex as defined herein may comprise the steps of:
- the cells are loaded with a complex as defined herein, wherein the complex is a polypeptide or a protein and used in the prevention and/or treatment of colorectal cancer.
- the complex is a polypeptide or a protein and used in the prevention and/or treatment of colorectal cancer.
- the cells loaded with a complex(es) according as defined herein and used in the prevention and/or treatment of colorectal cancer present the at least one antigen or antigenic epitope comprised by said complex at the cell surface in an MHC class I context and/or in an MHC class II context.
- the invention provides a composition, preferably for use in the prevention and/or treatment of colorectal cancer, the composition comprising at least one component selected from:
- composition according to the present invention comprises the complex as defined herein.
- composition (for use) according to the present invention may also comprises more than one of the above components (i) to (v).
- the composition (for use) according to the present invention may comprise at least two different complexes under (i), at least two different nucleic acids under (ii), at least two different vectors under (iii), at least two different host cells under (iv), and/or at least two different cells under (v); e.g., the composition (for use) according to the invention may comprise at least two different complexes (i) and/or at least two different nucleic acids (ii).
- the different complexes (i) comprised by the composition as described above may differ in either component a), i.e. in the cell penetrating peptides, in component b), i.e. in the antigens or antigenic epitopes or in the subsets of more than one antigen or antigenic epitope, or in component c), i.e.
- the different complexes (i) comprised by the composition as described above may differ in two out of the three components a), b), and c); or the different complexes (i) comprised by the composition as described above may differ in all three components a), b), and c) of the complex.
- the different nucleic acids (ii) comprised by the composition as described above may differ in that they encode such different complexes; the different vectors (iii) comprised by the composition as described above may differ in that they comprise such different nucleic acids; the different host cells (iv) comprised by the composition as described above may differ in that they comprise such different vectors; and the different cells loaded with a complex (v) comprised by the composition as described above may differ in that they are loaded with such different complexes.
- the present invention also provides a vaccine, preferably for use in the prevention and/or treatment of colorectal cancer, the vaccine comprising at least one component selected from:
- the vaccine (for use) according to the present invention comprises the complex as defined herein.
- composition (for use) according to the present invention regarding more than one of the components (i) to (v), also apply for the vaccine (for use) according to the present invention.
- the term “vaccine” refers to a biological preparation that provides innate and/or adaptive immunity, typically to a particular disease, preferably cancer.
- a vaccine supports in particular an innate and/or an adaptive immune response of the immune system of a subject to be treated.
- the antigen or antigenic epitope of the complex as defined herein typically leads to or supports an adaptive immune response in the patient to be treated, and the TLR peptide agonist of the complex as defined herein may lead to or support an innate immune response.
- inventive composition in particular the inventive vaccine, may also comprise a pharmaceutically acceptable carrier, adjuvant, and/or vehicle as defined below for the inventive pharmaceutical composition.
- a pharmaceutically acceptable carrier in the specific context of the inventive composition, in particular of the inventive vaccine, the choice of a pharmaceutically acceptable carrier is determined in principle by the manner in which the inventive composition, in particular the inventive vaccine, is administered.
- inventive composition, in particular the inventive vaccine can be administered, for example, systemically or locally.
- Routes for systemic administration in general include, for example, transdermal, oral, parenteral routes, including subcutaneous, intravenous, intramuscular, intraarterial, intradermal and intraperitoneal injections and/or intranasal administration routes.
- inventive compositions for local administration in general include, for example, topical administration routes but also intradermal, transdermal, subcutaneous, or intramuscular injections or intralesional, intracranial, intrapulmonal, intracardial, intranodal and sublingual injections.
- inventive composition, in particular the vaccines may be administered by an intradermal, subcutaneous, intranodal or intramuscular route.
- inventive composition, in particular the vaccine may be administered by subcutaneous, intranodal or intramuscular route.
- the inventive composition, in particular the vaccines may be administered by subcutaneous or intranodal route.
- the inventive composition, in particular the vaccines may be administered by subcutaneous route.
- inventive composition, in particular the inventive vaccines are therefore preferably formulated in liquid (or sometimes in solid) form.
- the suitable amount of the inventive composition, in particular the inventive vaccine, to be administered can be determined by routine experiments with animal models. Such models include, without implying any limitation, rabbit, sheep, mouse, rat, dog and non-human primate models.
- Preferred unit dose forms for injection include sterile solutions of water, physiological saline or mixtures thereof. The pH of such solutions should be adjusted to about 7.4.
- Suitable carriers for injection include hydrogels, devices for controlled or delayed release, polylactic acid and collagen matrices.
- Suitable pharmaceutically acceptable carriers for topical application include those which are suitable for use in lotions, creams, gels and the like. If the inventive composition, in particular the inventive vaccine, is to be administered orally, tablets, capsules and the like are the preferred unit dose form.
- the pharmaceutically acceptable carriers for the preparation of unit dose forms which can be used for oral administration are well known in the prior art. The choice thereof will depend on secondary considerations such as taste, costs and storability, which are not critical for the purposes of the present invention, and can be made without difficulty by a person skilled in the art.
- inventive composition in particular the inventive vaccine, can additionally contain one or more auxiliary substances in order to further increase its immunogenicity.
- various mechanisms can come into consideration in this respect. For example, compounds that permit the maturation of dendritic cells (DCs), for example lipopolysaccharides, TNF-alpha or CD40 ligand, form a first class of suitable auxiliary substances.
- DCs dendritic cells
- TNF-alpha or CD40 ligand form a first class of suitable auxiliary substances.
- auxiliary substance any agent that influences the immune system in the manner of a “danger signal” (LPS, GP96, etc.) or cytokines, such as GM-CSF, which allow an immune response produced by the immune-stimulating adjuvant according to the invention to be enhanced and/or influenced in a targeted manner.
- a “danger signal” LPS, GP96, etc.
- cytokines such as GM-CSF
- auxiliary substances are cytokines, such as monokines, lymphokines, interleukins or chemokines, that further promote the innate immune response, such as IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IFN-alpha, IFN-beta, IFN-gamma, GM-CSF, G-CSF, M-CSF, LT-beta or TNF-alpha, growth factors, such as hGH.
- cytokines such as monokines, lymphokines, interleukins
- emulsifiers such as, for example, Tween®
- wetting agents such as, for example, sodium lauryl sulfate
- colouring agents such as, for example, sodium lauryl sulfate
- taste-imparting agents pharmaceutical carriers
- tablet-forming agents such as, for example, stabilizers; antioxidants; preservatives.
- inventive composition in particular the inventive vaccine, can also additionally contain any further compound, which is known to be immune-stimulating due to its binding affinity (as ligands) to human Toll-like receptors TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, or due to its binding affinity (as ligands) to murine Toll-like receptors TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, TLR11, TLR12 or TLR13.
- binding affinity as ligands
- CpG nucleic acids in particular CpG-RNA or CpG-DNA.
- a CpG-RNA or CpG-DNA can be a single-stranded CpG-DNA (ss CpG-DNA), a double-stranded CpG-DNA (dsDNA), a single-stranded CpG-RNA (ss CpG-RNA) or a double-stranded CpG-RNA (ds CpG-RNA).
- the CpG nucleic acid is preferably in the form of CpG-RNA, more preferably in the form of single-stranded CpG-RNA (ss CpG-RNA).
- the CpG nucleic acid preferably contains at least one or more (mitogenic) cytosine/guanine dinucleotide sequence(s) (CpG motif(s)).
- CpG motif(s) cytosine/guanine dinucleotide sequence(s)
- at least one CpG motif contained in these sequences in particular the C (cytosine) and the G (guanine) of the CpG motif, is unmethylated. All further cytosines or guanines optionally contained in these sequences can be either methylated or unmethylated.
- the C (cytosine) and the G (guanine) of the CpG motif can also be present in methylated form.
- the present invention also provides a pharmaceutical composition, preferably for use in the prevention and/or treatment of colorectal cancer, in particular a vaccine composition as described above, and a method for treating a subject, preferably a mammalian subject, and most preferably a human subject, who is suffering from colorectal cancer.
- the present invention provides a pharmaceutical composition (for use) in the prevention and/or treatment of colorectal cancer comprising at least one complex as defined herein or at least one cell loaded with a complex as defined herein, and optionally a pharmaceutically acceptable carrier and/or vehicle, or any excipient, buffer, stabilizer or other materials well known to those skilled in the art, in particular the pharmaceutical composition comprising at least one complex as defined herein or at least one cell loaded with a complex as defined herein and a pharmaceutically acceptable carrier.
- the inventive pharmaceutical composition may in particular comprise a pharmaceutically acceptable carrier and/or vehicle.
- a pharmaceutically acceptable carrier typically includes the liquid or non-liquid basis of the inventive pharmaceutical composition. If the inventive pharmaceutical composition is provided in liquid form, the carrier will typically be pyrogen-free water; isotonic saline or buffered (aqueous) solutions, e.g phosphate, citrate etc. buffered solutions.
- water or preferably a buffer preferably an aqueous buffer
- a sodium salt preferably at least 30 mM of a sodium salt
- a calcium salt preferably at least 0.05 mM of a calcium salt
- optionally a potassium salt preferably at least 1 mM of a potassium salt.
- the sodium, calcium and, optionally, potassium salts may occur in the form of their halogenides, e.g. chlorides, iodides, or bromides, in the form of their hydroxides, carbonates, hydrogen carbonates, or sulfates, etc.
- examples of sodium salts include e.g.
- examples of the optional potassium salts include e.g. KCl, KI, KBr, K 2 CO 3 , KHCO 3 , K 2 SO 4
- examples of calcium salts include e.g. CaCl 2 , CaI 2 , CaBr 2 , CaCO 3 , CaSO 4 , Ca(OH) 2 .
- organic anions of the aforementioned cations may be contained in the buffer.
- the buffer suitable for injection purposes as defined above may contain salts selected from sodium chloride (NaCl), calcium chloride (CaCl 2 ) and optionally potassium chloride (KCl), wherein further anions may be present additional to the chlorides.
- CaCl 2 can also be replaced by another salt like KCl.
- the salts in the injection buffer are present in a concentration of at least 30 mM sodium chloride (NaCl), at least 1 mM potassium chloride (KCl) and at least 0.05 mM calcium chloride (CaCl 2 ).
- the injection buffer may be hypertonic, isotonic or hypotonic with reference to the specific reference medium, i.e.
- the buffer may have a higher, identical or lower salt content with reference to the specific reference medium, wherein preferably such concentrations of the afore mentioned salts may be used, which do not lead to damage of cells due to osmosis or other concentration effects.
- Reference media are e.g. liquids occurring in “in vivo” methods, such as blood, lymph, cytosolic liquids, or other body liquids, or e.g. liquids, which may be used as reference media in “in vitro” methods, such as common buffers or liquids.
- Such common buffers or liquids are known to a skilled person. Saline (0.9% NaCl) and Ringer-Lactate solution are particularly preferred as a liquid basis.
- the (pharmaceutical) composition which comprises the complex as described herein, further comprises arginine, such as L-arginine.
- one or more compatible solid or liquid fillers or diluents or encapsulating compounds may be used as well for the inventive pharmaceutical composition, which are suitable for administration to a subject to be treated.
- the term “compatible” as used herein means that these constituents of the inventive pharmaceutical composition are capable of being mixed with the complex as defined herein as defined above in such a manner that no interaction occurs which would substantially reduce the pharmaceutical effectiveness of the inventive pharmaceutical composition under typical use conditions.
- Pharmaceutically acceptable carriers, fillers and diluents must, of course, have sufficiently high purity and sufficiently low toxicity to make them suitable for administration to a subject to be treated.
- Some examples of compounds which can be used as pharmaceutically acceptable carriers, fillers or constituents thereof are sugars, such as, for example, lactose, glucose and sucrose; starches, such as, for example, corn starch or potato starch; cellulose and its derivatives, such as, for example, sodium carboxymethylcellulose, ethylcellulose, cellulose acetate; powdered tragacanth; malt; gelatin; tallow; solid glidants, such as, for example, stearic acid, magnesium stearate; calcium sulfate; vegetable oils, such as, for example, groundnut oil, cottonseed oil, sesame oil, olive oil, corn oil and oil from theobroma ; polyols, such as, for example, polypropylene glycol, glycerol, sorbitol, mannitol and polyethylene glycol; alginic acid.
- sugars such as, for example, lactose, glucose and sucrose
- starches such as, for example, corn
- the inventive pharmaceutical composition may be administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir.
- parenteral as used herein includes subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional, intracranial, transdermal, intradermal, intrapulmonal, intraperitoneal, intracardial, intraarterial, intranodal and sublingual injection or infusion techniques.
- the inventive pharmaceutical composition may be administered intradermally, intramuscularly, intranodally or subcutaneously.
- inventive pharmaceutical composition may be administered intramuscularly, intranodally or subcutaneously. Even more preferably the inventive pharmaceutical composition may be administered intranodally or subcutaneously. Most preferably, the inventive pharmaceutical composition may be administered subcutaneously. It is also particularly preferred that the inventive pharmaceutical composition may be administered subcutaneously or intradermally.
- the inventive pharmaceutical composition may be administered by parenteral injection, more preferably by subcutaneous, intravenous, intramuscular, intra-articular, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional, intracranial, transdermal, intradermal, intrapulmonal, intraperitoneal, intracardial, intraarterial, intranodal and sublingual injection or via infusion techniques.
- Sterile injectable forms of the inventive pharmaceutical compositions may be aqueous or oleaginous suspension. These suspensions may be formulated according to techniques known in the art using suitable dispersing or wetting agents and suspending agents.
- the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally-acceptable diluent or solvent, for example as a solution in 1.3-butanediol.
- a non-toxic parenterally-acceptable diluent or solvent for example as a solution in 1.3-butanediol.
- acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution.
- sterile, fixed oils are conventionally employed as a solvent or suspending medium.
- any bland fixed oil may be employed including synthetic mono- or di-glycerides.
- Fatty acids such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions.
- These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, such as carboxymethyl cellulose or similar dispersing agents that are commonly used in the formulation of pharmaceutically acceptable dosage forms including emulsions and suspensions.
- Other commonly used surfactants such as Tweens, Spans and other emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms may also be used for the purposes of formulation of the inventive pharmaceutical composition.
- the active ingredient will preferably be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability.
- isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
- Preservatives, stabilizers, buffers, antioxidants and/or other additives may be included, as required.
- administration is preferably in a “prophylactically effective amount” or a “therapeutically effective amount” (as the case may be), this being sufficient to show benefit to the individual.
- a “prophylactically effective amount” or a “therapeutically effective amount” as the case may be
- the actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated.
- inventive pharmaceutical composition as defined above may also be administered orally in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions.
- carriers commonly used include lactose and corn starch.
- Lubricating agents such as magnesium stearate, are also typically added.
- useful diluents include lactose and dried cornstarch.
- the active ingredient i.e. the inventive transporter cargo conjugate molecule as defined above, is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.
- the inventive pharmaceutical composition may also be administered topically, especially when the target of treatment includes areas or organs readily accessible by topical application, e.g. including diseases of the skin or of any other accessible epithelial tissue. Suitable topical formulations are readily prepared for each of these areas or organs.
- the inventive pharmaceutical composition may be formulated in a suitable ointment, containing the inventive immunostimulatory composition, particularly its components as defined above, suspended or dissolved in one or more carriers.
- Carriers for topical administration include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water.
- the inventive pharmaceutical composition can be formulated in a suitable lotion or cream.
- suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
- prescription of treatment e.g. decisions on dosage etc. when using the above pharmaceutical composition is typically within the responsibility of general practitioners and other medical doctors, and typically takes account of the disorder to be treated, the condition of the individual patient, the site of delivery, the method of administration and other factors known to practitioners. Examples of the techniques and protocols mentioned above can be found in REMINGTON'S PHARMACEUTICAL SCIENCES, 16th edition, Osol, A. (ed), 1980.
- the inventive pharmaceutical composition typically comprises a “safe and effective amount” of the components of the inventive pharmaceutical composition, in particular of the complex as defined herein as defined above and/or cells loaded with said complex.
- a “safe and effective amount” means an amount of the complex as defined herein that is sufficient to significantly induce a positive modification of a disease or disorder, i.e. an amount of the complex as defined herein or cells loaded with said complex, that elicits the biological or medicinal response in a tissue, system, animal or human that is being sought.
- An effective amount may be a “therapeutically effective amount” for the alleviation of the symptoms of the disease or condition being treated and/or a “prophylactically effective amount” for prophylaxis of the symptoms of the disease or condition being prevented.
- the term also includes the amount of active complex sufficient to reduce the progression of the disease, notably to reduce or inhibit the tumor growth or infection and thereby elicit the response being sought, in particular such response could be an immune response directed against the antigens or antigenic epitopes comprised in by the complex (i.e. an “inhibition effective amount”).
- an “inhibition effective amount” is small enough to avoid serious side-effects, that is to say to permit a sensible relationship between advantage and risk. The determination of these limits typically lies within the scope of sensible medical judgment.
- a “safe and effective amount” of the components of the inventive pharmaceutical composition, particularly of the complex as defined herein as defined above, will furthermore vary in connection with the particular condition to be treated and also with the age and physical condition of the patient to be treated, the body weight, general health, sex, diet, time of administration, rate of excretion, drug combination, the activity of the specific components a), b), and c) of the complex as defined herein as defined above, the severity of the condition, the duration of the treatment, the nature of the accompanying therapy, of the particular pharmaceutically acceptable carrier used, and similar factors, within the knowledge and experience of the accompanying doctor.
- the inventive pharmaceutical composition may be used for human and also for veterinary medical purposes, preferably for human medical purposes, as a pharmaceutical composition in general or as a vaccine.
- compositions in particular vaccine compositions, or formulations according to the invention may be administered as a pharmaceutical formulation which can contain a complex as defined herein in any form described herein.
- pharmaceutical formulation and “pharmaceutical composition” as used in the context of the present invention refer in particular to preparations which are in such a form as to permit biological activity of the active ingredient(s) to be unequivocally effective and which contain no additional component which would be toxic to subjects to which the said formulation would be administered.
- an “efficacy” of a treatment can be measured based on changes in the course of a disease in response to a use or a method according to the present invention.
- the efficacy of a treatment of cancer can be measured by a reduction of tumor volume, and/or an increase of progression free survival time, and/or a decreased risk of relapse post-resection for primary cancer.
- assessment of efficacy can be by the spectrum of clinical patterns of antitumor response for immunotherapeutic agents through novel immune-related response criteria (irRC), which are adapted from Response Evaluation Criteria in Solid Tumors (RECIST) and World Health Organization (WHO) criteria ( J. Natl. Cancer inst.
- the efficacy of prevention of infectious disease is ultimately assessed by epidemiological studies in human populations, which often correlates with titres of neutralizing antibodies in sera, and induction of multifunctional pathogen specific T cell responses.
- Preclinical assessment can include resistance to infection after challenge with infectious pathogen.
- Treatment of an infectious disease can be measured by inhibition of the pathogen's growth or elimination of the pathogen (and, thus, absence of detection of the pathogen), correlating with pathogen specific antibodies and/or T cell immune responses.
- compositions in particular vaccine compositions, or formulations according to the invention may also be administered as a pharmaceutical formulation which can contain antigen presenting cells loaded with a complex according to the invention in any form described herein.
- the vaccine and/or the composition (for use) according to the present invention may also be formulated as pharmaceutical compositions and unit dosages thereof, in particular together with a conventionally employed adjuvant, immunomodulatory material, carrier, diluent or excipient as described above and below, and in such form may be employed as solids, such as tablets or filled capsules, or liquids such as solutions, suspensions, emulsions, elixirs, or capsules filled with the same, all for oral use, or in the form of sterile injectable solutions for parenteral (including subcutaneous and intradermal) use by injection or continuous infusion.
- injectable compositions are typically based upon injectable sterile saline or phosphate-buffered saline or other injectable carriers known in the art.
- Such pharmaceutical compositions and unit dosage forms thereof may comprise ingredients in conventional proportions, with or without additional active compounds or principles, and such unit dosage forms may contain any suitable effective amount of the active ingredient commensurate with the intended daily dosage range to be employed.
- suitable adjuvants and/or immunomodulatory materials include MPL® (Corixa), aluminum-based minerals including aluminum compounds (generically called Alum), AS01-4, MF59, CalciumPhosphate, Liposomes, Iscom, polyinosinic:polycytidylic acid (polyIC), including its stabilized form poly-ICLC (Hiltonol), CpG oligodeoxynucleotides, Granulocyte-macrophage colony-stimulating factor (GM-CSF), lipopolysaccharide (LPS), Montanide, polylactide co-glycolide (PLG), Flagellin, Soap Bark tree saponins (QS21), amino alkyl glucosamide compounds (e.g.
- RC529 two component antibacterial peptides with synthetic oligodeoxynucleotides (e.g. IC31), Imiquimod, Resiquimod, Immunostimulatory sequences (ISS), monophosphoryl lipid A (MPLA), Fibroblast-stimulating lipopeptide (FSL1), and anti-CD40 antibodies.
- synthetic oligodeoxynucleotides e.g. IC31
- Imiquimod Imiquimod
- Resiquimod Immunostimulatory sequences
- MPLA monophosphoryl lipid A
- FSL1 Fibroblast-stimulating lipopeptide
- compositions in particular pharmaceutical compositions and vaccines, (for use) according to the present invention may be liquid formulations including, but not limited to, aqueous or oily suspensions, solutions, emulsions, syrups, and elixirs.
- the compositions may also be formulated as a dry product for reconstitution with water or other suitable vehicle before use.
- Such liquid preparations may contain additives including, but not limited to, suspending agents, emulsifying agents, non-aqueous vehicles and preservatives.
- Suspending agents include, but are not limited to, sorbitol syrup, methyl cellulose, glucose/sugar syrup, gelatin, hydroxyethyl cellulose, carboxymethyl cellulose, aluminum stearate gel, and hydrogenated edible fats.
- Emulsifying agents include, but are not limited to, lecithin, sorbitan monooleate, and acacia.
- Preservatives include, but are not limited to, methyl or propyl p-hydroxybenzoate and sorbic acid.
- Dispersing or wetting agents include but are not limited to poly(ethylene glycol), glycerol, bovine serum albumin, Tween®, Span®.
- compositions in particular pharmaceutical compositions and vaccines, (for use) according to the present invention may also be formulated as a depot preparation, which may be administered by implantation or by intramuscular injection.
- compositions in particular pharmaceutical compositions and vaccines, (for use) according to the present invention may also be solid compositions, which may be in the form of tablets or lozenges formulated in a conventional manner.
- tablets and capsules for oral administration may contain conventional excipients including, but not limited to, binding agents, fillers, lubricants, disintegrants and wetting agents.
- Binding agents include, but are not limited to, syrup, accacia, gelatin, sorbitol, tragacanth, mucilage of starch and polyvinylpyrrolidone.
- Fillers include, but are not limited to, lactose, sugar, microcrystalline cellulose, maizestarch, calcium phosphate, and sorbitol.
- Lubricants include, but are not limited to, magnesium stearate, stearic acid, talc, polyethylene glycol, and silica.
- Disintegrants include, but are not limited to, potato starch and sodium starch glycollate.
- Wetting agents include, but are not limited to, sodium lauryl sulfate. Tablets may be coated according to methods well known in the art.
- compositions in particular pharmaceutical compositions and vaccines, (for use) according to the present invention may also be administered in sustained release forms or from sustained release drug delivery systems.
- compositions in particular pharmaceutical compositions and vaccines, (for use) according to the present invention may be adapted for delivery by repeated administration.
- compositions in particular pharmaceutical compositions and vaccines, (for use) according to the present invention or in the context of their preparation are set out in “Part 5 of Remington's “The Science and Practice of Pharmacy”, 22nd Edition, 2012, University of the Sciences in Philadelphia, Lippincott Williams & Wilkins”.
- the present invention also relates to a kit-of-parts, preferably for use in the prevention and/or treatment of colorectal cancer, the kit of parts comprising at least one of:
- the kit-of-parts of the invention may comprise more than one component (i) to (v).
- the kit-of-parts according to the present invention may comprise at least two different complexes under (i), at least two different nucleic acids under (ii), at least two different vectors under (iii), at least two different host cells under (iv), and/or at least two different cells under (v); e.g., the kit-of-parts of the invention may comprise at least two different complexes (i) and/or at least two different nucleic acids (ii).
- the different complexes (i) comprised by the kit-of-parts as described above may differ in either component a), i.e. in the cell penetrating peptides, in component b), i.e. in the antigens or antigenic epitopes or in the subsets of more than one antigen or antigenic epitope, or in component c), i.e.
- the different complexes (i) comprised by the kit-of-parts as described above may differ in two out of the three components a), b), and c); or the different complexes (i) comprised by the kit-of-parts as described above may differ in all three components a), b), and c) of the complex.
- the different nucleic acids (ii) comprised by the kit-of-parts as described above may differ in that they encode such different complexes;
- the different vectors (iii) comprised by the kit-of-parts as described above may differ in that they comprise such different nucleic acids;
- the different host cells (iv) comprised by the kit-of-parts as described above may differ in that they comprise such different vectors;
- the different cells loaded with a complex (v) comprised by the kit-of-parts as described above may differ in that they are loaded with such different complexes.
- kit-of-parts may be packaged in one or more containers.
- the above components may be provided in a lyophilized or dry form or dissolved in a suitable buffer.
- the kit may also comprise additional reagents including, for instance, preservatives, growth media, and/or buffers for storage and/or reconstitution of the above-referenced components, washing solutions, and the like.
- additional reagents including, for instance, preservatives, growth media, and/or buffers for storage and/or reconstitution of the above-referenced components, washing solutions, and the like.
- the kit-of-parts according to the present invention may optionally contain instructions of use.
- the present invention also provides a vaccination kit for treating, preventing and/or stabilizing colorectal cancer, comprising the pharmaceutical composition as described herein or a vaccine as described herein and instructions for use of said pharmaceutical composition or of said vaccine in the prevention and/or treatment of colorectal cancer.
- the present invention also provides a kit comprising the complex as described herein, the cell as described herein, the composition as described herein, the vaccine as described herein, and/or the pharmaceutical composition as described herein.
- such a kit further comprises a package insert or instruction leaflet with directions to treat colorectal cancer by using the complex (for use) according to the present invention as described herein, the cell as described herein, the composition as described herein, the vaccine as described herein, and/or the pharmaceutical composition as described herein.
- a package insert or instruction leaflet with directions to treat colorectal cancer by using the complex (for use) according to the present invention as described herein, the cell as described herein, the composition as described herein, the vaccine as described herein, and/or the pharmaceutical composition as described herein.
- the kit comprises a chemotherapeutic agent, a targeted drug and/or an immunotherapeutic agent, such as an immune checkpoint modulator, as described herein in the context of the combination for use as described herein.
- the present invention provides the use of any one of: (i) a complex as described herein, and/or (ii) cells, such as antigen-presenting cells, loaded with a complex as described herein, (for the preparation of a medicament) for the prevention, treatment or stabilization of colorectal cancer. Accordingly, the present invention provides any one of: (i) a complex as described herein, and/or (ii) cells, such as antigen-presenting cells, loaded with a complex as described herein, for use in the prevention, treatment or stabilization of colorectal cancer.
- the present invention also provides a complex for use according to the present invention, which allows the transport and presentation of the at least one antigen or antigenic epitope comprised by the complex at the cell surface of antigen presenting cells in an MHC class I and/or MHC class 11 context, for use in vaccination and/or immunotherapy.
- the present invention provides a method of preventing, treating or repressing colorectal cancer, wherein said method comprises administering any one of: (i) a complex of the invention, (ii) cells, such as antigen-presenting cells, loaded with a complex of the invention, or (iii) a pharmaceutical formulation of (i) to (ii), to said subject.
- the present invention provides a method for eliciting or improving, in a subject, an immune response against one or multiple epitopes that is dependent on CD4 + helper T cells and/or CD8 + cytotoxic T cells, wherein said method comprises administering any one of: (i) a complex for use according to the present invention, and/or (ii) cells, such as antigen-presenting cells, loaded with said complex, or (iii) a pharmaceutical formulation of (i) to (ii), to said subject.
- An immune response that is dependent on CD4 + and/or CD8 + response can be determined by evaluating an inflammatory response, a pro-inflammatory cytokine response, including an increase in the expression of one or more of IFN- ⁇ , TNF- ⁇ and IL-2 mRNA or protein relative to the level before administration of the compounds of the invention. It can also be measured by an increase in the frequency or absolute number of antigen-specific T cells after administration of the compounds of the invention, measured by HLA-peptide multimer staining, ELISPOT assays, and delayed type hypersensitivity tests. It can also be indirectly measured by an increase in antigen-specific serum antibodies that are dependent on antigen-specific T helper cells.
- the present invention also provides a method for eliciting or improving, in a subject, an immune response against one or multiple antigens or antigenic epitopes that is restricted by multiple MHC class I molecules and/or multiple MHC class II molecules, wherein said method comprises administering any one of: (i) a complex for use according to the present invention, and/or (ii) cells, such as antigen-presenting cells, loaded with said complex, or (iii) a pharmaceutical formulation of (i) to (ii), to said subject.
- a method for eliciting or improving, in a subject, an immune response against multiple epitopes as described herein, that is restricted by multiple MHC class I molecules and/or multiple MHC class II molecules can be determined by evaluating a cytokine response, including an increase in the expression of one or more of IFN- ⁇ , TNF- ⁇ and IL-2 mRNA or protein relative to the level before administration of the compounds of the invention, after in vitro stimulation of T cells with individual peptides binding to discrete MHC class I and class II molecules on antigen presenting cells. Restriction to different MHC molecules can also be validated by using antigen presenting cells expressing different MHC molecules, or by using MHC blocking antibodies. It can also be measured by an increase in the frequency or absolute number of antigen-specific T cells after administration of the compounds of the invention, measured by HLA-peptide multimer staining, which uses multimers assembled with discrete MHC molecules.
- the immune response is directed against one or multiple epitopes of a tumor-associated antigen or a tumor-specific antigen as, for instance, a combination of epitopes as described herein.
- the immune response may be directed against multiple epitopes of an antigenic protein from a pathogen.
- the methods according to the present invention as described herein may be for eliciting or improving, in a subject, an immune response against one or multiple epitopes that is restricted by MHC class I molecules and/or MHC class II molecules.
- the present invention thus provides a method for preventing and/or treating colorectal cancer or initiating, enhancing or prolonging an anti-tumor-response in a subject in need thereof comprising administering to the subject a complex comprising:
- the complex (for use) according to the present invention as described herein, the nucleic acid as described herein, the cell as described herein, the composition as described herein, the vaccine as described herein, and/or the pharmaceutical composition as described herein is administered to the subject.
- the subject has colorectal cancer and/or was diagnosed with colorectal cancer.
- the present invention provides the use of any one of: (i) a complex as described herein, and/or (ii) cells, such as antigen-presenting cells, loaded with the complex as described herein, for the preparation of an imaging composition for imaging techniques in the context of (diagnosis of) colorectal cancer or for the preparation of a diagnosis composition (“diagnostic compositions”) for diagnosing colorectal cancer.
- a diagnostic composition for diagnosing colorectal cancer according to the present invention comprises at least one component selected from:
- the diagnostic composition according to the present invention comprises the complex as described above.
- the complex (for use) according to the present invention, the nucleic acid as described herein, the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention, the inventive composition, the inventive pharmaceutical composition or the inventive vaccine or, most preferably, the inventive diagnostic composition may be utilized in diagnosis as a diagnostic tool, e.g. in (in vivo or in vitro) assays, e.g. in immunoassays, to detect, prognose, diagnose, or monitor colorectal cancer.
- (in vitro) assays may be performed by delivering the complex (for use) according to the present invention, the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention, the inventive composition, the inventive pharmaceutical composition or the inventive vaccine or, most preferably, the inventive diagnostic composition to target cells typically selected from e.g. cultured animal cells, human cells or micro-organisms, and to monitor the cell response by biophysical methods typically known to a skilled person.
- the target cells typically used therein may be cultured cells (in vitro), e.g. cells isolated from human or animal body, such as blood cells isolated from human or animal body, or in vivo cells, i.e.
- markers or labels which may be contained in the complex (for use) according to the present invention and, in particular, in the diagnostic composition according to the present invention.
- the invention provides a method of diagnosing colorectal cancer in a subject, wherein said method comprises administering any one of: (i) a complex of the invention, (ii) cells, such as antigen-presenting cells, loaded with the complex of the invention, or (iii) a pharmaceutical formulation of (i) to (ii), to said subject or to said subject's sample ex vivo.
- uses and methods according to the present invention comprise administration of a complex (for use) according to the invention.
- uses and methods according to the present invention comprise administration of more than one complex, cells, or pharmaceutical formulation according to the invention.
- at least two different complexes are used or administered, wherein each complex comprises at least one antigen or antigenic epitope and said antigen or antigenic epitope or (if more than one antigen or antigenic epitope is comprised by said complex) said subset of antigens or antigenic epitopes are different between the two complexes.
- the different complexes (i) comprised by the composition as described above may differ in either component a), i.e. in the cell penetrating peptides, in component b), i.e. in the antigens or antigenic epitopes or in the subsets of more than one antigen or antigenic epitope, or in component c), i.e.
- the different complexes (i) comprised by the composition as described above may differ in two out of the three components a), b), and c); or the different complexes (i) comprised by the composition as described above may differ in all three components a), b), and c) of the complex.
- the different nucleic acids (ii) comprised by the composition as described above may differ in that they encode such different complexes; the different vectors (iii) comprised by the composition as described above may differ in that they comprise such different nucleic acids; the different host cells (iv) comprised by the composition as described above may differ in that they comprise such different vectors; and the different cells loaded with a complex (v) comprised by the composition as described above may differ in that they are loaded with such different complexes.
- the cells according to the present invention may be antigen presenting cells, in particular dendritic cells, more preferably dendritic cells from the subject to be treated.
- the complex (for use) according to the present invention; the nucleic acid (for use) according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be administered in any manner as described above, including enterally, such as orally or rectally, and parenterally, such as intravenously or combinations thereof.
- Parenteral administration includes, but is not limited to, intravenous, intra-arterial, intra-peritoneal, subcutaneous, intradermal and intramuscular.
- the complex for use according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex for use according to the present invention; the inventive composition; the inventive pharmaceutical composition and/or the inventive vaccine are administered via an enteral route of administration, such as oral, sublingual and rectal.
- the complex (for use) according to the present invention; the nucleic acid ((for use)) according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may also be preferably administered via topical, intratumoral, intradermal, subcutaneous, intramuscular, intranasal, or intranodal route.
- the complex (for use) according to the present invention; the nucleic acid ((for use)) according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may also be administered in the form of an implant, which allows slow release of the compositions as well as a slow controlled i.v. infusion.
- the complex (for use) according to the present invention; the nucleic acid (for use) according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be administered subcutaneously or intradermally.
- the administration of complex (for use) according to the present invention; the nucleic acid (for use) according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may require multiple successive injections/administrations.
- the administration may be repeated at least two times, for example once as primary immunization injections/administration and, later, as booster injections/administration.
- the complex (for use) according to the present invention; the nucleic acid (for use) according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be administered repeatedly or continuously.
- the complex (for use) according to the present invention; the nucleic acid (for use) according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be administered repeatedly or continuously for a period of at least 1, 2, 3, or 4 weeks; 2, 3, 4, 5, 6, 8, 10, or 12 months; or 2, 3, 4, or 5 years.
- the complex (for use) according to the present invention may be administered twice per day, once per day, every two days, every three days, once per week, every two weeks, every three weeks, once per month or every two months.
- the complex (for use) according to the present invention may be administered repeatedly, for example once per week or (once) every two weeks.
- the cell penetrating peptide, components a), b), and c), i.e. the at least one antigen or antigenic epitope and the at least one TLR peptide agonist, composing the complex (for use) according to the present invention may be contained in separate compositions which are mixed just before administration or which are administered simultaneously to the subject in need thereof.
- the complex (for use) according to the present invention; the nucleic acid (for use) according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be administered directly to a patient using the administration routes as described above, in particular for pharmaceutical compositions.
- the complex (for use) according to the present invention; the nucleic acid (for use) according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine may be administered to a patient using an ex vivo approach, e.g.
- the pharmaceutical composition, the vaccine or the inventive transporter cargo conjugate molecule as defined above into cells, preferably autologous cells, i.e. cells derived from the patient to be treated, and transplanting these cells into the site of the patient to be treated, optionally subsequent to storing and/or culturing these cells prior to treatment.
- autologous cells i.e. cells derived from the patient to be treated
- the dosage administered, as single or multiple doses, to an individual will vary depending upon a variety of factors, including pharmacokinetic properties, subject conditions and characteristics (sex, age, body weight, health, size), extent of symptoms, concurrent treatments, frequency of treatment and the effect desired.
- the therapeutically effective dose of a complex (for use) according to the present invention is from about 0.01 mg to 5 mg per injection, in particular from about 0.1 mg to 2 mg per injection, or from about 0.01 nmol to 1 mmol per injection, in particular from 1 nmol to 1 mmol per injection, preferably from 1 ⁇ mol to 1 mmol per injection.
- the therapeutically effective dose of an antigen presenting cell loaded with a complex (for use) according to the present invention is from about 0.2 million cells to 2 million cells per injection.
- the administration of the complex (for use) according to the present invention; the nucleic acid (for use) according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine in the methods and uses according to the invention can be carried out alone or in combination with a co-agent useful for treating and/or stabilizing colorectal cancer.
- the administration of the pharmaceutical compositions in the methods and uses according to the invention can be carried out in combination with substances used in conventional chemotherapy directed against solid colorectal tumors and for control of establishment of metastases or any other molecule that act by triggering programmed cell death e.g. for example a co-agent selected from Tumor Necrosis Family Members including, but not limited, to Fas Ligand and tumor necrosis factor (TNF)-related apoptosis inducing (TRAIL) ligand.
- TNF tumor necrosis factor
- TRAIL tumor necrosis factor
- the administration of the complex (for use) according to the present invention; the nucleic acid (for use) according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine in the methods and uses according to the present invention can be carried out in parallel of radiotherapy.
- the invention encompasses the administration of the complex (for use) according to the present invention; the nucleic acid (for use) according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine, wherein it is administered to a subject prior to, simultaneously or sequentially with other therapeutic regimens or co-agents useful for treating, and/or stabilizing a colorectal cancer and/or preventing colorectal cancer relapsing (e.g. multiple drug regimens), in a therapeutically effective amount.
- Said complex, cell, composition, vaccine or pharmaceutical composition, that is administered simultaneously with said co-agents can be administered in the same or different composition(s) and by the same or different route(s) of administration.
- Said other therapeutic regimens or co-agents may be selected from the group consisting of radiation therapy, chemotherapy, surgery, targeted therapy (including small molecules, peptides and monoclonal antibodies), and anti-angiogenic therapy.
- Anti-angiogenic therapy is defined herein as the administration of an agent that directly or indirectly targets tumor-associated vasculature.
- the present invention also provides a combination of
- chemotherapeutic agents are cytotoxic, i.e. they act by killing cells that divide rapidly, one of the main properties of most cancer cells.
- Preferred chemotherapeutic agents for combination with the complex as defined herein are such chemotherapeutic agents known to the skilled person for treatment of colorectal cancer.
- Preferred chemotherapeutic agents for combination include 5-Fluorouracil (5-FU), Capecitabine (Xeloda®), Irinotecan (Camptosar®) and Oxaliplatin (Eloxatin®).
- the complex as defined herein is combined with a combined chemotherapy, preferably selected from (i) FOLFOX (5-FU, leucovorin, and oxaliplatin); (ii) CapeOx (Capecitabine and oxaliplatin); (iii) 5-EU and leucovorin; (iv) FOLFOXIRI (leucovorin, 5-FU, oxaliplatin, and irinotecan); and (v) FOLFIRI (5-FU, leucovorin, and irinotecan).
- a combined chemotherapy preferably selected from (i) FOLFOX (5-FU, leucovorin, and oxaliplatin); (ii) CapeOx (Capecitabine and oxaliplatin); (iii) 5-EU and leucovorin; (iv) FOLFOXIRI (leucovorin, 5-FU, oxaliplatin, and irinotecan); and (v) FOLFIRI (5-FU,
- a combination with (i) FOLFOX (5-EU, leucovorin, and oxaliplatin); (ii) CapeOx (Capecitabine and oxaliplatin); or (iii) 5-FU and leucovorin is preferred.
- FOLFOXIRI leucovorin, 5-FU, oxaliplatin, and irinotecan
- FOLFOX 5-FU, leucovorin, and oxaliplatin
- FOLFIRI 5-EU, leucovorin, and irinotecan
- Targeted drugs for combination with the complex as defined herein for treatment of colorectal cancer include VEGF-targeted drugs and EGFR-targeted drugs.
- VEGF-targeted drugs include Bevacizumab (Avastin®), ramucirumab (Cyramza®) or ziv-aflibercept (Zaltrap®).
- EGFR-targeted drugs include Cetuximab (Erbitux®), panitumumab (Vectibix®) or Regorafenib (Stivarga®).
- Immunotherapeutic agents for combination with the complex as defined herein for treatment of colorectal cancer include vaccines, chimeric antigen receptors (CARs), checkpoint modulators and oncolytic virus therapies.
- Preferred vaccines for combination with the complex as defined herein for treatment of colorectal cancer include TroVax, OncoVax, IMA910, ETBX-011, MicOryx, EP-2101, MKC1106-PP, CDX-1307, V934N935, MelCancerVac, Imprime PGG, FANG, Tecemotide, AlloStim, DCVax, GI-6301, AVX701, OCV-C02.
- Artificial T cell receptors also known as chimeric T cell receptors, chimeric immunoreceptors, chimeric antigen receptors (CARs) are engineered receptors, which graft an arbitrary specificity onto an immune effector cell. Artificial T cell receptors (CARs) are preferred in the context of adoptive cell transfer. To this end, T cells are removed from a patient and modified so that they express receptors specific to colorectal cancer. The T cells, which can then recognize and kill the cancer cells, are reintroduced into the patient.
- an immune checkpoint modulator refers to a molecule or to a compound that modulates (e.g., totally or partially reduces, inhibits, interferes with, activates, stimulates, increases, reinforces or supports) the function of one or more checkpoint molecules.
- an immune checkpoint modulator may be an “immune checkpoint inhibitor” (also referred to as “checkpoint inhibitor” or “inhibitor”) or an “immune checkpoint activator” (also referred to as “checkpoint activator” or “activator”).
- an “immune checkpoint inhibitor” (also referred to as “checkpoint inhibitor” or “inhibitor”) totally or partially reduces, inhibits, interferes with, or negatively modulates the function of one or more checkpoint molecules.
- An “immune checkpoint activator” (also referred to as “checkpoint activator” or “activator”) totally or partially activates, stimulates, increases, reinforces, supports or positively modulates the function of one or more checkpoint molecules.
- Immune checkpoint modulators are typically able to modulate (i) self-tolerance and/or (ii) the amplitude and/or the duration of the immune response.
- the immune checkpoint modulator used according to the present invention modulates the function of one or more human checkpoint molecules and is, thus, a “human checkpoint inhibitor”.
- Checkpoint molecules are molecules, such as proteins, are typically involved in immune pathways and, for example, regulate T-cell activation, T-cell proliferation and/or T-cell function. Accordingly, the function of checkpoint molecules, which is modulated (e.g., totally or partially reduced, inhibited, interfered with, activated, stimulated, increased, reinforced or supported) by checkpoint modulators, is typically the (regulation of) T-cell activation, T-cell proliferation and/or T cell function. Immune checkpoint molecules thus regulate and maintain self-tolerance and the duration and amplitude of physiological immune responses.
- immune checkpoint molecules belong to the B7:CD28 family or to the tumor necrosis factor receptor (TNFR) super family and, by the binding of specific ligands, activate signaling molecules that are recruited to the cytoplasmic domain (cf. Susumu Suzuki et al., 2016: Current status of immunotherapy. Japanese Journal of Clinical Oncology, 2016: doi: 10.1093/jjco/hyv201 [Epub ahead of print]; in particular Table 1).
- the immune checkpoint modulator for combination with the complex as defined herein for treatment of colorectal cancer is an activator or an inhibitor of one or more immune checkpoint point molecule(s) selected from CD27, CD28, CD40, CD122, CD137, OX40, GITR, ICOS, A2AR, B7-H3, B7-H4, BTLA, CD40, CTLA-4, IDO, KIR, LAG3, PD-1, TIM-3, VISTA, CEACAM1, GARP, PS, CSF1R, CD94/NKG2A, TDO, GITR, TNFR and/or FasR/DcR3; or an activator or an inhibitor of one or more ligands thereof.
- one or more immune checkpoint point molecule(s) selected from CD27, CD28, CD40, CD122, CD137, OX40, GITR, ICOS, A2AR, B7-H3, B7-H4, BTLA, CD40, CTLA-4, IDO, KIR, L
- the immune checkpoint modulator is an activator of a (co-)stimulatory checkpoint molecule or an inhibitor of an inhibitory checkpoint molecule or a combination thereof.
- the immune checkpoint modulator is more preferably (i) an activator of CD27, CD28, CD40, CD122, CD137, OX40, GITR and/or ICOS or (ii) an inhibitor of A2AR, B7-H3, B7-H4, BTLA, CD40, CTLA-4, IDO, KIR, LAG3, PD-1, PDL-1, PD-L2, TIM-3, VISTA, CEACAM1, GARP, PS, CSF1 R, CD94/NKG2A, TDO, TNFR and/or FasR/DcR3.
- the immune checkpoint modulator is an inhibitor of an inhibitory checkpoint molecule (but preferably no inhibitor of a stimulatory checkpoint molecule). Accordingly, the immune checkpoint modulator is even more preferably an inhibitor of A2AR, B7-H3, B7-H4, BTLA, CTLA-4, IDO, KIR, LAG3, PD-1, PDL-1, PD-L2, TIM-3, VISTA, CEACAM1, GARP, PS, CSF1 R, CD94/NKG2A, TDO, TNFR and/or DcR3 or of a ligand thereof.
- the immune checkpoint modulator is an activator of a stimulatory or costimulatory checkpoint molecule (but preferably no activator of an inhibitory checkpoint molecule). Accordingly, the immune checkpoint modulator is more preferably an activator of CD27, CD28, CD40, CD122, CD137, OX40, GITR and/or ICOS or of a ligand thereof.
- the immune checkpoint modulator is a modulator of the CD40 pathway, of the IDO pathway, of the CTLA-4 pathway and/or of the PD-1 pathway.
- the immune checkpoint modulator is preferably a modulator of CD40, CTLA-4, PD-L1, PD-L2, PD-1 and/or IDO, more preferably the immune checkpoint modulator is an inhibitor of CTLA-4, PD-L1, PD-L2, PD-1 and/or IDO or an activator of CD40, even more preferably the immune checkpoint modulator is an inhibitor of CTLA-4, PD-L1, PD-1 and/or IDO and most preferably the immune checkpoint modulator is an inhibitor of CTLA-4 and/or PD-1.
- the immune checkpoint modulator is a modulator of the CD40 pathway, of the IDO pathway, of the LAG3 pathway, of the CTLA-4 pathway and/or of the PD-1 pathway.
- the immune checkpoint modulator is preferably a modulator of CD40, LAG3, CTLA-4, PD-L1, PD-L2, PD-1 and/or IDO, more preferably the immune checkpoint modulator is an inhibitor of CTLA-4, PD-L1, PD-L2, PD-1, LAG3, and/or IDO or an activator of CD40, even more preferably the immune checkpoint modulator is an inhibitor of CTLA-4, PD-L1, PD-1, LAG3 and/or IDO, even more preferably the immune checkpoint modulator is an inhibitor of LAG3, CTLA-4 and/or PD-1, and most preferably the immune checkpoint modulator is an inhibitor of CTLA-4 and/or PD-1.
- the checkpoint modulator for combination with the complex as defined herein for treatment of colorectal cancer may be selected from known modulators of the CD40 pathway, the CTLA-4 pathway or the PD-1 pathway.
- the checkpoint modulator for combination with the complex as defined herein for treatment of colorectal cancer may be selected from known modulators of the CD40 pathway, the LAG3 pathway, the CTLA-4 pathway or the PD-1 pathway.
- the immune checkpoint modulator is a PD-1 inhibitor.
- Preferred inhibitors of the CTLA-4 pathway and of the PD-1 pathway include the monoclonal antibodies Yervoy® (Ipilimumab; Bristol Myers Squibb) and Tremelimumab (Pfizer/Medlmmune) as well as Opdivo® (Nivolumab; Bristol Myers Squibb), Keytruda (Pembrolizumab; Merck), Durvalumab (MedImmune/AstraZeneca), MED14736 (AstraZeneca; cf. WO 2011/066389 A1), MPDL3280A (Roche/Genentech; cf. U.S. Pat. No.
- More preferred checkpoint inhibitors include the CTLA-inhibitors Yervoy® (Ipilimumab; Bristol Myers Squibb) and Tremelimumab (Pfizer/Medlmmune) as well as the PD-1 inhibitors Opdivo® (Nivolumab; Bristol Myers Squibb), Keytruda® (Pembrolizumab; Merck), Pidilizumab (CT-011; CureTech), MED10680 (AMP-514; AstraZeneca), AMP-224 and Lambrolizumab (e.g. disclosed as hPD109A and its humanized derivatives h409A11, h409A16 and h409A17 in WO2008/156712; Hamid 0.
- LAG3 inhibitor is the anti-LAG3 monoclonal antibody BMS-986016 (Bristol-Myers Squibb).
- Other preferred examples of a LAG3 inhibitor include LAG525 (Novartis), IMP321 (Immutep) and LAG3-Ig as disclosed in WO 2009/044273 A2 and in Brumble et al., 2009, Clin. Cancer Res.
- the immune checkpoint modulator is not a modulator of CD40.
- the immune checkpoint modulator is not a CD40 ligand. It is also preferred that the immune checkpoint modulator is not an anti-CD40 antibody.
- the immune checkpoint modulator for combination with the complex as defined herein for treatment of colorectal cancer is selected from the group consisting of Pembrolizumab, Ipilimumab, Nivolumab, MPDL3280A, MEDI4736, Tremelimumab, Avelumab, PDR001, LAG525, INCB24360, Varlilumab, Urelumab, AMP-224 and CM-24.
- Oncolytic viruses are engineered to cause cell lysis by replicating in tumors, thus activating an antitumor immune response.
- An oncolytic virus therapy for combination with the complex as defined herein for treatment of colorectal cancer is preferably selected from the group consisting of JX594 (Thymidine Kinase-Deactivated Vaccinia Virus), ColoAd1 (adenovirus), NV1020 (HSV-derived), ADXS11-001 (attenuated Listeria vaccine), Reolysin® (special formulation of the human reovirus), PANVAC (recombinant vaccinia-virus CEA-MUC-1-TRICOM), Ad5-hGCC-PADRE (recombinant adenovirus vaccine) and vvDD-CDSR (vaccinia virus).
- JX594 Thimidine Kinase-Deactivated Vaccinia Virus
- ColoAd1 adenovirus
- NV1020 HSV-derived
- the complex and (ii) the chemotherapeutic agent, the targeted drug and/or the immunotherapeutic agent, such as an immune checkpoint modulator, are administered at about the same time.
- “At about the same time”, as used herein, means in particular simultaneous administration or that directly after administration of (i) the chemotherapeutic agent, the targeted drug and/or the immunotherapeutic agent, such as an immune checkpoint modulator, (ii) the complex is administered or directly after administration of (i) the complex (ii) the chemotherapeutic agent, the targeted drug and/or the immunotherapeutic agent, such as an immune checkpoint modulator, is administered.
- directly after includes the time necessary to prepare the second administration—in particular the time necessary for exposing and disinfecting the location for the second administration as well as appropriate preparation of the “administration device” (e.g., syringe, pump, etc.).
- Simultaneous administration also includes if the periods of administration of (i) the complex and of (ii) the chemotherapeutic agent, the targeted drug and/or the immunotherapeutic agent, such as an immune checkpoint modulator, overlap or if, for example, one component is administered over a longer period of time, such as 30 min, 1 h, 2 h or even more, e.g. by infusion, and the other component is administered at some time during such a long period.
- Administration of (i) the complex and of (ii) the chemotherapeutic agent, the targeted drug and/or the immunotherapeutic agent, such as an immune checkpoint modulator, at about the same time is in particular preferred if different routes of administration and/or different administration sites are used.
- the complex and (ii) the chemotherapeutic agent, the targeted drug and/or the immunotherapeutic agent, such as an immune checkpoint modulator are administered consecutively.
- the complex is administered before or after (ii) the chemotherapeutic agent, the targeted drug and/or the immunotherapeutic agent, such as an immune checkpoint modulator.
- the time between administration of the first component and administration of the second component is preferably no more than one week, more preferably no more than 3 days, even more preferably no more than 2 days and most preferably no more than 24 h.
- the complex and (ii) the chemotherapeutic agent, the targeted drug and/or the immunotherapeutic agent, such as an immune checkpoint modulator are administered at the same day with the time between administration of the first component (the checkpoint modulator of the complex) and administration of the second component (the other of the checkpoint modulator and the complex) being preferably no more than 6 hours, more preferably no more than 3 hours, even more preferably no more than 2 hours and most preferably no more than 1 h.
- the complex and (ii) the chemotherapeutic agent, the targeted drug and/or the immunotherapeutic agent, such as an immune checkpoint modulator are administered via the same route of administration. It is also preferred that (i) the complex and (ii) the chemotherapeutic agent, the targeted drug and/or the immunotherapeutic agent, such as an immune checkpoint modulator, are administered via distinct routes of administration.
- the complex and (ii) the chemotherapeutic agent, the targeted drug and/or the immunotherapeutic agent, such as an immune checkpoint modulator are preferably provided in distinct compositions.
- the complex and (ii) the chemotherapeutic agent, the targeted drug and/or the immunotherapeutic agent, such as an immune checkpoint modulator are preferably provided in the same composition.
- the present invention provides a pharmaceutical formulation comprising a complex (for use) according to the invention or a cell (for use) according to the invention, in particular an antigen-presenting cell (for use) according to the invention, combined with at least one co-agent useful for treating and/or stabilizing a cancer and/or preventing colorectal cancer relapsing, and at least one pharmaceutically acceptable carrier.
- the complex (for use) according to the present invention; the cell, such as antigen-presenting cell, loaded with the complex (for use) according to the present invention; the inventive composition; the inventive pharmaceutical composition or the inventive vaccine can be administered after surgery where solid tumors have been removed as a prophylaxis against relapsing and/or metastases.
- the administration of the imaging or diagnosis composition in the methods and uses according to the invention can be carried out alone or in combination with a co-agent useful for imaging and/or diagnosing colorectal cancer.
- the present invention can be applied to any subject suffering from colorectal cancer or at risk to develop colorectal cancer.
- the therapeutic effect of said complex may be to elicit an immune response directed against said antigens or antigenic epitopes, in particular a response that is dependent on CD4 + helper T cells and/or CD8 + cytotoxic T cells and/or that is restricted by MHC class I molecules and/or MHC class II molecules.
- subjects according to the invention have been subjected to a surgical removal of a tumor.
- FIG. 1 shows for Example 1 expression of activation marker CD40 by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 300 nM of EDAZ13Mad5, Z13Mad5, Mad5 or 25 ng/ml of LPS during 48h. Isotype staining for each condition was also performed (isotype is not shown in the FIG. 1 ) (one experiment).
- FIG. 2 shows for Example 1 expression of activation marker CD86 by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 300 nM of EDAZ13Mad5, Z13Mad5, Mad5 or 25 ng/ml of LPS during 48h. Isotype staining for each condition was also performed (isotype is not shown in the FIG. 2 ) (one experiment).
- FIG. 3 shows for Example 1 expression of activation marker HLADR by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 300 nM of EDAZ13Mad5, Z13Mad5, Mad5 or 25 ng/ml of LPS during 48h. Isotype staining for each condition was also performed (isotype is not shown in the FIG. 3 ) (one experiment).
- FIG. 4 shows for Example 1 expression of activation marker CD83 by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 300 nM of EDAZ13Mad5, Z13Mad5, Mad5 or 25 ng/ml of LPS during 48 h. Isotype staining for each condition was also performed (isotype is not shown in the FIG. 4 ) (one experiment).
- FIG. 5 shows for Example 2 functional MHC class I-restricted cross-presentation in a murine in an vitro system using bone marrow derived dendritic cells (BMDCs) and splenocytes from different TCR transgenic mice.
- BMDCs bone marrow derived dendritic cells
- splenocytes from different TCR transgenic mice.
- BMDCs were loaded overnight with 300 nM of EDAZ13Mad5, EDAMad5 or Mad5.
- Efficient MHC class 1-restricted presentation of OVACD8 epitope and gp100 epitope was monitored after 4 days with CFSE-labeled OT1 cells and P-Mel cells respectively.
- Efficient MHC class II-restricted presentation of OVACD4 epitope was monitored after 4 days with CFSE-labeled OT2 cells.
- BMDCs were pulsed for 1h with 5 uM peptide (one experiment representative of 2 individual experiments).
- FIG. 6 shows the results for the 2 nmol groups for Example 3.
- C57BL/6 mice were vaccinated twice (Wk0 and Wk2) with 2 nmol of EDAMad5 or EDAZ13Mad5.
- Positive control group was vaccinated with Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after last vaccination and pentamer staining was performed (3-4 mice per group, one experiment).
- FIG. 7 shows the results for the 10 nmol groups for Example 3.
- C57BL/6 mice were vaccinated twice (Wk0 and Wk2) with 10 nmol of EDAMad5 or EDAZ13Mad5.
- Positive control group was vaccinated with Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after last vaccination and pentamer staining was performed (3-4 mice per group, one experiment).
- FIG. 8 shows for Example 3 the percentage of pentamer positive CD8+ T cells for all groups tested.
- C57BL/6 mice were vaccinated twice (Wk0 and Wk2) with 2 nmol or 10 nmol of EDAMad5 or EDAZ13Mad5.
- Positive control group was vaccinated with Mad5 and MPLA (equimolar to EDA). Mice were bled 7 days after last vaccination and pentamer staining was performed (one experiment with 3-4 mice per group).
- FIG. 9 shows for Example 4 the tumor growth of 7 mice per group (mean ⁇ SEM); *, p ⁇ 0.05 EDAZ13Mad5 versus control group (2-way Anova test).
- C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and vaccinated twice (d5 and d13) by subcutaneous injection of 10 nmol of EDAZ13Mad5, EDAMad5, Mad5 or Mad5 and MPLA (equimolar to EDA) s.c. in the right flank. Tumor size was measured with a caliper.
- FIG. 10 shows for Example 4 individual tumor growth curves (7 individual mice per group).
- C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and vaccinated twice (d5 and dl 3) by subcutaneous injection of 10 nmol of EDAZ13Mad5, EDAMad5, Mad5 or Mad5 and MPLA (equimolar to EDA) s.c. in the right flank. Tumor size was measured with a caliper.
- FIG. 11 shows for Example 4 (A) the survival curve of 7 mice per group; *, p ⁇ 0.05 EDAZ13Mad5 versus control group (Log-rank test) and (B) the tumor-free progression curve of 7 mice per group; *, p ⁇ 0.05 EDAZ13Mad5 versus control group (Log-rank test).
- FIG. 12 shows for Example 5 the number of metastasis for every experimental group.
- C57BL/6 mice were implanted i.v. with 1 ⁇ 10 5 B16-OVA melanoma tumor cells and vaccinated twice (d0 and d9) by subcutaneous injection of 2 nmol of EDAZ13Mad5, EDAMad5 or Z13Mad5 MPLA (equimolar to EDA) or MPLA alone s.c. in the right flank. Mice were euthanized at day 13 and lung recovered. Number of metastasis foci was counted for each lung. **, p ⁇ 0.01; ****, p ⁇ 0.0001 (Unpaired T test).
- FIG. 13 shows for Example 6 the number of metastasis for every experimental group.
- C57BL/6 mice were vaccinated twice (d-21 and d-7) by subcutaneous injection of 2 nmoles of EDAZ13Mad5, EDAMad5 or Z13Mad5 MPLA (equimolar to EDA) s.c. in the right flank.
- mice were implanted i.v. with 1 ⁇ 10 5 B16-OVA melanoma tumor cells.
- Mice were euthanized at day 14 and lung recovered. Number of metastasis foci was counted for each lung. *, p ⁇ 0.05.
- ***, p ⁇ 0.001 Unpaired T test).
- FIG. 14 shows the results for Example 8.
- HEK-hTLR2 cell lines were seeded in flat 96-well plate in culture medium, stimulated with 0.3 ⁇ M, 1 ⁇ M or 3 ⁇ M of AnaxaZ13Mad5 or Z13Mad5Anaxa and incubated at 37° C. for 24h. Positive control was performed with 500 ng/ml of Pam3CSK4.
- A Twenty microliters of supernatant were added to QuantiBlue® detection medium and incubated at 37° C. for 1 h before OD reading (620 nm).
- B Quantification of IL-8 secretion (by ELISA) in the supernatant.
- FIG. 15 shows the results for Example 9.
- C57BL/6 mice were vaccinated twice (Wk0 and Wk2) with 2nmoles of Z13Mad5Anaxa or AnaxaZ13Mad5. Mice were bled 7 days after last vaccination and pentamer staining was performed (one experiment).
- FIG. 16 shows the results for Example 9.
- C57BL/6 mice were vaccinated twice (Wk0 and Wk2) with 2nmoles Z13Mad5Anaxa or AnaxaZ13Mad5. Mice were bled 7 days after last vaccination and pentamer staining was performed (one experiment with 4 mice per group). *, p ⁇ 0.05.
- FIG. 17 shows for Example 10 the tumor growth of 7 mice per group (mean ⁇ SEM).
- C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-0VA tumor cells in the left flank and vaccinated twice (d5 and d13) by subcutaneous injection of 10 nmol of either AnaxZ13Mad5, Z13Mad5Anaxa or co-injection of Z13Mad5+Pam3CSK4 (equimolar to Anaxa) in the right flank.
- Tumor size was measured with a caliper. *, p ⁇ 0.05; ***, p ⁇ 0.001, ****, p ⁇ 0.0001.
- FIG. 18 shows for Example 10 the individual tumor growth curves (7 individual mice per group).
- C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and vaccinated twice (c15 and d13) by subcutaneous injection of 10 nmol of either AnaxZ13Mad5, Z13Mad5Anaxa or co-injection of Z13Mad5+Pam3CSK4 (equimolar to Anaxa) s.c. in the right flank. Tumor size was measured with a caliper.
- FIG. 19 shows for Example 10 the survival curve of 7 mice per group.
- C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and vaccinated twice (d5 and dl 3) by subcutaneous injection of 10 nmol of either AnaxZ13Mad5, Z13Mad5Anaxa or co-injection of Z13Mad5+Pam3CSK4 (equimolar to Anaxa) in the right flank. Tumor size was measured with a caliper. *, p ⁇ 0.05, **, p ⁇ 0.01, ****, p ⁇ 0.0001 (Log-rank test).
- FIG. 20 shows for Example 11 the tumor growth of 7 mice per group (mean ⁇ SEM).
- C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-0VA tumor cells in the left flank and vaccinated twice (d5 and d13) by subcutaneous injection of 2nmoles of Hp91Z13Mad5, EDAZ13Mad5, Z13Mad5Anaxa, Z13Mad5EDA or Z13Mad5 and MPLA (equimolar to EDA) in the right flank.
- FIG. 21 shows for Example 11 the individual tumor growth curves (7 individual mice per group).
- C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and vaccinated twice (d5 and d13) by subcutaneous injection of 2nmoles of Hp91Z13Mad5, EDAZ13Mad5, Z13Mad5Anaxa, Z13Mad5EDA or Z13Mad5 and MPLA (equimolar to EDA) s.c. in the right flank.
- FIG. 22 shows for Example 11 the survival curves of all 7 mice per group. Median survival is indicated on the graph (m.s.). *, p ⁇ 0.05; **, p ⁇ 0.01 (Log-rank test).
- FIG. 23 shows for Example 12 the tumor growth of 7 mice per group (mean ⁇ SEM); ****, p ⁇ 0.0001 (Log-rank test).
- C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and vaccinated twice (once at d5 and once at d13) by subcutaneous injection of either 0.5 nmol, 2 nmol or 10 nmol of Z13Mad5Anaxa in the right flank. Tumor size was measured with a caliper.
- FIG. 24 shows for Example 13 the SIINFEKL-specific CD8 T cell responses detected in the blood of C57BL/6 mice vaccinated three times (once at Wk0, once at Wk2 and once at Wk4) s.c., i.d. or i.m. with 0.5 nmol (A) or 2nmol (B) of Z13Mad5Anaxa. Blood was obtained from mice 7 days after the 2nd and the 3rd vaccination and multimer staining was performed (one experiment with 4 mice per group). *, p ⁇ 0.05.
- FIG. 25 shows for Example 13 KLRG1 expression (A) and PD-1 expression (B), which were analyzed on multimer-positive CD8 T cells (one experiment with 4 mice per group). Briefly, C57BL/6 mice were vaccinated three times (once at Wk0, once at Wk2 and once at Wk4) s.c., i.d. or i.m. with 2nmol of Z13Mad5Anaxa. Blood was obtained from mice 7 days after the 2nd and the 3rd vaccination and FACS staining was performed.
- FIG. 26 shows for Example 14 SIINFEKL-specific CD8 T cell responses in C57BL/6 mice vaccinated two times (once at Wk0 and once at Wk2) intranodally with 0.5 nmol of Z13Mad5Anaxa. Blood was obtained from mice 7 days after the 2nd vaccination and multimer staining was performed (3 mice per group).
- FIG. 27 shows for Example 15 the percentage of pentamer-positive cells among CD8 T cells (A and B; *, p ⁇ 0.05) and KLRG1 geomean of pentamer-positive CD8 T cells (C and D).
- C and D C57BL/6 mice were vaccinated 3 times (A and C: Wk0, Wk2 and Wk4; B and D: Wk0, Wk2 and Wk8) s.c. with 2 nmol of Z13Mad5Anaxa. Mice were bled 7 days after last vaccination and pentamer staining was performed (one experiment with 4 mice per group).
- FIG. 28 shows for Example 15 the percentage of multimer-positive cells among CD8 T cells (A and D); KLRG1 geomean of multimer-positive CD8 T cells (B and E) and PD1 geomean of multimer-positive CD8 T cells (C and F).
- A-C C57BL/6 mice were vaccinated 3 times at Day0, Day3 and Day7 and bled at Day7 and Day14.
- D-F C57BL/6 mice were vaccinated 3 times at Day0, Day7 and Day14 and bled at Day14 and Day21.
- Vaccination was performed s.c. with 0.5 nmol of Z13Mad5Anaxa. Multimer staining was performed on blood samples (one experiment with 4 mice per group).
- FIG. 29 shows for Example 16 the IL-6 secretion indicating the APC activation after incubation of BMDCs with various constructs as indicated in the Figure.
- BMDCs were seeded in flat 96-well plate in culture medium, stimulated with 1 ⁇ M of Z13Mad5Anaxa, Mad5Anaxa, Z13Mad5, EDAZ13Mad5 or EDAMad5 and incubated for 24h at 37° C.
- IL-6 secretion was quantified by ELISA in the supernatant. Mean ⁇ SEM of 2 to 3 individual experiments.
- FIG. 30 shows for Example 16 the TNF- ⁇ secretion indicating the APC activation after incubation of Raw 264.7 cells with various constructs as indicated in the Figure. Briefly, Raw 264.7 cells were seeded in flat 96-well plate in culture medium, stimulated with 1 ⁇ M of Z13Mad5Anaxa, Mad5Anaxa or Z13Mad5 and incubated for 24h at 37° C. TNF- ⁇ secretion was quantified by ELISA in the supernatant. Mean ⁇ SEM of 2 to 3 individual experiments.
- FIG. 31 shows for Example 17 the IL-8 secretion indicating TLR4 binding after incubation of HEK-hTLR4 cells with various constructs as indicated in the Figure.
- HEK-hTLR4 were seeded in flat 96-well plate in culture medium, stimulated with 1 ⁇ M of Z13Mad5Anaxa, Mad5Anaxa, Z13Mad5, EDAZ13Mad5 or EDAMad5 and incubated 24h at 37° C.
- IL-8 secretion was quantified by ELISA in the supernatant. Mean ⁇ SEM of 2 individual experiments.
- FIG. 32 shows for Example 18 the number of metastasis in a lung metastasis model with semitherapeutic settings. Briefly, C57BL/6 mice were implanted i.v. with 1 ⁇ 10 5 B16-OVA melanoma tumor cells and vaccinated twice (d0 and d9) by subcutaneous injection of 2 nmol of EDAZ13Mad5, Z13Mad5 MPLA (equimolar to EDA) or MPLA alone s.c. in the right flank. Mice were euthanized at day 13 and lung recovered. Number of metastasis foci was counted for each lung. **, p ⁇ 0.01 (One-way Anova with Tukey's multiple comparisons test).
- FIG. 33 shows for Example 19 the number of metastasis in a lung metastasis model with semitherapeutic settings.
- C57BL/6 mice were implanted i.v. with 1 ⁇ 10 5 B16-OVA melanoma tumor cells and vaccinated twice (d0 and d9) by subcutaneous injection of 0.5 nmol of Z13Mad5Anaxa, Mad5Anaxa or Z13Mad5+Pam3CSK4 (equimolar to Anaxa) s.c. in the right flank. Mice were euthanized at day 21 and lung recovered. Number of metastasis foci was counted for each lung. *, p ⁇ 0.05; **, p ⁇ 0.01 (Unpaired t-test).
- FIG. 34 shows for Example 20 the quantification of SIINFEKL-specific CD8 T cells in a Quad-GI261 glioblastoma model. Briefly, C57BL/6 mice were implanted i.c. with 5 ⁇ 10 5 GI261-Quad tumor cells and vaccinated twice (d7 and 21) by s.c. injection of 2 nmol of Z13Mad5Anaxa or 2 nmol of Z13Mad5 and 2 nmol of Anaxa. SIINFEKL-specific CDS T cells were quantified in blood and in BILs at d28 by multimer staining (5-8 mice per group).
- FIG. 35 shows for Example 20 the cytokine secretion.
- C57BL/6 mice were implanted i.c. with 5 ⁇ 10 5 GI261-Quad tumor cells and vaccinated twice (d7 and 21) by s.c. injection of 2 nmol of Z13Mad5Anaxa or 2 nmol of Z13Mad5 and 2 nmol of Anaxa.
- BILs were isolated and cultured during 6h with matured BMDCs loaded or not with SIINFEKL peptide in presence of BrefeldinA before intracellular staining for cytokines.
- % of CD8 T cells secreting cytokine (5-8 mice per group).
- FIG. 36 shows for Example 21 the effect of Z13Mad5Anaxa on survival in the Quad-G1261 glioblastoma model. Briefly, C57BL/6 mice were implanted i.c. with 5 ⁇ 10 5 GI261-Quad tumor cells and vaccinated three times (d7, d21 and d35) by s.c. injection of 2 nmol of Z13Mad5Anaxa. Mice were weight daily and euthanized when weight loss reached more than 15%.
- FIG. 37 shows for Example 22 the effect of Z13Mad5Anaxa on tumor growth and survival in subcutaneous EG7-OVA tumor model in a prophylactic setting.
- C57BL/6 mice were vaccinated twice (d-21 and d-7) by s.c. injection of 0.5 nmol of Z13Mad5Anaxa in the right flank and then implanted at day0 s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank. Tumor size was measured with a caliper.
- A Tumor growth of 7 mice per group (mean ⁇ SEM); ****, p ⁇ 0.0001 (2-way Anova test at day 30).
- B Survival curve of 7 mice per group. Median survival is indicated on the graph (m.s.). ***, p ⁇ 0.001 (Log-rank test).
- FIG. 38 shows for Example 23 the effect of Z13Mad5Anaxa on tumor growth and survival in subcutaneous B16-OVA tumor model in a therapeutic setting on an established tumor.
- C57BL/6 mice were implanted s.c. with 1 ⁇ 10 5 B16-OVA tumor cells in the left flank and vaccinated twice (d14 and d21) by s.c. injection of 0.5 nmol of Z13Mad5Anaxa in the right flank.
- A Tumor growth of 7 mice per group (mean ⁇ SEM); *, p ⁇ 0.05 (2-way Anova test at day 32).
- FIG. 39 shows for Example 24 the effect of the CPP in Z13Mad5Anaxa on tumor growth and survival in subcutaneous EG7-OVA tumor model.
- C57BL/6 mice were implanted at day0 s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and then vaccinated twice (d5 and d13) by s.c. injection of 0.5 nmol of Z13Mad5Anaxa or Mad5Anaxa in the right flank. Tumor size was measured with a caliper.
- A Tumor growth of 7 mice per group (mean ⁇ SEM); ****, p ⁇ 0.0001.
- B Survival curve of 7 mice per group. Median survival is indicated on the graph (m.s.). **, p ⁇ 0.01; ***, p ⁇ 0.001.
- FIG. 40 shows for Example 25 the effect of complexes having different CPPs on the immune response.
- C57BL/6 mice were vaccinated five times (Wk0, Wk2, Wk4, Wk6 and Wk8) s.c. with either 2 nmol (A) or 0.5 nmol (B) of Z13Mad5Anaxa, Z14Mad5Anaxa or Z18Mad5Anaxa.
- Mice were bled 7 days after the 2 nd , 3 rd , 4 th and 5 th vaccination and multimer staining was performed (one experiment with 4 mice per group).
- * p ⁇ 0.05 between vaccinated versus na ⁇ ve mice at each time point except after Vac2 for Z18Mad5Anaxa-vaccinated mice.
- FIG. 41 shows for Example 26 the effect of complexes having different CPPs on CD8 T cells in spleen (A), draining lymph nodes (B) and bone marrow (C).
- C57BL/6 mice were vaccinated five times (Wk0, Wk2, Wk4, Wk6 and Wk8) s.c. with 2 nmol of Z13Mad5Anaxa or Z14Mad5Anaxa.
- mice were euthanized, organs recovered and multimer staining was performed.
- FIG. 42 shows for Example 26 the effect of complexes having different CPPs on T cells in spleen (CD8 T cell response (A) and CD4 T cell response (B)).
- C57BU6 mice were vaccinated five times (Wk0, Wk2, Wk4, Wk6 and Wk8) s.c. with 2 nmol of Z13Mad5Anaxa or Z14Mad5Anaxa.
- Elispot assay was performed on spleen cells stimulated with SIINFEKL OVACD8 peptide.
- Elispot assay was performed on spleen cells stimulated with OVACD4 peptide.
- FIG. 43 shows for Example 26 the effect of complexes having different CPPs on CD8 T cell effector function.
- C57BL/6 mice were vaccinated five times (Wk0, Wk2, Wk4, Wk6 and Wk8) s.c. with 2 nmol of Z13Mad5Anaxa or Z14Mad5Anaxa.
- intracellular staining was performed on spleen cells stimulated with SIINFEKL OVACD8 peptide.
- FIG. 44 shows for Example 27 the effect of complexes having different CPPs on tumor growth (A) and survival rates (B).
- C57BU6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and vaccinated twice (d5 and d13) by s.c. injection of 0.5 nmol of Z13Mad5Anaxa or Z14Mad5Anaxa in the right flank.
- A Tumor growth of 7 mice per group (mean ⁇ SEM); *, p ⁇ 0.05; **** p ⁇ 0.0001 (2-way Anova test at day 28).
- FIG. 45 shows for Example 28 the effect of complexes having different CPPs on the immune response.
- C57BL/6 mice were vaccinated three times (Wk0, Wk2 and Wk4) s.c. with 2 nmol (A) or 0.5 nmol (B) of EDAZ13Mad5, EDAZ14Mad5 or EDAZ18Mad5.
- Mice were bled 7 days after the 3rd vaccination and multimer staining was performed (one experiment with 4 mice per group). *, p ⁇ 0.05
- FIG. 46 shows for Example 29 the effect of EDAZ14Mad5 on tumor growth (A) and survival rates (B).
- C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and vaccinated twice (d5 and d13) by s.c. injection of 2nmoles of EDAZ14Mad5 in the right flank.
- Left panel Tumor growth of 7 mice per group (mean ⁇ SEM); **, p ⁇ 0.01 (2-way Anova test at day 27).
- Right panel Survival curve of 7 mice per group. Median survival is indicated on the graph (m.s.).
- FIG. 47 shows for Example 30 the quantification of SIINFEKL-specific CD8 T cells in a Quad-GI261 glioblastoma model. Briefly, C57BL/6 mice were implanted i.c. with 5 ⁇ 10 5 GI261-Quad tumor cells and vaccinated twice (d7 and 21) by s.c. injection of 2 nmol of Z13Mad5Anaxa or 2 nmol of Z13Mad5 and 2 nmol of Anaxa. SIINFEKL-specific CD8 T cells were quantified in blood and in BILs at d28 by multimer staining (7-16 mice per group).
- FIG. 48 shows for Example 30 the cytokine secretion. Briefly, C57BL/6 mice were implanted i.c. with 5 ⁇ 10 5 GI261-Quad tumor cells and vaccinated twice (d7 and 21) by s.c. injection of 2 nmol of Z13Mad5Anaxa or 2 nmol of Z13Mad5 and 2 nmol of Anaxa. BILs were isolated and cultured during 6h with matured BMDCs loaded or not with SIINFEKL peptide in presence of BrefeldinA before intracellular staining for cytokines. % of CD8 T cells secreting cytokine (7-16 mice per group).
- FIG. 49 shows for Example 31 the effect of Z13Mad8Anaxa on T cells in spleen (CD8 T cell response (A) and CD4 T cell response (B)).
- C57BL/6 mice were vaccinated four times (Wk0, Wk2, Wk4 and Wk6) s.c. with 2 nmol of Z13Mad8Anaxa.
- Elispot assay was performed on spleen cells stimulated gp70CD8 peptide.
- Elispot assay was performed on spleen cells stimulated with gp70CD4 peptide.
- FIG. 50 shows for Example 32 the effect of Z13Mad11Anaxa on the number of metastasis in the B16 lung metastasis model (A) and on the T cell response in spleen (B).
- C57BL/6 mice were vaccinated two times (day0, day10) s.c. with 1 nmol of Z13Mad11Anaxa.
- FIG. 51 shows for Example 33 the effect of Z13Mad9Anaxa on T cells in spleen (CD8 T cell response.
- C57BL/6 mice were vaccinated four times (Wk0, Wk2, Wk4 and Wk6) s.c. with 2 nmol of Z13Mad9Anaxa.
- Elispot assay was performed on spleen cells stimulated with adpgk peptide.
- FIG. 52 shows for Example 34 the effect of complexes having different CPPs on the immune response.
- C57BL/6 mice were vaccinated two times (Wk0 and Wk2) s.c. with 2 nmol of either 713Mad5Anaxa or TatFMad5Anaxa. Mice were bled 7 days after the 2 nd vaccination and multimer staining was performed (one experiment with 8 mice per group).
- FIG. 53 shows for Example 35 the quantification of SIINFEKL-specific CD8 T cells in naive mice. Briefly, C57BL/6 mice were vaccinated once (day0) by s.c. injection of 2 nmol of Z13Mad5Anaxa (group “Z13Mad5Anaxa”) or 2 nmol of Z13Mad5 and 2 nmol of Anaxa (group “Z13Mad5+Anaxa”). SIINFEKL-specific CD8 T cells were quantified in blood at d7 by multimer staining (4-8 mice per group).
- FIG. 54 shows for Example 36 the effect of Z13Mad12Anaxa on T cells in blood (CD8 T cell response).
- C57BL/6 mice were vaccinated twice (Wk0 and Wk2) s.c. with 2 nmol of Z13Mad12Anaxa.
- Wk0 and Wk2 the number of mice in blood cells.
- multimer staining for the neoantigen reps was performed on blood cells.
- FIG. 55 shows for Example 37 expression of activation marker HLA-DR, CD83, CD80 and CD86 (from left to right) by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 300 nM of Z13Mad5Anaxa (lower panels) or Z13Mad5 (upper panels) during 48h. Isotype staining for each condition was also performed as shown.
- FIG. 56 shows for Example 38 the percentage of multimer-positive cells (% of CD8 T cells) over the course of repeated vaccination. Briefly, C57BL/6 mice were vaccinated subcutaneously 6 times (weeks 0, 2, 4, 8, 12, 16) with 2 nmol of Z13Mad5Anaxa. Mice were bled 7 days after each vaccination or before vaccination and pentamer staining was performed (two experiment with 4 mice per group). The arrows under the time axis indicate the vaccination time points.
- FIG. 57 shows for Example 39 the tumor volume (A) and the survival rate (B) of mice vaccinated with Z13Mad11Anaxa and control mice in the MC-38 tumor model. Briefly, C57BL/6 mice were implanted s.c. with 2 ⁇ 10 5 MC38 tumor cells in the left flank and vaccinated twice ( ⁇ d21 & ⁇ d7 before tumor implantation) by s.c. injection of 2 nmol of Z13Mad11Anaxa in the right flank. (A) Tumor growth and (B) Survival curve of 7 mice per group. Median survival is indicated on the graph (m.s.). *, p ⁇ 0.05; **, p ⁇ 0.01 (Log-rank test).
- FIG. 59 shows for Example 41 neoantigen adpgk-specific immune response at the tumor site (Tumor-infiltrating cells, TILs) for control (column (A)) and Z13Mad12Anaxa-vaccinated mice (column (B)). FACS dot plots of TILs are shown. Percentage of multimer-positive cells (in % of CD8 T cells) is indicated for each dot plot.
- FIG. 60 shows for Example 41 neoantigen reps1-specific immune response at the tumor site (Tumor-infiltrating cells, TILs) for control (column (A)) and Z13Mad12Anaxa-vaccinated mice (column (B)). FACS dot plots of blood cells are shown. Percentage of multimer-positive cells (in % of CD8 T cells) is indicated for each dot plot.
- FIG. 61 shows for Example 41 neoantigen-specific immune response at the tumor site (Tumor-infiltrating cells, TILs) for control and Z13Mad12Anaxa-vaccinated mice. Percentage of multimer-positive cells (in % of CD8 T cells) is shown for each epitope (adpgk (A) and reps1 (B)).
- FIG. 62 shows for Example 42 expression of activation markers HLA-DR, CD83, CD80 and CD86 by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 300 nM of ATP110 during over night. Isotype staining for each condition was also performed as shown.
- FIG. 63 shows for Example 42 expression of activation markers HLA-DR, CD83, CD80 and CD86 by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 300 nM of ATP112 during over night. Isotype staining for each condition was also performed as shown.
- FIG. 64 shows for Example 42 expression of activation markers HLA-DR, CD83, CD80 and CD86 by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 300 nM of ATP115 during over night. Isotype staining for each condition was also performed as shown.
- FIG. 65 shows for Example 42 expression of activation markers HLA-DR, CD83, CD80 and CD86 by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 300 nM of ATM 17 during over night. Isotype staining for each condition was also performed as shown.
- FIG. 66 shows for Example 42 expression of activation markers HLA-DR, CD83, CD80 and CD86 by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 300 nM of ATM 18 during over night. Isotype staining for each condition was also performed as shown.
- FIG. 67 shows for Example 42 expression of activation markers HLA-DR, CD83, CD80 and CD86 by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 300 nM of ATP119 during over night. Isotype staining for each condition was also performed as shown.
- FIG. 68 shows for Example 42 expression of activation markers HLA-DR, CD83, CD80 and CD86 by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 300 nM of ATP120 during over night. Isotype staining for each condition was also performed as shown.
- FIG. 69 shows for Example 42 expression of activation markers HLA-DR, CD83, CD80 and CD86 by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 300 nM of ATM 22 during over night. Isotype staining for each condition was also performed as shown.
- FIG. 70 shows for Example 42 expression of activation markers HLA-DR, CD83, CD80 and CD86 by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 300 nM of ATP123 during over night. Isotype staining for each condition was also performed as shown.
- FIG. 71 shows for Example 42 expression of activation markers HLA-DR, CD83, CD80 and CD86 by human blood monocyte-derived dendritic cells (DCs) from one single buffy.
- the DCs were stimulated with 600 nM of ATP125 during over night. Isotype staining for each condition was also performed as shown.
- FIG. 72 shows for Example 43 the tumor growth (A) and the survival rate (B) of 13 to 14 mice per group (mean ⁇ SEM).
- C57BL/6 mice were implanted s.c. with 2 ⁇ 10 5 MC-38 tumor cells on the back.
- Mice of the groups “Z13Mad12Anaxa” and “Z13Mad12Anaxa+anti-PD1” were vaccinated 3 times (d3, dl 0 and d17) by subcutaneous injection of 2 nmol of Z13Mad12Anaxa at the tail base. 200 ⁇ g of anti-PD1 antibody were administered i.p.
- FIG. 73 shows for Example 43 individual tumor growth curves of 13 to 14 mice per group.
- C57BL/6 mice were implanted s.c. with 2 ⁇ 10 5 MC-38 tumor cells on the back.
- Mice of the groups “Z13Mad12Anaxa” and “Z13Mad12Anaxa+anti-PD1” were vaccinated 3 times (d3, d10 and d17) by subcutaneous injection of 2 nmol of Z13Mad12Anaxa at the tail base.
- 200 ⁇ g of anti-PD1 antibody were administered i.p. on each of days 6, 10, 13, 17, 20, 24 and 27 to mice of groups “anti-PD1” and “Z13Mad12Anaxa+anti-PD1”. Tumor size was measured with a caliper.
- FIG. 74 shows for the results for Example 44.
- C57BL/6 mice were vaccinated once with 4nmol of ATP128. Mice were bled 7 clays later and Elispot assay was performed on blood cells stimulated with dendritic cells loaded with ATP128 (one experiment).
- FIG. 75 shows for Example 45 the Activation Index of human blood monocyte-derived dendritic cells (DCs) from ten different buffys.
- the DCs were stimulated with 300 nM of ATP128 overnight.
- Negative and positive controls were performed by incubating cells with buffer and MPLA, respectively.
- FIG. 76 shows for Example 46 the regions of ATP128 containing peptides that were found presented on MHC class I (A) and class II (B) at the surface of human dendritic cells from two different donors, donor 9 (solid line) and donor 10 (dotted line), after overnight loading with ATP128 and the respective number of peptides presented on MHC class I and class II (C). Underlined numbers correspond to peptides previously described in the literature as immunogenic peptides.
- the complex for use according to the present invention is a fusion protein, comprising the cell-penetrating peptide “Z13”, a protein “MAD5”, which consists of different CD8 + and CD4 + epitopes from various antigens, and the TLR4 peptide agonist “EDA”. Accordingly, a fused protein with the EDA peptide at the N-terminal position and different control conjugated proteins without Z13 or EDA or both were designed.
- the EDAZ13Mad5, Z13Mad5 and Mad5 proteins were investigated for their capacity to induce human dendritic cell (DC) maturation. After incubation during 48h with 300 nM of protein, activation markers expression (CD86, CD40, CD83 and HLA-DR) was assessed on the human DCs by FACS ( FIGS. 1-4 ). Specific buffers of each protein were used as negative controls.
- Results are shown for CD40 in FIG. 1 , for CD86 in FIG. 2 , for HLADR in FIG. 3 , and for CD83 in FIG. 4 .
- EDAZ13Mad5 induced maturation of human DCs
- Z13Mad5 and Mad5 proteins were not able to activate human DCs.
- BMDCs were loaded overnight with 300 nM of with the EDAMad5, EDAZ13Mad5 and Mad5 proteins containing OVACD8, OVACD4 and gp100 epitopes. Processing and presentation of these MHC I-restricted OVACD8 and gp100 epitopes were monitored by measuring the in vitro proliferation of na ⁇ ve OVA 257-264 -specific CD8 + T cells from OT-1 T cell receptor (TCR) transgenic mice and gp100-specific CD8 + T cells from P-mel T cell TCR transgenic mice respectively.
- TCR OT-1 T cell receptor
- MHC class I-restricted presentation of OVACD8 epitope and gp100 epitope was monitored after 4 days with CFSE-labeled 011 cells and P-Mel cells respectively.
- Processing and presentation of MHC II-restricted OVACD4 epitope was monitored by measuring the in vitro proliferation of na ⁇ ve OVA 323-339 -specific CD4 + T cells from OT-2 T cell receptor (TCR) transgenic mice.
- efficient MHC class II-restricted presentation of OVACD4 epitope was monitored after 4 days with CFSE-labeled OT2 cells.
- BMDCs were pulsed for 1h with 5 uM peptide (one experiment representative of 2 individual experiments).
- Results are shown in FIG. 5 . Similar cross-presentation and processing capacity of all assessed Mad5-based proteins were observed.
- C57BL/6 mice were vaccinated twice (Wk0 and Wk2), by subcutaneous injection of either 2 nmol or 10 nmol of the constructs EDAZ13Mad5 or EDAMad5 (described in Examples 1 and 2).
- Positive control group was vaccinated with Mad5 and the TLR4 agonist MPLA (equimolar to EDA).
- Two doses were assessed 2 nmol of the construct ( FIG. 6 ) and 10 nmol of the construct ( FIG. 7 ). 3-4 mice were used per group.
- mice Seven days after the last vaccination, mice were bled and pentamer staining was performed to monitor the OVA-specific immune response in the blood.
- pentamer staining was performed to monitor the OVA-specific immune response in the blood.
- FIG. 8 the percentage of pentamer positive CD8+ T cells is shown for all groups and both doses tested.
- mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank. After tumor implantation, mice were vaccinated at day 5 and 13 with 10 nmol of one of the following constructs (cf. Examples 1 and 2 for construct description): EDAZ13Mad5, EDAMad5, Mad5, or Mad5 and MPLA (equimolar to WA) s.c. in the right flank. Tumor size was measured with a caliper.
- FIG. 9 shows the tumor growth of 7 mice per group (mean ⁇ SEM); *, p ⁇ 0.05 EDAZ13Mad5 versus control group (2-way Anova test).
- FIG. 10 shows individual tumor growth curves (7 individual mice per group).
- FIG. 11 A shows the survival curve of 7 mice per group; *, p ⁇ 0.05 EDAZ13Mad5 versus control group (Log-rank test).
- FIG. 11 B shows the tumor-free progression curve of 7 mice per group; *, p ⁇ 0.05 EDAZ13Mad5 versus control group (Log-rank test).
- EDAZ13Mad5 was the only protein vaccine to significantly control the tumor growth compared to the control group with a significant better tumor free progression curve and survival curve.
- construct protein EDAZ13Mad5 is a highly potent vaccine for controlling the tumor growth in a therapeutic setting.
- EDAMad5 EDAZ13Mad5
- Z13Mad5+MPLA cf. Examples 1 and 2 for design of the constructs
- MPLA alone C57BL/6 mice were implanted i.v. with 1 ⁇ 10 5 B16-OVA melanoma tumor cells and at the same time (d0) 2 nmol of the vaccine (EDAMad5, EDAZ13Mad5, Z13Mad5+ MPLA, MPLA alone) was administered by subcutaneous injection in the right flank. Nine days later, mice were vaccinated a second time with the same dose.
- Example 6 Vaccine Efficacy on Tumor Growth in a Melanoma Metastasis Model—Prophylactic Setting
- mice were vaccinated 21 and 7 days before implantation of tumor cells (d-21 and d-7) by subcutaneous injection of 2 nmol of EDAZ13Mad5, EDAMad5 or Z13Mad5+MPLA (equimolar to EDA) s.c. in the right flank.
- mice were implanted i.v. with 1 ⁇ 10 5 B16-OVA melanoma tumor cells. Mice were euthanized at day 14 and lung recovered. Results are shown in FIG. 13 .
- Example 7 Design of Further Constructs Comprising a TLR2 Peptide Agonist
- the complex for use according to the present invention is again a fusion protein, comprising the cell-penetrating peptide “Z13”, the protein “MAD5”, which consists of different CD8 + and CD4 + epitopes from various antigens, and the TLR2 peptide agonist “Anaxa”. Accordingly, fused proteins with the Anaxa peptide at the C-terminal or N-terminal position were designed.
- Endotoxin level 3.1 EU/mg
- HEK-BlueTM hTLR2 were seeded in flat 96-well plate in culture medium, stimulated with 0.3 ⁇ M, 1 ⁇ M or 3 ⁇ M of AnaxaZ13Mad5 or Z13Mad5Anaxa and incubated at 37° C. for 24h. Positive control was performed with 500 ng/ml of Pam3CSK4, a TLR2 agonist.
- C57BL/6 mice were vaccinated twice (Wk0 and Wk2), by subcutaneous injection of 2 nmol of AnaxaZ13Mad5 or 2 nmol of Z13Mad5Anaxa. Seven clays after the last vaccination, mice were bled and to monitor the OVA-specific immune response in the blood, pentamer staining was performed (one experiment with 4 mice per group). Results are shown in FIGS. 15 and 16 .
- Example 7 To evaluate the effect of the Anaxa-conjugated construct proteins designed in Example 7 on tumor growth control, a benchmark tumor model was used, namely the s.c. implantation of EG.7-OVA thymoma cells.
- mice C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank. After tumor implantation, the three groups of 7 mice each were vaccinated s.c. in the right flank at day 5 and 13 by subcutaneous injection of 10 nmol of either AnaxZ13Mad5 (group 1), Z13Mad5Anaxa (group 2) or Z13Mad5 and Pam3CSK4 (equimolar to Anaxa; group 3). In order to compare the effect to a protein mixed with an external adjuvant, a control group was vaccinated with Z13Mad5 and Pam3CSK4 (equimolar to Anaxa). Tumor size was measured with a caliper. Results are shown in FIG. 17-19 .
- Z13Mad5Anaxa and AnaxaZ13Mad5 are better protein vaccines for controlling tumor growth compared to the control group, i.e. co-injection of Z13Mad5 and Pam3CSK showing a significant better survival curve.
- Z13Mad5Anaxa and AnaxaZ13Mad5 demonstrate significantly higher efficacy than Z13Mad5 administrated separately with Pam3CSK4. The results therefore suggest that the construct proteins Z13Mad5Anaxa and AnaxaZ13Mad5 are promising conjugate-vaccines for controlling the tumor growth in a therapeutic setting.
- mice C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG.7-OVA thymoma cells in the left flank as described previously in Example 10.
- Mice (7 individual mice per group) were vaccinated s.c. in the right flank at day 5 and 13 with 2 nmol of either EDAZ13Mad5, Z13Mad5Anaxa or co-injection of Z13Mad5+MPLA (equimolar to EDA).
- Results are shown in FIGS. 20, 21 and 22 .
- Z13Mad5Anaxa, EDAZ13Mad5, and Z13Mad5+MPLA were similarly able to significantly control tumor growth.
- Z13Mad5Anaxa is the best construct to significantly control tumor growth and EDAZ13Mad5 was slightly better than Z13Mad5+MPLA in this experimental setting.
- Z13Mad5Anaxa three different doses (0.5 nmol, 2 nmol and 10 nmol) of Z13Mad5Anaxa (cf. Example 7) were assessed for their ability to control tumor growth.
- the dose effect of Z13Mad5Anaxa construct was evaluated in the s.c. model of EG.7-OVA thymoma cells as described previously in Example 10. After tumor implantation, mice were vaccinated twice (at day 5 and at day 13 after tumor implantation) in a therapeutic setting at 0.5, 2 or 10 nmol of Z13Mad5Anaxa.
- C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and vaccinated twice (d5 and d13) by subcutaneous injection of either 0.5 nmol, 2 nmol or 10 nmol of Z13Mad5Anaxa in the right flank. Tumor size was measured with a caliper. The tumor growth of 7 mice per group is depicted in FIG. 23 . Those data show that the doses of 0.5 and 2 nmol are at least as efficacious as 10 nmol for controlling tumor growth.
- mice were vaccinated three times every two weeks (Wk0, Wk2 and Wk4) with 0.5 or 2 nmol of 713Mad5Anaxa (cf. Example 7).
- the 1st and the 3rd vaccinations were performed in the right flank whereas the 2nd was done in the left flank.
- SIINFEKL-specific CD8+T cell response was analyzed 1 week after the 2nd and the 3rd vaccination in the blood.
- FIG. 24 shows the SIINFEKL-specific CD8 T cell responses after each vaccination detected in the blood of C57BU6 mice vaccinated three times (Wk0, Wk2 and Wk4) s.c., i.d. or i.m.
- FIG. 24 A 0.5 nmol
- FIG. 24 B 2nmol
- Z13Mad5Anaxa Blood was obtained from mice 7 days after the 2nd and the 3rd vaccination and multimer staining was performed (one experiment with 4 mice per group).
- results indicate that at the two doses assessed (0.5 and 2nmol), (i) all routes of administration tested elicited a SIINFEKL-specific CD8 immune response and (ii) the subcutaneous vaccination elicited the strongest SIINFEKL-specific CD8 immune response.
- the maximum response was reached after the 3nd vaccination and still maintained after the 3rd vaccination.
- the SIINFEKL-specific CD8 immune response after the 2nd vaccination elicited by intradermal and intramuscular vaccinations is lower compared to subcutaneous vaccination and is not enhanced after the 3rd vaccination.
- mice were vaccinated three times (Wk0, Wk2 and Wk4) s.c., i.d. or i.m. with 2nmol of Z13Mad5Anaxa (cf. Example 7).
- Blood was obtained from mice 7 days after the 2nd and the 3rd vaccination and FACS staining was performed.
- KLRG1 and PD-1 expression were analyzed on multimer-positive CD8 T cells (one experiment with 4 mice per group). Results are shown in FIG. 25 .
- KLRG 1 is strongly increasing on SIINFEKL-specific CD8 T cells after subcutaneous vaccination. After i.d. or i.m. vaccination, the observed effects were lower. The percentage of KLRG 1-positive cells among SIINFEKL-specific CD8 T cells is also enhanced after s.c. vaccination (data not shown).
- PD-1 expression is decreasing with the time and the vaccinations, for subcutaneous and intramuscular vaccination routes. This suggests that SIINFEKL-specific CD8 T cells are not exhausted. The percentage of PD1-positive cells among SIINFEKL-specific CD8 T cells is also reduced after s.c. and i.m. vaccination (data not shown). It is important to note that PD-1 expression is higher after the 2nd vaccination when mice were vaccinated subcutaneously, reflecting the early activation status of specific T cells (Keir, M. E., et al., PD -1 and its ligands in tolerance and immunity . Annu Rev Immunol, 2008. 26: p. 677-704).
- Tim-3 The expression of the late exhaustion marker Tim-3 was also analyzed. A very low expression as observed for all groups.
- results indicate that subcutaneous vaccination elicits the best specific CD8 immune response compared to intramuscular or intradermal injections.
- Example 13 Based on the previous experiments (Example 13), the intranodal route of administration was additionally investigated. To this end, the immune response elicited by intranodal injection of Z13Mad5Anaxa (cf. Example 7) was investigated.
- mice were first injected with Evans Blue subcutaneously in order to allow easily visualizing the lymph nodes for injection and inject intranodally without invasive surgery, for example as described in Jewell, C. M., S. C. Lopez, and D. J. Irvine, In situ engineering of the lymph node microenvironment via intranodal injection of adjuvant - releasing polymer particles . Proc Natl Acad Sci USA, 2011. 108(38): p. 15745-50.
- C57BL/6 mice were vaccinated two times every two weeks (Wk0 and Wk2) intranodally with 0.5 nmol of Z13Mad5Anaxa (cf. Example 7).
- the 1st vaccination was performed in the right inguinal lymph node, whereas the second vaccination was done in the left inguinal lymph node.
- Blood was obtained from mice 7 days after the 2nd vaccination and multimer staining was performed (3 mice per group).
- SIINFEKL-specific CD8+T cell response was analyzed one week after the 2nd vaccination in the blood.
- FIG. 26 shows the SIINFEKL-specific CD8 T cell responses. Those data indicate that also intranodal injection was able to elicit SIINFEKL-specific CD8 T cells.
- the vaccination schedule evaluation work was initiated with the objective to identify the impact of the third vaccination using the same Z13Mad5Anaxa construct as described above (cf. Example 7).
- the subcutaneous route was chosen given the previous results.
- SIINFEKL-specific CD8+T cell response was analyzed one week after the 2nd and the 3rd vaccination ( FIGS. 28A and D). Additionally, the effector function of SIINFEKL-specific T cells was evaluated by analyzing the expression of KLRG 1 on specific CD8 T cells (FIGS. 28 B and 28 E) and the exhaustion status by analyzing the PD-1 expression of specific T cells ( FIGS. 28C and 28F ).
- vaccination schedule data set indicates that the Wk0-Wk2-Wk4 vaccination schedule is the best vaccination schedule for inducing potent OVA-specific CD8 immune response with high effector function.
- Example 16 Capacity of TLR Agonist-CPP Conjugate Constructs to Activate Murine Antigen-Presenting Cells (APCs)
- control peptide is also a fusion protein and which comprises the protein “MAD5”, which consists of different CD8 + and CD4 + epitopes from various antigens, and the TLR2 peptide agonist “Anaxa” (i.e. without cell penetrating peptide). Accordingly, the following control construct was additionally designed:
- the aim of this study was to evaluate the capacity of two exemplary complexes according to the present invention, namely EDAZ13Mad5 (cf. Example 1) and Z13Mad5Anaxa (cf. Example 7), to promote antigen-presenting cells activation in comparison to reference complexes lacking either the cell penetrating peptide component Z13 (Mad5Anaxa, cf. above; EDAMad5, cf. Example 2) or the TLR agonist (Z13Mad5, cf. Example 1).
- BMDCs bone marrow-derived dendritic cells
- BMDCs were seeded in flat 96-well plate in culture medium, stimulated with 1 pM of either Z13Mad5Anaxa (cf. Example 7), Mad5Anaxa (cf. above), Z13Mad5 (cf. Example 1), EDAZ13Mad5 (cf. Example 1) or EDAMad5 (cf. Example 2) and incubated for 24h at 37° C.
- the APC activation was investigated by monitoring the secretion of IL-6 in the culture supernatant of BMDCs. IL-6 secretion was quantified by ELISA in the supernatant.
- Raw 264.7 cells were seeded in flat 96-well plate in culture medium, stimulated with 1 ⁇ M of either Z13Mad5Anaxa (cf. Example 7), Mad5Anaxa (cf. above) or Z13Mad5 (cf. Example 1) and incubated for 24h at 37° C.
- the CPP may facilitate the entry of the molecule into the cells, allowing a better targeting of intracellular TLR.
- a complex for use according to the present invention comprising the Anaxa peptide as TLR agonist, for example Z13Mad5Anaxa, is able to bind to human TLR2 and to promote the secretion of IL-8 by HEK-hTLR2 cells (cf. Example 8, FIG. 14 ).
- HEK cells transfected with human TLR4 were seeded in flat 96-well plate in culture medium, stimulated with 1 ⁇ M of either Z13Mad5Anaxa (cf. Example 7), Mad5Anaxa (cf. above), Z13Mad5 (cf. Example 1), EDAZ13Mad5 (cf. Example 1) or EDAMad5 (cf. Example 2) and incubated for 24h at 37° C.
- IL-8 secretion was quantified by ELISA in the supernatant.
- Results are shown in FIG. 31 .
- incubation of HEK-hTLR4 with EDAZ13Mad5 resulted in remarkable IL-8 secretion, indicating binding of EDAZ13Mad5 to TLR4.
- the IL-8 secretion of EDAMad5 was remarkably lower as compared to EDAZ13Mad5, showing the effect of the presence of a CPP.
- the Z13Mad5 construct which does not comprise a TLR agonist, showed no IL-8 secretion, indicating—as expected—a lack of binding to TLR4.
- Example 18 Vaccine Efficacy on Tumor Growth in a Lung Metastasis Model—Semi-Therapeutic Setting: TLR Agonist EDA
- Example 6 shows the efficacy of a complex for use according to the present invention, namely EDAZ13Mad5, in a melanoma lung metastasis model in a prophylactic setting (cf. FIG. 13 ).
- mice were vaccinated at the same time as tumor cells were implanted (d0) and, for a second time, at nine days after implantation (d9).
- Vaccination was performed by subcutaneous injection of 2 nmol of EDAZ13Mad5, Z13Mad5+MPLA (equimolar to EDA) or MPLA s.c. in the right flank. At day 0, mice were implanted i.v.
- Example 19 Vaccine Efficacy on Tumor Growth in a Lung Metastasis Model—Semi-Therapeutic Setting: TLR Agonist Anaxa
- Example 18 This study is based on Example 18 with the same model (semitherapeutic settings) and experimental schedule. However, the effect of complexes according to the present invention comprising the “Anaxa” peptide as TLR agonist were investigated—instead of the EDA TLR agonist as in Example 18.
- mice C57BL/6 mice were implanted i.v. with 1 ⁇ 10 5 B16-OVA melanoma tumor cells and vaccinated twice (d0 and d9) by subcutaneous injection of 0.5 nmol of Z13Mad5Anaxa, Mad5Anaxa or Z13Mad5+Pam3CSK4 (equimolar to Anaxa) s.c. in the right flank. Mice were euthanized at day 21 and the lung was recovered. Number of metastasis foci was counted for each lung. The results are shown in FIG. 33 .
- GBM glioblastoma multiforme
- the G1261 glioma is a carcinogen-induced mouse glioma model.
- This model represents one of the very few brain tumor models developed in immunocompetent animals, that has growth characteristics similar to human GBM (Newcomb, E. and D. Zagzag, The murine GL 261 glioma experimental model to assess novel brain tumor treatments , in CNS Cancer Models, Markers, Prognostic, Factors, Targets, and Therapeutic Approaches , E.G. Van Meir, Editor. 2009, Humana Press: Atlanta. p. 227-241; Jacobs, V. L., et al., Current review of in vivo GBM rodent models: emphasis on the CNS -1 tumour model . ASN Neuro, 2011.
- GI261 model (Ohlfest, J. R., et al., Vaccine injection site matters: qualitative and quantitative defects in CDB T cells primed as a function of proximity to the tumor in a marine glioma model . J Immunol, 2013. 190(2): p. 613-20) by transfecting GI261 cell line with the “Quad Cassette” expressing four peptides presented by H-2b class I or II molecules: human gp100 25-33 , chicken OVA 257-264 , chicken OVA 323-339 , and mouse I-E ⁇ 52-68 .
- the Quad-GI261 cell line also stably expresses luciferase, which allows the follow-up of tumor growth by bioluminescence.
- the goal of this study was to assess the efficacy of a complex for use according to the present invention in the Quad-GI261 glioblastoma model.
- Z13Mad5Anaxa The effect of a complex for use according to the present invention, namely Z13Mad5Anaxa (cf. Example 7) was evaluated in the above described glioblastoma model. T cell homing at the tumor site was therefore analyzed in GI261-Quad tumor-bearing mice vaccinated twice (Wk1 and Wk3) with Z13Mad5Anaxa vaccine. A group vaccinated with Z13Mad5 and Anaxa (equimolar to Z13Mad5Anaxa) administrated separately was used as control. Briefly, C57BL/6 mice were implanted i.c.
- SIINFEKL-specific CD8 T cells In general, low frequency of SIINFEKL-specific CD8 T cells was quantified in the blood. However, a higher percentage of SIINFEKL-specific CD8 T cells was observed in the blood of Z13Mad5Anaxa-vaccinated mice. In all groups, there was a sensibly stronger accumulation of SIINFEKL-specific CD8 T cells in the BILs.
- cytokine secretion was assessed.
- C57BL/6 mice were implanted i.c. with 5 ⁇ 10 5 GI261-Quad tumor cells and vaccinated twice (d7 and 21) by s.c. injection of 2 nmol of Z13Mad5Anaxa or 2 nmol of Z13Mad5 and 2 nmol of Anaxa.
- BILs were isolated and cultured during 6h with matured BMDCs loaded or not with SIINFEKL peptide in presence of BrefeldinA before intracellular staining for cytokines. Results are shown in FIG. 35 .
- Z13Mad5Anaxa is efficacious for eliciting high brain infiltrating SIINFEKL-specific CD8 immune response.
- Z13Mad5Anaxa is able to promote the secretion of cytokine by antigen-specific CD8 T cells in the brain.
- mice C57BL/6 mice were implanted i.c. with 5 ⁇ 10 5 GI261-Quad tumor cells and vaccinated three times (d7, d21 and d35) by s.c. injection of 2 nmol of Z13Mad5Anaxa. Mice were weight daily and euthanized when weight loss reached more than 15%. Results are shown in FIG. 36 .
- Example 22 Vaccine Efficacy in a Subcutaneous Tumor Model—Prophylactic Setting
- Example 7 To evaluate the effect of the Anaxa-conjugated construct proteins designed in Example 7 on tumor growth control, a benchmark tumor model was used, namely the s.c. implantation of EG.7-OVA thymoma cells. In contrast to Example 10, wherein vaccination was performed on clays 5 and 13, in the present study a prophylactic setting was evaluated, wherein mice were vaccinated 21 and 7 clays before tumor implantation.
- C57BL/6 mice were vaccinated twice (d-21 and d-7) by s.c. injection of 0.5 nmol of Z13Mad5Anaxa in the right flank and then implanted at day0 s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and. Tumor size was measured with a caliper.
- FIG. 37 The results are shown in FIG. 37 with tumor volume ( FIG. 37 A) and survival rate ( FIG. 37 B).
- the data is showing that prophylactic vaccination with Z13Mad5Anaxa is highly efficacious for controlling tumor growth and survival rate.
- the volume of the tumor is highly significantly decreased in mice treated with Z13Mad5Anaxa as compared to control mice.
- the survival rate is highly significantly increased in mice treated with Z13Mad5Anaxa as compared to control mice.
- Example 23 Vaccine Efficacy in a Subcutaneous Tumor Model—Therapeutic Setting with Established Tumor
- Example 7 This study is based on the results obtained in Example 10 as shown in FIGS. 17-19 and on the results obtained in Example 22 shown in FIG. 37 . It was the goal of this study to evaluate the effect of Z13Mad5Anaxa (cf. Example 7) on an established tumor.
- the s.c. model of B16-OVA melanoma cells was used.
- tumor cells are spreading slowly, therefore allowing a bigger vaccination time window.
- the first vaccination with the low dose of 0.5 nmol of Z13Mad5Anaxa was performed once the tumor was established and visible i.e. at day 14 after tumor cell implantation.
- C57BL/6 mice were implanted s.c. with 1 ⁇ 10 5 B16-OVA tumor cells in the left flank and vaccinated twice (d14 and d21) by s.c. injection of 0.5 nmol of Z13Mad5Anaxa in the right flank. Tumor growth and survival curves were monitored. Results are shown in FIG. 38 .
- the protocol of this study corresponds to the study described in Example 10, with the difference that an additional group “Mad5Anaxa” (cf. Example 16) was evaluated.
- a benchmark tumor model was used, namely the s.c. implantation of EG.7-OVA thymoma cells.
- C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank.
- groups of 7 mice each were vaccinated s.c. in the right flank at day 5 and 13 by subcutaneous injection of 0.5 nmol of either Z13Mad5Anaxa (group 1) or Mad5Anaxa (group 2) and compared to a control group. Tumor size was measured with a caliper. Results are shown in FIG. 39 .
- mice treated with Z13Mad5Anaxa show a significantly decreased tumor volume and a significantly increased survival rate compared to both, control mice and mice treated with Mad5Anaxa, i.e. a construct without CPP.
- These results indicate that the presence of a CPP results in significantly decreased tumor volume and a significantly increased survival rate, i.e. in increased efficiency of vaccination. Therefore, the results indicate—together with the results obtained in Example 10—that the presence of a CPP and the TLR agonist exert a synergic effect on tumor growth and survival rate.
- fusion proteins which comprise CPPs other than Z13—namely Z14 (SEQ ID NO: 7) or Z18 (SEQ ID NO: 11).
- Those fusion proteins also comprise the protein “MAD5”, which consists of different CD8 + and CD4 + epitopes from various antigens, and the TLR2 peptide agonist “Anaxa”. Accordingly, the following constructs were additionally designed:
- mice were assigned to eight different groups (4 mice per group): three groups receiving 2 nmol of either Z13Mad5Anaxa, Z14Mad5Anaxa or Z18Mad5Anaxa and a respective control and three groups receiving 0.5 nmol of Z13Mad5Anaxa, Z14Mad5Anaxa or Z18Mad5Anaxa and a respective control.
- the mice were vaccinated five times (Week0, Week2, Week4, Week6 and Week8) s.c. Mice were bled 7 days after the 2 nd , 3 rd , 4 th and 5 th vaccination and multimer staining was performed (one experiment with 4 mice per group).
- C57BL/6 mice were assigned to three different groups (3-4 mice per group): naive, Z13Mad5Anaxa or Z14Mad5Anaxa.
- C57BL/6 mice of the Z13Mad5Anaxa group and of the Z14Mad5Anaxa group were vaccinated five times (Week0, Week2, Week4, Week6 and Week8) s.c. with 2 nmol of either Z13Mad5Anaxa (cf. Example 7) or Z14Mad5Anaxa (cf. Example 25).
- mice Nine days after the 5th vaccination, mice were euthanized, organs recovered and multimer staining was performed to identify the percentage of SIINFEKL-specific CD8 T cells in the spleen, bone marrow and draining lymph nodes (inguinal and axillary).
- mice vaccinated with Z13Mad5Anaxa or with Z14Mad5Anaxa showed a similar increase in multimer-positive cells, in particular in the spleen and bone marrow as well as a slight increase in draining lymph nodes.
- mice vaccinated with Z13Mad5Anaxa showed a significant increase in IFN- ⁇ producing cells compared to na ⁇ ve mice.
- Mice vaccinated with Z14Mad5Anaxa showed also an increase in IFN- ⁇ producing cells compared to na ⁇ ve mice, however, the increase was not significant, which may be due to the low number of mice (3 mice in Z14Mad5Anaxa group).
- mice vaccinated with Z13Mad5Anaxa showed a highly significant increase in IFN- ⁇ producing cells compared to na ⁇ ve mice.
- Mice vaccinated with Z14Mad5Anaxa showed also an increase in IFN- ⁇ producing cells compared to na ⁇ ve mice, however, the increase was not significant, which may be due to the low number of mice (3 mice in Z14Mad5Anaxa group).
- mice intracellular staining was performed on spleen cells stimulated with SIINFEKL OVACD8 peptide (SEQ ID NO: 35) to identify CD107a + IFN- ⁇ + TNF- ⁇ + cells. Results are shown in FIG. 43 . Mice vaccinated with Z13Mad5Anaxa or with Z14Mad5Anaxa showed a similar increase in CD107a + IFN- ⁇ + JNF- ⁇ + cells.
- mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and assigned to three different groups (na ⁇ ve, Z13Mad5Anaxa and Z14Mad5Anaxa). Mice were vaccinated twice at d5 and d13 after tumor implantation by s.c. injection of either 0.5 nmol of Z13Mad5Anaxa or Z14Mad5Anaxa in the right flank.
- Results are shown in FIG. 44 .
- Vaccination with Z13Mad5Anaxa or with Z14Mad5Anaxa resulted in significantly decreased tumor volumes compared to control mice ( FIG. 44 A) as well as to significantly increased survival rates compared to control mice ( FIG. 44 B).
- Those results indicate that both complexes, Z13Mad5Anaxa and Z14Mad5Anaxa, are able to significantly decrease tumor growth and to significantly prolong survival.
- Example 28 Comparison of the Immune Responses after Vaccination with Complexes Having Different Cell Penetrating Peptides
- fusion proteins which comprise CPPs other than Z13—namely Z14 (SEQ ID NO: 7) or Z18 (SEQ ID NO: 11).
- Those fusion proteins also comprise the protein “MAD5”, which consists of different CD8 + and CD4 + epitopes from various antigens, and the TLR4 peptide agonist “EDA”. Accordingly, the following constructs were additionally designed:
- mice were assigned to eight different groups (4 mice per group): three groups receiving 2 nmol of either EDAZ13Mad5, EDAZ14Mad5 or EDAZ18Mad5 and a respective control and three groups receiving 0.5 nmol of either EDAZ13Mad5, EDAZ14Mad5 or EDAZ18Mad5 and a respective control group.
- the mice were vaccinated three times (Week0, Week2 and Week4) s.c. Mice were bled 7 days after the 2 nd and 3 rd vaccination and multimer staining was performed (one experiment with 4 mice per group).
- mice On d0 C57BL/6 mice were implanted s.c. with 3 ⁇ 10 5 EG7-OVA tumor cells in the left flank and assigned to two different groups (naive and EDAZ14Mad5). Mice were vaccinated twice at d5 and dl 3 after tumor implantation by s.c. injection of 0.5 nmol of EDAZ14Mad5 in the right flank.
- Results are shown in FIG. 46 .
- EDAZ13Mad5 cf. Example 4, FIGS. 9-11
- vaccination with EDAZ14Mad5 resulted in significantly decreased tumor volumes compared to control mice ( FIG. 46 A) as well as to significantly increased survival rates compared to control mice ( FIG. 46 B).
- Those results indicate that EDAZ14Mad5 is able to significantly decrease tumor growth and to significantly prolong survival—similarly to EDAZ13Mad5 (cf. Example 4, FIGS. 9-11 ).
- Example 30 Superior Efficacy of Z13Mad5Anaxa Fusion Construct Compared to Z13Mad5 and Anaxa in a Glioblastoma Model
- glioblastoma model was chosen (cf. Example 20). Namely, Z13Mad5Anaxa (cf. Example 7; SEQ ID NO: 28) was administered to one group of mice, whereas Z13Mad5 (SEQ ID NO: 29) and Anaxa (SEQ ID NO: 15) were administered (both together) to another group of mice.
- T cell homing at the tumor site was analyzed in G1261-Quad tumor-bearing mice (7-16 mice per group) vaccinated twice, namely at day 7 and at day 21 after tumor implantation (day 0), with 2 nmol Z13Mad5Anaxa vaccine.
- a group vaccinated with both, Z13Mad5 and Anaxa was used as control.
- C57BL/6 mice were implanted i.c. (intracranially) with 5 ⁇ 10 5 G1261-Quad tumor cells and vaccinated twice (at d7 and d21 following implantation) by s.c.
- FIG. 47 Results are shown in FIG. 47 .
- a significantly higher percentage of SIINFEKL-specific CD8 T cells was observed in the blood of Z13Mad5Anaxa-vaccinated mice as compared to mice vaccinated with both, Z13Mad5 and Anaxa ( FIG. 47A ).
- cytokine secretion was assessed.
- C57BL/6 mice were implanted i.c. with 5 ⁇ 10 5 G1261-Quad tumor cells and vaccinated twice (d7 and 21) by s.c. injection of 2 nmol of Z13Mad5Anaxa or 2 nmol of Z13Mad5 and 2 nmol of Anaxa.
- BILs were isolated and cultured during 6h with matured BMDCs loaded or not with SIINFEKL peptide (SEQ ID NO: 35) in presence of BrefeldinA before intracellular staining for cytokines.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Pharmacology & Pharmacy (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- Oncology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Cell Biology (AREA)
- General Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Gynecology & Obstetrics (AREA)
- Pregnancy & Childbirth (AREA)
- Developmental Biology & Embryology (AREA)
- Reproductive Health (AREA)
- Vascular Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Enzymes And Modification Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicinal Preparation (AREA)
- Virology (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Genetics & Genomics (AREA)
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EPPCT/EP2016/072475 | 2016-09-21 | ||
| EP2016072475 | 2016-09-21 | ||
| PCT/EP2017/073954 WO2018055060A1 (en) | 2016-09-21 | 2017-09-21 | Fusion comprising a cell penetrating peptide, a multi epitope and a tlr peptide agonist for treatment of cancer |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2017/073954 A-371-Of-International WO2018055060A1 (en) | 2016-09-21 | 2017-09-21 | Fusion comprising a cell penetrating peptide, a multi epitope and a tlr peptide agonist for treatment of cancer |
Related Child Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/104,786 Continuation US11338027B2 (en) | 2016-09-21 | 2020-11-25 | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| US20190255165A1 true US20190255165A1 (en) | 2019-08-22 |
Family
ID=60037562
Family Applications (3)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US16/331,398 Abandoned US20190255165A1 (en) | 2016-09-21 | 2017-09-21 | Fusion Comprising A Cell Penetrating Peptide, A Multi Epitope And A TLR Peptide Agonist For Treatment Of Cancer |
| US17/104,786 Active US11338027B2 (en) | 2016-09-21 | 2020-11-25 | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer |
| US17/718,975 Active 2038-03-10 US12220387B2 (en) | 2016-09-21 | 2022-04-12 | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer |
Family Applications After (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US17/104,786 Active US11338027B2 (en) | 2016-09-21 | 2020-11-25 | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer |
| US17/718,975 Active 2038-03-10 US12220387B2 (en) | 2016-09-21 | 2022-04-12 | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer |
Country Status (15)
| Country | Link |
|---|---|
| US (3) | US20190255165A1 (enExample) |
| EP (1) | EP3515476B1 (enExample) |
| JP (1) | JP7346291B2 (enExample) |
| KR (2) | KR20190057345A (enExample) |
| CN (1) | CN109963585B (enExample) |
| AU (1) | AU2017331949B2 (enExample) |
| CA (1) | CA3031170A1 (enExample) |
| CL (3) | CL2019000694A1 (enExample) |
| DK (1) | DK3515476T3 (enExample) |
| ES (1) | ES2983085T3 (enExample) |
| HU (1) | HUE067838T2 (enExample) |
| IL (1) | IL265479B (enExample) |
| MX (1) | MX2019002968A (enExample) |
| PL (1) | PL3515476T3 (enExample) |
| WO (1) | WO2018055060A1 (enExample) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20200087363A1 (en) * | 2018-09-17 | 2020-03-19 | Immatics Biotechnologies Gmbh | B*44 restricted peptides for use in immunotherapy against cancers and related methods |
| US20220088162A1 (en) * | 2020-09-14 | 2022-03-24 | Boehringer Ingelheim International Gmbh | Heterologous Prime Boost Vaccine |
| US11338027B2 (en) * | 2016-09-21 | 2022-05-24 | Amal Therapeutics Sa | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer |
| US12178788B2 (en) | 2015-03-16 | 2024-12-31 | Amal Therapeutics Sa | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist |
| US12214048B2 (en) | 2016-03-16 | 2025-02-04 | Amal Therapeutics Sa | Combination of an immune checkpoint modulator and a complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for use in medicine |
Families Citing this family (16)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| KR20240149976A (ko) | 2017-04-04 | 2024-10-15 | 바린투스 바이오테라퓨틱스 노쓰 아메리카, 인크. | 펩티드-기반 백신, 그의 제조 방법, 및 면역 반응을 유도하기 위한 그의 용도 |
| US12121573B2 (en) | 2019-07-14 | 2024-10-22 | Tianxin Wang | Methods and agents including STING agonist to treat tumor |
| JP2022536695A (ja) * | 2019-06-12 | 2022-08-18 | ビオンテック ユーエス インコーポレイテッド | 新抗原組成物およびその使用 |
| CN110448689A (zh) * | 2019-08-06 | 2019-11-15 | 太仓美诺恒康生物技术有限公司 | mRNA疫苗及其试剂盒、应用 |
| US20220347315A1 (en) * | 2019-11-22 | 2022-11-03 | The University Of North Carolina At Chapel Hill | Methods and compositions for increasing transduction efficiency with cell membrane fusion proteins |
| EP3827840A1 (en) | 2019-11-29 | 2021-06-02 | Academisch Ziekenhuis Leiden h.o.d.n. LUMC | Teipp peptide variant and uses thereof |
| KR20230012559A (ko) | 2020-05-19 | 2023-01-26 | 베링거 인겔하임 인터내셔날 게엠베하 | 암 치료를 위한 결합 분자 |
| WO2022079175A1 (en) * | 2020-10-14 | 2022-04-21 | Boehringer Ingelheim International Gmbh | Combination of a sting agonist and a complex comprising a cell penetrating peptide, a cargo and a tlr peptide agonist |
| CN113480666B (zh) * | 2021-08-13 | 2024-01-26 | 郑州伊美诺生物技术有限公司 | Ca153融合蛋白及其制备方法和ca153检测质控品或校准品 |
| CN113786481A (zh) * | 2021-09-27 | 2021-12-14 | 深圳市中佳生物医疗科技有限公司 | 一种抗肿瘤疫苗及其制备方法 |
| MX2024011238A (es) * | 2022-03-16 | 2024-09-19 | Boehringer Ingelheim Int | Antigenos tumorales, compuestos que comprenden los antigenos tumorales kras, tpx2 o aurka y usos de los mismos. |
| KR102823824B1 (ko) | 2022-08-10 | 2025-06-24 | 강원대학교산학협력단 | Pde5 억제제 특이적 결합 도메인, 재조합 단백질 및 이의 용도 |
| KR102886457B1 (ko) | 2022-10-14 | 2025-11-18 | 강원대학교산학협력단 | mTOR 억제제 특이적 결합 도메인, 재조합 단백질 및 이의 용도 |
| GB202216453D0 (en) * | 2022-11-04 | 2022-12-21 | Lisziewicz Julianna | Identification of antigens which induce t-cell responses |
| WO2024196664A1 (en) * | 2023-03-17 | 2024-09-26 | University Of Washington | Dna vaccine targeting overexpressed antigens in colorectal cancer |
| JP7723457B2 (ja) * | 2023-07-03 | 2025-08-14 | メスキュージェナシス株式会社 | 細胞膜透過性を有するペプチドおよびそのスクリーニング方法 |
Family Cites Families (93)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5851795A (en) | 1991-06-27 | 1998-12-22 | Bristol-Myers Squibb Company | Soluble CTLA4 molecules and uses thereof |
| US6479055B1 (en) | 1993-06-07 | 2002-11-12 | Trimeris, Inc. | Methods for inhibition of membrane fusion-associated events, including respiratory syncytial virus transmission |
| FR2728904B1 (fr) | 1995-01-04 | 1997-03-14 | Pasteur Institut | Reactif peptidique permettant de detecter une infection primaire a virus d'epstein-barr par recherche des anticorps correspondants, et procede d'utilisation de ce reactif |
| US5855887A (en) | 1995-07-25 | 1999-01-05 | The Regents Of The University Of California | Blockade of lymphocyte down-regulation associated with CTLA-4 signaling |
| US6051227A (en) | 1995-07-25 | 2000-04-18 | The Regents Of The University Of California, Office Of Technology Transfer | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| US5811097A (en) | 1995-07-25 | 1998-09-22 | The Regents Of The University Of California | Blockade of T lymphocyte down-regulation associated with CTLA-4 signaling |
| AU6703198A (en) | 1997-03-21 | 1998-10-20 | Brigham And Women's Hospital | Immunotherapeutic ctla-4 binding peptides |
| US6258782B1 (en) | 1998-05-20 | 2001-07-10 | Trimeris, Inc. | Hybrid polypeptides with enhanced pharmacokinetic properties |
| HK1041274B (zh) | 1998-12-23 | 2017-12-01 | 辉瑞大药厂 | 抗ctla-4的人单克隆抗体 |
| US6682736B1 (en) | 1998-12-23 | 2004-01-27 | Abgenix, Inc. | Human monoclonal antibodies to CTLA-4 |
| US7109003B2 (en) | 1998-12-23 | 2006-09-19 | Abgenix, Inc. | Methods for expressing and recovering human monoclonal antibodies to CTLA-4 |
| US6750008B1 (en) | 1999-07-09 | 2004-06-15 | Trimeris, Inc. | Methods and compositions for inhibition of membrane fusion-associated events, including HIV transmission |
| US7605238B2 (en) | 1999-08-24 | 2009-10-20 | Medarex, Inc. | Human CTLA-4 antibodies and their uses |
| CN1371416B (zh) | 1999-08-24 | 2012-10-10 | 梅达里克斯公司 | 人ctla-4抗体及其应用 |
| WO2001054732A1 (en) | 2000-01-27 | 2001-08-02 | Genetics Institute, Llc. | Antibodies against ctla4 (cd152), conjugates comprising same, and uses thereof |
| EP1650221B1 (en) * | 2000-02-23 | 2012-06-27 | GlaxoSmithKline Biologicals SA | Novel compounds |
| US7229960B2 (en) * | 2000-11-03 | 2007-06-12 | University Of Vermont And State Agricultural College | Methods and compositions for inhibiting GRB7 |
| US20060222656A1 (en) | 2005-04-01 | 2006-10-05 | University Of Maryland, Baltimore | MAGE-A3/HPV 16 peptide vaccines for head and neck cancer |
| AUPR593101A0 (en) | 2001-06-26 | 2001-07-19 | Council Of The Queensland Institute Of Medical Research, The | Cytomegalovirus t cell epitopes |
| US7892559B2 (en) | 2002-01-30 | 2011-02-22 | Survac Aps | Survivin-derived peptides and use thereof |
| GB0218821D0 (en) | 2002-08-13 | 2002-09-18 | Glaxosmithkline Biolog Sa | Novel compositions |
| ATE540978T1 (de) | 2002-10-17 | 2012-01-15 | Genmab As | Humane monoklonale antikörper gegen cd20 |
| ATE552011T1 (de) | 2003-10-15 | 2012-04-15 | Ist Superiore Sanita | Kolorektal-karzinom-antigen |
| US20080305120A1 (en) | 2004-06-17 | 2008-12-11 | Medimmune, Inc. | Immunogenic Compositions Comprising Hmgb 1 Polypeptides |
| CA2601417C (en) | 2004-07-01 | 2018-10-30 | Novo Nordisk A/S | Human anti-kir antibodies |
| DK1853305T3 (en) | 2005-02-04 | 2014-12-01 | Survac Aps | Survivin-peptide vaccine |
| ES2291071B1 (es) | 2005-06-13 | 2009-03-16 | Proyecto De Biomedicina Cima, S.L. | Agentes y metodos basados en el uso del dominio eda de la fibronectina. |
| HUE030139T2 (en) | 2006-12-27 | 2017-04-28 | Univ Emory | Compositions and methods for the treatment of infections |
| EP1987839A1 (en) | 2007-04-30 | 2008-11-05 | I.N.S.E.R.M. Institut National de la Sante et de la Recherche Medicale | Cytotoxic anti-LAG-3 monoclonal antibody and its use in the treatment or prevention of organ transplant rejection and autoimmune disease |
| CA2691357C (en) | 2007-06-18 | 2014-09-23 | N.V. Organon | Antibodies to human programmed death receptor pd-1 |
| RS54147B1 (sr) | 2007-07-27 | 2015-12-31 | Immatics Biotechnologies Gmbh | Nova imunoterapija protiv tumora mozga |
| CA2695385A1 (en) | 2007-07-31 | 2009-02-05 | Atul Bedi | Polypeptide-nucleic acid conjugate for immunoprophylaxis or immunotherapy for neoplastic or infectious disorders |
| EP2044949A1 (en) | 2007-10-05 | 2009-04-08 | Immutep | Use of recombinant lag-3 or the derivatives thereof for eliciting monocyte immune response |
| EP2278994A4 (en) | 2008-04-25 | 2012-01-18 | Inst Systems Biology | Flagellin POLYPEPTIDE VACCINES |
| SI2119726T2 (en) | 2008-05-14 | 2018-03-30 | Immatics Biotechnologies Gmbh | New and powerful Class II MHC peptides derived from survivin and neurocane |
| WO2009155535A2 (en) | 2008-06-20 | 2009-12-23 | Duke University | Compositions, methods and kits for eliciting an immune response |
| AR072999A1 (es) | 2008-08-11 | 2010-10-06 | Medarex Inc | Anticuerpos humanos que se unen al gen 3 de activacion linfocitaria (lag-3) y los usos de estos |
| KR101040281B1 (ko) * | 2008-08-22 | 2011-06-10 | 가톨릭대학교 산학협력단 | Tat-항원 융합단백질과 아쥬번트를 포함하는 백신 조성물 |
| US8074880B2 (en) | 2008-12-01 | 2011-12-13 | Research In Motion Limited | Method, system and mobile device employing enhanced fingerprint authentication |
| PT2376535T (pt) | 2008-12-09 | 2017-06-23 | Hoffmann La Roche | Anticorpos anti-pd-l1 e a sua utilização para a melhoria do funcionamento das células t |
| WO2010105347A1 (en) | 2009-03-16 | 2010-09-23 | Mcmaster University | Vaccination methods |
| MX2011012623A (es) * | 2009-05-27 | 2011-12-14 | Glaxosmithkline Biolog Sa | Construcciones de casb7439. |
| US8563694B2 (en) | 2009-07-31 | 2013-10-22 | Medarex, Inc. | Fully human antibodies to BTLA |
| CA2772204A1 (en) | 2009-08-31 | 2011-03-03 | Amplimmune, Inc. | Methods and compositions for the inhibition of transplant rejection |
| EP2476440B1 (en) | 2009-09-11 | 2017-08-02 | Proyecto de Biomedicina Cima, S.L. | Therapeutic compositions for the treatment of hpv-induced diseases |
| WO2011036211A1 (en) | 2009-09-23 | 2011-03-31 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Polypeptides and nucleic acids for treating erbb2-dependent cancers |
| WO2011066389A1 (en) | 2009-11-24 | 2011-06-03 | Medimmmune, Limited | Targeted binding agents against b7-h1 |
| WO2011101332A1 (en) | 2010-02-16 | 2011-08-25 | Proyecto De Biomedicina Cima, S.L. | Compositions based on the fibronectin extracellular domain a for the treatment of melanoma |
| PH12012501751A1 (en) | 2010-03-04 | 2012-11-12 | Macrogenics Inc | Antibodies reactive with b7-h3, immunologically active fragments thereof and uses thereof |
| US9175048B2 (en) | 2010-04-26 | 2015-11-03 | Universite Joseph Fourier | Use of peptides as transporters intended for the internalization of molecules of interest into target cells |
| US9314516B2 (en) | 2010-05-04 | 2016-04-19 | Cassian Yee | Conditional superagonist CTL ligands for the promotion of tumor-specific CTL responses |
| ES2558106T3 (es) | 2010-07-30 | 2016-02-02 | Curevac Ag | Formación de complejos de ácidos nucleicos con componentes catiónicos disulfuro-reticulados para la transfección e inmunoestimulación |
| CA3066981A1 (en) | 2010-08-24 | 2012-03-01 | University Of Pittsburgh - Of The Commonwealth System Of Higher Educatn | Interleukin-13 receptor alpha 2 peptide-based brain cancer vaccines |
| JP5991976B2 (ja) | 2010-09-14 | 2016-09-14 | カウンスィル オブ サイエンティフィック アンド インダストリアル リサーチCouncil Of Scientific & Industrial Research | 病原体に対する持続性免疫および防御を生成させるのに有用な合成免疫原 |
| US9555074B2 (en) | 2010-10-08 | 2017-01-31 | Regents Of The University Of Minnesota | Annexin II compositions |
| KR101760464B1 (ko) | 2010-10-13 | 2017-07-24 | 사회복지법인 삼성생명공익재단 | 교모세포종의 진단 또는 예후 예측용 바이오 마커 및 그 용도 |
| EP2663367A4 (en) | 2011-01-10 | 2014-08-06 | Cleveland Biolabs Inc | USE OF GREAT-SIMILAR RECEPTOR AGONISTS FOR THE TREATMENT OF CANCER |
| US9187534B2 (en) * | 2011-03-11 | 2015-11-17 | Universite De Geneve | Multi-epitopic vaccine |
| TWI454478B (zh) | 2011-05-13 | 2014-10-01 | Academia Sinica | 類鐸受體-2 增效劑及其用於刺激免疫反應之用途 |
| WO2013006490A2 (en) | 2011-07-01 | 2013-01-10 | Cellerant Therapeutics, Inc. | Antibodies that specifically bind to tim3 |
| US9676854B2 (en) | 2011-08-15 | 2017-06-13 | Medimmune, Llc | Anti-B7-H4 antibodies and their uses |
| US9422351B2 (en) | 2011-11-03 | 2016-08-23 | The Trustees Of The University Of Pennsylvania | Isolated B7-H4 specific compositions and methods of use thereof |
| SG11201402365RA (en) | 2011-11-16 | 2014-06-27 | Amgen Inc | Methods of treating epidermal growth factor deletion mutant viii related disorders |
| WO2013113326A1 (en) | 2012-01-31 | 2013-08-08 | Curevac Gmbh | Pharmaceutical composition comprising a polymeric carrier cargo complex and at least one protein or peptide antigen |
| US9597393B2 (en) | 2012-02-09 | 2017-03-21 | Av Therapeutics, Inc. | Synthetic toll-like receptor-4 (TLR-4) agonist peptides |
| AU2013289372B2 (en) | 2012-07-13 | 2017-11-02 | S-Target Therapeutics Gmbh | Immunoregulatory vaccine |
| US9657064B2 (en) | 2012-09-13 | 2017-05-23 | Les Hopitaux Universitaires De Geneve | Cell penetrating peptides |
| KR101839864B1 (ko) | 2012-09-21 | 2018-03-20 | 인텐시티 쎄라퓨틱스, 인코포레이티드 | 암을 치료하는 방법 |
| US20150290306A1 (en) | 2012-10-29 | 2015-10-15 | David E. Anderson | Compositions and methods for diagnosis and treatment of malignant gliomas |
| EP2968407A4 (en) | 2013-03-13 | 2017-01-04 | Neostem Oncology, LLC | Individualized high purity colon carcinoma stem cells, methods and use of the same |
| US20160257961A1 (en) | 2013-11-06 | 2016-09-08 | Solstice Biologics, Ltd. | Polynucleotide constructs having disulfide groups |
| HUE060293T2 (hu) * | 2013-11-13 | 2023-02-28 | Univ Minnesota | Annexin II variáns készítmények és eljárások |
| US20160326597A1 (en) | 2014-01-02 | 2016-11-10 | Memorial Sloan Kettering Cancer Center | Determinants of cancer response to immunotherapy |
| JP2017522046A (ja) | 2014-06-06 | 2017-08-10 | ソルスティス バイオロジクス,リミティッド | 生物可逆的および生物不可逆的基を有するポリヌクレオチド構築物 |
| KR20170074235A (ko) | 2014-10-31 | 2017-06-29 | 메사추세츠 인스티튜트 오브 테크놀로지 | 면역 세포로의 생체분자의 전달 |
| CN106999582A (zh) * | 2014-11-13 | 2017-08-01 | 约翰·霍普金斯大学 | 检查点阻断和微卫星不稳定性 |
| US20180133327A1 (en) * | 2015-03-16 | 2018-05-17 | Amal Therapeutics Sa | Cell Penetrating Peptides and Complexes Comprising the Same |
| BR102015025502B1 (pt) | 2015-04-30 | 2022-06-21 | Aegerion Pharmaceuticals, Inc | Composição de lomitapida, tablete, produto de lomitapida, métodos para analisar uma composição de amostra de lomitapida e para determinar uma quantidade de uma impureza em uma amostra da composição |
| JPWO2017002345A1 (ja) | 2015-06-29 | 2018-04-19 | パナソニックIpマネジメント株式会社 | 冷蔵庫 |
| GB201520592D0 (en) | 2015-11-23 | 2016-01-06 | Immunocore Ltd & Adaptimmune Ltd | Peptides |
| EP3400292B1 (en) | 2016-01-08 | 2020-08-26 | Replimune Limited | Use of an oncolytic virus for the treatment of cancer |
| CN109069561A (zh) | 2016-01-11 | 2018-12-21 | 图恩斯通有限合伙公司 | 溶瘤病毒和检查点抑制剂组合疗法 |
| CA3010779A1 (en) | 2016-03-16 | 2017-09-21 | Amal Therapeutics Sa | Combination of an immune checkpoint modulator and a complex comprising a cell penetrating peptide, a cargo and a tlr peptide agonist for use in medicine |
| US20190151437A1 (en) | 2016-05-09 | 2019-05-23 | Turnstone Limited Partnership | Combination prime: boost therapy |
| PL417980A1 (pl) | 2016-07-16 | 2018-01-29 | Univ Warszawski | Nowe fosfotriazolowe analogi kapu końca 5' mRNA, kompozycja je zawierająca, cząsteczka RNA je zawierająca, ich zastosowania i sposób syntezy cząsteczki RNA, białka i peptydu |
| US11052149B2 (en) | 2016-09-19 | 2021-07-06 | The University Of North Carolina At Chapel Hill | Methods and compositions for inducing an immune response |
| EP3515476B1 (en) | 2016-09-21 | 2024-05-22 | Amal Therapeutics SA | Fusion comprising a cell penetrating peptide, a multiepitope and a tlr peptide agonist for treatment of cancer |
| CA3058807A1 (en) | 2017-04-03 | 2018-10-11 | Neon Therapeutics, Inc. | Protein antigens and uses thereof |
| EP3746104A1 (en) | 2018-02-02 | 2020-12-09 | Novartis AG | Combination of sting agonist and il-15/il15-ra for the treatment of cancer |
| CA3110102A1 (en) | 2018-06-20 | 2019-12-26 | Yale University | Rig-i agonists and treatments using same |
| WO2020010451A1 (en) | 2018-07-10 | 2020-01-16 | Trillium Therapeutics Inc. | Heteroaromatic-fused imidazolyl amides, compositions and uses thereof as sting agonists |
| CN116348137A (zh) | 2020-09-14 | 2023-06-27 | 勃林格殷格翰国际有限公司 | 异源初免加强疫苗 |
| WO2022079175A1 (en) * | 2020-10-14 | 2022-04-21 | Boehringer Ingelheim International Gmbh | Combination of a sting agonist and a complex comprising a cell penetrating peptide, a cargo and a tlr peptide agonist |
-
2017
- 2017-09-21 EP EP17780656.9A patent/EP3515476B1/en active Active
- 2017-09-21 ES ES17780656T patent/ES2983085T3/es active Active
- 2017-09-21 JP JP2019510849A patent/JP7346291B2/ja active Active
- 2017-09-21 DK DK17780656.9T patent/DK3515476T3/da active
- 2017-09-21 CN CN201780069631.0A patent/CN109963585B/zh active Active
- 2017-09-21 IL IL265479A patent/IL265479B/en unknown
- 2017-09-21 AU AU2017331949A patent/AU2017331949B2/en active Active
- 2017-09-21 HU HUE17780656A patent/HUE067838T2/hu unknown
- 2017-09-21 CA CA3031170A patent/CA3031170A1/en active Pending
- 2017-09-21 KR KR1020197011382A patent/KR20190057345A/ko not_active Ceased
- 2017-09-21 MX MX2019002968A patent/MX2019002968A/es unknown
- 2017-09-21 US US16/331,398 patent/US20190255165A1/en not_active Abandoned
- 2017-09-21 WO PCT/EP2017/073954 patent/WO2018055060A1/en not_active Ceased
- 2017-09-21 PL PL17780656.9T patent/PL3515476T3/pl unknown
- 2017-09-21 KR KR1020237029678A patent/KR102879364B1/ko active Active
-
2019
- 2019-03-18 CL CL2019000694A patent/CL2019000694A1/es unknown
-
2020
- 2020-11-25 US US17/104,786 patent/US11338027B2/en active Active
-
2021
- 2021-06-11 CL CL2021001541A patent/CL2021001541A1/es unknown
-
2022
- 2022-04-12 US US17/718,975 patent/US12220387B2/en active Active
-
2023
- 2023-07-31 CL CL2023002252A patent/CL2023002252A1/es unknown
Cited By (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12178788B2 (en) | 2015-03-16 | 2024-12-31 | Amal Therapeutics Sa | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist |
| US12220450B2 (en) | 2015-03-16 | 2025-02-11 | Amal Therapeutics Sa | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for treatment of colorectal cancer |
| US12453762B2 (en) | 2015-03-16 | 2025-10-28 | Amal Therapeutics Sa | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for treatment of glioblastoma |
| US12214048B2 (en) | 2016-03-16 | 2025-02-04 | Amal Therapeutics Sa | Combination of an immune checkpoint modulator and a complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for use in medicine |
| US11338027B2 (en) * | 2016-09-21 | 2022-05-24 | Amal Therapeutics Sa | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer |
| US12220387B2 (en) | 2016-09-21 | 2025-02-11 | Amal Therapeutics Sa | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer |
| US20200087363A1 (en) * | 2018-09-17 | 2020-03-19 | Immatics Biotechnologies Gmbh | B*44 restricted peptides for use in immunotherapy against cancers and related methods |
| US11945850B2 (en) * | 2018-09-17 | 2024-04-02 | Immatics Biotechnologies Gmbh | B*44 restricted peptides for use in immunotherapy against cancers and related methods |
| US12162917B2 (en) | 2018-09-17 | 2024-12-10 | Immatics Biotechnologies Gmbh | B*44 restricted peptides for use in immunotherapy against cancers and related methods |
| US20220088162A1 (en) * | 2020-09-14 | 2022-03-24 | Boehringer Ingelheim International Gmbh | Heterologous Prime Boost Vaccine |
Also Published As
| Publication number | Publication date |
|---|---|
| WO2018055060A1 (en) | 2018-03-29 |
| PL3515476T3 (pl) | 2024-09-30 |
| CL2019000694A1 (es) | 2019-06-07 |
| CA3031170A1 (en) | 2018-03-29 |
| US12220387B2 (en) | 2025-02-11 |
| US20220305101A1 (en) | 2022-09-29 |
| US11338027B2 (en) | 2022-05-24 |
| AU2017331949A1 (en) | 2019-01-31 |
| AU2017331949B2 (en) | 2024-11-14 |
| CL2023002252A1 (es) | 2024-03-01 |
| US20210085768A1 (en) | 2021-03-25 |
| MX2019002968A (es) | 2019-10-15 |
| JP2019528693A (ja) | 2019-10-17 |
| RU2019111160A (ru) | 2020-10-22 |
| EP3515476B1 (en) | 2024-05-22 |
| IL265479A (en) | 2019-05-30 |
| CN109963585A (zh) | 2019-07-02 |
| IL265479B (en) | 2022-09-01 |
| JP7346291B2 (ja) | 2023-09-19 |
| EP3515476A1 (en) | 2019-07-31 |
| CL2021001541A1 (es) | 2022-02-04 |
| KR102879364B1 (ko) | 2025-11-04 |
| KR20230131498A (ko) | 2023-09-13 |
| HUE067838T2 (hu) | 2024-11-28 |
| CN109963585B (zh) | 2024-10-15 |
| ES2983085T3 (es) | 2024-10-21 |
| DK3515476T3 (da) | 2024-09-02 |
| KR20190057345A (ko) | 2019-05-28 |
| RU2019111160A3 (enExample) | 2021-01-19 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12220450B2 (en) | Complex comprising a cell penetrating peptide, a cargo and a TLR peptide agonist for treatment of colorectal cancer | |
| US12220387B2 (en) | Fusion comprising a cell penetrating peptide, a multi epitope and a TLR peptide agonist for treatment of cancer | |
| RU2807135C2 (ru) | Слитая конструкция, содержащая проникающий в клетку пептид, полиэпитоп и пептидный агонист tlr, предназначенная для лечения рака | |
| HK40012989B (en) | Fusion comprising a cell penetrating peptide, a multi epitope and a tlr peptide agonist for treatment of cancer | |
| HK40012989A (en) | Fusion comprising a cell penetrating peptide, a multi epitope and a tlr peptide agonist for treatment of cancer |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| AS | Assignment |
Owner name: AMAL THERAPEUTICS SA, SWITZERLAND Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:DEROUAZI, MADIHA;BELNOUE, ELODIE;REEL/FRAME:048809/0896 Effective date: 20190322 |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: APPLICATION DISPATCHED FROM PREEXAM, NOT YET DOCKETED |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
| STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
| STCB | Information on status: application discontinuation |
Free format text: EXPRESSLY ABANDONED -- DURING EXAMINATION |