US20160355589A1 - Anti-tigit antibodies - Google Patents

Anti-tigit antibodies Download PDF

Info

Publication number
US20160355589A1
US20160355589A1 US15/121,624 US201515121624A US2016355589A1 US 20160355589 A1 US20160355589 A1 US 20160355589A1 US 201515121624 A US201515121624 A US 201515121624A US 2016355589 A1 US2016355589 A1 US 2016355589A1
Authority
US
United States
Prior art keywords
seq
amino acid
antibody
acid sequence
variable region
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
US15/121,624
Other languages
English (en)
Inventor
Sybil M. G. Williams
Drake LaFace
Laurence Fayadat-Dilman
Gopalan Raghunathan
Linda Liang
Wolfgang Seghezzi
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Merck Sharp and Dohme LLC
Original Assignee
Merck Sharp and Dohme LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=53938463&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=US20160355589(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Application filed by Merck Sharp and Dohme LLC filed Critical Merck Sharp and Dohme LLC
Priority to AP2017009765A priority Critical patent/AP2017009765A0/en
Priority to US15/121,624 priority patent/US20160355589A1/en
Assigned to MERCK SHARP & DOHME CORP. reassignment MERCK SHARP & DOHME CORP. ASSIGNMENT OF ASSIGNORS INTEREST (SEE DOCUMENT FOR DETAILS). Assignors: LIANG, LINDA, FAYADAT-DILMAN, Laurence, LA FACE, DRAKE, RAGHUNATHAN, GOPALAN, SEGHEZZI, WOLFGANG, WILLIAMS, SYBIL M. G.
Publication of US20160355589A1 publication Critical patent/US20160355589A1/en
Abandoned legal-status Critical Current

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39541Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against normal tissues, cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/04Immunostimulants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507Comprising a combination of two or more separate antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/74Inducing cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • YGENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02ATECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Definitions

  • the present invention relates to anti-TIGIT antibodies, as well as use of these antibodies in the treatment of diseases such as cancer and infectious disease.
  • IMRs inhibitory immune modulatory receptors
  • Blockade of inhibitory IMRs appears to unleash potent tumor-specific immune responses more effectively than direct stimulation of tumor-immunity with activating cytokines or tumor vaccines, and this approach has the potential to transform human cancer therapy.
  • inhibitory IMRs and ligands that regulate cellular immunity are commonly overexpressed on tumor cells and tumor associated macrophages (TAMs).
  • TAMs tumor associated macrophages
  • overexpression of PD-L1 in tumors is associated with tumor specific T cell exhaustion and a poor prognosis.
  • Blockade of PD-1/PD-L1 ligation in clinical trials resulted in durable tumor regression responses in a substantial proportion of patients.
  • TIGIT T cell immunoreceptor with Ig and ITIM domains
  • TIGIT is an immunomodulatory receptor expressed primarily on activated T cells and NK cells.
  • TIGIT is also known as VSIG9; VSTM3; and WUCAM. Its structure shows one extracellular immunoglobulin domain, a type 1 transmembrane region and two ITIM motifs.
  • TIGIT forms part of a co-stimulatory network that consists of positive (CD226) and negative (TIGIT) immunomodulatory receptors on T cells, and ligands expressed on APCs (CD155 and CD112).
  • TIGIT immunoreceptor tyrosine-based inhibition motif
  • ITIM immunoreceptor tyrosine-based inhibition motif
  • ligation of TIGIT by receptor-ligands CD155 and CD112 expressed by tumor cells or TAMS may contribute to the suppression of TCR-signaling and T cell activation, which is essential for mounting effective anti-tumor immunity.
  • an antagonist antibody specific for TIGIT could inhibit the CD155 and CD112 induced suppression of T cell responses and enhance anti-tumor immunity. It is an object of the present invention to obtain an anti-TIGIT antibody that can be used for the treatment of cancer, either alone or in combination with other reagents.
  • the invention provides anti-TIGIT antibodies and antigen binding fragments thereof comprising the structural and functional features specified below.
  • the invention provides an antibody or antigen binding fragment thereof that binds to human TIGIT, comprising: a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82, 83, 59, 90, 140, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166 or 167.
  • a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82, 83, 59, 90, 140, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166 or 167.
  • the antibody or antigen binding fragment thereof optionally has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e g KinExa or OCTET); (ii) cross-reacts with cynomolgous and rhesus TIGIT; (iii) blocks binding of human TIGIT to human CD155 and human CD112; (iv) increases T cell activation; (v) stimulates antigen-specific T-cell production of IL-2 and IFN ⁇ ; (vi) blocks induction of T cell suppression of activation induced by TIGIT ligation with cognate ligands CD155 and CD112.
  • the invention provides an antibody or antigen binding fragment thereof that binds to human TIGIT, comprising: a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6, 62, 74, 75, 76, 77, 78 or 93.
  • the antibody optionally has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g.
  • the invention provides an antibody or antigen binding fragment thereof that binds to human TIGIT comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 140.
  • the antibody or antigen binding fragment comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82 or 83.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3.
  • the antibody or antigen binding fragment thereof optionally has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e g KinExa or OCTET); (ii) cross-reacts with cynomolgous and rhesus TIGIT; (iii) blocks binding of human TIGIT to human CD155 and human CD112; (iv) increases T cell activation; (v) stimulates antigen-specific T-cell production of IL-2 and IFN ⁇ ; (vi) blocks induction of T cell suppression of activation induced by TIGIT ligation with cognate ligands CD155 and CD112.
  • the invention provides an antibody or antigen binding fragment that binds to human TIGIT comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 57; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 58; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 59.
  • the antibody or antigen binding fragment thereof optionally has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g.
  • the invention provides an antibody or antigen binding fragment that binds to human TIGIT comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 147; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 153.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 134 or 135; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166 or 167.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 154.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 155.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 156.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 157.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 158.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 159.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 160.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 161.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 162.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 163.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 164.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 165.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 166.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; and (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 167.
  • the antibody or antigen binding fragment thereof optionally has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e g KinExa or OCTET); (ii) cross-reacts with cynomolgous and rhesus TIGIT; (iii) blocks binding of human TIGIT to human CD155 and human CD112; (iv) increases T cell activation; (v) stimulates antigen-specific T-cell production of IL-2 and IFN ⁇ ; (vi) blocks induction of T cell suppression of activation induced by TIGIT ligation with cognate ligands CD155 and CD112.
  • the invention provides an antibody or antigen binding fragment that binds to human TIGIT comprising: (i) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (ii) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 141; and (iii) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 142.
  • the antibody or antigen binding fragment thereof comprises: (i) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (ii) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5, 65, 66, 67, 68, 69, 70, 71, 72 or; and (iii) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6, 74, 75, 76, 77 or 78.
  • the antibody or antigen binding fragment thereof comprises: (i) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (ii) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (iii) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the antibody or antigen binding fragment thereof optionally has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e g KinExa or OCTET); (ii) cross-reacts with cynomolgous and rhesus TIGIT; (iii) blocks binding of human TIGIT to human CD155 and human CD112; (iv) increases T cell activation; (v) stimulates antigen-specific T-cell production of IL-2 and IFN ⁇ ; (vi) blocks induction of T cell suppression of activation induced by TIGIT ligation with cognate ligands CD155 and CD112.
  • the invention provides an antibody or antigen binding fragment that binds to human TIGIT comprising: (i) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 60; (ii) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 61; and (iii) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 62.
  • the antibody or antigen binding fragment thereof optionally has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e g KinExa or OCTET); (ii) cross-reacts with cynomolgous and rhesus TIGIT; (iii) blocks binding of human TIGIT to human CD155 and human CD112; (iv) increases T cell activation; (v) stimulates antigen-specific T-cell production of IL-2 and IFN ⁇ ; (vi) blocks induction of T cell suppression of activation induced by TIGIT ligation with cognate ligands CD155 and CD112.
  • the invention provides an antibody or antigen binding fragment that binds to human TIGIT comprising: (i) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (ii) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 148; and (iii) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof comprises: (i) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (ii) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121 or 122; and (iii) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof comprises: (i) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (ii) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (iii) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof optionally has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e g KinExa or OCTET); (ii) cross-reacts with cynomolgous and rhesus TIGIT; (iii) blocks binding of human TIGIT to human CD155 and human CD112; (iv) increases T cell activation; (v) stimulates antigen-specific T-cell production of IL-2 and IFN ⁇ ; (vi) blocks induction of T cell suppression of activation induced by TIGIT ligation with cognate ligands CD155 and CD112.
  • the invention provides an antibody or antigen binding fragment that binds to human TIGIT comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 140; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 141; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 142.
  • the antibody or antigen binding fragment comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82 or 83; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5, 65, 66, 67, 68, 69, 70, 71, 72 or 73; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6, 74, 75, 76, 77 or 78.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the antibody or antigen binding fragment thereof is humanized.
  • the antibody or antigen binding fragment thereof comprises a heavy chain variable region selected from the group consisting of SEQ ID NOs:9-24, 37-47, 143 and 144; and a light chain variable region selected from the group consisting of SEQ ID NOs: 25-30, 48-52, 146 and 147.
  • the antibody or antigen binding fragment thereof optionally has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g.
  • the invention provides an antibody or antigen binding fragment that binds to human TIGIT comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82 or 83; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5, 65, 66, 67, 68, 69, 70, 71, 72 or 73; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6, 74, 75, 76, 77 or 78; wherein the antibody or antigen binding fragment thereof comprises a heavy chain variable region comprising
  • the sequence variations occur in the framework regions.
  • the antibody binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
  • the invention also provides an antibody or antigen binding fragment thereof that binds to human TIGIT comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the antibody or antigen binding fragment thereof comprises 1, 2 or 3 amino acid substitutions in the heavy chain CDRs (SEQ ID NOs: 1-3) or in the light chain CDRs (SEQ ID NOs: 3-6).
  • the antibody comprises one amino acid substitution in the heavy chain CDR of SEQ ID NO: 3, wherein the substitution is made at position 13W, and wherein residue 13W is substituted to: F, Y, I, V or L.
  • the antibody comprises two amino acid substitutions in the light chain CDR of SEQ ID NO: 5, wherein the substitutions are made at position 3-4, and wherein residues 3N and 4S are substituted to: SN, SS, ST, TT, SY, NQ, GS, SQ and DS.
  • the antibody comprises one amino acid substitution in the light chain CDR of SEQ ID NO: 6, wherein the substitution is made at position 7, and wherein residue 7W is substituted to: F, Y, I, V or L.
  • the VH sequences of SEQ ID NOs: 9-24 and 37-47 have the CDRs of SEQ ID NOs:1-3; and VL sequences of SEQ ID NOs:25-30 and 48-52 have the CDRs of SEQ ID NOs: 4-6.
  • the CDR substitutions described above can be made in the corresponding CDRs of the VH sequences of SEQ ID NOs: 9-24 and 37-37, and in the CDRs of the VL sequences of SEQ ID NOs: 25-30 and 48-52.
  • the antibody binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e g KinExa or OCTET).
  • surface plasmon resonance e.g., BIACORE
  • a similar technique e.g KinExa or OCTET.
  • the invention provides an antibody or antigen binding fragment that binds to human TIGIT comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 57; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 58; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 59; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 60; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 61; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 62.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises 1, 2 or 3 amino acid substitutions in the heavy chain CDRs (SEQ ID NOs: 57-59) or in the light chain CDRs (SEQ ID NOs: 60-62), and retains one or more of its functional characteristics.
  • the antibody or antigen binding fragment thereof optionally has at least one of the following functional characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e g KinExa or OCTET), (ii) cross-reacts with cynomolgous and rhesus TIGIT; (iii) blocks binding of human TIGIT to human CD155 and human CD112; (iv) increases T cell activation; (v) stimulates antigen-specific T-cell production of IL-2 and IFN ⁇ ; (vi) blocks induction of T cell suppression of activation induced by TIGIT ligation with cognate ligands CD155 and CD112.
  • the invention also provides an antibody or antigen binding fragment thereof that binds to human TIGIT comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 147; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 153; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 148; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166 or 167; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92, 112, 113, 114, 115, 116,
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 154; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 155; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 156; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 157; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 158; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 159; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 160; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 161; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 162; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 163; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 164; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 165; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 166; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 167; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof optionally has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g.
  • the antibody or antigen binding fragment thereof binds to human TIGIT and comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the antibody comprises one amino acid substitution in the heavy chain CDR2 of SEQ ID NO: 89, wherein the substitution is made at position 7, and wherein residue D is substituted with: R, L, K, F, S, Y or V.
  • the antibody comprises one amino acid substitution in the heavy chain CDR2 of SEQ ID NO: 89, wherein the substitution is made at position 8, and wherein residue G is substituted with: R, N, Q, E, L K, S, Y or V.
  • the antibody comprises one amino acid substitution in the heavy chain CDR2 of SEQ ID NO: 89, wherein the substitution is made at position 12, wherein the N is substituted with: A or S.
  • the antibody comprises one amino acid substitution in the heavy chain CDR2 of SEQ ID NO: 89, wherein the substitution is made at position 13, wherein E is substituted with Q. In another embodiment, the antibody comprises one amino acid substitution in the heavy chain CDR2 of SEQ ID NO: 89, wherein the substitution is made at position 16, wherein K is substituted with Q. In another embodiment, the antibody comprises three amino acid substitution in the heavy chain CDR2 of SEQ ID NO: 89, wherein amino acid residue 12 is substituted with: A or S, amino acid residue 13 is substituted with Q and amino acid residue 16 is substituted with Q.
  • the antibody comprises one amino acid substitution in the heavy chain CDR3 of SEQ ID NO:90, wherein amino acid residue 6 is substituted with: A, D, E, F, G, I, K, N, Q, R, S, T, V or Y.
  • the antibody comprises one amino acid substitution in the light chain CDR of SEQ ID NO: 92, wherein the substitution is made at position 1, and wherein residue N is substituted with A, Y, W, S, T, R, H, G, I or V.
  • the antibody comprises one amino acid substitution in the light chain CDR of SEQ ID NO: 92, wherein the substitution is made at position 2, and wherein residue A is substituted with N, I, L, T, V.
  • the antibody or antigen binding fragment thereof is humanized. In one embodiment, the antibody or antigen binding fragment thereof optionally has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e g KinExa or OCTET), (ii) cross-reacts with cynomolgous and rhesus TIGIT; (iii) blocks binding of human TIGIT to human CD155 and human CD112; (iv) increases T cell activation; (v) stimulates antigen-specific T-cell production of IL-2 and IFN ⁇ ; (vi) blocks induction of T cell suppression of activation induced by TIGIT ligation with cognate ligands CD155 and CD112.
  • the invention also provides an antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region comprising the CDR1, CDR2 and CDR3 of any of SEQ ID NOs: 124-129 and/or a light chain variable region comprising the CDR1, CDR2 and CDR3 of any of SEQ ID NOs:130-133.
  • the invention also provides an isolated antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region selected from the group consisting of: SEQ ID NOs: 124-129 and/or a light chain variable region selected from the group consisting of: SEQ ID NOs: 130-133.
  • the D residue at position 56 of any one of SEQ ID NOs: 124-129 can be substituted with R, L, K, F, S, Y or V.
  • the G residue at position 57 of any one of SEQ ID NOs: 124-129 can be substituted with R, N, Q, E, L K, S, Y or V.
  • the W residue at position 104 of any one of SEQ ID NOs: 124-129 can be substituted with: A, D, E, F, G, I, K, N, Q, R, S, T, V or Y.
  • the N residue at position 50 of any one of SEQ ID NOs: 130-133 can be substituted with A, Y, W, S, T, I or V.
  • the A residue at position 51 of any of SEQ ID NOs: 130-133 is substituted with N, I, L, T or V.
  • the invention provides an isolated antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region comprising SEQ ID NO:128 or a light chain variable region comprising SEQ ID NO:132.
  • the invention provides an isolated antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region comprising SEQ ID NO:128 or a light chain variable region comprising SEQ ID NO:133.
  • the invention also provides an isolated antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region comprising SEQ ID NO:127 or a light chain variable region comprising SEQ ID NO:130.
  • the invention provides an isolated antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region comprising SEQ ID NO:128 and a light chain variable region comprising SEQ ID NO:132.
  • the invention also provides an isolated antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region comprising SEQ ID NO:128 and a light chain variable region comprising SEQ ID NO:133.
  • the invention also provides an isolated antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region comprising SEQ ID NO:126 and a light chain variable region comprising SEQ ID NO:131.
  • the invention also provides an isolated antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region comprising SEQ ID NO:128 and a light chain variable region comprising SEQ ID NO:131.
  • the invention also provides an isolated antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region comprising SEQ ID NO:125 and a light chain variable region comprising SEQ ID NO:133.
  • the invention also provides an isolated antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region comprising SEQ ID NO:126 and a light chain variable region comprising SEQ ID NO:130.
  • the invention also provides an isolated antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region comprising SEQ ID NO:125 and a light chain variable region comprising SEQ ID NO:132.
  • the invention also provides an isolated antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region comprising SEQ ID NO:127 and a light chain variable region comprising SEQ ID NO:130.
  • the antibody or antigen binding fragment thereof binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
  • the invention also provides an antibody or antigen binding fragment thereof that binds to human TIGIT comprising: (i) a heavy chain variable region comprising the CDR1, CDR2 and CDR3 of any one of SEQ ID NOs: 124-129, wherein the heavy chain variable region comprises at least 90%, 95%, 96%, 97%, 98% or 99% identity to any of one SEQ ID NOs: 124-129 and/or (ii) a light chain variable region comprising the CDR1, CDR2 and CDR3 of any one of SEQ ID NOs: 130-133, wherein the light chain variable region comprises at least 90%, 95%, 96%, 97%, 98% or 99% identity to any one of SEQ ID NOs: 130-133.
  • the invention also provides an antibody or antigen binding fragment thereof that binds to human TIGIT comprising: (i) a heavy chain variable region comprising the CDR1, CDR2 and CDR3 of SEQ ID NOs: 128, wherein the heavy chain variable region comprises 90%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NOs: 128 and/or (ii) a light chain variable region comprising the CDR1, CDR2 and CDR3 of SEQ ID NOs: 132, wherein the light chain variable region comprises at least 90%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NOs: 132.
  • the invention also provides an antibody or antigen binding fragment thereof that binds to human TIGIT comprising: (i) a heavy chain variable region comprising the CDR1, CDR2 and CDR3 of SEQ ID NOs: 128, wherein the heavy chain variable region comprises at least 90%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NOs: 128 and/or (ii) a light chain variable region comprising the CDR1, CDR2 and CDR3 of SEQ ID NOs: 133, wherein the light chain variable region comprises at least 90%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NOs: 133.
  • the invention also provides an antibody or antigen binding fragment thereof that binds to human TIGIT comprising: (i) a heavy chain variable region comprising the CDR1, CDR2 and CDR3 of SEQ ID NOs: 127, wherein the heavy chain variable region comprises at least 90%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NOs: 127 and/or (ii) a light chain variable region comprising the CDR1, CDR2 and CDR3 of SEQ ID NOs: 130, wherein the light chain variable region comprises at least 90%, 95%, 96%, 97%, 98% or 99% identity to SEQ ID NOs: 130.
  • the allowed sequence variations occur in the framework regions of the variable chains.
  • the antibody or antigen binding fragment thereof binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
  • the invention provides an antibody or antigen binding fragment thereof, comprising: a variable heavy chain comprising the amino acid sequence of SEQ ID NO: 7 and/or a variable light chain selected comprising the amino acid sequence of SEQ ID NO: 8, wherein the antibody or antigen binding fragment thereof binds to human TIGIT.
  • the antibody binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
  • the invention provides an antibody or antigen binding fragment thereof, comprising: a variable heavy chain comprising the amino acid sequence of SEQ ID NO: 143 and/or a variable light chain selected comprising the amino acid sequence of SEQ ID NO: 145, wherein the antibody or antigen binding fragment thereof binds to human TIGIT.
  • the antibody binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
  • the invention provides an antibody or antigen binding fragment thereof, comprising: a variable heavy chain comprising the amino acid sequence of SEQ ID NO: 144 and/or a variable light chain selected comprising the amino acid sequence of SEQ ID NO: 146, wherein the antibody or antigen binding fragment thereof binds to human TIGIT.
  • the antibody binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
  • the invention provides an antibody or antigen binding fragment thereof, comprising: a variable heavy chain comprising the amino acid sequence of SEQ ID NO: 63 and/or a variable light chain selected comprising the amino acid sequence of SEQ ID NO: 64, wherein the antibody or antigen binding fragment thereof binds to human TIGIT.
  • the antibody binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
  • the invention provides an antibody or antigen binding fragment thereof, comprising: a variable heavy chain comprising the amino acid sequence of SEQ ID NO: 94 and/or a variable light chain selected comprising the amino acid sequence of SEQ ID NO: 95, wherein the antibody or antigen binding fragment thereof binds to human TIGIT.
  • the antibody binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
  • the invention also provides an isolated antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region comprising SEQ ID NO:149 and/or a light chain variable region comprising SEQ ID NO:151.
  • the antibody binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
  • the invention also provides an isolated antibody or antigen binding fragment thereof that binds to human TIGIT comprising: a heavy chain variable region comprising SEQ ID NO:150 and/or a light chain variable region comprising SEQ ID NO:152.
  • the antibody binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
  • the invention provides an antibody or antigen binding fragment thereof that binds to the same epitope of human TIGIT as an antibody comprising the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 8, wherein the antibody or antigen binding fragment thereof has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g.
  • the antibody comprises at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity with the variable heavy chain and/or the variable light chain of any one of SEQ ID NOs: 7-30 or 37-52.
  • the antibody or antigen binding fragment thereof comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid substitutions in the variable heavy light chain of any one of SEQ ID NOs: 7, 9-24 and 37-47 and/or the variable light chains of any one of SEQ ID NOs: 8, 25-30 and 48-52.
  • the invention provides an antibody or antigen binding fragment thereof that binds to an epitope of human TIGIT that comprises at least one of the following regions: residues 54-57 of SEQ ID NO: 31, residues 68-70 of SEQ ID NO:31 and residues 76-81 of SEQ ID NO: 31. In one embodiment, the invention provides an antibody or antigen binding fragment thereof that binds to an epitope of human TIGIT comprising residues: 54-57, 68-70 and 76-81 of SEQ ID NO:31.
  • the invention provides an antibody or antigen binding fragment thereof that binds to the same epitope of human TIGIT as an antibody comprising the variable heavy chain of SEQ ID NO: 63 and the variable light chain of SEQ ID NO: 64, wherein the antibody or antigen binding fragment thereof has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g.
  • the antibody or antigen binding fragment thereof comprises at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity with the variable heavy chain of SEQ ID NO:63 and/or the variable light chain of SEQ ID NO: 64.
  • the antibody or antigen binding fragment thereof comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid substitutions in the variable heavy light chain of SEQ ID NO:63 and/or the variable light chain of SEQ ID NO: 64.
  • the antibody or antigen binding fragment thereof comprises 1, 2 or 3 amino acid substitutions in the heavy chain CDRs (SEQ ID NOs: 57-59) or in the light chain CDRs (SEQ ID NOs: 60-62).
  • the invention provides an antibody or antigen binding fragment thereof that binds to the same epitope of human TIGIT as an antibody comprising the variable heavy chain of SEQ ID NO: 94 and the variable light chain of SEQ ID NO:95, wherein the antibody or antigen binding fragment thereof has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g.
  • the antibody or antigen binding fragment thereof comprises at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence with the variable heavy chain of any one of SEQ ID NOs:94 or 124-129, and/or the variable light chain of any one of SEQ ID NO: 95 or 130-133.
  • the antibody or antigen binding fragment thereof comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid substitutions in the variable heavy light chain of any one of SEQ ID NOs:94 or 124-129, and/or the variable light chain of any one of SEQ ID NO: 95 or 130-133.
  • the antibody or antigen binding fragment thereof comprises 1, 2 or 3 amino acid substitutions in the heavy chain CDRs (SEQ ID NOs: 88-90) and/or in the light chain CDRs (SEQ ID NOs: 91-93). In another embodiment, the antibody or antigen binding fragment thereof comprises heavy chain CDRs of SEQ ID NOs: 88, 134 and 90 and/or the light chain CDRs of SEQ ID NOs: 91, 92 and 93.
  • the invention provides an antibody or antigen binding fragment thereof that binds to an epitope of human TIGIT that comprises at least one of the following regions: residues 53-57, residues 60-65, residues 68-70, residues 72-81, residues 94-95, and residues 109-119 of SEQ ID NO:31. In one embodiment, the invention provides an antibody or antigen binding fragment thereof that binds to an epitope of human TIGIT comprising residues: 53-57, 60-65, 68-70, 72-81, 94-95, and 109-119 of SEQ ID NO:31.
  • the invention provides an antibody or antigen binding fragment thereof that cross-blocks the binding of (or competes with) an antibody comprising the variable heavy chain of SEQ ID NO: 7 and the variable light chain of SEQ ID NO: 8 to human TIGIT, wherein the antibody or antigen binding fragment thereof has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g.
  • the antibody or antigen binding fragment thereof comprises at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity with the variable heavy chain or variable light chains of SEQ ID NOs: 7-30 or 37-52.
  • the antibody or antigen binding fragment thereof comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid substitutions in the variable heavy light chains of SEQ ID NOs:7, 9-24 and 37-47 or the variable light chains of SEQ ID NOs: 8, 25-30 and 48-52.
  • the antibody or antigen binding fragment thereof comprises 1, 2 or 3 amino acid substitutions in the heavy chain CDRs (SEQ ID NOs: 1-3) or in the light chain CDRs (SEQ ID NOs: 3-6).
  • the invention provides an antibody or antigen binding fragment thereof that cross-blocks the binding of (or competes with) an antibody comprising the variable heavy chain of SEQ ID NO: 63 and the variable light chain of SEQ ID NO: 64 to human TIGIT, wherein the antibody or antigen binding fragment thereof has at least one of the following functional characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e g KinExa or OCTET); (ii) cross-reacts with cynomolgous and rhesus TIGIT; (iii) blocks binding of human TIGIT to human CD155 and human CD112; (iv) increases T cell activation; (v) stimulates antigen-specific T-cell production of IL-2 and IFN ⁇ (vi) blocks induction of T cell suppression of activation induced by TIGIT
  • the antibody comprises at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity with the variable heavy chain of SEQ ID NO:63 or the variable light chains of SEQ ID NO: 64.
  • the antibody or antigen binding fragment thereof comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid substitutions in the variable heavy light chain of SEQ ID NO: 63 or the variable light chain of SEQ ID NO: 64.
  • the antibody or antigen binding fragment thereof comprises 1, 2 or 3 amino acid substitutions in the heavy chain CDRs (SEQ ID NOs: 57-59) or in the light chain CDRs (SEQ ID NOs: 60-62).
  • the invention provides an antibody or antigen binding fragment thereof that cross-blocks the binding of (or competes with) an antibody comprising the variable heavy chain of SEQ ID NO: 94 and the variable light chain of SEQ ID NO: 95 to human TIGIT, wherein the antibody or antigen binding fragment thereof has at least one of the following characteristics: (i) binds to human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g.
  • the antibody comprises at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity with the variable heavy chain of SEQ ID NO: 94 or the variable light chains of SEQ ID NO: 95.
  • the antibody or antigen binding fragment thereof comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 amino acid substitutions in the variable heavy light chain of any one of SEQ ID NOs: 94 or 124-129, or the variable light chain of any one of SEQ ID NOs: 95 or 130-133.
  • the antibody or antigen binding fragment thereof comprises 1, 2 or 3 amino acid substitutions in the heavy chain CDRs (SEQ ID NOs: 88-90) or in the light chain CDRs (SEQ ID NOs: 91-93).
  • the antibody or antigen binding fragment thereof comprises: a heavy chain variable region comprising SEQ ID NO:128 and a light chain variable region comprising SEQ ID NO:132. In another embodiment, antibody or antigen binding fragment thereof comprises: a heavy chain variable region comprising SEQ ID NO:127 and a light chain variable region comprising SEQ ID NO:130. In another embodiment, antibody or antigen binding fragment thereof comprises: a heavy chain variable region comprising SEQ ID NO:128 and a light chain variable region comprising SEQ ID NO:133.
  • the invention provides an antibody or antigen binding fragment thereof that binds to human TIGIT comprising a variable heavy chain selected from the group consisting of any one of SEQ ID NOs: 9-24 and 37-47, and/or a variable light chain selected from the group consisting of any one of SEQ ID NOs: 25-30 and 48-52.
  • the antibody comprises an amino acid substitution in FR4 of the heavy chain, wherein the substitution is made at position 122 of SEQ ID NOs: 9-24 and 37-47, wherein the residue is substituted from M to: V, L, A, R, N, P, Q, E, G, I, H, K, F, S, T, W or Y.
  • the antibody comprises two amino acid substitutions in FR4 of the heavy chain, wherein the substitutions are made at positions 122 and 123 of SEQ ID NOs: 9-24 and 37-47, wherein the residues are substituted from M and V to T and L, respectively.
  • the invention provides an antibody or antigen binding fragment thereof that binds to human TIGIT comprising a variable heavy chain selected from the group consisting of any one of SEQ ID NOs: 9-24 and 37-47, and/or a variable light chain selected from the group consisting of any one of SEQ ID NOs: 25-30 and 48-52.
  • the antibody comprises an amino acid substitution in FR4 of the heavy chain, wherein the substitution is made at position 122 of SEQ ID NOs: 9-24 and 37-47, wherein the residue is substituted from M to: V, L, A, R, N, P, Q, E, G, I, H, K, F, S, T, W or Y.
  • the antibody comprises two amino acid substitutions in FR4 of the heavy chain, wherein the substitutions are made at positions 122 and 123 of SEQ ID NOs: 9-24 and 37-47, wherein the residues are substituted from M and V to T and L, respectively.
  • the invention relates to an isolated antibody or antigen binding fragment that binds to human TIGIT comprising: a heavy chain comprising the amino acid sequence of SEQ ID NO: 7 or variant thereof comprising up to 30 amino acid substitutions, and/or a light chain comprising the amino acid sequence of SEQ ID NO: 8 comprising up to 12 amino acid substitutions.
  • the heavy chain comprises the amino acid sequence of SEQ ID NO: 7 comprising amino acid substitutions at one or more positions selected from the group consisting of: 6, 9, 12, 15, 16, 17, 23, 25, 37, 39, 40, 43, 44, 45, 48, 67, 68, 70, 71, 79, 81, 83, 87, 88, 92, 94, 119, 122 and 123.
  • the heavy chain comprises the amino acid sequence of SEQ ID NO:7 comprising amino acid substitutions at one or more positions selected from the group consisting of: 6, 9, 12, 15, 16, 17, 23, 25, 37, 39, 40, 43, 44, 45, 48, 67, 68, 70, 71, 79, 81, 83, 87, 88, 92, 94, 110, 119, 122 and 123, wherein: the amino acid at position 6 can be E or Q, the amino acid at position 9 can be P or A, the amino acid at position 12 can be V or L, the amino acid at position 15 can be S or P, the amino acid at position 16 can be Q or E or G, the amino acid at position 17 can be S or T, the amino acid at position 23 can be S or T, the amino acid at position 25 can be T or S, the amino acid at position 37 can be I or V, the amino acid at position 39 can be K or Q, the amino acid at position 40 can be F or P, the amino acid at position 43 can be N or K, the amino acid at position 6
  • the light chain comprises the amino acid sequence of SEQ ID NO: 8 comprising amino acid substitutions at one or more positions selected from the group consisting of: 10, 21, 22, 40, 42, 46, 52, 53, 58, 77, 83, 87, 95 and 106.
  • the light chain comprises the amino acid sequence of SEQ ID NO: 8 comprising amino acid substitutions at one or more positions selected from the group consisting of: 10, 21, 22, 40, 42, 46, 52, 53, 58, 77, 83, 87, 95 and 106
  • the amino acid at position 10 can be L or S
  • the amino acid at position 21 can be L or I
  • the amino acid at position 22 can be N or T
  • the amino acid at position 40 can be L or P
  • the amino acid at position 42 can be E or K
  • the amino acid at position 46 can be F or L
  • the amino acid at position 52 can be N, S, T, G or D
  • the amino acid at position 53 can be S, N, T, Y or Q
  • the amino acid at position 58 can be I or V
  • the amino acid at position 77 can be G or S
  • the amino acid at position 83 can be V or F
  • the amino acid at position 87 can be F or Y
  • the amino acid at position 95 can be W, F, Y,
  • the invention relates to an antibody or antigen binding fragment that binds to human TIGIT comprising: a heavy chain comprising the amino acid sequence of SEQ ID NO: 9 and/or a light chain comprising the amino acid sequence of SEQ ID NO: 25, wherein each of the variable chains can comprise 1, 2, 3, 4, 5, 6, 7 or 8 amino acid substitutions.
  • the antibody can comprise mutations at positions 27, 48, 67, 71, 83, 110, 122 and 123 of SEQ ID NO: 9.
  • the amino acid at position 27 can be G or S; the amino acid at position 48 can be I or M; the amino acid at position 67 can be V or I; the amino acid at position 71 can be V or R; the amino acid at position 83 can be S or H; the amino acid at position 110 can be W, F, Y, I, V or L; the amino acid at position 122 can be M, V, L, A, R, N, P, Q, E, G, I, H, K, F, S, T, W or Y; and the amino acid at position 123 can be V, T or L.
  • the antibody can comprise mutations at positions 46, 52, 53, 58 and 95 of SEQ ID NO: 25.
  • the amino acid at position 46 can be L or F; the amino acid at position 52 can be N, S, T, G or D, the amino acid at position 53 can be S, N, T, Y or Q; the amino acid at position 58 can be I or V; the amino acid at position 58 can be V or I; and the amino acid at position 95 can be W, F, Y, I, V or L.
  • the invention relates to an antibody or antigen binding fragment that binds to human TIGIT comprising: a heavy chain comprising the amino acid sequence of SEQ ID NO: 94 or variant thereof comprising up to 30 amino acid substitutions, and a light chain comprising the amino acid sequence of SEQ ID NO: 95 or a variant thereof comprising up to 18 amino acid substitutions.
  • the heavy chain comprises a variant of the amino acid sequence of SEQ ID NO: 94 comprising amino acid substitutions at one or more positions selected from the group consisting of: 5, 9, 11, 12, 16, 20, 38, 40, 44, 56, 57, 61, 62, 65, 67, 68, 72, 74, 76, 79, 85, 87, 89, 91, 92, 104 and 111.
  • the heavy chain comprises a variant of the amino acid sequence of SEQ ID NO: 94 comprising amino acid substitutions at one or more positions selected from the group consisting of: 5, 9, 11, 12, 16, 20, 38, 40, 44, 56, 57, 61, 62, 65, 67, 68, 72, 74, 76, 79, 85, 87, 89, 91, 92, 104 and 111, wherein: the amino acid at position 5 can be Q or V, the amino acid at position 9 can be P or A, the amino acid at position 11 can be V or L, the amino acid at position 12 can be V or K, the amino acid at position 16 can be S or A, the amino acid at position 20 can be M or V, the amino acid at position 38 can be K or R, the amino acid at position 40 can be K or A, the amino acid at position 44 can be G or R, the amino acid at position 56 can be D, R, L, K, F, S, Y or V, the amino acid at position 57 can be G, R, N
  • the light chain comprises a variant of the amino acid sequence of SEQ ID NO: 95 comprising amino acid substitutions at one or more positions selected from the group consisting of: 9, 17, 18, 40, 43, 45, 48, 50, 51, 70, 72, 74, 76, 83, 84, 100, 103 and 106.
  • the light chain comprises a variant of the amino acid sequence of SEQ ID NO: 95 comprising amino acid substitutions at one or more positions selected from the group consisting of: 9, 17, 18, 40, 43, 45, 48, 50, 51, 70, 72, 74, 76, 83, 84, 100, 103 and 106, wherein the amino acid at position 9 can be A or S, the amino acid at position 17 can be E or D, the amino acid at position 18 can be T or R, the amino acid at position 40 can be Q or P, the amino acid at position 43 can be S, A or V, the amino acid at position 45 can be Q or K, the amino acid at position 48 can be V or I, the amino acid at position 50 can be N, A, Y, W, S, T, I or V, the amino acid at position 51 can be A, N, I, L, T or V, the amino acid at position 70 can be Q or D, the amino acid at position 72 can be S or T, the amino acid at position 74 can be K or T, the amino acid at position 9 can
  • the invention relates to an antibody or antigen binding fragment that binds to human TIGIT comprising: a heavy chain comprising the amino acid sequence of SEQ ID NO: 124 or variant thereof comprising up to 10 amino acid substitutions, and/or a light chain comprising the amino acid sequence of SEQ ID NO: 130 or a variant thereof comprising up to 5 amino acid substitutions.
  • the invention provides an antibody or antigen binding fragment thereof that binds to human TIGIT comprising a variable heavy chain of SEQ ID NO: 124 or a variant thereof, wherein the variant comprises substitutions at one or more positions selected from the group consisting of: 16, 44, 56, 57, 61, 72, 74, 76, 79, 85, 89, 92 and 104.
  • the invention provides an antibody or antigen binding fragment thereof that binds to human TIGIT comprising a variable heavy chain of SEQ ID NO: 124 or a variant thereof, wherein the variant comprises substitutions at one or more positions selected from the group consisting of: 16, 44, 56, 57, 61, 72, 74, 76, 79, 85, 89, 92 and 104, wherein the amino acid at position 16 can be A or S, the amino acid at position 44 can be R or G, the amino acid at position 56 can be D, R, L, K, F, S, Y or V, the amino acid at position 57 can be G, R, N, Q, E, L K, S, Y or V, the amino acid at position 61 can be S or A, the amino acid at position 72 can be R or S, the amino acid at position 74 can be T or K, the amino acid at position 76 can be A or T or I, the amino acid at position 79 can be A or V, the amino acid at position 85 can be S or R
  • the invention provides an antibody or antigen binding fragment thereof that binds to human TIGIT comprising a variable light chain of SEQ ID NO: 130 or a variant thereof comprising substitutions at one or more positions selected from the group consisting of: 43, 50, 51, 70 and 83.
  • the invention provides an antibody or antigen binding fragment thereof that binds to human TIGIT comprising a variable light chain of SEQ ID NO: 130 or a variant thereof comprising substitutions at one or more positions selected from the group consisting of: 43, 50, 51, 70 and 83, wherein the amino acid at position 43 can be S, A or V, the amino acid at position 50 can be N, A, Y, W, S, T, I or V, the amino acid at position 51 can be A, N, I, L, T or V, the amino acid at position 70 can be Q or D, and the amino acid at position 83 can be F or V.
  • the amino acid at position 43 can be S, A or V
  • the amino acid at position 50 can be N, A, Y, W, S, T, I or V
  • the amino acid at position 51 can be A, N, I, L, T or V
  • the amino acid at position 70 can be Q or D
  • the amino acid at position 83 can be F or V.
  • the antibody or antigen binding fragment thereof is isolated.
  • the antibody or antigen binding fragment thereof is a recombinant antibody.
  • the antibody or antigen binding fragment thereof is a full-length antibody.
  • the antibody or antigen binding fragment thereof is a humanized antibody.
  • the antibody or antigen binding fragment thereof is a humanized antibody comprising two heavy chains and two light chains.
  • the heavy chains are of the IgG1 isotype and the light chains are kappa light chains.
  • the antibody or antigen binding fragment thereof of the invention can comprise a variable heavy region consisting of: (a) any of the variable heavy chains described above and (b) a leader peptide (for example, the leader peptide of SEQ ID NO: 53).
  • the antibody or antigen binding fragment thereof of the invention can comprise a light heavy region consisting of: (a) any of the light heavy chains described above and (b) a leader peptide (for example, the leader peptide of SEQ ID NO: 54).
  • the antibody or antigen binding fragment thereof of the invention is an antibody comprising any of the variable heavy chains described above and any human heavy chain constant domain.
  • the antibody or antigen binding fragment thereof of the invention is of the IgG isotype, and comprises a human IgG1, IgG2, IgG3 or IgG4 human heavy chain constant domain.
  • the antibody or antigen binding fragment thereof of the invention comprises a human heavy chain IgG1 constant domain (SEQ ID NO: 86) or a variant thereof, wherein the variant comprises up to 20 modified amino acid substitutions.
  • the antibody or antigen binding fragment thereof of the invention is an antibody comprising a human heavy chain IgG1 constant domain comprising the amino acid sequence of SEQ ID NO: 86. In one embodiment, the antibody or antigen binding fragment thereof of the invention comprises a human heavy chain IgG1 constant domain wherein the IgG1 constant domain is afucosylated. In one embodiment, the antibody or antigen binding fragment thereof of the invention comprises a human heavy chain IgG4 constant domain or a variant thereof, wherein the variant comprises up to 20 modified amino acid substitutions. In another embodiment, the antibody or antigen binding fragment thereof of the invention comprises a human heavy chain IgG4 constant domain, wherein the amino acid at position 228 (using EU numbering scheme) has been substituted from Ser to Pro. In one embodiment, the antibody or antigen binding fragment thereof of the invention comprises a human heavy chain IgG4 constant domain comprising the amino acid sequence of SEQ ID NO: 55.
  • the antibody or antigen binding fragment thereof of the invention can comprise any of the variable light chains described above and human light chain constant domain.
  • the antibody or antigen binding fragment thereof of the invention comprises a human kappa light chain constant domain or a variant thereof, wherein the variant comprises up to 20 modified amino acid substitutions.
  • the antibody or antigen binding fragment thereof of the invention comprises a human lambda light chain constant domain or a variant thereof, wherein the variant comprises up to 20 modified amino acid substitutions.
  • the antibody or antigen binding fragment thereof of the invention comprises a human kappa light chain constant domain comprising the amino acid sequence of SEQ ID NO: 56.
  • the anti-TIGIT antibody of the invention comprises a full tetrameric structure having two light chains and two heavy chains, wherein each light chain comprises: a variable region comprising SEQ ID NO:132 and a human kappa light chain (SEQ ID NO:56); and each heavy chain comprises: a variable region comprising SEQ ID NO:128, a human IgG1 constant region (SEQ ID NO:86).
  • the anti-TIGIT antibody of the invention comprises a full tetrameric structure having two light chains and two heavy chains, wherein each light chain comprises: a variable region comprising SEQ ID NO:130 and a human kappa light chain (SEQ ID NO:56); and each heavy chain comprises: a variable region comprising SEQ ID NO:127, a human IgG1 constant region (SEQ ID NO:86).
  • the anti-TIGIT antibody of the invention comprises a full tetrameric structure having two light chains and two heavy chains, wherein each light chain comprises: a variable region comprising SEQ ID NO:133 and a human kappa light chain (SEQ ID NO:56); and each heavy chain comprises: a variable region comprising SEQ ID NO:128, a human IgG1 constant region (SEQ ID NO:86).
  • the anti-TIGIT antibody or antigen binding fragment thereof of the invention can be conjugated to at least one therapeutic agent.
  • the therapeutic agent comprises a second antibody or fragment thereof, an immunomodulator, a hormone, a cytotoxic agent, an enzyme, a radionuclide, a second antibody conjugated to at least one immunomodulator, enzyme, radioactive label, hormone, antisense oligonucleotide, or cytotoxic agent, or a combination thereof.
  • the invention also provides isolated polypeptides comprising the amino acid sequence of any one of SEQ ID NOs: 1-30, 37-52, 57-83 or 88-151, or a fragment of any said sequences.
  • the invention also provides isolated nucleic acids encoding anyone of the anti-TIGIT antibodies or antigen binding fragments of the invention.
  • the invention provides isolated nucleic acids encoding anyone of the polypeptides of SEQ ID NOs: 1-30, 37-52, 57-64 or 88-133, wherein said polypeptides can optionally comprise a leader sequence.
  • the invention also provides expression vectors comprising a nucleic acid encoding anyone of the polypeptides of SEQ ID NOs: 1-30, 37-52, 57-83 or 88-167 (wherein said polypeptides can optionally comprise a leader sequence).
  • the invention also provides host cells comprising isolated nucleic acids encoding anyone of the polypeptides of SEQ ID NOs: 1-30, 37-52, 57-83 or 88-151 (wherein said polypeptides can optionally comprise a leader sequence).
  • the host cell is Chinese hamster ovary cell.
  • the host cell is a yeast cell, for example a Pichia cell or a Pichia pastoris host cell.
  • the invention also provides pharmaceutical compositions comprising an antibody or antigen binding fragment of the invention and a pharmaceutically acceptable carrier or diluent.
  • the composition comprises a further therapeutic agent.
  • the further therapeutic agent is selected from the group consisting of: an anti-PD1 antibody or an antigen binding fragment thereof; an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD27 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL2 antibody or an antigen binding fragment thereof; an anti-GI
  • the anti-PD1 antibody or an antigen binding fragment thereof is selected from the group consisting of: pembrolizumab or an antigen binding fragment thereof and nivolumab or an antigen binding fragment thereof.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82, 83 or 140; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5, 65, 66, 67, 68, 69, 70, 71, 72, 73 or 141; and (vi
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 134, 135 or 147; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122 or 148; and (vi) a light chain variable region CDR1 compris
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 57; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 58; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 59; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 60; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 61; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 62.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the invention provides a composition comprising: (i) an anti-TIGIT antibody or antigen binding fragment of the invention; and (ii) an anti-PD1 antibody comprising the heavy chain sequence of SEQ ID NO: 33 and the light chain variable sequence of SEQ ID NO: 34.
  • the invention provides a composition comprising: (a) an anti-TIGIT antibody or antigen binding fragment of the invention; and (b) an anti-PD1 antibody comprising the heavy chain sequence of SEQ ID NO: 35 and the light chain variable sequence of SEQ ID NO: 36.
  • the anti-PD1 antibody is administered prior to the administration of an anti-TIGIT antibody.
  • the anti-PD1 antibody is administered 4-10 days prior to the administration of the anti-TIGIT antibody.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82, 83 or 140; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5, 65, 66, 67, 68, 69, 70, 71, 72, 73 or 141; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO:
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 134, 135 or 147; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122 or 148; and (vi) a light chain variable region CDR1 compris
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 57; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 58; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 59; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 60; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 61; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 62.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the invention also comprises a combination comprising an anti-TIGIT antibody or antigen binding fragment of the invention, in combination with one, two or more therapeutic agents; wherein the second therapeutic agent is selected from the group consisting of: an anti-PD1 antibody or an antigen binding fragment thereof; an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD27 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL2 antibody or an antigen binding fragment thereof; an anti-GITR antibody or an antigen binding fragment thereof; an
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82, 83 or 140; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5, 65, 66, 67, 68, 69, 70, 71, 72, 73 or 141; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6, 74, 75, 76, 77, 78 or 142.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 134, 135 or 147; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122 or 148; and (vi) a light chain variable region CDR1 compris
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 57; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 58; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 59; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 60; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 61; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 62.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the invention also provides a vessel or injection device comprising anyone of the anti-TIGIT antibodies or antigen binding fragments of the invention.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82, 83 or 140; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5, 65, 66, 67, 68, 69, 70, 71, 72, 73 or 141; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6, 74
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 134, 135 or 147; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122 or 148; and (vi) a light chain variable region CDR1 compris
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 57; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 58; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 59; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 60; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 61; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 62.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the invention also provides a method of producing an anti-TIGIT antibody or antigen binding fragment of the invention comprising: culturing a host cell comprising a polynucleotide encoding a heavy chain and/or light chain of an antibody of the invention (or an antigen binding fragment thereof) under conditions favorable to expression of the polynucleotide; and optionally, recovering the antibody or antigen binding fragment from the host cell and/or culture medium.
  • the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain are in a single vector.
  • the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain are in different vectors.
  • the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain encode an antibody or antigen binding fragment comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82, 83 or 140; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO:5, 65, 66, 67, 68, 69, 70, 71, 72, 73 or 141; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO:6, 74, 75, 76, 77
  • the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain encode an antibody or antigen binding fragment comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 134, 135 or 147; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92, 112, 113, 114, 115, 116, 117, 118,
  • the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain encode an antibody or antigen binding fragment comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain encode an antibody or antigen binding fragment comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 57; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 58; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 59; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 60; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 61; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO:62.
  • the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain encode an antibody or antigen binding fragment comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain encode an antibody or antigen binding fragment comprising: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain encode an antibody or antigen binding fragment comprising: a heavy chain variable region comprising SEQ ID NO:128 and a light chain variable region comprising SEQ ID NO:132.
  • the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain encode an antibody or antigen binding fragment comprising: a heavy chain variable region comprising SEQ ID NO:127 and a light chain variable region comprising SEQ ID NO:130.
  • the polynucleotide encoding the heavy chain and the polynucleotide encoding the light chain encode an antibody or antigen binding fragment comprising: a heavy chain variable region comprising SEQ ID NO:128 and a light chain variable region comprising SEQ ID NO:133.
  • the invention also provides a method of treating cancer in a subject in need thereof, comprising administering to the subject an effective amount of an anti-TIGIT antibody or antigen binding fragment of the invention, optionally in association with a further therapeutic agent or therapeutic procedure.
  • the subject been treated is a human subject.
  • the further therapeutic agent is selected from the group consisting of: an anti-PD1 antibody or an antigen binding fragment thereof; an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD27 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL2 antibody or an antigen binding fragment thereof; an anti-GITR antibody or an antigen binding fragment thereof; an anti-ICOS antibody or an antigen binding fragment thereof; an anti-SIRP ⁇ antibody or an antigen binding fragment thereof; an anti-ILT2
  • the anti-PD1 antibody or an antigen binding fragment thereof is selected from the group consisting of: pembrolizumab or an antigen binding fragment thereof and nivolumab or an antigen binding fragment thereof.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82, 83 or 140; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO:5, 65, 66, 67, 68, 69, 70, 71, 72, 73 or 141; and (vi)
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 134, 135 or 147; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122 or 148; and (vi) a light chain variable region CDR
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 57; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 58; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 59; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 60; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 61; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 62.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the invention also provides a method of treating cancer in a subject in need thereof, comprising administering to the subject an effective amount of an anti-TIGIT antibody or antigen binding fragment of the invention, and further administering an anti-PD1 antibody or an antigen binding fragment thereof.
  • the anti-PD1 antibody or an antigen binding fragment thereof is selected from the group consisting of: pembrolizumab or an antigen binding fragment thereof and nivolumab or an antigen binding fragment thereof.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82, 83 or 140; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO:5, 65, 66, 67, 68, 69, 70, 71, 72, 73 or 141; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO:6, 74, 75, 76, 77, 78 or 142.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 134, 135 or 147; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122 or 148; and (vi) a light chain variable region CDR1 compris
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the anti-TIGIT How antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 57; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 58; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 59; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 60; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 61; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 62.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the invention also provides a method of treating an infection or infectious disease in a subject, comprising administering to the subject an effective amount of an antibody or antigen binding fragment of the invention, optionally in association with a further therapeutic agent or therapeutic procedure.
  • the subject been treated is a human subject.
  • the further therapeutic agent is selected from the group consisting of: an anti-PD1 antibody or an antigen binding fragment thereof; an anti-LAG3 antibody or an antigen binding fragment thereof; an anti-VISTA antibody or an antigen binding fragment thereof; an anti-BTLA antibody or an antigen binding fragment thereof; an anti-TIM3 antibody or an antigen binding fragment thereof; an anti-CTLA4 antibody or an antigen binding fragment thereof; an anti-HVEM antibody or an antigen binding fragment thereof; an anti-CD27 antibody or an antigen binding fragment thereof; an anti-CD137 antibody or an antigen binding fragment thereof; an anti-OX40 antibody or an antigen binding fragment thereof; an anti-CD28 antibody or an antigen binding fragment thereof; an anti-PDL1 antibody or an antigen binding fragment thereof; an anti-PDL2 antibody or an antigen binding fragment thereof; an anti-GITR antibody or an antigen binding fragment thereof; an anti-ICOS antibody or an antigen binding fragment thereof; an anti-SIRP ⁇ antibody or an antigen binding fragment thereof; an anti-ILT2
  • the anti-PD1 antibody or an antigen binding fragment thereof is selected from the group consisting of: pembrolizumab or an antigen binding fragment thereof and nivolumab or an antigen binding fragment thereof.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82, 83 or 140; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO:5, 65, 66, 67, 68, 69, 70, 71, 72, 73 or 141; and (vi
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 134, 135 or 147; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122 or 148; and (vi) a light chain variable region CDR
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 57; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 58; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO:59; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 60; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 61; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 62.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82, 83 or 1401; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5, 65, 66, 67, 68, 69, 70, 71, 72, 73 or 141; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO:6, 74, 75, 76, 77,
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 134, 135 or 147; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122 or 148; and (vi) a light chain variable region CDR1 compris
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 57; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 58; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 59; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 60; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 61; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 62.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the vaccine further comprises an antigen.
  • the invention also provides a method for detecting the presence of a TIGIT peptide or a fragment thereof in a sample comprising contacting the sample with an antibody or antigen binding fragment thereof of the invention and detecting the presence of a complex between the antibody or fragment and the peptide; wherein detection of the complex indicates the presence of the TIGIT peptide.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82, 83 or 140; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO:4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO:5, 65, 66, 67, 68, 69, 70, 71, 72, 73 or 141; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6, 74, 75, 76, 77, 78 or 142.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 134, 135 or 147; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 153; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122 or 148; and (vi) a light chain variable region CDR3 comprising
  • the antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 57; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 58; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 59; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 60; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 61; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 62.
  • the antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the invention also provides a method of increasing the activity of an immune cell, comprising contacting the immune cell with any one of the antibodies or antigen binding fragments of the invention.
  • the invention provides a method of increasing the activity of an immune cell, comprising administering to a subject in need thereof an effective amount of an antibody or antigen binding fragments of the invention.
  • the method is used for: the treatment of cancer, the treatment of an infection or infectious disease, or as a vaccine adjuvant.
  • the increase in activity of an immune cell can be detected by measuring the proliferation of the immune cell.
  • an increase in activity of a T cell can be detected by measuring the proliferation of the T cell.
  • the increase in activity of an immune cell can be detected by measuring T cell activation ex vivo in a sample derived from the subject.
  • the increase in T cell activity is determined by: (i) measuring mixed lymphocyte reactions or direct anti-CD3 mAb stimulation of T cell receptor (TCR) signaling to induce production of a cytokine selected from the group consisting of: IL-2, TNF ⁇ , IL-17, IFN ⁇ , IL-1 ⁇ , GM-CSF, RANTES, IL-6, IL-8, IL-5 and IL-13; (ii) measuring SEB induced production of one or more cytokines selected from the group consisting of: IL-2, TNF ⁇ , IL-17, IFN ⁇ , GM-CSF, RANTES, IL-6, IL-8, IL-5 and IL-13; or (iii) measuring TT induced production of a cytokine selected from the group consisting of: IL-2, TNF ⁇ , IL-17, IFN ⁇ , GM
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3, 79, 80, 81, 82, 83 or 140; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5, 65, 66, 67, 68, 69, 70, 71, 72, 73 or 141; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6, 74, 75, 76, 77, 78 or 142.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 134, 135 or 147; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122 or 148; and (vi) a light chain variable region CDR1 compris
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 57; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 58; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 59; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 60; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 61; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 62.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the invention also comprises a method of treating cancer or infectious disease in a subject, comprising administering to the subject an effective amount of an antagonist anti-TIGIT antibody and an antagonist anti-PD1 antibody, wherein the anti-TIGIT antibody has increased effector function when compared to a parental antibody.
  • a “parental anti-antibody” refers to antibody having a wild-type Fc region and/or wild type glycosylation (i.e., glycosylation pattern resulting from expression of the polypeptide in a non-engineered mammalian host cell).
  • the effector function of a parental antibody can be increased by mutating its Fc region or by altering its glycosylation (as discussed in further detail below).
  • the anti-PD1 antibody is administered prior to the administration of a parental antibody. In one embodiment, the anti-PD1 antibody is administered 4-10 days prior to the administration of the anti-TIGIT antibody. In one embodiment, pretreatment treatment with anti-PD1 antibody may modulate immune cells resulting in enhanced Fc-mediated function of the anti-TIGIT antibodies. In one embodiment, the anti-TIGIT antibody comprises a human IgG1 constant domain. In one embodiment, treatment with the anti-TIGIT and anti-PD1 antibodies does not result in depletion of Tregs. In one embodiment, the anti-PD1 antibody or an antigen binding fragment thereof; is selected from the group consisting of: pembrolizumab and nivolumab.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3 (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90 (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the invention also comprises a method of treating cancer or infectious disease in a subject, comprising administering to the subject an effective amount of an antagonist anti-TIGIT antibody and an antagonist anti-PD1 antibody, wherein the anti-TIGIT antibody is afucosylated.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 1; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 2; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 3 (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 4; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 5; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 6.
  • the anti-TIGIT antibody or antigen binding fragment of the invention comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 89, 134 or 135; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90 (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the anti-TIGIT antibody or antigen binding fragment thereof comprises: (i) a heavy chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 88; (ii) a heavy chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 134; (iii) a heavy chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 90; (iv) a light chain variable region CDR1 comprising the amino acid sequence of SEQ ID NO: 91; (v) a light chain variable region CDR2 comprising the amino acid sequence of SEQ ID NO: 92; and (vi) a light chain variable region CDR3 comprising the amino acid sequence of SEQ ID NO: 93.
  • the invention also provides a method of increasing the anti-tumor activity of an anti-TIGIT antibody comprising: obtaining a parental anti-TIGIT antibody and increasing the effector function of the parental anti-TIGIT antibody; wherein the activity of the resulting anti-TIGIT antibody is increased as compared to the parental anti-TIGIT antibody.
  • a “parental anti-antibody” refers to antibody having a wild-type Fc region and/or wild type glycosylation (i.e., glycosylation pattern resulting from expression of the polypeptide in a non-engineered mammalian host cell).
  • the effector function of a parental antibody can be increased by mutating its Fc region or by altering its glycosylation, for example by making the antibody afucosylated (as discussed in further detail below).
  • the effector function of a parental anti-TIGIT antibody is increased by making mutations in the Fc region of the parental anti-TIGIT antibody.
  • the effector function of a parental anti-TIGIT antibody is increased by removing the fucose residues from the antibody, or expressing the antibody in a host cell that has been genetically engineered to remove the activity of the enzyme that adds fucose to glycoproteins.
  • FIG. 1 shows binding of antibody 14A6 to human and rhesus TIGIT (expressed in CHO-K1 cells).
  • FIG. 2 shows binding of antibody 28H5 to human and rhesus TIGIT (expressed in CHO-K1 cells).
  • FIG. 3 shows that antibodies 14A6 and 28H5 block hCD155 interaction with hTIGIT as determined by a cell-based ELISA blocking assay.
  • FIG. 4 shows binding of antibody 31C6 to human and rhesus TIGIT (expressed in CHO-K1 cells), and also shows that antibody 31C6 blocks hCD155 interaction with hTIGIT.
  • FIG. 5 shows the activity of antibodies 14A6 and 28H5 in an in vitro T cell assay.
  • FIG. 6 shows the activity of antibodies 14A6 and 31C6 in vitro T cell assay.
  • FIG. 7 shows expression of TIGIT, CD226, CD155 and CD96 in primary human T cell lines.
  • clone BC4-49 shows highest up-regulation of TIGIT (negative) ad down-regulation of CD226 (positive)
  • FIGS. 8A and 8B show the activity of various anti-TIGIT antibodies in an in vitro T cell assay. It shows that MBS43 and 14A6, 37D10 and 28H5 anti-TIGIT antibodies rescue IFN ⁇ responses in primary human T cells.
  • GIGD7 rat anti-mouse TIGIT antibody
  • PD-1 anti-mouse PD-1 antibody
  • FIG. 10 shows the effect of Fc isotype on the anti-tumor activity of an anti-TIGIT antibody (18G10) in combination with an anti-PD-1 antibody in an animal tumor model.
  • FIGS. 11A-11C show the effect of Fc isotype on the anti-tumor activity of an anti-TIGIT antibody (18G10) in combination with an anti-PD-1 antibody in an animal tumor model.
  • FIG. 12 shows the effect of Fc isotype on the anti-tumor activity of an anti-TIGIT antibody (11A11) in combination with an anti-PD-1 antibody in an animal tumor model.
  • FIGS. 13A-13C show the effect of Fc isotype on the anti-tumor activity of an anti-TIGIT antibody (11A11) in combination with an anti-PD-1 antibody in an animal tumor model.
  • FIG. 14 shows a heat map indicating regions of human TIGIT which are strongly or weakly protected from deuteration by the binding of the 14A6 antibody.
  • the amino acid sequence shown in the heatmap corresponds to SEQ ID NO:87.
  • FIG. 15 shows a heat map indicating regions of human TIGIT which are strongly or weakly protected from deuteration by the binding of the 31C6 antibody.
  • the amino acid sequence shown in the heatmap corresponds to SEQ ID NO:87.
  • FIG. 16 shows the effect of various humanized clones of 31C6 as compared to chimera and parental antibodies in an engineered T cell functional assay.
  • FIG. 17 shows the effect of various humanized clones of 31C6 as compared to chimera antibodies in a primary T cell functional assay.
  • administering refers to contact of an exogenous pharmaceutical, therapeutic, diagnostic agent, or composition to the animal, human, subject, cell, tissue, organ, or biological fluid.
  • Treatment of a cell encompasses contact of a reagent to the cell, as well as contact of a reagent to a fluid, where the fluid is in contact with the cell.
  • administering and “treatment” also means in vitro and ex vivo treatments, e.g., of a cell, by a reagent, diagnostic, binding compound, or by another cell.
  • Treat” or “treating” means to administer a therapeutic agent, such as a composition containing any of the antibodies or antigen-binding fragments of the present invention, internally or externally to a subject or patient having one or more disease symptoms, or being suspected of having a disease, for which the agent has therapeutic activity.
  • the agent is administered in an amount effective to alleviate one or more disease symptoms in the treated subject or population, whether by inducing the regression of or inhibiting the progression of such symptom(s) by any clinically measurable degree.
  • the amount of a therapeutic agent that is effective to alleviate any particular disease symptom may vary according to factors such as the disease state, age, and weight of the patient, and the ability of the drug to elicit a desired response in the subject. Whether a disease symptom has been alleviated can be assessed by any clinical measurement typically used by physicians or other skilled healthcare providers to assess the severity or progression status of that symptom.
  • TIGIT includes human TIGIT, cynomolgous monkey TIGIT and rhesus TIGIT as well as fragments thereof such as the mature fragment thereof lacking the signal peptide.
  • the amino acid sequence of human TIGIT comprises the amino acid sequence disclosed in amino acid residues 25-244 of Genbank Accession Number NP_776160.2 (SEQ ID NO: 31). (Amino acid residues 1-24 of SEQ ID NO:31 correspond to a leader peptide.)
  • the amino acid sequence of rhesus monkey TIGIT is identical to the amino acid sequence of cynomolgous monkey TIGIT. (Amino acid residues 1-24 of SEQ ID NO:32 correspond to a leader peptide.)
  • the present invention provides antibodies or antigen-binding fragments thereof that bind human TIGIT and uses of such antibodies or fragments.
  • the anti-TIGIT antibodies are isolated.
  • an anti-TIGIT antibody or antigen-binding fragment thereof refers to an antibody or antigen-binding fragment thereof that specifically binds to human TIGIT.
  • An antibody or antigen-binding fragment thereof that “specifically binds to human TIGIT” is an antibody or antigen-binding fragment thereof that binds to human TIGIT with a KD of about 1 nM or a higher affinity (e.g., 1 nM-2 pM, 1 nM, 100 pM, 10 pM or 2 pM), but does not bind to other proteins lacking this sequence.
  • an antibody that “specifically binds” human TIGIT does not bind to human CD226, human CD155 and human CD112.
  • an antibody or antigen-binding fragment that specifically binds to human TIGIT may bind to a FLAG®-tagged form of human TIGIT but will not bind to other FLAG®-tagged proteins that lack human TIGIT epitopes.
  • the antibody of the invention which specifically binds to human TIGIT is also cross-reactive with cynomolgus and rhesus TIGIT.
  • cross-reactivity refers to the ability of an antibody to react with a homologous protein from other species. Whether an antibody specifically binds to human TIGIT can be determined using any assay known in the art. Examples of assays known in the art to determining binding affinity include surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
  • the present invention includes anti-TIGIT antibodies and methods of use thereof.
  • antibody refers to any form of antibody that exhibits the desired biological activity. Thus, it is used in the broadest sense and specifically covers, but is not limited to, monoclonal antibodies (including full length monoclonal antibodies comprising two light chains and two heavy chains), polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), humanized antibodies, fully human antibodies, chimeric antibodies and camelized single domain antibodies.
  • the present invention includes non-human parental (e.g. mouse and rodent) anti-TIGIT antibodies and antigen-binding fragments thereof and methods of use thereof. These antibodies may be modified for an intended use, such as humanization of an antibody for use as a human therapeutic antibody or fragment.
  • non-human parental (e.g. mouse and rodent) anti-TIGIT antibodies and antigen-binding fragments thereof and methods of use thereof may be modified for an intended use, such as humanization of an antibody for use as a human therapeutic antibody or fragment.
  • antibody fragment or “antigen-binding fragment” refers to antigen-binding fragments of antibodies, i.e. antibody fragments that retain the ability to bind specifically to the antigen bound by the full-length antibody, e.g. fragments that retain one or more CDR regions.
  • antigen-binding fragments include, but are not limited to, Fab, Fab′, F(ab′) 2 , and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules, e.g., sc-Fv; nanobodies and multispecific antibodies formed from antibody fragments.
  • the present invention includes anti-TIGIT Fab fragments and methods of use thereof.
  • a “Fab fragment” is comprised of one light chain and the C H 1 and variable regions of one heavy chain. The heavy chain of a Fab molecule cannot form a disulfide bond with another heavy chain molecule.
  • An “Fab fragment” can be the product of papain cleavage of an antibody.
  • the present invention includes anti-TIGIT antibodies and antigen-binding fragments thereof which comprise an Fc region and methods of use thereof.
  • An “Fc” region contains two heavy chain fragments comprising the C H 1 and C H 2 domains of an antibody. The two heavy chain fragments are held together by two or more disulfide bonds and by hydrophobic interactions of the C H 3 domains.
  • the present invention includes anti-TIGIT Fab′ fragments and methods of use thereof.
  • a “Fab′ fragment” contains one light chain and a portion or fragment of one heavy chain that contains the V H domain and the C H 1 domain and also the region between the C H 1 and C H 2 domains, such that an interchain disulfide bond can be formed between the two heavy chains of two Fab′ fragments to form a F(ab′) 2 molecule.
  • the present invention includes anti-TIGIT F(ab′) 2 fragments and methods of use thereof.
  • a “F(ab′) 2 fragment” contains two light chains and two heavy chains containing a portion of the constant region between the C H1 and C H2 domains, such that an interchain disulfide bond is formed between the two heavy chains.
  • a F(ab′) 2 fragment thus is composed of two Fab′ fragments that are held together by a disulfide bond between the two heavy chains.
  • An “F(ab′) 2 fragment” can be the product of pepsin cleavage of an antibody.
  • the present invention includes anti-TIGIT Fv fragments and methods of use thereof.
  • the “Fv region” comprises the variable regions from both the heavy and light chains, but lacks the constant regions.
  • the present invention includes anti-TIGIT scFv fragments and methods of use thereof.
  • the term “single-chain Fv” or “scFv” antibody refers to antibody fragments comprising the V H and V L domains of an antibody, wherein these domains are present in a single polypeptide chain.
  • the Fv polypeptide further comprises a polypeptide linker between the V H and V L domains which enables the scFv to form the desired structure for antigen-binding.
  • scFv see Pluckthun (1994) T HE P HARMACOLOGY OF M ONOCLONAL A NTIBODIES , vol. 113, Rosenburg and Moore eds. Springer-Verlag, New York, pp. 269-315. See also, International Patent Application Publication No. WO 88/01649 and U.S. Pat. Nos. 4,946,778 and 5,260,203.
  • a “domain antibody” is an immunologically functional immunoglobulin fragment containing only the variable region of a heavy chain or the variable region of a light chain.
  • two or more V H regions are covalently joined with a peptide linker to create a bivalent domain antibody.
  • the two V H regions of a bivalent domain antibody may target the same or different antigens.
  • the present invention includes anti-TIGIT bivalent antibodies and methods of use thereof.
  • a “bivalent antibody” comprises two antigen-binding sites. In some instances, the two binding sites have the same antigen specificities. However, bivalent antibodies may be bispecific (see below).
  • the present invention includes anti-TIGIT camelized single domain antibodies and methods of use thereof.
  • antibodies herein also include camelized single domain antibodies. See, e.g., Muyldermans et al. (2001) Trends Biochem. Sci. 26:230; Reichmann et al. (1999) J. Immunol. Methods 231:25; WO 94/04678; WO 94/25591; U.S. Pat. No. 6,005,079).
  • the present invention provides single domain antibodies comprising two V H domains with modifications such that single domain antibodies are formed.
  • the present invention includes anti-TIGIT diabodies and methods of use thereof.
  • diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy chain variable domain (V H ) connected to a light chain variable domain (V L ) in the same polypeptide chain (V H —V L or V L —V H ).
  • V H heavy chain variable domain
  • V L light chain variable domain
  • the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites.
  • Diabodies are described more fully in, e.g., EP 404,097; WO 93/11161; and Holliger et al. (1993) Proc. Natl. Acad. Sci. USA 90: 6444-6448.
  • Holliger and Hudson (2005) Nat. Biotechnol. 23:1126-1136 For a review of engineered antibody variants generally see Holliger and Hudson (2005) Nat. Biotechnol. 23:1126-1136
  • an antibody or antigen-binding fragment of the invention which is modified in some way retains at least 10% of its binding activity (when compared to the parental antibody) when that activity is expressed on a molar basis.
  • an antibody or antigen-binding fragment of the invention retains at least 20%, 50%, 70%, 80%, 90%, 95% or 100% or more of the TIGIT binding affinity as the parental antibody.
  • an antibody or antigen-binding fragment of the invention can include conservative or non-conservative amino acid substitutions (referred to as “conservative variants” or “function conserved variants” of the antibody) that do not substantially alter its biologic activity.
  • the present invention includes isolated anti-TIGIT antibodies and antigen-binding fragments thereof and methods of use thereof “Isolated” antibodies or antigen-binding fragments thereof are at least partially free of other biological molecules from the cells or cell cultures in which they are produced.
  • biological molecules include nucleic acids, proteins, lipids, carbohydrates, or other material such as cellular debris and growth medium.
  • An isolated antibody or antigen-binding fragment may further be at least partially free of expression system components such as biological molecules from a host cell or of the growth medium thereof.
  • the term “isolated” is not intended to refer to a complete absence of such biological molecules or to an absence of water, buffers, or salts or to components of a pharmaceutical formulation that includes the antibodies or fragments.
  • the present invention includes monoclonal anti-TIGIT antibodies and antigen-binding fragments thereof as well as monoclonal compositions comprising a plurality of isolated monoclonal antibodies.
  • monoclonal antibody refers to a population of substantially homogeneous antibodies, i.e., the antibody molecules comprising the population are identical in amino acid sequence except for possible naturally occurring mutations that may be present in minor amounts.
  • conventional (polyclonal) antibody preparations typically include a multitude of different antibodies having different amino acid sequences in their variable domains, particularly their CDRs that are often specific for different epitopes.
  • the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al. (1975) Nature 256: 495, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567).
  • the “monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in Clackson et al. (1991) Nature 352: 624-628 and Marks et al. (1991) J. Mol. Biol. 222: 581-597, for example. See also Presta (2005) J. Allergy Clin. Immunol. 116:731.
  • the present invention includes anti-TIGIT chimeric antibodies (e.g., human constant domain/mouse variable domain) and methods of use thereof.
  • a “chimeric antibody” is an antibody having the variable domain from a first antibody and the constant domain from a second antibody, where the first and second antibodies are from different species.
  • variable domains are obtained from an antibody from an experimental animal (the “parental antibody”), such as a rodent, and the constant domain sequences are obtained from human antibodies, so that the resulting chimeric antibody will be less likely to elicit an adverse immune response in a human subject than the parental (e.g., mouse) antibody.
  • parental antibody an antibody from an experimental animal
  • the constant domain sequences are obtained from human antibodies, so that the resulting chimeric antibody will be less likely to elicit an adverse immune response in a human subject than the parental (e.g., mouse) antibody.
  • the present invention includes anti-TIGIT humanized antibodies and antigen-binding fragments thereof (e.g., rat or mouse antibodies that have been humanized) and methods of use thereof.
  • the invention includes any humanized version of the 14A6 antibody (comprising SEQ ID NOs:7 and 8), the 28H5 antibody (comprising SEQ ID NOs:63 and 64) and the 31C6 antibody (comprising SEQ ID NOs: 94-95).
  • the term “humanized antibody” refers to forms of antibodies that contain sequences from both human and non-human (e.g., mouse or rat) antibodies.
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin, and all or substantially all of the framework (FR) regions are those of a human immunoglobulin sequence.
  • the humanized antibody may optionally comprise at least a portion of a human immunoglobulin constant region (Fc).
  • the basic antibody structural unit comprises a tetramer.
  • Each tetramer includes two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa).
  • the amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
  • the carboxy-terminal portion of the heavy chain may define a constant region primarily responsible for effector function.
  • human light chains are classified as kappa and lambda light chains.
  • human heavy chains are typically classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
  • the variable and constant regions are joined by a “J” region of about 12 or more amino acids, with the heavy chain also including a “D” region of about 10 more amino acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989).
  • variable regions of each light/heavy chain pair form the antibody binding site.
  • an intact antibody has two binding sites.
  • the two binding sites are, in general, the same.
  • variable domains of both the heavy and light chains comprise three hypervariable regions, also called complementarity determining regions (CDRs), located within relatively conserved framework regions (FR).
  • CDRs complementarity determining regions
  • FR framework regions
  • the CDRs are usually aligned by the framework regions, enabling binding to a specific epitope.
  • both light and heavy chains variable domains comprise FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
  • the assignment of amino acids to each domain is, generally, in accordance with the definitions of Sequences of Proteins of Immunological Interest , Kabat, et al.; National Institutes of Health, Bethesda, Md.; 5 th ed.; NIH Publ. No.
  • hypervariable region refers to the amino acid residues of an antibody or antigen-binding fragment thereof that are responsible for antigen-binding.
  • the hypervariable region comprises amino acid residues from a “complementarity determining region” or “CDR” (i.e. CDRL1, CDRL2 and CDRL3 in the light chain variable domain and CDRH1, CDRH2 and CDRH3 in the heavy chain variable domain).
  • CDR complementarity determining region
  • isolated nucleic acid molecule or “isolated polynucleotide” means a DNA or RNA of genomic, mRNA, cDNA, or synthetic origin or some combination thereof which is not associated with all or a portion of a polynucleotide in which the isolated polynucleotide is found in nature, or is linked to a polynucleotide to which it is not linked in nature.
  • a nucleic acid molecule comprising a particular nucleotide sequence does not encompass intact chromosomes.
  • Isolated nucleic acid molecules “comprising” specified nucleic acid sequences may include, in addition to the specified sequences, coding sequences for up to ten or even up to twenty or more other proteins or portions or fragments thereof, or may include operably linked regulatory sequences that control expression of the coding region of the recited nucleic acid sequences, and/or may include vector sequences.
  • control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism.
  • the control sequences that are suitable for prokaryotes include a promoter, optionally an operator sequence, and a ribosome binding site.
  • Eukaryotic cells are known to use promoters, polyadenylation signals, and enhancers.
  • a nucleic acid or polynucleotide is “operably linked” when it is placed into a functional relationship with another nucleic acid sequence.
  • DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide;
  • a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
  • operably linked means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
  • the expressions “cell,” “cell line,” and “cell culture” are used interchangeably and all such designations include progeny.
  • the words “transformants” and “transformed cells” include the primary subject cell and cultures derived therefrom without regard for the number of transfers. It is also understood that not all progeny will have precisely identical DNA content, due to deliberate or inadvertent mutations. Mutant progeny that have the same function or biological activity as screened for in the originally transformed cell are included. Where distinct designations are intended, it will be clear from the context.
  • germline sequence refers to a sequence of unrearranged immunoglobulin DNA sequences. Any suitable source of unrearranged immunoglobulin sequences may be used.
  • Human germline sequences may be obtained, for example, from JOINSOLVER germline databases on the website for the National Institute of Arthritis and Musculoskeletal and Skin Diseases of the United States National Institutes of Health.
  • Mouse germline sequences may be obtained, for example, as described in Giudicelli et al. (2005) Nucleic Acids Res. 33:D256-D261.
  • the present invention provides anti-TIGIT antibodies and antigen-binding fragments thereof having specified structural and functional features, and methods of use of the antibodies or antigen-binding fragments thereof in the treatment or prevention of disease (e.g., cancer or infectious disease).
  • disease e.g., cancer or infectious disease.
  • an “anti-TIGIT antibody or antigen-binding fragment thereof of the present invention” includes: any antibody or antigen-binding fragment thereof that is discussed herein (e.g., 14A6, 28H5, 31C6 or humanized versions of the these antibodies disclosed in Table 4) or a variant thereof (e.g., sequence variant or functional variant); any antibody or antigen-binding fragment comprising any one or more of the CDRs set forth in Table 4; any antibody or antigen-binding fragment that binds to the same epitope in human TIGIT as the antibodies discussed herein (e.g., 14A6, 28H5 or 31C6); and any antibody or antigen-binding fragment that cross-blocks (partially or fully) or is cross-blocked (partially or fully) by an antibody discussed herein (e.g., 14A6, 28H5 or 31C6) for TIGIT binding.
  • any antibody or antigen-binding fragment thereof that is discussed herein e.g., 14A6, 28H5, 31C6 or humanized
  • Cross-blocking antibodies and antigen-binding fragments thereof can be identified based on their ability to cross-compete with an antibody of the invention in standard binding assays (e.g., BIACore, ELISA, flow cytometry).
  • standard ELISA assays can be used in which a recombinant TIGIT (e.g., human TIGIT) protein is immobilized on the plate, one of the antibodies is fluorescently labeled and the ability of non-labeled antibodies to compete off the binding of the labeled antibody is evaluated.
  • BIAcore analysis can be used to assess the ability of the antibodies to cross-compete.
  • test antibody to inhibit the binding of another antibody (for example, antibody 14A6 or 28H5 or 31C6) to TIGIT (e.g., human TIGIT) demonstrates that the test antibody can compete with another antibody (e.g., 14A6 or 28H5 or 31C6) for binding to TIGIT (e.g., human TIGIT) and thus, may, in some cases, bind to the same epitope on TIGIT (e.g., human TIGIT) as antibody 14A6 or 28H5 or 31C6 or to an overlapping epitope.
  • another antibody for example, antibody 14A6 or 28H5 or 31C6
  • TIGIT e.g., human TIGIT
  • antibodies and fragments that bind to the same epitope as any of the anti-TIGIT antibodies or antigen-binding fragments thereof of the present invention also form part of the present invention.
  • antibodies that bind to an epitope that overlaps with the epitope bound by any of the anti-TIGIT antibodies of the invention also form part of the present invention.
  • There are several methods available for mapping antibody epitopes on target antigens including: H/D-Ex Mass spec, X-ray crystallography, pepscan analysis and site directed mutagenesis.
  • HDX Hydrogen Deuterium Exchange
  • proteolysis and mass spectrometry can be used to determine the epitope of an antibody on a specific antigen Y.
  • HDX-MS relies on the accurate measurement and comparison of the degree of deuterium incorporation by an antigen when incubated in D 2 O on its own and in presence of its antibody at various time intervals. Deuterium is exchanged with hydrogen on the amide backbone of the proteins in exposed areas whereas regions of the antigen bound to the antibody will be protected and will show less or no exchange after analysis by LC-MS/MS of proteolytic fragments.
  • Example 9 exemplifies the use of HDX to map the epitope bound by antibody 14A6.
  • immunoglobulin chains of anti-TIGIT antibodies of the invention include, but are not limited those disclosed in Table 4 (SEQ ID NOs: 1-30, 37-52, 57-83 or 88-167).
  • the present invention includes any polypeptide comprising or consisting of the amino acid sequences of SEQ ID NOs: 1-30, 37-52, 57-83 or 88-167, and recombinant nucleotides encoding such polypeptides.
  • the scope of the present invention includes isolated anti-TIGIT antibodies and antigen-binding fragments thereof (e.g., humanized antibodies), comprising a variant of an immunoglobulin chain set forth herein, e.g., any of SEQ ID NOs: 7-30, 37-52, 63-64, 94-95 or 124-133; wherein the variant exhibits one or more of the following properties: (i) binds human TIGIT; (ii) cross-reacts with cynomolgous and rhesus TIGIT; (iii) blocks binding of human TIGIT to human CD155 and human CD112; (iv) increases T cell activation; (v) stimulates antigen-specific T-cell production of IL-2 and IFN ⁇ ; (vi) blocks induction of T cell suppression of activation induced by TIGIT ligation with cognate ligands CD155 and CD112.
  • an immunoglobulin chain set forth herein e.g., any of SEQ ID NOs:
  • the invention provides antibodies or antigen-binding fragment thereof that binds human TIGIT (e.g., humanized antibodies) and has V L domains and V H domains with at least 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% sequence identity with SEQ ID NOs: 7-30, 37-52, 63-64, 94-95 or 124-133; wherein the variant exhibits the desired binding and properties, e.g., (i) binds human TIGIT with a KD value of about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e g KinExa or OCTET); (ii) cross-reacts with cynomolgous and rhesus TIGIT; (iii) blocks binding of human TIGIT to human CD155 and human CD112; (iv) increases T cell activation; (v) stimulates
  • Constantly modified variants or “conservative substitution” refers to substitutions of amino acids in a protein with other amino acids having similar characteristics (e.g. charge, side-chain size, hydrophobicity/hydrophilicity, backbone conformation and rigidity, etc.), such that the changes can frequently be made without altering the biological activity of the protein.
  • Those of skill in this art recognize that, in general, single amino acid substitutions in non-essential regions of a polypeptide do not substantially alter biological activity (see, e.g., Watson et al. (1987) Molecular Biology of the Gene , The Benjamin/Cummings Pub. Co., p. 224 (4th Ed.)).
  • substitutions of structurally or functionally similar amino acids are less likely to disrupt biological activity. Exemplary conservative substitutions are set forth in Table 1.
  • “Function-conservative variants,” as used herein, refers to antibodies or fragments in which one or more amino acid residues have been changed without altering a desired property, such an antigen affinity and/or specificity. Such variants include, but are not limited to, replacement of an amino acid with one having similar properties, such as the conservative amino acid substitutions of Table 1.
  • isolated polypeptides comprising the V L domains of the anti-TIGIT antibodies of the invention (e.g., SEQ ID NOs: 8, 25-30 and 48-52), and isolated polypeptides comprising the V H domains (e.g., SEQ ID NOs: 7, 9-24 and 37-47) of the anti-TIGIT antibodies of the invention having up to 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more amino acid substitutions.
  • isolated polypeptides comprising the V L domains of the anti-TIGIT antibodies of the invention (e.g., SEQ ID NO:64) and isolated polypeptides comprising the V H domains (e.g., SEQ ID NO:63) of the anti-TIGIT antibodies of the invention having up to 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more amino acid substitutions.
  • isolated polypeptides comprising the V L domains of the anti-TIGIT antibodies of the invention (e.g., SEQ ID NOs: 95 and 130-133) and isolated polypeptides comprising the V H domains (e.g., SEQ ID NOs: 94 and 124-129) of the anti-TIGIT antibodies of the invention having up to 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more amino acid substitutions.
  • an antibody or antigen-binding fragment thereof that binds TIGIT and has V L domains and V H domains with at least 99% 98%, 97%, 96%, 95%, 90%, 85%, 80% or 75% sequence identity to one or more of the V L domains or V H domains described herein, and exhibits specific binding to TIGIT.
  • the binding antibody or antigen-binding fragment thereof of the present invention comprises V L and V H domains (with and without signal sequence) having up to 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more amino acid substitutions, and exhibits specific binding to TIGIT.
  • the present invention further comprises the polynucleotides encoding any of the polypeptides or immunoglobulin chains of anti-TIGIT antibodies and antigen-binding fragments thereof of the invention.
  • the present invention includes the polynucleotides encoding the amino acids described in SEQ ID NOs: 1-30, 37-52, 57-83 and 88-167, as well as polynucleotides which hybridize thereto and, also, any polypeptide encoded by such a hybridizing polynucleotide.
  • the invention comprises a nucleic acid sequence comprising or consisting essentially of SEQ ID NO:84 or SEQ ID NO:85.
  • the polynucleotides hybridize under low, moderate or high stringency conditions, and encode antibodies or antigen-binding fragments thereof that maintain the ability to bind to TIGIT (human, rhesus and/or cynomolgous monkey, e.g., Macaca fascicularis ).
  • a first polynucleotide molecule is “hybridizable” to a second polynucleotide molecule when a single stranded form of the first polynucleotide molecule can anneal to the second polynucleotide molecule under the appropriate conditions of temperature and solution ionic strength (see Sambrook, et al., supra).
  • Typical low stringency hybridization conditions include 55° C., 5 ⁇ SSC, 0.1% SDS and no formamide; or 30% formamide, 5 ⁇ SSC, 0.5% SDS at 42° C.
  • Typical moderate stringency hybridization conditions are 40% formamide, with 5 ⁇ or 6 ⁇ SSC and 0.1% SDS at 42° C.
  • High stringency hybridization conditions are 50% formamide, 5 ⁇ or 6 ⁇ SSC at 42° C. or, optionally, at a higher temperature (e.g., 57° C., 59° C., 60° C., 62° C., 63° C., 65° C. or 68° C.).
  • SSC 0.15M NaCl and 0.015M Na-citrate.
  • Hybridization requires that the two polynucleotide contain complementary sequences, although, depending on the stringency of the hybridization, mismatches between bases are possible.
  • the appropriate stringency for hybridizing polynucleotides depends on the length of the polynucleotides and the degree of complementation, variables well known in the art. The greater the degree of similarity or homology between two nucleotide sequences, the higher the stringency under which the nucleic acids may hybridize. For hybrids of greater than 100 nucleotides in length, equations for calculating the melting temperature have been derived (see Sambrook, et al., supra, 9.50-9.51).
  • oligonucleotide For hybridization with shorter polynucleotides, e.g., oligonucleotides, the position of mismatches becomes more important, and the length of the oligonucleotide determines its specificity (see Sambrook, et al., supra, 11.7-11.8).
  • an isolated polynucleotide for example DNA, encoding the polypeptide chains of the isolated antibodies or antigen-binding fragments set forth herein is provided.
  • the isolated polynucleotide encodes an antibody or antigen-binding fragment thereof comprising at least one mature immunoglobulin light chain variable (VL) domain according to the invention and/or at least one mature immunoglobulin heavy chain variable (V H ) domain according to the invention.
  • the isolated polynucleotide encodes both a light chain and a heavy chain on a single polynucleotide molecule, and in other embodiments the light and heavy chains are encoded on separate polynucleotide molecules.
  • the polynucleotides further encodes a signal sequence.
  • the invention comprises an isolated polynucleotide encoding an antibody heavy variable (V H ) domain or an antigen-binding fragment thereof comprising CDR-H1 (SEQ ID NO:1), CDR-H2 (SEQ ID NO:2) and CDR-H3 (SEQ ID NO:3 or 79 or 80 or 81 or 82, 83 or 140).
  • V H antibody heavy variable
  • the invention comprises an isolated polynucleotide encoding an antibody light chain variable (V L ) domain or an antigen-binding fragment thereof comprising CDR-L1 (SEQ ID NO:4), CDR-L2 (SEQ ID NO:5 or 65 or 66 or 67 or 68 or 69 or 70 or 71 or 72 or 73 or 141) and CDR-L3 (SEQ ID NO:6 or 74 or 75 or 76 or 77 or 78).
  • V L antibody light chain variable
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V H ) domain of SEQ ID NO: 7.
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V L ) domain of SEQ ID NO: 8.
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V H ) domain of any one of SEQ ID NOs: 9-24 or 37-47.
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V L ) domain of any one of SEQ ID NOs: 25-30 or 48-52
  • the invention comprises an isolated polynucleotide encoding an antibody heavy variable (V H ) domain or an antigen-binding fragment thereof comprising CDR-H1 (SEQ ID NO:57), CDR-H2 (SEQ ID NO:58) and CDR-H3 (SEQ ID NO:59).
  • V H antibody heavy variable
  • the invention comprises an isolated polynucleotide encoding an antibody light chain variable (V L ) domain or an antigen-binding fragment thereof comprising CDR-L1 (SEQ ID NO:60), CDR-L2 (SEQ ID NO:61) and CDR-L3 (SEQ ID NO:62).
  • V L antibody light chain variable
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V H ) domain of SEQ ID NO: 63.
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V L ) domain of SEQ ID NO: 64.
  • the invention comprises an isolated polynucleotide encoding an antibody heavy variable (V H ) domain or an antigen-binding fragment thereof comprising CDR-H1 (SEQ ID NO: 88), CDR-H2 (SEQ ID NO: 89, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 134 or 135) and CDR-H3 (SEQ ID NO: 90).
  • V H antibody heavy variable
  • the invention comprises an isolated polynucleotide encoding an antibody light chain variable (V L ) domain or an antigen-binding fragment thereof comprising CDR-L1 (SEQ ID NO: 91), CDR-L2 (SEQ ID NO: 92, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122 or 123) and CDR-L3 (SEQ ID NO: 93).
  • V L antibody light chain variable
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V H ) domain of SEQ ID NO: 94.
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V L ) domain of SEQ ID NO: 95.
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V H ) domain of any one of SEQ ID NOs: 124-129.
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V L ) domain of any one of SEQ ID NOs: 130-133.
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V H ) domain of SEQ ID NO: 127.
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V H ) domain of SEQ ID NO: 128.
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V L ) domain of SEQ ID NO: 130.
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V L ) domain of SEQ ID NO: 132.
  • the invention comprises an isolated polynucleotide encoding the immunoglobulin heavy chain variable (V L ) domain of SEQ ID NO: 133.
  • This present invention also provides vectors, e.g., expression vectors, such as plasmids, comprising the isolated polynucleotides of the invention, wherein the polynucleotide is operably linked to control sequences that are recognized by a host cell when the host cell is transfected with the vector.
  • vectors e.g., expression vectors, such as plasmids
  • host cells comprising a vector of the present invention and methods for producing the antibody or antigen-binding fragment thereof or polypeptide disclosed herein comprising culturing a host cell harboring an expression vector or a nucleic acid encoding the immunoglobulin chains of the antibody or antigen-binding fragment thereof in culture medium, and isolating the antigen or antigen-binding fragment thereof from the host cell or culture medium.
  • polypeptides e.g., immunoglobulin polypeptides, comprising amino acid sequences that are at least about 75% identical, 80% identical, more preferably at least about 90% identical and most preferably at least about 95% identical (e.g., 95%, 96%, 97%, 98%, 99%, 100%) to the amino acid sequences of the antibodies provided herein when the comparison is performed by a BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g. expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11, extension 1; conditional compositional score matrix adjustment).
  • BLAST algorithm wherein the parameters of the algorithm are selected to give the largest match between the respective sequences over the entire length of the respective reference sequences (e.g. expect threshold: 10; word size: 3; max matches in a query range: 0; BLOSUM 62 matrix; gap costs: existence 11,
  • Sequence identity refers to the degree to which the amino acids of two polypeptides are the same at equivalent positions when the two sequences are optimally aligned.
  • BLAST ALGORITHMS Altschul et al. (2005) FEBS J. 272(20): 5101-5109; Altschul, S. F., et al., (1990) J. Mol. Biol. 215:403-410; Gish, W., et al., (1993) Nature Genet. 3:266-272; Madden, T. L., et al., (1996) Meth. Enzymol. 266:131-141; Altschul, S. F., et al., (1997) Nucleic Acids Res. 25:3389-3402; Zhang, J., et al., (1997) Genome Res.
  • the antibodies and antigen-binding fragments disclosed herein may bind human TIGIT with a K D value of at least about 1 ⁇ 10 ⁇ 9 M (i.e., a K D value of 1 ⁇ 10 ⁇ 9 M or lower) as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
  • the antibodies and antigen-binding fragments disclosed herein may bind human TIGIT with a K D value of at least about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
  • the antibodies and antigen-binding fragments disclosed herein may bind human TIGIT with a K D value of at about 1 ⁇ 10 ⁇ 9 M to about 1 ⁇ 10 ⁇ 12 M as determined by surface plasmon resonance (e.g., BIACORE) or a similar technique (e.g. KinExa or OCTET).
  • the antibodies and antigen-binding fragments disclosed herein may bind human TIGIT with a K D value of at least about 50 pM (i.e, a K D value of about 50 pM or lower) as determined by BIACORE or a similar technique.
  • the antibodies and antigen-binding fragments disclosed herein may bind human TIGIT with a K D value of at least about 10 pM (i.e, a K D value of about 10 pm lower) as determined by BIACORE or a similar technique. In one embodiment, the antibodies and antigen-binding fragments of the invention may bind to human TIGIT with a K D of about 50 pM to about 1 pM as determined by BIACORE or a similar technique.
  • the antibodies or antigen binding fragments of the invention increase the activity of an immune cell.
  • the increase of the activity of an immune cell can be detected using any method known in the art.
  • the increase in activity of an immune cell can be detected by measuring the proliferation of the immune cell.
  • an increase in activity of a T cell can be detected by measuring the proliferation of the T cell or signal transduction events such as tyrosine phosphorylation of immune receptors or downstream kinases that transmit signals to transcriptional regulators.
  • the increase in activity of an immune cell can be detected by measuring CTL or NK cell cytotoxic function on specific target cells or IFN ⁇ cytokine responses, which are associated with stimulation of anti-tumor immunity.
  • the increase in activity of an immune cell can be detected by measuring T cell activation ex vivo in a sample derived from the subject.
  • the increase in T cell activity is determined by: (i) measuring SEB ( Staphylococcus Enterotoxin B) induced production of one or more pro-inflammatory cytokines selected from the group consisting of: IL-2, TNF ⁇ , IL-17, IFN ⁇ , IL-1 ⁇ , GM-CSF, RANTES, IL-6, IL-8, IL-5 and IL-13; or (ii) measuring mixed lymphocyte reactions or direct anti-CD3 mAb stimulation of T cell receptor (TCR) signaling to induce production of a cytokine selected from the group consisting of: IL-2, TNF ⁇ , IL-17, IFN ⁇ , IL-1 ⁇ , GM-CSF, RANTES, IL-6, IL-8, IL-5 and IL-13.
  • TCR T cell receptor
  • the present invention includes antagonist anti-TIGIT antibodies and antigen-binding fragments thereof and methods of use thereof, e.g., humanized, antagonist anti-TIGIT antibodies and fragments.
  • An antagonist anti-TIGIT antibody or antigen-binding fragment thereof antagonizes an activity of human TIGIT such as by inhibiting TIGIT binding to CD155 and CD112, and inhibiting functional ITIM signal transduction by TIGIT upon binding to CD155 and CD112.
  • Measurement of anti-TIGIT antagonist activity can be assessed by demonstrating blocking of T cell suppression following TCR activation induced by TIGIT ligation with cognate ligands CD155 and CD112.
  • treating with antagonist anti-TIGIT antibodies are able to rescue IL-2 responses to levels observed in T cells that are not repressed by CD155 or CD112 induction of TIGIT.
  • responses following treatment with an anti-TIGIT antagonist antibody may increase responses to a level higher than T cell responses not repressed by CD155 or CD112.
  • the anti-TIGIT antibodies or antigen binding fragments of the invention are able to block binding of human TIGIT to human CD155 and human CD112.
  • the ability to block binding of human TIGIT to human CD155 and human CD112 can be determined using any method known in the art.
  • the ability of the antibodies to block binding of human TIGIT to human CD155 and human CD112 is determined using an ELISA assay as described in Example 2.
  • Hybridoma cells that produce parental (e.g., rat or mouse) monoclonal anti-TIGIT antibodies or antigen-binding fragments thereof discussed herein may be produced by methods which are commonly known in the art. Such isolated hybridomas are part of the present invention. These methods include, but are not limited to, the hybridoma technique originally developed by Kohler, et al., (1975) (Nature 256:495-497), as well as the trioma technique (Hering, et al., (1988) Biomed. Biochim. Acta. 47:211-216 and Hagiwara, et al., (1993) Hum. Antibod.
  • Hybridomas 4:15) the human B-cell hybridoma technique (Kozbor, et al., (1983) Immunology Today 4:72 and Cote, et al., (1983) Proc. Natl. Acad. Sci. U.S.A 80:2026-2030), the EBV-hybridoma technique (Cole, et al., in Monoclonal Antibodies and Cancer Therapy , Alan R. Liss, Inc., pp. 77-96, 1985), and electric field based electrofusion using a Cyto Pulse large chamber cull fusion electroporator (Cyto Pulse Sciences, Inc., Glen Burnie, Md.).
  • mouse splenocytes are isolated and fused with PEG or by electrofusion to a mouse myeloma cell line based upon standard protocols.
  • the resulting hybridomas may then be screened for the production of antigen-specific antibodies.
  • single cell suspensions of splenic lymphocytes from immunized mice may by fused to one-sixth the number of P3 ⁇ 63-Ag8.653 nonsecreting mouse myeloma cells (ATCC, CRL 1580) with 50% PEG.
  • Cells may be plated at approximately 2 ⁇ 10 5 cells/mL in a flat bottom microtiter plate, followed by a two week incubation in selective medium containing 20% fetal Clone Serum, 18% “653” conditioned media, 5% origen (IGEN), 4 mM L-glutamine, 1 mM L-glutamine, 1 mM sodium pyruvate, 5 mM HEPES, 0.055 mM 2-mercaptoethanol, 50 units/ml penicillin, 50 mg/ml streptomycin, 50 mg/ml gentamycin and 1 ⁇ HAT (Sigma; the HAT is added 24 hours after the fusion). After two weeks, cells may be cultured in medium in which the HAT is replaced with HT.
  • selective medium containing 20% fetal Clone Serum, 18% “653” conditioned media, 5% origen (IGEN), 4 mM L-glutamine, 1 mM L-glutamine, 1 mM sodium pyruvate, 5
  • Individual wells may then be screened by ELISA for anti-TIGIT monoclonal IgG antibodies. Once extensive hybridoma growth occurs, medium can be observed usually after 10-14 days.
  • the antibody secreting hybridomas may be replated, screened again, and if still positive for human IgG, anti-TIGIT monoclonal antibodies, can be subcloned at least twice by limiting dilution.
  • the stable subclones may then be cultured in vitro to generate small amounts of antibody in tissue culture medium for characterization.
  • the present invention includes methods for making an anti-TIGIT antibody or antigen-binding fragment thereof of the present invention comprising culturing a hybridoma cell that expresses the antibody or fragment under condition favorable to such expression and, optionally, isolating the antibody or fragment from the hybridoma and/or the growth medium (e.g. cell culture medium).
  • the growth medium e.g. cell culture medium
  • the anti-TIGIT antibodies disclosed herein may also be produced recombinantly (e.g., in an E. coli /T7 expression system, a mammalian cell expression system or a lower eukaryote expression system).
  • nucleic acids encoding the antibody immunoglobulin molecules of the invention e.g., V H or V L
  • the present invention includes methods for expressing an antibody or antigen-binding fragment thereof or immunoglobulin chain thereof in a host cell (e.g., bacterial host cell such as E.
  • a bacterial host cell such as a E. coli
  • Transformation can be by any known method for introducing polynucleotides into a host cell.
  • Methods for introduction of heterologous polynucleotides into mammalian cells are well known in the art and include dextran-mediated transfection, calcium phosphate precipitation, polybrene-mediated transfection, protoplast fusion, electroporation, encapsulation of the polynucleotide(s) in liposomes, biolistic injection and direct microinjection of the DNA into nuclei.
  • nucleic acid molecules may be introduced into mammalian cells by viral vectors. Methods of transforming cells are well known in the art. See, for example, U.S. Pat. Nos. 4,399,216; 4,912,040; 4,740,461 and 4,959,455.
  • the present invention includes recombinant methods for making an anti-TIGIT antibody or antigen-binding fragment thereof of the present invention, or an immunoglobulin chain thereof, comprising introducing a polynucleotide encoding one or more immunoglobulin chains of the antibody or fragment (e.g., heavy and/or light immunoglobulin chain); culturing the host cell (e.g., CHO or Pichia or Pichia pastoris ) under condition favorable to such expression and, optionally, isolating the antibody or fragment or chain from the host cell and/or medium in which the host cell is grown.
  • a polynucleotide encoding one or more immunoglobulin chains of the antibody or fragment (e.g., heavy and/or light immunoglobulin chain)
  • the host cell e.g., CHO or Pichia or Pichia pastoris
  • Anti-TIGIT antibodies can also be synthesized by any of the methods set forth in U.S. Pat. No. 6,331,415.
  • Eukaryotic and prokaryotic host cells including mammalian cells as hosts for expression of the antibodies or fragments or immunoglobulin chains disclosed herein are well known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC). These include, inter alia, Chinese hamster ovary (CHO) cells, NSO, SP2 cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), A549 cells, 3T3 cells, HEK-293 cells and a number of other cell lines.
  • Mammalian host cells include human, mouse, rat, dog, monkey, pig, goat, bovine, horse and hamster cells.
  • Cell lines of particular preference are selected through determining which cell lines have high expression levels.
  • Other cell lines that may be used are insect cell lines, such as Sf9 cells, amphibian cells, bacterial cells, plant cells and fungal cells.
  • Fungal cells include yeast and filamentous fungus cells including, for example, Pichia pastoris, Pichia finlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia minuta ( Ogataea minuta, Pichia lindneri ), Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula polymorphs, Kluyveromyces sp., Kluyveromy
  • Pichia sp. any Saccharomyces sp., Hansenula polymorpha , any Kluyveromyces sp., Candida albicans , any Aspergillus sp., Trichoderma reesei, Chrysosporium lucknowense , any Fusarium sp., Yarrowia lipolytica , and Neurospora crassa .
  • the antibodies are produced by culturing the host cells for a period of time sufficient to allow for expression of the antibody or fragment or chain in the host cells or secretion of the into the culture medium in which the host cells are grown.
  • Antibodies and antigen-binding fragments thereof and immunoglobulin chains can be recovered from the culture medium using standard protein purification methods. Further, expression of antibodies and antigen-binding fragments thereof and immunoglobulin chains of the invention (or other moieties therefrom) from production cell lines can be enhanced using a number of known techniques.
  • the glutamine synthetase gene expression system (the GS system) is a common approach for enhancing expression under certain conditions. The GS system is discussed in whole or part in connection with European Patent Nos. 0 216 846, 0 256 055, and 0 323 997 and European Patent Application No. 89303964.4.
  • the mammalian host cells e.g., CHO
  • the polynucleotide encoding the immunoglobulin chain comprises a glutamine synthetase gene which complements the lack of the gene in the host cell.
  • the present invention includes methods for purifying an anti-TIGIT antibody or antigen-binding fragment thereof of the present invention comprising introducing a sample comprising the antibody or fragment to a purification medium (e.g., cation exchange medium, anion exchange medium, hydrophobic exchange medium, affinity purification medium (e.g., protein-A, protein-G, protein-A/G, protein-L)) and either collecting purified antibody or fragment from the flow-through fraction of said sample that does not bind to the medium; or, discarding the flow-through fraction and eluting bound antibody or fragment from the medium and collecting the eluate.
  • a purification medium e.g., cation exchange medium, anion exchange medium, hydrophobic exchange medium, affinity purification medium (e.g., protein-A, protein-G, protein-A/G, protein-L)
  • the medium is in a column to which the sample is applied.
  • the purification method is conducted following recombinant expression of the antibody or fragment in a host cell, e.g., wherein the host cell is first lysed and, optionally, the lysate is purified of insoluble materials prior to purification on a medium.
  • glycoproteins produced in a particular cell line or transgenic animal will have a glycosylation pattern that is characteristic for glycoproteins produced in the cell line or transgenic animal. Therefore, the particular glycosylation pattern of an antibody will depend on the particular cell line or transgenic animal used to produce the antibody.
  • all antibodies encoded by the nucleic acid molecules provided herein, or comprising the amino acid sequences provided herein comprise the instant invention, independent of the glycosylation pattern the antibodies may have.
  • antibodies with a glycosylation pattern comprising only non-fucosylated N-glycans may be advantageous, because these antibodies have been shown to typically exhibit more potent efficacy than their fucosylated counterparts both in vitro and in vivo (See for example, Shinkawa et al., J. Biol. Chem. 278: 3466-3473 (2003); U.S. Pat. Nos. 6,946,292 and 7,214,775). These antibodies with non-fucosylated N-glycans are not likely to be immunogenic because their carbohydrate structures are a normal component of the population that exists in human serum IgG.
  • the present invention includes polyclonal anti-TIGIT antibodies and antigen-binding fragments thereof, e.g., a composition comprising a plurality of anti-TIGIT antibodies and fragments, which include one or more of the anti-TIGIT antibodies or antigen-binding fragments thereof of the present invention, and methods of use thereof.
  • a polyclonal antibody is an antibody which was produced among or in the presence of one or more other, non-identical antibodies.
  • polyclonal antibodies are produced from collections of different B-lymphocytes, e.g., the B-lymphocyte of an animal treated with an immunogen of interest, which produces a population of different antibodies but which are all directed to the immunogen.
  • polyclonal antibodies are obtained directly from an immunized animal, e.g., spleen, serum or ascites fluid.
  • the present invention includes bispecific and bifunctional antibodies and antigen-binding fragments having a binding specificity for TIGIT and another antigen such as, for example, PD-1 or PD-L1 or LAG-3, and methods of use thereof.
  • the anti-TIGIT chains comprise any one of the VH/VL sequences described in Table 4, and the PD1 chains comprise the amino acid sequence of SEQ ID NOs: 33 and 34 or of SEQ ID NOs: 35 and 36 (or an antigen binding fragment of any of said sequences).
  • a bispecific or bifunctional antibody is an artificial hybrid antibody having two different heavy/light chain pairs and two different binding sites. Bispecific antibodies can be produced by a variety of methods including fusion of hybridomas or linking of Fab′ fragments.
  • bispecific antibodies may be formed as “diabodies” (Holliger, et al., (1993) PNAS USA 90:6444-6448) or as “Janusins” (Traunecker, et al., (1991) EMBO J. 10:3655-3659 and Traunecker, et al., (1992) Int. J. Cancer Suppl. 7:51-52).
  • the present invention further includes anti-TIGIT antigen-binding fragments of the anti-TIGIT antibodies disclosed herein.
  • the antibody fragments include F(ab) 2 fragments, which may be produced by enzymatic cleavage of an IgG by, for example, pepsin.
  • Fab fragments may be produced by, for example, reduction of F(ab) 2 with dithiothreitol or mercaptoethylamine.
  • Immunoglobulins may be assigned to different classes depending on the amino acid sequences of the constant domain of their heavy chains. There are at least five major classes of immunoglobulins: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgG1, IgG2, IgG3 and IgG4; IgA1 and IgA2.
  • the invention comprises antibodies and antigen-binding fragments of any of these classes or subclasses of antibodies.
  • the antibody or antigen-binding fragment comprises a heavy chain constant region, e.g. a human constant region, such as ⁇ 1, ⁇ 2, ⁇ 3, or ⁇ 4 human heavy chain constant region or a variant thereof.
  • the antibody or antigen-binding fragment comprises a light chain constant region, e.g. a human light chain constant region, such as lambda or kappa human light chain region or variant thereof.
  • the human heavy chain constant region can be ⁇ 4 and the human light chain constant region can be kappa.
  • the Fc region of the antibody is ⁇ 4 with a Ser228Pro mutation (Schuurman, J et. al., Mol. Immunol. 38: 1-8, 2001).
  • the antibody or antigen-binding fragment comprises a heavy chain constant region of the IgG1 subtype.
  • different constant domains may be appended to humanized V L and V H regions derived from the CDRs provided herein.
  • a heavy chain constant domain other than human IgG1 may be used, or hybrid IgG1/IgG4 may be utilized.
  • human IgG1 antibodies provide for long half-life and for effector functions, such as complement activation and antibody-dependent cellular cytotoxicity, such activities may not be desirable for all uses of the antibody.
  • a human IgG4 constant domain for example, may be used.
  • the present invention includes anti-TIGIT antibodies and antigen-binding fragments thereof which comprise an IgG4 constant domain, e.g., antagonist, humanized anti-TIGIT antibodies and fragments, and methods of use thereof.
  • the IgG4 constant domain can differ from the native human IgG4 constant domain (Swiss-Prot Accession No.
  • the anti-TIGIT antibodies and antigen-binding fragments thereof are engineered antibodies to include modifications to framework residues within the variable domains of a parental (e.g., mouse or rat) monoclonal antibody, e.g. to improve the properties of the antibody or fragment.
  • framework modifications are made to decrease the immunogenicity of the antibody or fragment. This is usually accomplished by replacing non-CDR residues in the variable domains (i.e. framework residues) in a parental (e.g. rodent) antibody or fragment with analogous residues from the immune repertoire of the species in which the antibody is to be used, e.g. human residues in the case of human therapeutics.
  • Such an antibody or fragment is referred to as a “humanized” antibody or fragment.
  • an engineered (e.g. humanized) antibody In some cases it is desirable to increase the affinity, or alter the specificity of an engineered (e.g. humanized) antibody.
  • One approach is to “backmutate” one or more framework residues to the corresponding germline sequence. More specifically, an antibody or fragment that has undergone somatic mutation can contain framework residues that differ from the germline sequence from which the antibody is derived. Such residues can be identified by comparing the antibody or fragment framework sequences to the germline sequences from which the antibody or fragment is derived.
  • Another approach is to revert to the original parental (e.g., rodent) residue at one or more positions of the engineered (e.g. humanized) antibody, e.g.
  • the anti-TIGIT antibodies and antigen-binding fragments thereof are engineered (e.g. humanized) to include modifications to in the framework and/or CDRs to improve their properties.
  • engineered changes can be based on molecular modelling.
  • a molecular model for the variable region for the parental (non-human) antibody sequence can be constructed to understand the structural features of the antibody and used to identify potential regions on the antibody that can interact with the antigen.
  • Conventional CDRs are based on alignment of immunoglobulin sequences and identifying variable regions.
  • Human frameworks can be selected based on best matches with the non-human sequence both in the frameworks and in the CDRs.
  • FR4 framework 4
  • VJ regions for the human germlines are compared with the corresponding non-human region.
  • FR4 (framework 4) in VL J-kappa and J-Lambda regions of human germline sequences are compared with the corresponding non-human region.
  • the CDRs are grafted into the selected human frameworks. In some cases certain residues in the VL-VH interface can be retained as in the non-human (parental) sequence.
  • Molecular models can also be used for identifying residues that can potentially alter the CDR conformations and hence binding to antigen. In some cases, these residues are retained as in the non-human (parental) sequence. Molecular models can also be used to identify solvent exposed amino acids that can result in unwanted effects such as glycosylation, deamidation and oxidation. Developability filters can be introduced early on in the design stage to eliminate/minimize these potential problems.
  • Another type of framework modification involves mutating one or more residues within the framework region, or even within one or more CDR regions, to remove T cell epitopes to thereby reduce the potential immunogenicity of the antibody. This approach is also referred to as “deimmunization” and is described in further detail in U.S. Pat. No. 7,125,689.
  • the antibodies of the present disclosure do not contain deamidation or asparagine isomerism sites.
  • an asparagine (Asn) residue may be changed to Gln or Ala to reduce the potential for formation of isoaspartate at any Asn-Gly sequences, particularly within a CDR.
  • a similar problem may occur at a Asp-Gly sequence. Reissner and Aswad (2003) Cell. Mol. Life Sci. 60:1281. Isoaspartate formation may debilitate or completely abrogate binding of an antibody to its target antigen. See, Presta (2005) J. Allergy Clin. Immunol. 116:731 at 734.
  • the asparagine is changed to glutamine (Gln).
  • any methionine residues may be changed to Lys, Leu, Ala, or Phe or other amino acids in order to reduce the possibility that the methionine sulfur would oxidize, which could reduce antigen-binding affinity and also contribute to molecular heterogeneity in the final antibody preparation. Id.
  • the CDR3 of SEQ ID NO:3 can be modified at position 110W to reduce or remove potential oxidation (wherein the numbering is according to Kabat).
  • SEQ ID NO:3 (MPSFITLASLSTWEGYFDF) can be modified to any of the following sequences: MPSFITLASLSTFEGYFDF (SEQ ID NO:79), MPSFITLASLSTYEGYFDF (SEQ ID NO:80), MPSFITLASLSTIEGYFDF (SEQ ID NO:81), MPSFITLASLSTVEGYFDF (SEQ ID NO:82) or MPSFITLASLSTLEGYFDF (SEQ ID NO:83).
  • the anti-TIGIT antibody of the invention comprises a heavy chain variable region comprising the CDR1 of SEQ ID NO:1, the CDR2 of SEQ ID NO:2 and the CDR3 of SEQ ID NO: 3, 79, 80, 81, 82 or 83.
  • the CDR2 of SEQ ID NO:5 can be modified at positions 52N and 53S to reduce or remove potential deamidation sites (wherein the numbering is according to Kabat).
  • SEQ ID NO:5 (YANSLQT) can be modified to any of the following sequences: YASNLQT (SEQ ID NO:65), YASSLQT (SEQ ID NO:66), YASTLQT (SEQ ID NO:67), YATTLQT (SEQ ID NO:68), YASYLQT (SEQ ID NO:69), YANQLQT (SEQ ID NO:70), YAGSLQT (SEQ ID NO:71), YASQLQT (SEQ ID NO:72), YADSLQT (SEQ ID NO:73).
  • the anti-TIGIT antibody of the invention comprises a light chain variable region comprising the CDR1 of SEQ ID NO:4, the CDR2 of SEQ ID NO:5, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:72, SEQ ID NO:72 or SEQ ID NO:73, and the CDR3 of SEQ ID NO:6.
  • the CDR3 of SEQ ID NO:6 can be modified at position 95W to reduce or remove potential oxidation (wherein the numbering is according to Kabat).
  • SEQ ID NO:6 (QQYYSGWT) can be modified to any of the following sequences: QQYYSGFT (SEQ ID NO:74), QQYYSGYT (SEQ ID NO:75), QQYYSGIT (SEQ ID NO: 76), QQYYSGVT (SEQ ID NO:77), QQYYSGLT (SEQ ID NO:78).
  • the anti-TIGIT antibody of the invention comprises a light chain variable region comprising the CDR1 of SEQ ID NO:4, the CDR2 of SEQ ID NO:5 and the CDR3 of SEQ ID NO:6, SEQ ID NO:74, SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:77 or SEQ ID NO:78.
  • the anti-TIGIT antibody of the invention comprises a light chain variable region comprising the CDR1 of SEQ ID NO:4, the CDR2 of SEQ ID NO:5, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68, SEQ ID NO:69, SEQ ID NO:70, SEQ ID NO:72, SEQ ID NO:72 or SEQ ID NO:73, and the CDR3 of SEQ ID NO:6, SEQ ID NO:74, SEQ ID NO:75, SEQ ID NO:76, SEQ ID NO:77 or SEQ ID NO:78.
  • the anti-TIGIT antibody of the invention comprises a heavy chain FR4 region which comprises the amino acid sequence of any one of SEQ ID NOs: 7, 9-24 or 38-47, wherein the M at position 122 is substituted with V, L, A, R, N, P Q, E, G, I, H, K, F, S, T, W, or L to avoid potential oxidation.
  • the anti-TIGIT antibody of the invention comprises a heavy chain FR4 region which comprises the amino acid sequence of any one of SEQ ID NOs: 7, 9-24 or 38-47, wherein the M at position 122 and the V at position 123 are substituted with T and L respectively to avoid potential oxidation.
  • the CDR3 of SEQ ID NO:90 can be modified at position 6 to reduce or remove potential oxidation.
  • SEQ ID NO:90 GGPYGWYFDV
  • GGPYGWYFDV be modified to any of the following sequences: SEQ ID NOs: 154-167.
  • the antibodies e.g., humanized antibodies
  • antigen-binding fragments thereof disclosed herein e.g., 14A6, 28H5, 31C6 and humanized versions thereof
  • antibodies and antigen-binding fragments thereof disclosed herein can be chemically modified (e.g., one or more chemical moieties can be attached to the antibody) or be modified to alter its glycosylation, again to alter one or more properties of the antibody or fragment.
  • chemically modified e.g., one or more chemical moieties can be attached to the antibody
  • be modified to alter its glycosylation again to alter one or more properties of the antibody or fragment.
  • the antibodies and antigen-binding fragments thereof disclosed herein also include antibodies and fragments with modified (or blocked) Fc regions to provide altered effector functions. See, e.g., U.S. Pat. No. 5,624,821; WO2003/086310; WO2005/120571; WO2006/0057702. Such modifications can be used to enhance or suppress various reactions of the immune system, with possible beneficial effects in diagnosis and therapy. Alterations of the Fc region include amino acid changes (substitutions, deletions and insertions), glycosylation or deglycosylation, and adding multiple Fc regions.
  • the antibody or antigen-binding fragment of the invention is an IgG4 isotype antibody or fragment comprising a Serine to Proline mutation at a position corresponding to position 228 (S228P; EU index) in the hinge region of the heavy chain constant region.
  • S228P Serine to Proline mutation at a position corresponding to position 228
  • This mutation has been reported to abolish the heterogeneity of inter-heavy chain disulfide bridges in the hinge region (Angal et al. supra; position 241 is based on the Kabat numbering system).
  • the hinge region of CH1 is modified such that the number of cysteine residues in the hinge region is increased or decreased. This approach is described further in U.S. Pat. No. 5,677,425.
  • the number of cysteine residues in the hinge region of CH1 is altered, for example, to facilitate assembly of the light and heavy chains or to increase or decrease the stability of the antibody.
  • the Fc hinge region of an antibody or antigen-binding fragment of the invention is mutated to decrease the biological half-life of the antibody or fragment. More specifically, one or more amino acid mutations are introduced into the CH2-CH3 domain interface region of the Fc-hinge fragment such that the antibody or fragment has impaired Staphylococcyl protein A (SpA) binding relative to native Fc-hinge domain SpA binding.
  • SpA Staphylococcyl protein A
  • the antibody or antigen-binding fragment of the invention is modified to increase its biological half-life.
  • the antibody or antigen-binding fragment of the invention e.g., 14A6 or 28H5 or a humanized version thereof
  • the antibody can be altered within the CH1 or CL region to contain a salvage receptor binding epitope taken from two loops of a CH2 domain of an Fc region of an IgG, as described in U.S. Pat. Nos. 5,869,046 and 6,121,022.
  • the Fc region is altered by replacing at least one amino acid residue with a different amino acid residue to alter the effector function(s) of the antibody or antigen-binding fragment.
  • one or more amino acids selected from amino acid residues 234, 235, 236, 237, 297, 318, 320 and 322 can be replaced with a different amino acid residue such that the antibody has an altered affinity for an effector ligand and retains the antigen-binding ability of the parent antibody.
  • the effector ligand to which affinity is altered can be, for example, an Fc receptor or the C1 component of complement. This approach is described in further detail in U.S. Pat. Nos. 5,624,821 and 5,648,260.
  • one or more amino acids selected from amino acid residues 329, 331 and 322 can be replaced with a different amino acid residue such that the antibody has altered C1q binding and/or reduced or abolished complement dependent cytotoxicity (CDC).
  • CDC complement dependent cytotoxicity
  • one or more amino acid residues within amino acid positions 231 and 239 are altered to thereby alter the ability of the antibody to fix complement. This approach is described further in PCT Publication WO 94/29351.
  • the Fc region is modified to decrease the ability of the antibody or antigen-binding fragment of the invention (e.g., 14A6 or 28H5 or a humanized version thereof) to mediate antibody dependent cellular cytotoxicity (ADCC) and/or to decrease the affinity of the antibody or fragment for an Fey receptor by modifying one or more amino acids at the following positions: 238, 239, 243, 248, 249, 252, 254, 255, 256, 258, 264, 265, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 301, 303, 305, 307, 309, 312, 315, 320, 322, 324, 326, 327, 329, 330, 331, 333, 334, 335, 337, 338, 340, 360, 373, 376, 378, 382, 388, 389, 398, 414, 4
  • ADCC
  • the Fc region is modified to decrease the ability of the antibody of the invention (e.g., 14A6, 28H5, 31C6 and humanized versions thereof) to mediate effector function and/or to increase anti-inflammatory properties by modifying residues 243 and 264.
  • the Fc region of the antibody or fragment is modified by changing the residues at positions 243 and 264 to alanine.
  • the Fc region is modified to decrease the ability of the antibody or fragment to mediate effector function and/or to increase anti-inflammatory properties by modifying residues 243, 264, 267 and 328.
  • the Fc region of an anti-TIGIT antibody is modified to increase the ability of the antibody or antigen-binding fragment to mediate effector function and/or to increase their binding to the Fcgamma receptors (Fc ⁇ Rs).
  • ADCC Antibody Dependant Cell mediated Cytotoxic activity
  • CDC Complement-dependant cytotoxic activity
  • ADCP antibody dependant cellular phagocytosis
  • Fc receptors including FcgammaRI (CD64), FcgammaRII (CD32) and FcgammaRIII (CD16) is believed to mediate the effector functions, such as ADCC and CDC, of the antigen binding protein.
  • Fc receptor is also important for antibody cross-linking, which can be important for anti-tumor immunity.
  • Effector function can be measured in a number of ways including for example via binding of the FcgammaRIII to Natural Killer cells or via FcgammaRI to monocytes/macrophages to measure for ADCC effector function.
  • an antigen binding protein of the present invention can be assessed for ADCC effector function in a Natural Killer cell assay. Examples of such assays can be found in Shields et al, 2001 J. Biol. Chem., Vol. 276, p 6591-6604; Chappel et al, 1993 J. Biol. Chem., Vol 268, p 25124-25131; Lazar et al, 2006 PNAS, 103; 4005-4010.
  • ADCC or CDC properties of antibodies of the present invention may be enhanced in a number of ways.
  • such mutations are in one or more of positions selected from 239, 332 and 330 (IgG1), or the equivalent positions in other IgG isotypes.
  • suitable mutations are S239D and I332E and A330L.
  • the antigen binding protein of the invention herein described is mutated at positions 239 and 332, for example S239D and I332E or in a further embodiment it is mutated at three or more positions selected from 239 and 332 and 330, for example S239D and I332E and A330L. (EU index numbering).
  • an antibody comprising a heavy chain constant region with an altered glycosylation profile such that the antigen binding protein has enhanced effector function.
  • the antibody has enhanced ADCC or enhanced CDC or wherein it has both enhanced ADCC and CDC effector function.
  • suitable methodologies to produce antigen binding proteins with an altered glycosylation profile are described in WO2003011878, WO2006014679 and EP1229125.
  • the present invention provides “non-fucosylated” or “afucosylated” antibodies.
  • Non-fucosylated antibodies harbour a tri-mannosyl core structure of complex-type N-glycans of Fc without fucose residue.
  • These glycoengineered antibodies that lack core fucose residue from the Fc N-glycans may exhibit stronger ADCC than fucosylated equivalents due to enhancement of FcgammaRIIIa binding capacity.
  • the present invention also provides a method for the production of an antibody according to the invention comprising the steps of: a) culturing a recombinant host cell comprising an expression vector comprising the isolated nucleic acid as described herein, wherein the recombinant host cell does not comprise an alpha-1,6-fucosyltransferase; and b) recovering the antigen binding protein.
  • the recombinant host cell may be not normally contain a gene encoding an alpha-1,6-fucosyltransferase (for example yeast host cells such as Pichia sp.) or may have been genetically modified to inactive an alpha-1,6-fucosyltransferase.
  • Recombinant host cells which have been genetically modified to inactivate the FUT8 gene encoding an alpha-1,6-fucosyltransferase are available. See, e.g., the POTELLIGENTTM technology system available from BioWa, Inc. (Princeton, N.J.) in which CHOK1SV cells lacking a functional copy of the FUT8 gene produce monoclonal antibodies having enhanced antibody dependent cell mediated cytotoxicity (ADCC) activity that is increased relative to an identical monoclonal antibody produced in a cell with a functional FUT8 gene. Aspects of the POTELLIGENTTM technology system are described in U.S. Pat. No. 7,214,775, U.S. Pat. No. 6,946,292, WO0061739 and WO0231240. Those of ordinary skill in the art will also recognize other appropriate systems.
  • ADCC antibody dependent cell mediated cytotoxicity
  • the antibodies or antigen-binding fragments of the invention comprise a particular glycosylation pattern.
  • an afucosylated or an aglycosylated antibody or fragment can be made (i.e., the antibody lacks fucose or glycosylation, respectively).
  • the glycosylation pattern of an antibody or fragment may be altered to, for example, increase the affinity or avidity of the antibody or fragment for a TIGIT antigen. Such modifications can be accomplished by, for example, altering one or more of the glycosylation sites within the antibody or fragment sequence.
  • one or more amino acid substitutions can be made that result removal of one or more of the variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
  • Such aglycosylation may increase the affinity or avidity of the antibody or fragment for antigen. See, e.g., U.S. Pat. Nos. 5,714,350 and 6,350,861.
  • Antibodies and antigen-binding fragments disclosed herein may further include those produced in lower eukaryote host cells, in particular fungal host cells such as yeast and filamentous fungi have been genetically engineered to produce glycoproteins that have mammalian- or human-like glycosylation patterns (See for example, Choi et al, (2003) Proc. Natl. Acad. Sci.
  • a particular advantage of these genetically modified host cells over currently used mammalian cell lines is the ability to control the glycosylation profile of glycoproteins that are produced in the cells such that compositions of glycoproteins can be produced wherein a particular N-glycan structure predominates (see, e.g., U.S. Pat. No. 7,029,872 and U.S. Pat. No. 7,449,308).
  • These genetically modified host cells have been used to produce antibodies that have predominantly particular N-glycan structures (See for example, Li et al., (2006) Nat. Biotechnol. 24: 210-215).
  • the antibodies and antigen-binding fragments thereof disclosed herein further include those produced in lower eukaryotic host cells and which comprise fucosylated and non-fucosylated hybrid and complex N-glycans, including bisected and multiantennary species, including but not limited to N-glycans such as GlcNAc (1-4) Man 3 GlcNAc 2 ; Gal (1-4) GlcNAc (1-4) Man 3 GlcNAc 2 ; NANA (1-4) Gal (1-4) GlcNAc (1-4) Man 3 GlcNAc 2 .
  • N-glycans such as GlcNAc (1-4) Man 3 GlcNAc 2 ; Gal (1-4) GlcNAc (1-4) Man 3 GlcNAc 2 ; NANA (1-4) Gal (1-4) GlcNAc (1-4) Man 3 GlcNAc 2 .
  • the antibodies and antigen-binding fragments thereof provided herein may comprise antibodies or fragments having at least one hybrid N-glycan selected from the group consisting of GlcNAcMan 5 GlcNAc 2 ; GalGlcNAcMan 5 GlcNAc 2 ; and NANAGalGlcNAcMan 5 GlcNAc 2 .
  • the hybrid N-glycan is the predominant N-glycan species in the composition.
  • the antibodies and antigen-binding fragments thereof provided herein comprise antibodies and fragments having at least one complex N-glycan selected from the group consisting of GlcNAcMan 3 GlcNAc 2 ; GalGlcNAcMan 3 GlcNAc 2 ; NANAGalGlcNAcMan 3 GlcNAc 2 ; GlcNAc 2 Man 3 GlcNAc 2 ; GalGlcNAc 2 Man 3 GlcNAc 2 ; Gal 2 GlcNAc 2 Man 3 GlcNAc 2 ; NANAGal 2 GlcNAc 2 Man 3 GlcNAc 2 ; and NANA 2 Gal 2 GlcNAc 2 Man 3 GlcNAc 2 .
  • N-glycan selected from the group consisting of GlcNAcMan 3 GlcNAc 2 ; GalGlcNAcMan 3 GlcNAc 2 ; NANAGalGlcNAcMan 3 GlcNAc 2 ; and NANA 2 Gal 2 GlcNA
  • the complex N-glycan are the predominant N-glycan species in the composition.
  • the complex N-glycan is a particular N-glycan species that comprises about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the complex N-glycans in the composition.
  • the antibody and antigen binding fragments thereof provided herein comprise complex N-glycans, wherein at least 50%, 60%, 70%, 80%, 90%, 95%, 97%, 98%, 99%, or 100% of the complex N-glycans in comprise the structure NANA 2 Gal 2 GlcNAc 2 Man 3 GlcNAc 2 , wherein such structure is afucosylated.
  • Such structures can be produced, e.g., in engineered Pichia pastoris host cells.
  • the N-glycan is fucosylated.
  • the fucose is in an ⁇ 1,3-linkage with the GlcNAc at the reducing end of the N-glycan, an ⁇ 1,6-linkage with the GlcNAc at the reducing end of the N-glycan, an ⁇ 1,2-linkage with the Gal at the non-reducing end of the N-glycan, an ⁇ 1,3-linkage with the GlcNac at the non-reducing end of the N-glycan, or an ⁇ 1,4-linkage with a GlcNAc at the non-reducing end of the N-glycan.
  • the glycoform is in an ⁇ 1,3-linkage or ⁇ 1,6-linkage fucose to produce a glycoform selected from the group consisting of Man 5 GlcNAc 2 (Fuc), GlcNAcMan 5 GlcNAc 2 (Fuc), Man 3 GlcNAc 2 (Fuc), GlcNAcMan 3 GlcNAc 2 (Fuc), GlcNAc 2 Man 3 GlcNAc 2 (Fuc), GalGlcNAc 2 Man 3 GlcNAc 2 (Fuc), Gal 2 GlcNAc 2 Man 3 GlcNAc 2 (Fuc), NANAGal 2 GlcNAc 2 Man 3 GlcNAc 2 (Fuc), and NANA 2 Gal 2 GlcNAc 2 Man 3 GlcNAc 2 (Fuc); in an ⁇ 1,3-linkage or ⁇ 1,4-linkage fucose to produce a glycoform selected from the group consisting of Man 5 GlcNAc 2 (Fu
  • the antibodies e.g., humanized antibodies
  • antigen-binding fragments thereof comprise high mannose N-glycans, including but not limited to, Man 8 GlcNAc 2 , Man 7 GlcNAc 2 , Man 6 GlcNAc 2 , Man 5 GlcNAc 2 , Man 4 GlcNAc 2 , or N-glycans that consist of the Man 3 GlcNAc 2 N-glycan structure.
  • the complex N-glycans further include fucosylated and non-fucosylated bisected and multiantennary species.
  • N-glycan and “glycoform” are used interchangeably and refer to an N-linked oligosaccharide, for example, one that is attached by an asparagine-N-acetylglucosamine linkage to an asparagine residue of a polypeptide.
  • N-linked glycoproteins contain an N-acetylglucosamine residue linked to the amide nitrogen of an asparagine residue in the protein.
  • glycoproteins The predominant sugars found on glycoproteins are glucose, galactose, mannose, fucose, N-acetylgalactosamine (GalNAc), N-acetylglucosamine (GlcNAc) and sialic acid (e.g., N-acetyl-neuraminic acid (NANA)).
  • GalNAc N-acetylgalactosamine
  • GlcNAc N-acetylglucosamine
  • sialic acid e.g., N-acetyl-neuraminic acid (NANA)
  • N-glycans have a common pentasaccharide core of Man 3 GlcNAc 2 (“Man” refers to mannose; “Glc” refers to glucose; and “NAc” refers to N-acetyl; GlcNAc refers to N-acetylglucosamine).
  • Man refers to mannose
  • Glc refers to glucose
  • NAc refers to N-acetyl
  • GlcNAc refers to N-acetylglucosamine
  • N-glycan structures are presented with the non-reducing end to the left and the reducing end to the right.
  • the reducing end of the N-glycan is the end that is attached to the Asn residue comprising the glycosylation site on the protein.
  • N-glycans differ with respect to the number of branches (antennae) comprising peripheral sugars (e.g., GlcNAc, galactose, fucose and sialic acid) that are added to the Man 3 GlcNAc 2 (“Man3”) core structure which is also referred to as the “trimannose core”, the “pentasaccharide core” or the “paucimannose core”.
  • branches comprising peripheral sugars (e.g., GlcNAc, galactose, fucose and sialic acid) that are added to the Man 3 GlcNAc 2 (“Man3”) core structure which is also referred to as the “trimannose core”, the “pentasaccharide core” or the “paucimannose core”.
  • Man3 Man 3 GlcNAc 2
  • N-glycans are classified according to their branched constituents (e.g., high mannose, complex or hybrid).
  • a “complex” type N-glycan typically has at least one GlcNAc attached to the 1,3 mannose arm and at least one GlcNAc attached to the 1,6 mannose arm of a “trimannose” core.
  • Complex N-glycans may also have galactose (“Gal”) or N-acetylgalactosamine (“GalNAc”) residues that are optionally modified with sialic acid or derivatives (e.g., “NANA” or “NeuAc”, where “Neu” refers to neuraminic acid and “Ac” refers to acetyl).
  • Complex N-glycans may also have intrachain substitutions comprising “bisecting” GlcNAc and core fucose (“Fuc”).
  • Complex N-glycans may also have multiple antennae on the “trimannose core,” often referred to as “multiple antennary glycans.”
  • a “hybrid” N-glycan has at least one GlcNAc on the terminal of the 1,3 mannose arm of the trimannose core and zero or more mannoses on the 1,6 mannose arm of the trimannose core.
  • the various N-glycans are also referred to as “glycoforms.”
  • G-2 refers to an N-glycan structure that can be characterized as Man 3 GlcNAc 2
  • G-1 refers to an N-glycan structure that can be characterized as GlcNAcMan 3 GlcNAc 2
  • G0 refers to an N-glycan structure that can be characterized as GlcNAc 2 Man 3 GlcNAc 2
  • G1 refers to an N-glycan structure that can be characterized as GalGlcNAc 2 Man 3 GlcNAc 2
  • G2 refers to an N-glycan structure that can be characterized as Gal 2 GlcNAc 2 Man 3 GlcNAc 2
  • A1 refers to an N-glycan structure that can be characterized as NANAG
  • the terms G-2′′, “G-1”, “G0”, “G1”, “G2”, “A1”, and “A2” refer to N-glycan species that lack fucose attached to the GlcNAc residue at the reducing end of the N-glycan.
  • the term includes an “F”
  • the “F” indicates that the N-glycan species contains a fucose residue on the GlcNAc residue at the reducing end of the N-glycan.
  • G0F, G1F, G2F, A1F, and A2F all indicate that the N-glycan further includes a fucose residue attached to the GlcNAc residue at the reducing end of the N-glycan.
  • Lower eukaryotes such as yeast and filamentous fungi do not normally produce N-glycans that produce fucose.
  • multiantennary N-glycan refers to N-glycans that further comprise a GlcNAc residue on the mannose residue comprising the non-reducing end of the 1,6 arm or the 1,3 arm of the N-glycan or a GlcNAc residue on each of the mannose residues comprising the non-reducing end of the 1,6 arm and the 1,3 arm of the N-glycan.
  • multiantennary N-glycans can be characterized by the formulas GlcNAc (2-4) Man 3 GlcNAc 2 , Gal (1-4) GlcNAc (2-4) Man 3 GlcNAc 2 , or NANA (1-4) Gal (1-4) GlcNAc (2-4) Man3GlcNAc 2 .
  • the term “1-4” refers to 1, 2, 3, or 4 residues.
  • bisected N-glycan refers to N-glycans in which a GlcNAc residue is linked to the mannose residue at the reducing end of the N-glycan.
  • a bisected N-glycan can be characterized by the formula GlcNAc 3 Man 3 GlcNAc 2 wherein each mannose residue is linked at its non-reducing end to a GlcNAc residue.
  • a multiantennary N-glycan is characterized as GlcNAc 3 Man 3 GlcNAc 2
  • the formula indicates that two GlcNAc residues are linked to the mannose residue at the non-reducing end of one of the two arms of the N-glycans and one GlcNAc residue is linked to the mannose residue at the non-reducing end of the other arm of the N-glycan.
  • the antibodies and antigen-binding fragments thereof disclosed herein may further contain one or more glycosylation sites in either the light or heavy chain immunoglobulin variable region. Such glycosylation sites may result in increased immunogenicity of the antibody or fragment or an alteration of the pK of the antibody due to altered antigen-binding (Marshall et al.
  • Each antibody or antigen-binding fragment (e.g., 14A6, 28H5, 31C6 or humanized versions thereof) will have a unique isoelectric point (pI), which generally falls in the pH range between 6 and 9.5.
  • the pI for an IgG1 antibody typically falls within the pH range of 7-9.5 and the pI for an IgG4 antibody typically falls within the pH range of 6-8.
  • Each antibody or antigen-binding fragment (e.g., 14A6, 28H5, 31C6 or humanized versions thereof) will have a characteristic melting temperature, with a higher melting temperature indicating greater overall stability in vivo (Krishnamurthy R and Manning M C (2002) Curr Pharm Biotechnol 3:361-71).
  • the T M1 (the temperature of initial unfolding) may be greater than 60° C., greater than 65° C., or greater than 70° C.
  • the melting point of an antibody or fragment can be measured using differential scanning calorimetry (Chen et at (2003) Pharm Res 20:1952-60; Ghirlando et at (1999) Immunol Lett 68:47-52) or circular dichroism (Murray et al. (2002) J. Chromatogr Sci 40:343-9).
  • antibodies and antigen-binding fragments thereof are selected that do not degrade rapidly.
  • Degradation of an antibody or fragment can be measured using capillary electrophoresis (CE) and MALDI-MS (Alexander A J and Hughes D E (1995) Anal Chem 67:3626-32).
  • antibodies e.g., 14A6, 28H5, 31C6 and humanized versions thereof
  • antigen-binding fragments thereof are selected that have minimal aggregation effects, which can lead to the triggering of an unwanted immune response and/or altered or unfavorable pharmacokinetic properties.
  • antibodies and fragments are acceptable with aggregation of 25% or less, 20% or less, 15% or less, 10% or less, or 5% or less. Aggregation can be measured by several techniques, including size-exclusion column (SEC), high performance liquid chromatography (HPLC), and light scattering.
  • the anti-TIGIT antibodies and antigen-binding fragments thereof disclosed herein may also be conjugated to a chemical moiety.
  • the chemical moiety may be, inter alia, a polymer, a radionuclide or a cytotoxic factor.
  • the chemical moiety is a polymer which increases the half-life of the antibody or fragment in the body of a subject.
  • Suitable polymers include, but are not limited to, hydrophilic polymers which include but are not limited to polyethylene glycol (PEG) (e.g., PEG with a molecular weight of 2 kDa, 5 kDa, 10 kDa, 12 kDa, 20 kDa, 30 kDa or 40 kDa), dextran and monomethoxypolyethylene glycol (mPEG).
  • PEG polyethylene glycol
  • mPEG monomethoxypolyethylene glycol
  • the antibodies and antigen-binding fragments thereof disclosed herein may also be conjugated with labels such as 99 Tc, 90 Y, 111 In, 32 P, 14 C, 125 I, 3 H, 131 I, 11 C, 15 O, 13 N, 18 F, 35 S, 51 Cr, 57 To, 226 Ra, 60 Co, 59 Fe, 57 Se, 152 Eu, 67 CU, 217 Ci, 211 At, 212 Pb, 47 Sc, 109 Pd, 234 Th, and 40 K, 157 Gd, 55 Mn, 52 Tr, and 56 Fe.
  • labels such as 99 Tc, 90 Y, 111 In, 32 P, 14 C, 125 I, 3 H, 131 I, 11 C, 15 O, 13 N, 18 F, 35 S, 51 Cr, 57 To, 226 Ra, 60 Co, 59 Fe, 57 Se, 152 Eu, 67 CU, 217 Ci, 211 At, 212 Pb, 47 Sc, 109 Pd, 234 Th, and 40 K, 157
  • the antibodies and antigen-binding fragments disclosed herein may also be PEGylated, for example to increase its biological (e.g., serum) half-life.
  • PEG polyethylene glycol
  • the antibody or fragment typically is reacted with a reactive form of polyethylene glycol (PEG), such as a reactive ester or aldehyde derivative of PEG, under conditions in which one or more PEG groups become attached to the antibody or antibody fragment.
  • PEG polyethylene glycol
  • the PEGylation is carried out via an acylation reaction or an alkylation reaction with a reactive PEG molecule (or an analogous reactive water-soluble polymer).
  • polyethylene glycol is intended to encompass any of the forms of PEG that have been used to derivatize other proteins, such as mono (C1-C10) alkoxy- or aryloxy-polyethylene glycol or polyethylene glycol-maleimide.
  • the antibody or fragment to be PEGylated is an aglycosylated antibody or fragment. Methods for PEGylating proteins are known in the art and can be applied to the antibodies of the invention. See, e.g., EP 0 154 316 and EP 0 401 384.
  • the antibodies and antigen-binding fragments disclosed herein may also be conjugated with fluorescent or chemilluminescent labels, including fluorophores such as rare earth chelates, fluorescein and its derivatives, rhodamine and its derivatives, isothiocyanate, phycoerythrin, phycocyanin, allophycocyanin, o-phthaladehyde, fluorescamine, 152 Eu, dansyl, umbelliferone, luciferin, luminal label, isoluminal label, an aromatic acridinium ester label, an imidazole label, an acridimium salt label, an oxalate ester label, an aequorin label, 2,3-dihydrophthalazinediones, biotin/avidin, spin labels and stable free radicals.
  • fluorophores such as rare earth chelates, fluorescein and its derivatives, rhodamine and its derivatives, isothiocyanate,
  • the antibodies and antigen-binding fragments thereof of the invention may also be conjugated to a cytotoxic factor such as diptheria toxin, Pseudomonas aeruginosa exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins and compounds (e.g., fatty acids), dianthin proteins, Phytoiacca americana proteins PAPI, PAPII, and PAP-S, momordica charantia inhibitor, curcin, crotin, saponaria officinalis inhibitor, mitogellin, restrictocin, phenomycin, and enomycin.
  • a cytotoxic factor such as diptheria toxin, Pseudomonas aeruginosa exotoxin A chain, ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins and compounds (
  • any method known in the art for conjugating the antibodies and antigen-binding fragments thereof of the invention e.g., 14A6, 28H5, 31C6 and humanized versions thereof
  • conjugating the antibodies and antigen-binding fragments thereof of the invention e.g., 14A6, 28H5, 31C6 and humanized versions thereof
  • Methods for conjugating antibodies and fragments are conventional and very well known in the art.
  • the isolated antibodies or antigen-binding fragments thereof disclosed herein e.g., 14A6, 28H5, 31C6 and humanized versions thereof.
  • such subject suffers from an infection or an infectious disease.
  • such subject suffers from cancer.
  • the cancer is a solid tumor which is infiltrated by tumor-infiltrating lymphocytes which express TIGIT.
  • the cancer is, e.g., osteosarcoma, rhabdomyosarcoma, neuroblastoma, kidney cancer, leukemia, renal transitional cell cancer, bladder cancer, Wilm's cancer, ovarian cancer, pancreatic cancer, breast cancer, prostate cancer, bone cancer, lung cancer (e.g., non-small cell lung cancer), gastric cancer, colorectal cancer, cervical cancer, synovial sarcoma, head and neck cancer, squamous cell carcinoma, multiple myeloma, renal cell cancer, retinoblastoma, hepatoblastoma, hepatocellular carcinoma, melanoma, rhabdoid tumor of the kidney, Ewing's sarcoma, chondrosarcoma, brain cancer, glioblastoma, meningioma, pituitary adenoma, vestibular schwannoma, a primitive neuroectodermal tumor, medulloblastoma,
  • the invention provides methods for treating subjects using an anti-TIGIT antibody or antigen-binding fragment thereof of the invention (e.g., 14A6, 28H5, 31C6 and humanized versions thereof), wherein the subject suffers from a viral infection.
  • the viral infection is infection with a virus selected from the group consisting of human immunodeficiency virus (HIV), hepatitis virus (A, B, or C), herpes virus (e.g., VZV, HSV-I, HAV-6, HSV-II, and CMV, Epstein Barr virus), adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, coronavirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papillomavirus, molluscum virus, poliovirus, rabies virus, JC virus or ar
  • the invention provides methods for treating subjects using an anti-TIGIT antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a bacterial infection.
  • the bacterial infection is infection with a bacteria selected from the group consisting of Chlamydia , rickettsial bacteria, mycobacteria, staphylococci, streptococci, pneumonococci, meningococci and gonococci, klebsiella, proteus, serratia, pseudomonas, Legionella, Corynebacterium diphtheriae, Salmonella , bacilli, Vibrio cholerae, Clostridium tetan, Clostridium botulinum, Bacillus anthricis, Yersinia pestis, Mycobacterium leprae, Mycobacterium lepromatosis , and Borriella.
  • the invention provides methods for treating subjects using an anti-TIGIT antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a fungal infection.
  • the fungal infection is infection with a fungus selected from the group consisting of Candida ( albicans, krusei, glabrata, tropicalis , etc.), Cryptococcus neoformans, Aspergillus ( fumigatus, niger , etc.), Genus Mucorales ( mucor, absidia, rhizopus ), Sporothrix schenkii, Blastomyces dermatitidis, Paracoccidioides brasiliensis, Coccidioides immitis and Histoplasma capsulatum.
  • Candida albicans, krusei, glabrata, tropicalis , etc.
  • Cryptococcus neoformans Aspergillus ( fumigatus, niger , etc.)
  • Genus Mucorales mucor, absidia
  • the invention provides methods for treating subjects using an anti-TIGIT antibody or antigen-binding fragment thereof of the invention, wherein the subject suffers from a parasitic infection.
  • the parasitic infection is infection with a parasite selected from the group consisting of Entamoeba histolytica, Balantidium coli, Naegleria fowleri, Acanthamoeba, Giardia lambia, Cryptosporidium, Pneumocystis carinii, Plasmodium vivax, Babesia microti, Trypanosoma brucei, Trypanosoma cruzi, Leishmania donovani, Toxoplasma gondii and Nippostrongylus brasiliensis.
  • the present invention provides a method for preventing or inhibiting TIGIT binding to MHC class II, enhancing antigen-specific T-cell activation or stimulating T-cell production of interleukin-2 in a subject (e.g., human), for example, wherein the subject suffers from cancer or infectious disease (e.g., as discussed herein) comprising administering an effective amount of anti-TIGIT antibody or antigen-binding fragment thereof (e.g., 14A6, 28A5, 31C6 and humanized versions thereof), optionally in association with a further chemotherapeutic agent.
  • a subject e.g., human
  • an effective amount of anti-TIGIT antibody or antigen-binding fragment thereof e.g., 14A6, 28A5, 31C6 and humanized versions thereof
  • a “subject” may be a mammal such as a human, dog, cat, horse, cow, mouse, rat, monkey (e.g., cynomolgous monkey, e.g., Macaca fascicularis ) or rabbit.
  • the subject is a human subject.
  • the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with other, further therapeutic agents and/or therapeutic procedures, for treating or preventing any disease such as cancer, e.g., as discussed herein, in a subject in need of such treatment or prevention.
  • Compositions e.g., pharmaceutical compositions comprising a pharmaceutically acceptable carrier, comprising such antibodies and fragments in association with further therapeutic agents are also part of the present invention.
  • the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with tumor vaccines.
  • the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with chemotherapeutic agents.
  • the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with radiation therapy.
  • the antibodies or antigen-binding fragments thereof disclosed herein may be used alone, or in association with targeted therapies.
  • targeted therapies include: hormone therapies, signal transduction inhibitors (e.g., EGFR inhibitors, such as cetuximab (Erbitux) and erlotinib (Tarceva)); HER2 inhibitors (e.g., trastuzumab (Herceptin) and pertuzumab (Perjeta)); BCR-ABL inhibitors (such as imatinib (Gleevec) and dasatinib (Sprycel)); ALK inhibitors (such as crizotinib (Xalkori) and ceritinib (Zykadia)); BRAF inhibitors (such as vemurafenib (Zelboraf) and dabrafenib (Tafinlar)), gene expression modulators, apoptosis induce
  • hormone therapies e.g., signal transduction inhibitors (e.g., EGFR inhibitor
  • the anti-TIGIT antibodies or antigen-binding fragments thereof of the invention may be used in combination with an anti-cancer therapeutic agent or immunomodulatory drug such as an immunomodulatory receptor inhibitor, e.g., an antibody or antigen-binding fragment thereof that specifically binds to the receptor.
  • an anti-cancer therapeutic agent or immunomodulatory drug such as an immunomodulatory receptor inhibitor, e.g., an antibody or antigen-binding fragment thereof that specifically binds to the receptor.
  • the present invention includes compositions comprising an anti-TIGIT antibody or antigen-binding fragment thereof of the present invention (e.g., 14A6, 28H5, 31C6 and humanized versions thereof) in association with pembrolizumab; as well as methods for treating or preventing cancer in a subject comprising administering an effective amount of the anti-TIGIT antibody or antigen-binding fragment thereof and pembrolizumab to the subject.
  • the subject is also administered a further therapeutic agent.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the present invention is in association with an isolated antibody comprising an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:33 and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:34.
  • SEQ ID NOs: 33 and 34 encode the heavy and light chain of pembrolizumab.
  • an anti-TIGIT antibody) or antigen-binding fragment thereof of the present invention is in association with an isolated antibody comprising an immunoglobulin heavy chain comprising the amino acid sequence of SEQ ID NO:35 and an immunoglobulin light chain comprising the amino acid sequence of SEQ ID NO:36.
  • SEQ ID NOs: 35 and 36 encode the heavy and light chain of nivolumab.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention is in association with one or more of: anti-PD1 antibody (e.g., pembrolizumab, nivolumab, pidilizumab (CT-011)), anti-PDLL antibody, anti-CTLA4 antibody, anti-CS1 antibody (e.g., elotuzumab), anti-KIR2DL1/2/3 antibody (e.g., lirilumab), anti-CD137 antibody (e.g., urelumab), anti-GITR antibody (e.g., TRX518), anti-PD-L1 antibody (e.g., BMS-936559, MSB0010718C or MPDL3280A), anti-PD-L2 antibody, anti-ILT1 antibody, anti-ILT2 antibody, anti-ILT3 antibody, anti-ILT4 antibody, anti-ILT5
  • anti-PD1 antibody e.g., pembrolizumab, nivolumab
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-PD1 antibody e.g., 14A6, 28H5, 31C6 or humanized versions thereof.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention is in association with an anti-PDLL antibody (e.g., BMS-936559, MSB0010718C or MPDL3280A).
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-CTLA4 antibody is in association with an anti-CTLA4 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-CS1 antibody is in association with an anti-CS1 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-KIR2DL1/2/3 antibody is in association with an anti-KIR2DL1/2/3 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD137 (e.g., urelumab) antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention is in association with an anti-GITR (e.g., TRX518) antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-PD-L2 antibody is in association with an anti-PD-L2 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-ITL1 antibody is in association with an anti-ITL1 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-ITL2 antibody is in association with an anti-ITL2 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-ITL3 antibody is in association with an anti-ITL3 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-ITL4 antibody is in association with an anti-ITL4 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-ITL5 antibody is in association with an anti-ITL5 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-ITL6 antibody is in association with an anti-ITL6 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-ITL7 antibody is in association with an anti-ITL7 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-ITL8 antibody is in association with an anti-ITL8 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention is in association with an anti-CD40 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-OX40 antibody is in association with an anti-OX40 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-KIR2DL1 antibody is in association with an anti-KIR2DL1 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-KIR2DL2/3 antibody is in association with an anti-KIR2DL2/3 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-KIR2DL4 antibody is in association with an anti-KIR2DL4 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-KIR2DL5A antibody is in association with an anti-KIR2DL5A antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-KIR2DL5B antibody is in association with an anti-KIR2DL5B antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-KIR3DL1 antibody is in association with an anti-KIR3DL1 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-KIR3DL2 antibody is in association with an anti-KIR3DL2 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-KIR3DL3 antibody is in association with an anti-KIR3DL3 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-NKG2A antibody is in association with an anti-NKG2A antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-NKG2C antibody is in association with an anti-NKG2C antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention is in association with an anti-ICOS antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-SIRP ⁇ antibody is in association with an anti-SIRP ⁇ antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-4-1BB antibody e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-IL-10 antibody is in association with an anti-IL-10 antibody.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-TSLP antibody e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention (e.g., 14A6, 28H5, 31C6 or humanized versions thereof) is in association with IL-10 or PEGylated IL-10.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention is in association with one or more of an inhibitor (e.g., a small organic molecule or an antibody or antigen-binding fragment thereof) such as: an MTOR (mammalian target of rapamycin) inhibitor, a cytotoxic agent, a platinum agent, an EGFR inhibitor, a VEGF inhibitor, a microtubule stabilizer, a taxane, a CD20 inhibitor, a CD52 inhibitor, a CD30 inhibitor, a RANK (Receptor activator of nuclear factor kappa-B) inhibitor, a RANKL (Receptor activator of nuclear factor kappa-B ligand) inhibitor, an ERK inhibitor, a MAP Kinase inhibitor, an AKT inhibitor, a MEK inhibitor, a PI3K inhibitor, a HER1 inhibitor, a HER1 inhibitor, a HER
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention is in association with any one or more of: 13-cis-retinoic acid, 3-[5-(methylsulfonylpiperadinemethyl)-indolyl]-quinolone, 4-hydroxytamoxifen, 5-deooxyuridine, 5′-deoxy-5-fluorouridine, 5-fluorouracil, 6-mecaptopurine, 7-hydroxystaurosporine, A-443654, abirateroneacetate, abraxane, ABT-578, acolbifene, ADS-100380, ALT-110, altretamine, amifostine, aminoglutethimide, amrubicin, Amsacrine, anagrelide, anastrozole, angiostatin, AP-23573, ARQ-197, arzoxifene, AS-252424,
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention is in association with one or more antiemetics including, but not limited to: casopitant (GlaxoSmithKline), Netupitant (MGI-Helsinn) and other NK-1 receptor antagonists, palonosetron (sold as Aloxi by MGI Pharma), aprepitant (sold as Emend by Merck and Co.; Rahway, N.J.), diphenhydramine (sold as Benadryl® by Pfizer; New York, N.Y.), hydroxyzine (sold as Atarax® by Pfizer; New York, N.Y.), metoclopramide (sold as Reglan® by AH Robins Co.; Richmond, Va.), lorazepam (sold as Ativan® by Wyeth; Madison, N.J.), alprazolam (sold as Xanax
  • casopitant GaxoSmithKline
  • MGI-Helsinn Netupitant
  • an anti-TIGIT antibody or antigen-binding fragment thereof (e.g., 14A6, 28H5, 31C6 or humanized versions thereof) is in association with an agent which treats or prevents such a deficiency, such as, e.g., filgrastim, PEG-filgrastim, erythropoietin, epoetin alfa or darbepoetin alfa.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention is administered in association with anti-cancer radiation therapy.
  • the radiation therapy is external beam therapy (EBT): a method for delivering a beam of high-energy X-rays to the location of the tumor. The beam is generated outside the patient (e.g., by a linear accelerator) and is targeted at the tumor site. These X-rays can destroy the cancer cells and careful treatment planning allows the surrounding normal tissues to be spared. No radioactive sources are placed inside the patient's body.
  • the radiation therapy is proton beam therapy: a type of conformal therapy that bombards the diseased tissue with protons instead of X-rays.
  • the radiation therapy is conformal external beam radiation therapy: a procedure that uses advanced technology to tailor the radiation therapy to an individual's body structures.
  • the radiation therapy is brachytherapy: the temporary placement of radioactive materials within the body, usually employed to give an extra dose—or boost—of radiation to an area.
  • a surgical procedure administered in association with an anti-TIGIT antibody or antigen-binding fragment thereof is surgical tumorectomy.
  • an anti-TIGIT antibody or antigen-binding fragment thereof e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • an anti-TIGIT antibody e.g., humanized antibody
  • antigen-binding fragment thereof e.g., 14A6, 28H5, 31C6 or humanized versions thereof
  • pembrolizumab e.g., a kit
  • Each component can be administered to a subject at a different time than when the other component is administered; for example, each administration may be given non-simultaneously (e.g., separately or sequentially) at several intervals over a given period of time.
  • the separate components may be administered to a subject by the same or by a different route.
  • the anti-TIGIT antibodies and antigen-binding fragments thereof disclosed herein may be used as affinity purification agents.
  • the anti-TIGIT antibodies and antigen-binding fragments thereof are immobilized on a solid phase such a Sephadex, glass or agarose resin or filter paper, using methods well known in the art.
  • the immobilized antibody or fragment is contacted with a sample containing the TIGIT protein (or a fragment thereof) to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except the TIGIT protein, which is bound to the immobilized antibody or fragment. Finally, the support is washed with a solvent which elutes the bound TIGIT (e.g., protein A).
  • a solvent which elutes the bound TIGIT e.g., protein A
  • antigens for generating secondary antibodies which are useful for example for performing Western blots and other immunoassays discussed herein.
  • polypeptides are disclosed which comprise the variable regions and/or CDR sequences of a therapeutic antibody disclosed herein (e.g., 14A6, 28H5 or 31C6) and which may be used to generate anti-idiotypic antibodies for use in specifically detecting the presence of the antibody, e.g., in a therapeutic context.
  • Anti-TIGIT antibodies e.g., humanized antibodies
  • antigen-binding fragments thereof may also be useful in diagnostic assays for TIGIT protein, e.g., detecting its expression in specific cells, tissues, or serum, e.g., tumor cells such as melanoma cells. Such diagnostic methods may be useful in various disease diagnoses.
  • the present invention includes ELISA assays (enzyme-linked immunosorbent assay) incorporating the use of an anti-TIGIT antibody or antigen-binding fragment thereof disclosed herein (e.g., 14A6 or a humanized version thereof).
  • such a method comprises the following steps:
  • a substrate e.g., surface of a microtiter plate well, e.g., a plastic plate
  • anti-TIGIT antibody or antigen-binding fragment thereof e.g., a sample to be tested for the presence of TIGIT to the substrate
  • a sample to be tested for the presence of TIGIT to the substrate
  • wash the plate so that unbound material in the sample is removed
  • detectably labeled antibodies e.g., enzyme-linked antibodies
  • wash the substrate so that the unbound, labeled antibodies are removed
  • the labeled antibodies are enzyme linked, apply a chemical which is converted by the enzyme into a fluorescent signal
  • detect the presence of the labeled antibody e.g., enzyme-linked antibodies
  • Detection of the label associated with the substrate indicates the presence of the TIGIT protein.
  • the labeled antibody or antigen-binding fragment thereof is labeled with peroxidase which react with ABTS (e.g., 2,2′-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)) or 3,3′,5,5′-Tetramethylbenzidine to produce a color change which is detectable.
  • ABTS e.g., 2,2′-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)
  • 3,3′,5,5′-Tetramethylbenzidine e.g., 2,2′-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)
  • 3,3′,5,5′-Tetramethylbenzidine e.g., 2,2′-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid)
  • 3,3′,5,5′-Tetramethylbenzidine e.g., 2,2′-azino
  • An anti-TIGIT antibody or antigen-binding fragment thereof of the invention may be used in a Western blot or immune-protein blot procedure.
  • Such a procedure forms part of the present invention and includes e.g.:
  • TIGIT e.g., from a PAGE or SDS-PAGE electrophoretic separation of the proteins in the sample
  • a membrane or other solid substrate using a method known in the art (e.g., semi-dry blotting or tank blotting); contacting the membrane or other solid substrate to be tested for the presence of bound TIGIT or a fragment thereof with an anti-TIGIT antibody or antigen-binding fragment thereof of the invention.
  • Such a membrane may take the form of a nitrocellulose or vinyl-based (e.g., polyvinylidene fluoride (PVDF)) membrane to which the proteins to be tested for the presence of TIGIT in a non-denaturing PAGE (polyacrylamide gel electrophoresis) gel or SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) gel have been transferred (e.g., following electrophoretic separation in the gel).
  • PVDF polyvinylidene fluoride
  • the membrane Before contacting the membrane with the anti-TIGIT antibody or fragment, the membrane is optionally blocked, e.g., with non-fat dry milk or the like so as to bind non-specific protein binding sites on the membrane.
  • Detection of the bound antibody or fragment indicates that the TIGIT protein is present on the membrane or substrate and in the sample. Detection of the bound antibody or fragment may be by binding the antibody or fragment with a secondary antibody (an anti-immunoglobulin antibody) which is detectably labeled and, then, detecting the presence of the secondary antibody.
  • a secondary antibody an anti-immunoglobulin antibody
  • anti-TIGIT antibodies and antigen-binding fragments thereof disclosed herein may also be used for immunohistochemistry.
  • Such a method forms part of the present invention and comprises, e.g.,
  • a cell e.g., a tumor cell such as a melanoma cell
  • TIGIT protein an anti-TIGIT antibody or antigen-binding fragment thereof of the invention
  • the antibody or fragment itself is detectably labeled, it can be detected directly. Alternatively, the antibody or fragment may be bound by a detectably labeled secondary antibody which is detected.
  • Certain anti-TIGIT antibodies and antigen-binding fragments thereof disclosed herein may also be used for in vivo tumor imaging.
  • Such a method may include injection of a radiolabeled anti-TIGIT antibody or antigen-binding fragment thereof into the body of a patient to be tested for the presence of a tumor associated with TIGIT expression (e.g., which expresses TIGIT, for example, on the tumor cell surface) followed by nuclear imaging of the body of the patient to detect the presence of the labeled antibody or fragment e.g., at loci comprising a high concentration of the antibody or fragment which are bound to the tumor. The detection of the loci indicates the presence of the TIGIT + tumor and tumor cells.
  • Imaging techniques include SPECT imaging (single photon emission computed tomography) or PET imaging (positron emission tomography).
  • Labels include e.g., iodine-123 ( 123 I) and technetium-99m ( 99m Tc), e.g., in conjunction with SPECT imaging or 11 C, 13 N, 15 O or 18 F, e.g., in conjunction with PET imaging or Indium-111 (See e.g., Gordon et al., (2005) International Rev. Neurobiol. 67:385-440).
  • compositions of the anti-TIGIT antibodies and antigen-binding fragments of the invention e.g., 14A6, 28H5, 31C6 and humanized versions thereof
  • the antibody or antigen-binding fragment thereof is admixed with a pharmaceutically acceptable carrier or excipient.
  • a pharmaceutically acceptable carrier or excipient See, e.g., Remington's Pharmaceutical Sciences and U.S. Pharmacopeia: National Formulary , Mack Publishing Company, Easton, Pa. (1984).
  • Formulations of therapeutic and diagnostic agents may be prepared by mixing with acceptable carriers, excipients, or stabilizers in the form of, e.g., lyophilized powders, slurries, aqueous solutions or suspensions (see, e.g., Hardman, et al. (2001) Goodman and Gilman's The Pharmacological Basis of Therapeutics , McGraw-Hill, New York, N.Y.; Gennaro (2000) Remington: The Science and Practice of Pharmacy , Lippincott, Williams, and Wilkins, New York, N.Y.; Avis, et al.
  • Toxicity and therapeutic efficacy of the antibodies of the invention, administered alone or in combination with another therapeutic agent can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for determining the LD 50 (the dose lethal to 50% of the population) and the ED 50 (the dose therapeutically effective in 50% of the population).
  • the dose ratio between toxic and therapeutic effects is the therapeutic index (LD 50 /ED 50 ).
  • the data obtained from these cell culture assays and animal studies can be used in formulating a range of dosage for use in human.
  • the dosage of such compounds lies preferably within a range of circulating concentrations that include the ED 50 with little or no toxicity.
  • the dosage may vary within this range depending upon the dosage form employed and the route of administration.
  • a further therapeutic agent that is administered to a subject in association with an anti-TIGIT antibody or antigen-binding fragment thereof of the invention (e.g., 14A6, 28H5, 31C6) in accordance with the Physicians' Desk Reference 2003 (Thomson Healthcare; 57th edition (Nov. 1, 2002)).
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., 14A6, 28H5, 31C6
  • the mode of administration can vary. Routes of administration include oral, rectal, transmucosal, intestinal, parenteral; intramuscular, subcutaneous, intradermal, intramedullary, intrathecal, direct intraventricular, intravenous, intraperitoneal, intranasal, intraocular, inhalation, insufflation, topical, cutaneous, transdermal, or intra-arterial.
  • the anti-TIGIT antibodies or antigen-binding fragments thereof of the invention can be administered by an invasive route such as by injection.
  • an anti-TIGIT antibody or antigen-binding fragment thereof, or pharmaceutical composition thereof is administered intravenously, subcutaneously, intramuscularly, intraarterially, intratumorally, or by inhalation, aerosol delivery.
  • Administration by non-invasive routes e.g., orally; for example, in a pill, capsule or tablet) is also within the scope of the present invention.
  • the present invention provides a vessel (e.g., a plastic or glass vial, e.g., with a cap or a chromatography column, hollow bore needle or a syringe cylinder) comprising any of the antibodies or antigen-binding fragments of the invention (e.g., 14A6, 28H5, 31C6 and humanized versions thereof) or a pharmaceutical composition thereof.
  • a vessel e.g., a plastic or glass vial, e.g., with a cap or a chromatography column, hollow bore needle or a syringe cylinder
  • an injection device comprising any of the antibodies or antigen-binding fragments of the invention (e.g., 14A6, 28H5, 31C6 and humanized versions thereof) or a pharmaceutical composition thereof.
  • An injection device is a device that introduces a substance into the body of a patient via a parenteral route, e.g., intramuscular, subcutaneous or intravenous.
  • an injection device may be a syringe (e.g., pre-filled with the pharmaceutical composition, such as an auto-injector) which, for example, includes a cylinder or barrel for holding fluid to be injected (e.g., antibody or fragment or a pharmaceutical composition thereof), a needle for piecing skin and/or blood vessels for injection of the fluid; and a plunger for pushing the fluid out of the cylinder and through the needle bore.
  • an injection device that comprises an antibody or antigen-binding fragment thereof of the present invention or a pharmaceutical composition thereof is an intravenous (IV) injection device.
  • IV intravenous
  • a device includes the antibody or fragment or a pharmaceutical composition thereof in a cannula or trocar/needle which may be attached to a tube which may be attached to a bag or reservoir for holding fluid (e.g., saline; or lactated ringer solution comprising NaCl, sodium lactate, KCl, CaCl 2 and optionally including glucose) introduced into the body of the patient through the cannula or trocar/needle.
  • fluid e.g., saline; or lactated ringer solution comprising NaCl, sodium lactate, KCl, CaCl 2 and optionally including glucose
  • the antibody or fragment or a pharmaceutical composition thereof may, in an embodiment of the invention, be introduced into the device once the trocar and cannula are inserted into the vein of a subject and the trocar is removed from the inserted cannula.
  • the IV device may, for example, be inserted into a peripheral vein (e.g., in the hand or arm); the superior vena cava or inferior vena cava, or within the right atrium of the heart (e.g., a central IV); or into a subclavian, internal jugular, or a femoral vein and, for example, advanced toward the heart until it reaches the superior vena cava or right atrium (e.g., a central venous line).
  • an injection device is an autoinjector; a jet injector or an external infusion pump.
  • a jet injector uses a high-pressure narrow jet of liquid which penetrate the epidermis to introduce the antibody or fragment or a pharmaceutical composition thereof to a patient's body.
  • External infusion pumps are medical devices that deliver the antibody or fragment or a pharmaceutical composition thereof into a patient's body in controlled amounts. External infusion pumps may be powered electrically or mechanically.
  • Different pumps operate in different ways, for example, a syringe pump holds fluid in the reservoir of a syringe, and a moveable piston controls fluid delivery, an elastomeric pump holds fluid in a stretchable balloon reservoir, and pressure from the elastic walls of the balloon drives fluid delivery.
  • a peristaltic pump a set of rollers pinches down on a length of flexible tubing, pushing fluid forward.
  • fluids can be delivered from multiple reservoirs at multiple rates.
  • the pharmaceutical compositions disclosed herein may also be administered with a needleless hypodermic injection device; such as the devices disclosed in U.S. Pat. Nos. 6,620,135; 6,096,002; 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824 or 4,596,556.
  • a needleless hypodermic injection device such as the devices disclosed in U.S. Pat. Nos. 6,620,135; 6,096,002; 5,399,163; 5,383,851; 5,312,335; 5,064,413; 4,941,880; 4,790,824 or 4,596,556.
  • Such needleless devices comprising the pharmaceutical composition are also part of the present invention.
  • the pharmaceutical compositions disclosed herein may also be administered by infusion. Examples of well-known implants and modules for administering the pharmaceutical compositions include those disclosed in: U.S. Pat. No. 4,487,603, which discloses an implantable micro
  • a tumor e.g., a TIGIT + tumor.
  • a targeted drug delivery system for example, in a liposome coated with a tissue-specific antibody, targeting, for example, a tumor e.g., a TIGIT + tumor, e.g., characterized by immunopathology.
  • the liposomes will be targeted to and taken up selectively by the afflicted tissue.
  • Such methods and liposomes are part of the present invention.
  • the administration regimen depends on several factors, including the serum or tissue turnover rate of the therapeutic antibody or antigen-binding fragment, the level of symptoms, the immunogenicity of the therapeutic antibody, and the accessibility of the target cells in the biological matrix.
  • the administration regimen delivers sufficient therapeutic antibody or fragment to effect improvement in the target disease state, while simultaneously minimizing undesired side effects.
  • the amount of biologic delivered depends in part on the particular therapeutic antibody and the severity of the condition being treated. Guidance in selecting appropriate doses of therapeutic antibodies or fragments is available (see, e.g., Wawrzynczak (1996) Antibody Therapy , Bios Scientific Pub.
  • Determination of the appropriate dose is made by the clinician, e.g., using parameters or factors known or suspected in the art to affect treatment. Generally, the dose begins with an amount somewhat less than the optimum dose and it is increased by small increments thereafter until the desired or optimum effect is achieved relative to any negative side effects.
  • Important diagnostic measures include those of symptoms of, e.g., the inflammation or level of inflammatory cytokines produced.
  • a biologic that will be used is derived from the same species as the animal targeted for treatment, thereby minimizing any immune response to the reagent.
  • humanized and fully human antibodies are may be desirable.
  • Antibodies or antigen-binding fragments thereof disclosed herein may be provided by continuous infusion, or by doses administered, e.g., daily, 1-7 times per week, weekly, bi-weekly, monthly, bimonthly, quarterly, semiannually, annually etc.
  • Doses may be provided, e.g., intravenously, subcutaneously, topically, orally, nasally, rectally, intramuscular, intracerebrally, intraspinally, or by inhalation.
  • a total weekly dose is generally at least 0.05 ⁇ g/kg body weight, more generally at least 0.2 ⁇ g/kg, 0.5 ⁇ g/kg, 1 ⁇ g/kg, 10 ⁇ g/kg, 100 ⁇ g/kg, 0.25 mg/kg, 1.0 mg/kg, 2.0 mg/kg, 5.0 mg/ml, 10 mg/kg, 25 mg/kg, 50 mg/kg or more (see, e.g., Yang, et al. (2003) New Engl. J. Med. 349:427-434; Herold, et al. (2002) New Engl. J. Med. 346:1692-1698; Liu, et al. (1999) J. Neurol. Neurosurg. Psych.
  • An anti-TIGIT antibody of the present invention is administered, e.g., subcutaneously or intravenously, on a weekly, biweekly, “every 4 weeks,” monthly, bimonthly, or quarterly basis at 10, 20, 50, 80, 100, 200, 500, 1000 or 2500 mg/subject.
  • the term “effective amount” refer to an amount of an anti-TIGIT or antigen-binding fragment thereof of the invention (e.g., humanized 14A6 or humanized 28H5) that, when administered alone or in combination with an additional therapeutic agent to a cell, tissue, or subject, is effective to cause a measurable improvement in one or more symptoms of disease, for example cancer or the progression of cancer.
  • An effective dose further refers to that amount of the antibody or fragment sufficient to result in at least partial amelioration of symptoms, e.g., tumor shrinkage or elimination, lack of tumor growth, increased survival time. When applied to an individual active ingredient administered alone, an effective dose refers to that ingredient alone.
  • an effective dose refers to combined amounts of the active ingredients that result in the therapeutic effect, whether administered in combination, serially or simultaneously.
  • An effective amount of a therapeutic will result in an improvement of a diagnostic measure or parameter by at least 10%; usually by at least 20%; preferably at least about 30%; more preferably at least 40%, and most preferably by at least 50%.
  • An effective amount can also result in an improvement in a subjective measure in cases where subjective measures are used to assess disease severity.
  • kits comprising one or more components that include, but are not limited to, an anti-TIGIT antibody or antigen-binding fragment, as discussed herein (e.g., humanized 14A6 or humanized 28H5 or humanized 31C6) in association with one or more additional components including, but not limited to a pharmaceutically acceptable carrier and/or a therapeutic agent, as discussed herein.
  • an anti-TIGIT antibody or antigen-binding fragment as discussed herein (e.g., humanized 14A6 or humanized 28H5 or humanized 31C6) in association with one or more additional components including, but not limited to a pharmaceutically acceptable carrier and/or a therapeutic agent, as discussed herein.
  • the antibody or fragment and/or the therapeutic agent can be formulated as a pure composition or in combination with a pharmaceutically acceptable carrier, in a pharmaceutical composition.
  • the kit includes an anti-TIGIT antibody or antigen-binding fragment thereof of the invention (e.g., humanized 14A6 or humanized 28H5 or humanized 31C6) or a pharmaceutical composition thereof in one container (e.g., in a sterile glass or plastic vial) and a pharmaceutical composition thereof and/or a therapeutic agent in another container (e.g., in a sterile glass or plastic vial).
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., humanized 14A6 or humanized 28H5 or humanized 31C6
  • a pharmaceutical composition thereof in one container e.g., in a sterile glass or plastic vial
  • a pharmaceutical composition thereof and/or a therapeutic agent e.g., in a sterile glass or plastic vial
  • the kit comprises a combination of the invention, including an anti-TIGIT antibody or antigen-binding fragment thereof of the invention (e.g., humanized 14A6 or humanized 28H5 or humanized 31C6) along with a pharmaceutically acceptable carrier, optionally in combination with one or more therapeutic agents formulated together, optionally, in a pharmaceutical composition, in a single, common container.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention e.g., humanized 14A6 or humanized 28H5 or humanized 31C6
  • a pharmaceutically acceptable carrier optionally in combination with one or more therapeutic agents formulated together, optionally, in a pharmaceutical composition, in a single, common container.
  • the kit can include a device for performing such administration.
  • the kit can include one or more hypodermic needles or other injection devices as discussed above.
  • the kit can include a package insert including information concerning the pharmaceutical compositions and dosage forms in the kit.
  • information concerning the pharmaceutical compositions and dosage forms in the kit aids patients and physicians in using the enclosed pharmaceutical compositions and dosage forms effectively and safely.
  • the following information regarding a combination of the invention may be supplied in the insert: pharmacokinetics, pharmacodynamics, clinical studies, efficacy parameters, indications and usage, contraindications, warnings, precautions, adverse reactions, overdosage, proper dosage and administration, how supplied, proper storage conditions, references, manufacturer/distributor information and patent information.
  • an anti-TIGIT antibody or antigen-binding fragment thereof of the invention can be provided in a kit, i.e., a packaged combination of reagents in predetermined amounts with instructions for performing the diagnostic or detection assay.
  • the kit will include substrates and cofactors required by the enzyme (e.g., a substrate precursor which provides the detectable chromophore or fluorophore).
  • substrates and cofactors required by the enzyme e.g., a substrate precursor which provides the detectable chromophore or fluorophore.
  • other additives may be included such as stabilizers, buffers (e.g., a block buffer or lysis buffer) and the like.
  • the relative amounts of the various reagents may be varied widely to provide for concentrations in solution of the reagents which substantially optimize the sensitivity of the assay.
  • the reagents may be provided as dry powders, usually lyophilized, including excipients which on dissolution will provide a reagent solution having the appropriate concentration.
  • kits comprising one or more such reagents for use in a variety of detection assays, including for example, immunoassays such as ELISA (sandwich-type or competitive format).
  • the kit's components may be pre-attached to a solid support, or may be applied to the surface of a solid support when the kit is used.
  • the signal generating means may come pre-associated with an antibody or fragment of the invention or may require combination with one or more components, e.g., buffers, antibody-enzyme conjugates, enzyme substrates, or the like, prior to use.
  • Kits may also include additional reagents, e.g., blocking reagents for reducing nonspecific binding to the solid phase surface, washing reagents, enzyme substrates, and the like.
  • the solid phase surface may be in the form of a tube, a bead, a microtiter plate, a microsphere, or other materials suitable for immobilizing proteins, peptides, or polypeptides.
  • an enzyme that catalyzes the formation of a chemilluminescent or chromogenic product or the reduction of a chemilluminescent or chromogenic substrate is a component of the signal generating means. Such enzymes are well known in the art.
  • Kits may comprise any of the capture agents and detection reagents described herein.
  • the kit may also comprise instructions for carrying out the methods of the invention.
  • kits comprising an anti-TIGIT antibody (e.g., humanized antibody) or antigen-binding fragment thereof packaged in a container, such as a vial or bottle, and further comprising a label attached to or packaged with the container, the label describing the contents of the container and providing indications and/or instructions regarding use of the contents of the container to treat one or more disease states as described herein.
  • an anti-TIGIT antibody e.g., humanized antibody
  • a label attached to or packaged with the container, the label describing the contents of the container and providing indications and/or instructions regarding use of the contents of the container to treat one or more disease states as described herein.
  • the kit is for treating cancer and comprises an anti-TIGIT antibody (e.g., humanized antibody) or antigen-binding fragment thereof and a further therapeutic agent or a vaccine.
  • the kit may optionally further include a syringe for parenteral, e.g., intravenous, administration.
  • the kit comprises an anti-TIGIT antibody (e.g., humanized antibody) or antigen-binding fragment thereof and a label attached to or packaged with the container describing use of the antibody or fragment with the vaccine or further therapeutic agent.
  • the kit comprises the vaccine or further therapeutic agent and a label attached to or packaged with the container describing use of the vaccine or further therapeutic agent with the anti-TIGIT antibody or fragment.
  • an anti-TIGIT antibody and vaccine or further therapeutic agent are in separate vials or are combined together in the same pharmaceutical composition.
  • concurrent administration of two therapeutic agents does not require that the agents be administered at the same time or by the same route, as long as there is an overlap in the time period during which the agents are exerting their therapeutic effect.
  • Simultaneous or sequential administration is contemplated, as is administration on different days or weeks.
  • the therapeutic and detection kits disclosed herein may also be prepared that comprise at least one of the antibody, peptide, antigen-binding fragment, or polynucleotide disclosed herein and instructions for using the composition as a detection reagent or therapeutic agent.
  • Containers for use in such kits may typically comprise at least one vial, test tube, flask, bottle, syringe or other suitable container, into which one or more of the detection and/or therapeutic composition(s) may be placed, and preferably suitably aliquoted.
  • the kit may also contain a second distinct container into which this second detection and/or therapeutic composition may be placed.
  • kits disclosed herein will also typically include a means for containing the vial(s) in close confinement for commercial sale, such as, e.g., injection or blow-molded plastic containers into which the desired vial(s) are retained.
  • the labeling agent may be provided either in the same container as the detection or therapeutic composition itself, or may alternatively be placed in a second distinct container means into which this second composition may be placed and suitably aliquoted.
  • the detection reagent and the label may be prepared in a single container means, and in most cases, the kit will also typically include a means for containing the vial(s) in close confinement for commercial sale and/or convenient packaging and delivery.
  • a device or apparatus for carrying out the detection or monitoring methods described herein may include a chamber or tube into which sample can be input, a fluid handling system optionally including valves or pumps to direct flow of the sample through the device, optionally filters to separate plasma or serum from blood, mixing chambers for the addition of capture agents or detection reagents, and optionally a detection device for detecting the amount of detectable label bound to the capture agent immunocomplex.
  • a fluid handling system optionally including valves or pumps to direct flow of the sample through the device, optionally filters to separate plasma or serum from blood, mixing chambers for the addition of capture agents or detection reagents, and optionally a detection device for detecting the amount of detectable label bound to the capture agent immunocomplex.
  • the flow of sample may be passive (e.g., by capillary, hydrostatic, or other forces that do not require further manipulation of the device once sample is applied) or active (e.g., by application of force generated via mechanical pumps, electroosmotic pumps, centrifugal force, or increased air pressure), or by a combination of active and passive forces.
  • a processor also provided is a processor, a computer readable memory, and a routine stored on the computer readable memory and adapted to be executed on the processor to perform any of the methods described herein.
  • suitable computing systems, environments, and/or configurations include personal computers, server computers, hand-held or laptop devices, multiprocessor systems, microprocessor-based systems, set top boxes, programmable consumer electronics, network PCs, minicomputers, mainframe computers, distributed computing environments that include any of the above systems or devices, or any other systems known in the art.
  • Monoclonal, polyclonal, and humanized antibodies can be prepared (see, e.g., Sheperd and Dean (eds.) (2000) Monoclonal Antibodies , Oxford Univ. Press, New York, N.Y.; Kontermann and Dubel (eds.) (2001) Antibody Engineering , Springer-Verlag, New York; Harlow and Lane (1988) Antibodies A Laboratory Manual , Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., pp. 139-243; Carpenter, et al. (2000) J. Immunol. 165:6205; He, et al. (1998) J. Immunol. 160:1029; Tang et al. (1999) J. Biol. Chem.
  • Bispecific antibodies are also provided (see, e.g., Azzoni et al. (1998) J. Immunol. 161:3493; Kita et al. (1999) J. Immunol. 162:6901; Merchant et al. (2000) J. Biol. Chem. 74:9115; Pandey et al. (2000) J. Biol. Chem. 275:38633; Zheng et al. (2001) J. Biol Chem. 276:12999; Propst et al. (2000) J. Immunol. 165:2214; Long (1999) Ann. Rev. Immunol. 17:875).
  • Animals can be immunized with cells bearing the antigen of interest. Splenocytes can then be isolated from the immunized animals, and the splenocytes can fused with a myeloma cell line to produce a hybridoma (see, e.g., Meyaard et al. (1997) Immunity 7:283-290; Wright et al. (2000) Immunity 13:233-242; Preston et al., supra; Kaithamana et al. (1999) J. Immunol. 163:5157-5164).
  • Antibodies can be conjugated, e.g., to small drug molecules, enzymes, liposomes, polyethylene glycol (PEG). Antibodies are useful for therapeutic, diagnostic, kit or other purposes, and include antibodies coupled, e.g., to dyes, radioisotopes, enzymes, or metals, e.g., colloidal gold (see, e.g., Le Doussal et al. (1991) J. Immunol. 146:169-175; Gibellini et al. (1998) J. Immunol. 160:3891-3898; Hsing and Bishop (1999) J. Immunol. 162:2804-2811; Everts et al. (2002) J. Immunol. 168:883-889).
  • PEG polyethylene glycol
  • Fluorescent reagents suitable for modifying nucleic acids including nucleic acid primers and probes, polypeptides, and antibodies, for use, e.g., as diagnostic reagents, are available (Molecular Probes (2003) Catalogue , Molecular Probes, Inc., Eugene, Oreg.; Sigma-Aldrich (2003) Catalogue , St. Louis, Mo.).
  • Hybridomas were generated by electrofusion of isolated lymphocytes with the myeloma fusion partner P3 ⁇ 63-AG8.653 using the Cytopulse Hybrimmune electrofusion system. Fused cells were plated in 96-well plates in DMEM/F12, 15% BCS, HAT, IL-6, OPI supplement, and gentamycin.
  • Hybridoma supernatants were assayed for binding to human TIGIT expressing CHOK1 cells and cross-reactivity to rhesus TIGIT expressing CHO cells using a cell-based ELISA format.
  • Human TIGIT and rhesus TIGIT expressing CHO-K1 cells were plated in 96-well tissue-culture plates in 50 ⁇ l of DMEM/F12, 10% BCS and gentamycin (CHO-K1 media). Cells were plated at either 2 ⁇ 10 4 cells/well two days prior to the assay or 4 ⁇ 10 4 cells/well one day prior to the assay. Media was removed from the wells prior to the assay and 50 ⁇ l of hybridoma supernatant added.
  • Hybridoma supernatants were incubated for 30-60 minutes at room temperature and washed 3 times with PBS/0.05% Tween 20 using a cell ELISA washing protocol on the Biotek EL405 ⁇ Select CW plate washer.
  • Fifty microliters of the detection antibody HRP-conjugated goat anti-rat IgG (Southern Biotech cat#3030-05) or HRP-conjugated goat anti-mouse IgG (Southern Biotech cat#1043-05)
  • Assay plates were washed as above and developed with TMB and stopped with TMB stop solution (KPL cat#50-85-06) or 0.1N phosphoric acid.
  • Positive hybridomas were subcloned by limiting dilution or subcloned by plating hybridomas in semi-solid media and clones picked on the ClonePix® (Genetix). Two rounds of subcloning were performed on the parental hybridomas. Final subclones were grown in small-scale cultures in serum-free hybridoma production medium and purified to generate purified antibody for further characterization.
  • a rat antibody generated according to the above described method is referred to as 14A6, and was derived from clone LB155.14A6.G2.A8.
  • This rat antibody (14A6) is of the IgG2/kappa isotype and comprises the heavy chain variable region of SEQ ID NO:7 and the light chain variable region of SEQ ID NO:8.
  • Purified 14A6 antibody binds to human TIGIT and rhesus TIGIT as determined by cell-based ELISA binding to human TIGIT and rhesus TIGIT-CHOK1 cells ( FIG. 1 ) using the methods described above.
  • Purified 14A6 antibody can also block the hTIGIT and hCD155 interaction using a cell-based ELISA blocking assay ( FIG. 3 ) using the method described above.
  • a mouse antibody generated according to the above described method is referred to as 28H5, and was derived from clone TC167.28H5.H5.
  • This mouse antibody (28H5) is of the IgG1/kappa isotype and comprises the heavy chain variable region of SEQ ID NO:63 and the light chain variable region of SEQ ID NO:64.
  • Purified 28H5 antibody also binds to human TIGIT and rhesus TIGIT as determined by cell-based ELISA binding to human TIGIT and rhesus TIGIT-CHOK1 cells ( FIG. 2 ) using the methods described above.
  • Purified 28H5 antibody also block the hTIGIT and hCD155 interaction using a cell-based ELISA blocking assay ( FIG. 3 ) using the method described above.
  • Another mouse antibody generated according to the above described method is referred to as 31C6, and was derived from clone MEB125.31C6.A1.205.
  • This mouse antibody (31C6) is of the IgG1/kappa isotype and comprises the heavy chain variable region of SEQ ID NO:94 and the light chain variable region of SEQ ID NO:95.
  • Purified 31C6 antibody also binds to human TIGIT and rhesus TIGIT as determined by cell-based ELISA binding to human TIGIT and rhesus TIGIT-CHOK1 cells ( FIG. 4 ) using the methods described above.
  • Purified 31C6 antibody also block the hTIGIT and hCD155 interaction using a cell-based ELISA blocking assay ( FIG. 4 ) using the method described above.
  • the kinetic binding activity of anti-human TIGIT antibodies 14A6 and 31C6 was measured by surface plasmon resonance using a Biacore T200 system (Biacore, GE Healthcare, Piscataway, N.J.). Approximately 5000 RU of Anti-mouse IgG, GE Healthcare Catalog Number BR-1008-38, or approximately 13,000 RU of Goat Anti-Rat IgG Fc gamma, Fragment Specific, Jackson ImmunoResearch Catalog Number 112-006-071, was immobilized via amine coupling chemistry onto a Series S CM5 sensor chip, catalog number BR-1005-30.
  • the Series S CM5 chip surface was regenerated using one three-minute injection of 10 mM Glycine pH 1.7 at a flow rate of 10 ⁇ L/min.
  • the Series S CM5 chip surface was regenerated using one 20-second injection of 10 mM Glycine pH 1.5 followed by two 10-second injections of 12.5 mM NaOH at a flow rate of 60 ⁇ L/min.
  • BIAcore KD BIAcore KD (human TIGIT-his) (human TIGIT-Fc) Clone (pM) (pM) 14A6 (rIgG2a/K) 3.09 3.12 31C6 (mIgG1/K) 34.4 10.9 Comparator MBSA43 36.3 16.5 (mIgG1)
  • TIGIT-Jurkat an immortalized line of human T lymphocyte cells (clone, E6-1; ATCC TIB-152), engineered to over-express human TIGIT (hTIGIT-Jurkat) which were co-cultured with THP-1 cells, a human monocytic cell line in the presence or absence of one of the TIGIT ligands, CD155 and CD112.
  • hTIGIT-Jurkat cells co-cultured with THP-1 cells and stimulated with plate-bound anti-CD3 mAb produce IL-2, but when TIGIT ligand (CD155 or CD112) is added to the co-culture, IL-2 levels were reduced in a ligand-dependent manner.
  • 96-well flat-bottom plates were coated with mouse anti-human CD3 antibody (1 ug/ml in PBS; Clone HIT3a; BD Pharmingen Cat#555336) overnight at 4° C.
  • hTIGIT-Jurkat cells 50,000 were plated in the pre-coated plates and pre-incubated for 30-60 minutes with mAb at varying concentrations.
  • THP-1 cells 50,000 were added to the culture followed by either CD155-Fc (ECD of human CD155 fused to human Fc; 1.0 ⁇ g/ml) or CD112-Fc (ECD of human CD112 fused to human Fc; 0.5 ⁇ g/ml). After incubation for 18-24 h at 37° C.
  • IL-2 levels were assessed in culture supernatants by Meso Scale (Human IL-2 Tissue Culture MESO Kit: Cat#K151AHB-2). Treatment with MBSA43 (10 ⁇ g/ml) rescues IL-2 to a level equal to when activated hTIGIT Jurkat cells are cultured with THP-1 in the absence of CD155 or CD112.
  • a titration of the anti-hTIGIT clone 28H5 from 30 ⁇ g/ml down to 0.04 ⁇ g/ml gave an EC50 of 0.24 ⁇ g/ml as compared to MBSA43 at 0.24 ⁇ g/ml using this assay.
  • a titration of the anti-hTIGIT clone 31C6 from 30 ⁇ g/ml down to 0.04 ⁇ g/ml gave an EC50 of 0.14 ⁇ g/ml as compared to MBSA43 at 0.24 ⁇ g/ml using this assay.
  • Clone 31C6 (30 ⁇ g/ml) rescued IL-2 to 118% of MBSA43 (10 ⁇ g/ml).
  • the BC4-clone 49 human T cell line is an allo-antigen specific human CD4+ T cell clone expressing a TCR specific for HLA-class II MHC molecules expressed on the EBV transformed cell line, JY (HLA-DR1,4).
  • the BC4-clone 49 human T cell line requires re-stimulation with allo antigen every two weeks, using irradiated (5000 Rads) JY stimulator cells, irradiated PBMC (4000 Rads) isolated from two buffy coats and PHA-P (2.5 ⁇ g/ml; Sigma), as well as 10 ng/ml human IL-2 (R&D) supplement every 3-4 day following restimulation and expansion.
  • Numerous T cell clones BC1-6, BC4-27, BC4-49
  • TIGIT, CD226, CD96 and CD155 were monitored following re-stimulation with irradiated (5000 Rads) JY stimulator cells, irradiated PBMC and PHA-P to assess the best time to assay antagonist mAbs for relative TIGIT-antagonist activity. Peak expression of TIGIT was observed at 3-4 days post restimulation, while expression of CD226 and CD96 decreased over the same time period. Expression of TIGIT then decreased, while expression of CD226 and CD96 increased again by day 6 post-restimulation ( FIG. 7 ). Accordingly, candidate TIGIT antagonist mAbs were assessed at 3-4 days post-restimulation.
  • Transfectant JY overexpressing human CD155 were generated using pMX->huTIGIT retroviral vectors as a means to suppress BC4-clone 47 T cell responses in the primary T cell bioassay and to assess the relative capacity of anti-TIGIT mAbs to antagonize CD155 activation of TIGIT and rescue T cell proliferation and IFN ⁇ three days later.
  • the primary T cell assay for relative anti-hTIGIT antagonist mAbs was set up as follows. Human CD4 + T cell line BC4-clone 49 was co-cultured with CD155-Fc blocking mAbs specific for hTIGIT at various concentrations (33, 11, 3.7, 1.2, 0.4 and 0.1 ⁇ g/ml) for 30 minutes and then plated in round-bottom 96-well plates (2 ⁇ 10 4 c/well).
  • JY-hCD155 transfectants expressing the allo-antigen and high levels of hCD155, were irradiated (5000 Rads), washed and then added to the wells containing the anti-TIGIT mAb treated BC4-clone 49 T cells for a final concentration of 1 ⁇ 10 4 (2:1 T cell: target cell ratio) or 5 ⁇ 10 3 (1:4 T cell: target cell ratio) in a total volume of 200 ⁇ l/well.
  • IFN ⁇ interferon-gamma
  • anti-hTIGIT mAb 14A6, 28H5 and 31C6 treatment of BC4-clone 49 T cells resulted in rescue of IFN ⁇ and proliferative responses as assessed by increased responses compared to isotype and untreated T cells.
  • Commercial antibody MBSA43 and antibodies 37D10 and 25G10 also show activity in this assay.
  • the increase in IFN ⁇ production after treatment with 14A6, 28H5 and 31C6 was on about 2 fold on average.
  • mice Approximately seven to eight week old female BALB/cAnN mice with an average body weight of 20 grams were obtained from Taconic Laboratory (Germantown, N.Y.). Conventional animal chow and water were provided ad libitum.
  • a monoclonal antibody of murine isotype IgG1 against murine PD-1 and isotype controls were obtained from internal sources as frozen ( ⁇ 80° C.) stocks.
  • the rat anti-mouse TIGIT (GIGD7) antibody was obtained from eBioscience as a 4° C. stock.
  • the IgG1 isotype control was a mouse monoclonal antibody specific for adenoviral hexon 25.
  • the IgG2a isotype control was a rat monoclonal antibody specific for beta-galactosidase.
  • Murine isotype IgG1 is the murine counterpart isotype to human isotype IgG4.
  • the formulation buffers were specific for each antibody to stabilize proteins and prevent precipitation.
  • the formulations were as follows: mIgG1:75 mM NaCl, 10 mM sodium phosphate, 3% sucrose, pH7.3; anti-PD-1:20 mM sodium acetate, 7% sucrose, pH5.5; rat IgG2a: 20 mM sodium acetate, 9% sucrose pH 5.5; and anti-TIGIT (GIGD7): PBS pH 7.0.
  • CT26 colon carcinoma cells were cultured in RPMI medium supplemented with 10% heat-inactivated fetal bovine serum. 3 ⁇ 10 5 log-phase and sub-confluent CT26 cells were injected subcutaneously (SC) in a 100 ⁇ L volume of serum-free RPMI in the right lower dorsal flank of each mouse. Mice were first shaved with electronic clippers in the area that would be used for the implant.
  • CT-26 is a murine colorectal adenocarcinoma cell line syngeneic to the BALB/c mouse strain.
  • CT-26 is a relevant model system for evaluating the mechanism of action for an anti-PD-1 antibody because of the translatable molecular profile of this tumor post-anti-PD-1 therapy.
  • Frozen stocks of the antibodies to be tested in the animal model were thawed and transferred to wet ice. To avoid repeated freeze thaw, each vial of stock was thawed once and aliquots made in volumes sufficient for one time use. Polypropylene, low adhesion tubes were used for this purpose. The aliquots were snap frozen in dry ice and stored at ⁇ 80° C. Before each dosing, one aliquot was thawed and diluted to nominal concentration in the appropriate diluent and dosed immediately. Aliquots of dosing solutions were snap frozen in dry ice and stored at ⁇ 80° C. until analyses. Dosing solutions were assessed using the Meso Scale Discovery (MSD®, Rockville, Md.) platform which is based on multi-array technology; a combination of electrochemiluminescence detection and patterned arrays.
  • MSD® Meso Scale Discovery
  • CT26 tumor-bearing BALB/cAnN mice were administered rat anti-mouse TIGIT (GIGD7) at a 20 mg/kg dose, IP, every 4 days for each of 5 cycles.
  • An anti-mouse PD-1 (described above) was administered at a 10 mg/kg dose, IP, every 4 days for each of 5 cycles.
  • Post dosing animals continued to be monitored and tumor volumes were measured out to 36 days. Treatment was started once the tumor size averaged 100 mm 3 (75 mm 3 -115 mm 3 ). Tumors were measured twice weekly. As demonstrated by the results, which are shown in FIG.
  • the mean anti-tumor response of combination therapy with the PD-1 antagonist and TIGIT antagonist was greater than the anti-tumor response observed with either anti-PD1 single agent (p ⁇ 0.05) or anti-TIGIT single agent (p ⁇ 0.005) treatment.
  • anti-PD1 single agent p ⁇ 0.05
  • anti-TIGIT single agent p ⁇ 0.005
  • TGI tumor growth inhibition
  • single agent anti-PD1 treatment 52% TGI was observed at day 14.
  • Combination treatment resulted in 85% TGI at day 14 and demonstrated 40% complete regressions (CR) such that no measurable tumor remained in 4 out of 10 mice by day 36.
  • the anti-tumor efficacy with either antibody delivered as monotherapy was 0-10% CR.
  • the rat 14A6 and the mouse 31C6 antibody were humanized using methods described in the specification. From the rat antibody 14A6, the following humanized variable heavy chains were constructed: SEQ ID NOs: 9-24 and SEQ ID NOs: 37-47; and the following humanized variable light chains were constructed: SEQ ID NOs: 25-30 and SEQ ID NOs: 48-52. From mouse antibody 31C6, the following humanized variable heavy chains were constructed: SEQ ID NOs: 124-129; and the following humanized variable light chains were constructed: SEQ ID Nos: 130-133.
  • mice Approximately seven to eight week old female BALB/cAnN mice with an average body weight of 20 grams were obtained from Taconic Laboratory (Germantown, N.Y.). Conventional animal chow and water were provided ad libitum.
  • CT26 colon carcinoma cells were cultured in RPMI medium supplemented with 10% heat-inactivated fetal bovine serum. 3 ⁇ 10 5 log-phase and sub-confluent CT26 cells were injected subcutaneously (SC) in a 100 ⁇ L volume of serum-free RPMI in the right lower dorsal flank of each mouse. Mice were first shaved with electronic clippers in the area that would be used for the implant.
  • CT-26 is a murine colorectal adenocarcinoma cell line syngeneic to the BALB/c mouse strain.
  • CT-26 is a relevant model system for evaluating the mechanism of action for an anti-PD-1 antibody because of the translatable molecular profile of this tumor post-anti-PD-1 therapy.
  • Frozen stocks of the antibodies to be tested in the animal model were thawed and transferred to wet ice. To avoid repeated freeze thaw, each vial of stock was thawed once and aliquots made in volumes sufficient for one time use. Polypropylene, low adhesion tubes were used for this purpose. The aliquots were snap frozen in dry ice and stored at ⁇ 80° C. Before each dosing, one aliquot was thawed and diluted to nominal concentration in the appropriate diluent and dosed immediately. Aliquots of dosing solutions were snap frozen in dry ice and stored at ⁇ 80° C. until analyses. Dosing solutions were assessed using the Meso Scale Discovery (MSD®, Rockville, Md.) platform which is based on multi-array technology; a combination of electrochemiluminescence detection and patterned arrays.
  • MSD® Meso Scale Discovery
  • CT26 tumor-bearing BALB/cAnN mice were randomized into 10 treatment groups when the mean tumor volume of these mice reached a tumor size average of 100 mm3 (80 mm3-119 mm3): (1) muIgG1 isotype control+rat IgG1 isotype control; (2) muIgG1 isotype control+ muIgG2a isotype control; (3) muDX400+ rat IgG1 isotype control; (4) muDX400+ muIgG2a isotype control; (5) muIgG1 isotype control+18G10; (6) muIgG1 isotype control+18G10-G1; (7) muIgG1 isotype control+18G10-G2a; (8) muDX400+18G10; (9) muDX400+18G10_G1; (10) muDX400+18G10_G2a.
  • Animals were administered rat anti-mouse TIGIT (18G10) or chimeric anti-TIGIT antibodies 18G10-G1 or 18G10-G2a (described above) at a 18 mg/kg dose, IP, every 4 days for each of 6 cycles.
  • An anti-mouse PD-1 (described above) was administered at a 10 mg/kg dose, IP, every 4 days for each of 6 cycles.
  • Post dosing animals continued to be monitored and tumor volumes were measured out to 76 days for some treatment groups. Tumors were measured twice weekly. The results are shown in FIGS. 10 and 11 .
  • Single agent anti-TIGIT treatment using 18G10-G2a showed 44% tumor growth inhibition (TGI) at day 13; while 18G10 parental antibody showed 38% and the 18G10-G1 antibody showed 36%.
  • TGI tumor growth inhibition
  • 18G10 parental antibody showed 38% and the 18G10-G1 antibody showed 36%.
  • anti-PD-1 was combined with isotype control muIgG2a
  • 50% TGI and 10% complete regressions (CR) were observed at day 18, such that 1 complete response out of 10 animals was observed.
  • the combination of anti-PD1 and parental 18G10 showed 80% TGI at day 13 and demonstrated 300% CR by day 39.
  • the combination of anti-PD1 and 18G10-G1 showed 59% TGI at day 13 and demonstrated 10% CR by day 13.
  • the combination of anti-PD1 and 18G10-G2a showed 88% TGI at day 13 and demonstrated 60% CR at day 63.
  • the combination of anti-PD1 and 18G10-G2a showed greater anti-tumor activity and more complete regressions compared to combinations of anti-PD1 with 18G10 parental or 18G10-G1. There was no significant body weight loss associated with administration of single agents or combination therapy indicating that treatments were well tolerated.
  • Example 7 The Experiment described in Example 7 was repeated, except that the rat 18G10 antibody was substituted with rat antibody 11A11.
  • mice Approximately seven to eight week old female BALB/cAnN mice with an average body weight of 20 grams were obtained from Taconic Laboratory (Germantown, N.Y.). Conventional animal chow and water were provided ad libitum.
  • CT26 colon carcinoma cells were cultured in RPMI medium supplemented with 10% heat-inactivated fetal bovine serum. 3 ⁇ 10 5 log-phase and sub-confluent CT26 cells were injected subcutaneously (SC) in a 100 ⁇ L volume of serum-free RPMI in the right lower dorsal flank of each mouse. Mice were first shaved with electronic clippers in the area that would be used for the implant.
  • CT-26 is a murine colorectal adenocarcinoma cell line syngeneic to the BALB/c mouse strain.
  • CT-26 is a relevant model system for evaluating the mechanism of action for an anti-PD-1 antibody because of the translatable molecular profile of this tumor post-anti-PD-1 therapy.
  • Frozen stocks of the antibodies to be tested in the animal model were thawed and transferred to wet ice. To avoid repeated freeze thaw, each vial of stock was thawed once and aliquots made in volumes sufficient for one time use. Polypropylene, low adhesion tubes were used for this purpose. The aliquots were snap frozen in dry ice and stored at ⁇ 80° C. Before each dosing, one aliquot was thawed and diluted to nominal concentration in the appropriate diluent and dosed immediately. Aliquots of dosing solutions were snap frozen in dry ice and stored at ⁇ 80° C. until analyses. Dosing solutions were assessed using the Meso Scale Discovery (MSD®, Rockville, Md.) platform which is based on multi-array technology; a combination of electrochemiluminescence detection and patterned arrays.
  • MSD® Meso Scale Discovery
  • CT26 tumor-bearing BALB/cAnN mice were randomized into 10 treatment groups when the mean tumor volume of these mice reached a tumor size average of 100 mm 3 (75 mm 3 -115 mm 3 ): (1) muIgG1 isotype control+ rat IgG1 isotype control; (2) muIgG1 isotype control+ muIgG2a isotype control; (3) muDX400+ rat IgG1 isotype control; (4) muDX400+ muIgG2a isotype control; (5) muIgG1 isotype control+11A11; (6) muIgG1 isotype control+11A11-G1; (7) muIgG1 isotype control+11A11-G2a; (8) muDX400+11A11; (9) muDX400+11A11_G1; (10) muDX400+11A11_G2a.
  • Animals were administered rat anti-mouse TIGIT (11A11) or chimeric anti-TIGIT antibodies 11A11-G1 or 11A11-G2a (described above) at a 20 mg/kg dose, IP, every 4 days for each of 6 cycles.
  • An anti-mouse PD-1 (described above) was administered at a 10 mg/kg dose, IP, every 4 days for each of 6 cycles.
  • Post dosing animals continued to be monitored and tumor volumes were measured out to 54 days for some treatment groups. Tumors were measured twice weekly. The results are shown in FIGS. 12 and 13 .
  • TGI tumor growth inhibition
  • 11A11-G2a Single agent anti-TIGIT treatment using 11A11-G2a showed 52% tumor growth inhibition (TGI) at day 14; while little to no activity was observed using the 11A11 parental antibody or the 11A11-G1 antibody.
  • 40-50% TGI was observed at day 14.
  • anti-PD-1 showed 10% complete regressions (CR) by day 28, such that 1 complete response out of 10 animals was observed.
  • the combination of anti-PD1 and parental 11A11 showed 60% TGI at day 14 and demonstrated 30% CR by day 54.
  • the combination of anti-PD1 and 11A11-G1 showed 56% TGI at day 14 and demonstrated 30% CR by day 25.
  • the combination of anti-PD1 and 11A11-G2a showed 94% TGI at day 14 and demonstrated 70% CR at day 42.
  • the combination of anti-PD1 and 11A11-G2a showed greater anti-tumor activity and more complete regressions compared to combinations of anti-PD1 with 11A11 parental or 11A11-G1. There was no significant body weight loss associated with administration of single agents or combination therapy indicating that treatments were well tolerated.
  • the contact areas between anti-TIGIT antibody 14A6 and human TIGIT were determined by use of hydrogen deuterium exchange mass spectrometry (HDX-MS) analysis.
  • HDX-MS measures the exchange of deuterium with hydrogen into the amide backbone of the protein. The exchange rate is influenced by the hydrogen's exposure to solvent. Comparison of the exchange levels in the antigen when the antibody is bound can identify regions of the protein where the antibody is binding.
  • the mass spectrometer was a Thermo Scientific Orbitrap-Velos.
  • the mass spectrometer was set to acquire one full scan MS data in the orbitrap at 60,000 resolving power, a target ion count of 1E6, a maximum ion injection time of 500 milliseconds and two microscans.
  • the mass spectrometer was set to acquire one full scan spectrum at 60,000 resolving power followed by ten data-dependent MS/MS spectra in the ion trap.
  • the liquid chromatography system was a Waters® nanoACQUITY for the analytical column gradient and a Waters® 515 isocratic pump for the sample digestion and loading.
  • the buffer used was 2% acetonitrile and 0.05% trifluoroacetic acid at a flow rate of 80 ul/min.
  • the buffers were Buffer A) 0.1% formic acid in water and Buffer B) 0.1% formic acid in acetonitrile.
  • the gradient was at 40 ul/min from 2% B to 36% B in 10 minutes, followed by a wash of 80% B for 2 minutes and a reequilibration at 2% B for 3 minutes.
  • the column was then washed by cycling the gradient between 2% and 80% B, three times with 1 minute at each step, followed by a final equilibration at 2% B for 5 minutes.
  • the trapping column was a Waters® Vanguard C18 BEH 1.7 um Guard Column and the analytical column was a Waters® C18 BEH300, 1.7 um 1 ⁇ 50 mm column.
  • Sample handling for the deuterium labeling was done by a Leaptec H/D-X PAL system.
  • the labeling sample tray was set to a temperature of 25° C.
  • the quenching tray was set to 1.5° C.
  • the trap and analytical column chamber was set to 1.5° C.
  • the immobilized pepsin column (Porosyme Immobilized Pepsin 2.1 ⁇ 30 mmm, Life Technologies) was kept outside the column chamber at room temperature.
  • hTIGIT-His (30 pmol/ ⁇ l) was mixed with an equal volume of the antibody (14 pmol/ ⁇ l) or, in the unbound control, PBS pH 7.6. The antibody bound samples and the unbound control were incubated at room temperature for 1 hour before beginning the labeling experiment.
  • a fully deuterated sample was generated by incubating 2 ⁇ l of hTIGIT with 108 ⁇ l of deuterated denaturing buffer (4M Urea, 100 mM TCEP, 0.01% DDM in 99.5% deueterium oxide). The sample was incubated at room temperature overnight. 55 ⁇ l was then directly injected into the column chamber and the data acquired as before.
  • deuterated denaturing buffer 4M Urea, 100 mM TCEP, 0.01% DDM in 99.5% deueterium oxide
  • LC-MS/MS data was acquired of an unlabeled sample and searched before deuterium labeling to verify successful digestion of the proteins and to generate a list of peptides from pepsin digestion.
  • Data was database searched using Proteome Discoverer 1.4 and the SEQUEST HT search algorithm (ThermoFisher Scientific).
  • the protein database used was the human TIGIT-His and anti-hTIGIT antibody sequences concatenated to the yeast Saccharomycese cerevisiae uniprot (5/20/13) database.
  • MS data from the deuterium labeling experience was processed by HDExaminer (version 1.3, Sierra Analytics). The mass and retention time selected by the software for each peptide was verified manually.
  • the human TIGIT peptides protected by bound 14A6 antibody are illustrated in the heatmap of FIG. 14 and correspond to amino acid residues 54-57, 68-70 and 76-81 of SEQ ID NO:31. (These same amino acids are shown as residues 30-33, 44-46 and 52-57 of SEQ ID NO:87.)
  • the contact areas between anti-TIGIT antibody 31C6 and human TIGIT were determined by use of hydrogen deuterium exchange mass spectrometry (HDX-MS) analysis.
  • HDX-MS measures the exchange of deuterium with hydrogen into the amide backbone of the protein.
  • One factor influencing the exchange rate is the hydrogen's exposure to solvent. Comparison of the exchange levels in the antigen when the antibody is bound can identify regions of the protein where the antibody is binding.
  • the mass spectrometer was a Thermo Scientific Orbitrap-Elite.
  • the mass spectrometer was set to acquire one full scan MS data in the orbitrap at 120,000 resolving power, a target ion count of 1E6, a maximum ion injection time of 500 milliseconds and two microscans.
  • the mass spectrometer was set to acquire one full scan spectrum at 120,000 resolving power followed by ten data-dependent MS/MS spectra in the ion trap.
  • the liquid chromatography system was a Waters nanoAcquity for the analytical column gradient and a Waters 515 isocratic pump for the sample digestion and loading.
  • the buffer used was 2% acetonitrile and 0.05% trifluoroacetic acid at a flow rate of 80 ul/min.
  • the buffers were Buffer A) 0.1% formic acid in water and Buffer B) 0.1% formic acid in acetonitrile.
  • the gradient was at 40 ul/min from 2% B to 36% B in 10 minutes, followed by a wash of 80% B for 2 minutes and a re-equilibration at 2% B for 3 minutes.
  • the column was then washed by cycling the gradient between 2% and 80% B, three times with 1 minute at each step, followed by a final equilibration at 2% B for 5 minutes.
  • the trapping column was a Waters Vanguard CSH C18 1.7 um Guard Column and the analytical column was a Waters CSH C18, 1.7 um 1 ⁇ 50 mm column.
  • Sample handling for the deuterium labeling was done by a Leaptec H/D-X PAL system.
  • the labeling sample tray was set to a temperature of 25° C.
  • the quenching tray was set to 1.5° C.
  • the trap and analytical column chamber was set to 1.5° C.
  • the immobilized pepsin column Enzymate BEH Pepsin, Waters corporation was kept outside the column chamber at room temperature.
  • hTIGIT-His (63 pmol/ul) was mixed with an equal volume of the antibody (32 pmol/ul) or, in the unbound control, PBS pH 7.6. The antibody bound samples and the unbound control were incubated at room temperature for 1 hour before beginning the labeling experiment.
  • a fully deuterated sample was generated by incubating 2 ⁇ l of hTIGIT (63 pmol/ul) with 108 ⁇ l of deuterated denaturing buffer (4M Urea, 100 mM TCEP, 0.01% DDM in 99.5% deuterium oxide). The sample was incubated at room temperature overnight. 55 ⁇ l was then directly injected into the column chamber and the data acquired as before.
  • deuterated denaturing buffer 4M Urea, 100 mM TCEP, 0.01% DDM in 99.5% deuterium oxide
  • LC-MS/MS data was acquired of an unlabeled sample and database searched to verify successful digestion of the proteins and to generate a list of peptides from the pepsin digestion.
  • Database search was done using Proteome Discoverer 1.4 and the SEQUEST HT search algorithm (ThermoFisher Scientific).
  • the protein database used was the human TIGIT-His and anti-hTIGIT antibody sequences concatenated to the yeast Saccharomyces cerevisiae uniprot (5/20/13) database.
  • MS data from the deuterium labeling experience was processed by HDExaminer (version 1.3, Sierra Analytics). The mass and retention time selected by the software for each peptide was verified manually.
  • the human TIGIT peptides protected by bound 31C6 antibody are illustrated in the heatmap of FIG. 15 and correspond to amino acid residues 53-57, 60-65, 68-70, 72-81, 94-95, 109-119 of SEQ ID NO:31. (These same amino acids are shown as residues 29-33, 36-41, 44-46, 48-57, 70-71, 85-95 of SEQ ID NO:87.)
  • IL-2 levels were reduced in a ligand dependent manner.
  • Treatment with anti-hTIGIT antibodies of the invention rescues IL-2 production in this assay in a dose-dependent fashion.
  • 96-well flat-bottom plates were coated with mouse anti-human CD3 antibody (1 ⁇ m/ml in PBS; Clone HIT3a; BD Pharmingen Cat#555336) overnight at 4° C.
  • hTIGIT expressing Jurkat cells 50,000
  • Human CD155 expressing JY cells 50,000
  • IL-2 levels were assessed in culture supernatants by mesoscale (Human IL-2 Tissue Culture MESO Kit: Cat#K151AHB-2). The results are shown in FIG. 16 .
  • the mouse human 31C6 chimera comprised the variable regions of the parental 31C6 clone (SEQ ID Nos: 94 and 95) and a human IgG1 region.
  • a titration of the 31C6 humanized variants from 30 ⁇ g/ml down to 0.04 ⁇ g/ml gives the following EC 50 s:
  • PBMCs peripheral blood mononuclear cells
  • HuCD155-Fc was coated onto tissue culture plates and PBMCs were stimulated with anti-CD3.
  • Proinflammatory cytokines IFNy, IL1 ⁇ , IL6 and TNF ⁇
  • mesoscale assay Human Proinflammaatory-4 I tissue culture MESO Kit: Cat#K15009B-4.
  • humanized variants of 31C6 were able to stimulate IL-6, TNF ⁇ and IFN ⁇ in a dose dependent manner similar to the mouse human 31C6 chimeric antibody.
  • the labels in FIG. 17 correspond to the following antibodies:
  • A8_VH2 20AHA_tigit_ 39 EVQLQESGPGLVKPSETLSLTCTVSGSSIA SDYWG WIRKPPGKGLEWIG FI 14a6_humanized_ TYSGSTSYNPSLKS RVTISRDTSKNQFSLKLSSVTAADTAVYYCAR MPSFI VH3 TLASLSTWEGYFDF WGQGTMVTVSS LB155.14A6.G2.
  • A8_VH3 21AHA_tigit_ 40 EVQLQESGPGLVKPSETLSLTCTVSGSSIA SDYWG WIRQPPGKKLEWIG FI 14a6_humanized_ TYSGSTSYNPSLKS RVTISRDTSKNQFSLKLSSVTAADTAVYYCAR MPSFI VH4 TLASLSTWEGYFDF WGQGTMVTVSS LB155.14A6.G2.
  • A8_VH6 23AHA_tigit_ 43 EVQLQESGPGLVKPSETLSLTCTVSGSSIA SDYWG WIRQFPGKGLEWIG FI 14a6_humanized_ TYSGSTSYNPSLKS RVTISRDTSKNQFSLKLSSVTADDTAVYYCAR MPSFI VH7 TLASLSTWEGYFDF WGQGTMVTVSS LB155.14A6.G2.
  • A8_VH7 24AHA_tigit_ 44 EVQLQESGPGLVKPSETLSLTCTVSGSSIA SDYWG WIRKPPGKKMEWIG FI 14a6_humanized_ TYSGSTSYNPSLKS RVTISVDTSKNQFSLKLSSVTAADTAVYYCAR MPSFI VH8 TLASLSTWEGYFDF WGQGTMVTVSS LB155.14A6.G2.
  • A8_VH8 25AHA_tigit_ 45 EVQLQESGPGLVKPSETLSLTCSVTGSSIA SDYWG WIRQPPGKGLEWIG FI 14a6_humanized_ TYSGSTSYNPSLKS RVTISRDTSKNQFSLKLSSVTAADTAVYYCAR MPSFI VH9 TLASLSTWEGYFDF WGQGTMVTVSS LB155.14A6.G2.
  • A8_VL1 11AHA_tigit_ 49 DIQMTQSPSSLSASVGDRVTITC KASQSIHKNLA WYQQKPGKAPKFLIY YA 14a6 humanized_ NSLQT GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC QQYYSGWT FGGGTK VL2 VEIK LB155.14A6.G2.
  • A8_VL5 Leader 53 MEWSWVFLFFLSVTTGVHS sequence heavy chains Leader 54 MSVPTQVLGLLLLWLTDARC sequence light chains Heavy chain 55 TKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF constant PAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGP domain- PCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQF IgG4 NWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK S228P GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVM HEALHNHYTQKSLSLSLGK Kappa light 56 VA

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Endocrinology (AREA)
  • Biomedical Technology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Nitrogen Condensed Heterocyclic Rings (AREA)
  • Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
  • Heterocyclic Carbon Compounds Containing A Hetero Ring Having Oxygen Or Sulfur (AREA)
  • Epoxy Compounds (AREA)
  • Steroid Compounds (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
US15/121,624 2014-08-19 2015-08-17 Anti-tigit antibodies Abandoned US20160355589A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
AP2017009765A AP2017009765A0 (en) 2014-08-19 2015-08-17 Anti-tigit antibodies
US15/121,624 US20160355589A1 (en) 2014-08-19 2015-08-17 Anti-tigit antibodies

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
US201462038912P 2014-08-19 2014-08-19
US201562126733P 2015-03-02 2015-03-02
PCT/US2015/045447 WO2016028656A1 (en) 2014-08-19 2015-08-17 Anti-tigit antibodies
US15/121,624 US20160355589A1 (en) 2014-08-19 2015-08-17 Anti-tigit antibodies

Related Parent Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2015/045447 A-371-Of-International WO2016028656A1 (en) 2014-08-19 2015-08-17 Anti-tigit antibodies

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US15/466,113 Continuation US20170198042A1 (en) 2014-08-19 2017-03-22 Anti-tigit antibodies
US15/817,691 Continuation US10618958B2 (en) 2014-08-19 2017-11-20 Anti-TIGIT antibodies

Publications (1)

Publication Number Publication Date
US20160355589A1 true US20160355589A1 (en) 2016-12-08

Family

ID=53938463

Family Applications (5)

Application Number Title Priority Date Filing Date
US15/121,624 Abandoned US20160355589A1 (en) 2014-08-19 2015-08-17 Anti-tigit antibodies
US15/466,113 Abandoned US20170198042A1 (en) 2014-08-19 2017-03-22 Anti-tigit antibodies
US15/817,691 Active US10618958B2 (en) 2014-08-19 2017-11-20 Anti-TIGIT antibodies
US16/806,658 Active 2037-09-27 US12102680B2 (en) 2014-08-19 2020-05-15 Anti-TIGIT antibodies
US18/794,138 Pending US20250064924A1 (en) 2014-08-19 2024-08-05 Anti-tigit antibodies

Family Applications After (4)

Application Number Title Priority Date Filing Date
US15/466,113 Abandoned US20170198042A1 (en) 2014-08-19 2017-03-22 Anti-tigit antibodies
US15/817,691 Active US10618958B2 (en) 2014-08-19 2017-11-20 Anti-TIGIT antibodies
US16/806,658 Active 2037-09-27 US12102680B2 (en) 2014-08-19 2020-05-15 Anti-TIGIT antibodies
US18/794,138 Pending US20250064924A1 (en) 2014-08-19 2024-08-05 Anti-tigit antibodies

Country Status (30)

Country Link
US (5) US20160355589A1 (enExample)
EP (1) EP3183267A1 (enExample)
JP (3) JP6920194B2 (enExample)
KR (2) KR102321168B1 (enExample)
CN (2) CN107148430B (enExample)
AP (1) AP2017009765A0 (enExample)
AU (3) AU2015305754B2 (enExample)
CA (1) CA2957722C (enExample)
CL (2) CL2017000310A1 (enExample)
CO (1) CO2017001561A2 (enExample)
CR (1) CR20170060A (enExample)
DO (1) DOP2017000046A (enExample)
EA (1) EA036311B1 (enExample)
GE (1) GEP20217331B (enExample)
GT (1) GT201700033A (enExample)
IL (1) IL250583B (enExample)
JO (2) JO3664B1 (enExample)
MA (1) MA40475A (enExample)
MD (1) MD4733C1 (enExample)
MX (2) MX389684B (enExample)
MY (2) MY184288A (enExample)
NI (1) NI201700019A (enExample)
PE (1) PE20170289A1 (enExample)
PH (1) PH12017500296B1 (enExample)
SG (1) SG11201701161QA (enExample)
TN (1) TN2017000024A1 (enExample)
TW (2) TWI790593B (enExample)
UA (1) UA122395C2 (enExample)
WO (1) WO2016028656A1 (enExample)
ZA (1) ZA201700955B (enExample)

Cited By (46)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20170165366A1 (en) * 2015-10-01 2017-06-15 Potenza Therapeutics, Inc. Anti-TIGIT Antigen-Binding Proteins and Methods of Use Thereof
WO2018085698A1 (en) 2016-11-04 2018-05-11 Aximmune, Inc. Beta-alethine, immune modulators, and uses thereof
WO2018128939A1 (en) * 2017-01-05 2018-07-12 Gensun Biopharma Inc. Checkpoint regulator antagonists
WO2018195552A1 (en) 2017-04-21 2018-10-25 Sillajen, Inc. Oncolytic vaccinia virus and checkpoint inhibitor combination therapy
US10112997B2 (en) 2015-05-28 2018-10-30 Oncomed Pharmaceuticals, Inc. Tight-binding agents and uses thereof
WO2018204405A1 (en) * 2017-05-02 2018-11-08 Merck Sharp & Dohme Corp. Stable formulations of anti-tigit antibodies alone and in combination with programmed death receptor 1 (pd-1) antibodies and methods of use thereof
US10124061B2 (en) 2016-08-17 2018-11-13 Compugen Ltd. Anti-TIGIT antibodies, anti-PVRIG antibodies and combinations thereof
US10259882B2 (en) 2015-05-07 2019-04-16 Agenus Inc. Anti-OX40 antibodies
US10323091B2 (en) 2015-09-01 2019-06-18 Agenus Inc. Anti-PD-1 antibodies and methods of use thereof
US10597453B2 (en) 2018-06-29 2020-03-24 Gensun Biopharma, Inc. Antitumor immune checkpoint regulator antagonists
CN110997720A (zh) * 2017-07-27 2020-04-10 Iteos治疗公司 抗tigit抗体
US10618958B2 (en) 2014-08-19 2020-04-14 Merck Sharp & Dohme Corp. Anti-TIGIT antibodies
WO2020096915A1 (en) * 2018-11-05 2020-05-14 Merck Sharp & Dohme Corp. Dosing regimen of anti-tigit antibody for treatment of cancer
US10766957B2 (en) 2015-08-14 2020-09-08 Merck Sharp & Dohme Corp Anti-TIGIT antibodies
US10836830B2 (en) 2015-12-02 2020-11-17 Agenus Inc. Antibodies and methods of use thereof
US10844119B2 (en) 2016-10-11 2020-11-24 Agenus Inc. Anti-LAG-3 antibodies and methods of use thereof
US10851157B2 (en) 2019-07-01 2020-12-01 Gensun Biopharma, Inc. Antagonists targeting the TGF-β pathway
WO2020242919A1 (en) 2019-05-29 2020-12-03 Eli Lilly And Company Tigit and pd-1/tigit-binding molecules
US10894823B2 (en) 2016-03-24 2021-01-19 Gensun Biopharma Inc. Trispecific inhibitors for cancer treatment
WO2021021767A1 (en) * 2019-07-30 2021-02-04 Merck Sharp & Dohme Corp. Anti-pd-1/lag3/tigit trispecific antibodies and anti-pd-1/lag3 bispecific antibodies
US20210054071A1 (en) * 2017-12-28 2021-02-25 Nanjing Legend Biotech Co., Ltd. Single-domain antibodies and variants thereof against tigit
US11028172B1 (en) * 2020-11-10 2021-06-08 Lepu Biopharma Co., Ltd. Anti-TIGIT antibodies and uses thereof
US11136384B2 (en) 2016-11-30 2021-10-05 Mereo Biopharma 5, Inc. Methods for treatment of cancer comprising TIGIT-binding agents
WO2021217893A1 (zh) 2020-04-29 2021-11-04 广州昂科免疫生物技术有限公司 结合tigit抗原的抗体及其制备方法与应用
US11225523B2 (en) 2017-06-01 2022-01-18 Compugen Ltd. Triple combination antibody therapies
US11359028B2 (en) 2016-11-09 2022-06-14 Agenus Inc. Anti-OX40 antibodies and anti-GITR antibodies
US20220193236A1 (en) * 2020-12-22 2022-06-23 Regina E. HERZLINGER Methods, systems, and apparatus for administering a monoclonal and/or polyclonal antibody treatment via rapid infusion
US11401339B2 (en) 2018-08-23 2022-08-02 Seagen Inc. Anti-TIGIT antibodies
US11453720B2 (en) 2017-03-30 2022-09-27 Potenza Therapeutics, Inc. Anti-TIGIT antigen-binding proteins and methods of use thereof
US20220379026A1 (en) * 2020-12-22 2022-12-01 Regina E. HERZLINGER Methods, systems, and apparatus for administering an antibody treatment via infusion
WO2022257279A1 (en) * 2021-06-10 2022-12-15 Beijing Mabworks Biotech Co., Ltd. Antibodies binding tigit and uses thereof
WO2023036340A1 (en) * 2021-09-13 2023-03-16 Biocytogen Pharmaceuticals (Beijing) Co., Ltd. Protein complexes targeting il21 pathway
US11623955B2 (en) 2015-02-19 2023-04-11 Compugen Ltd. Anti-PVRIG antibodies and methods of use
US11633476B2 (en) 2017-05-02 2023-04-25 Merck Sharp & Dohme Llc Stable formulations of programmed death receptor 1 (PD-1) antibodies and methods of use thereof
US20230235037A1 (en) * 2020-04-22 2023-07-27 Chemomab Ltd. Method of treatment using anti-ccl24 antibody
US11723971B2 (en) * 2016-03-04 2023-08-15 JN Biosciences, LLC Antibodies to TIGIT
WO2023170606A1 (en) 2022-03-08 2023-09-14 Alentis Therapeutics Ag Use of anti-claudin-1 antibodies to increase t cell availability
US11795209B2 (en) 2015-02-19 2023-10-24 Compugen Ltd. PVRIG polypeptides and methods of treatment
US11820824B2 (en) 2020-06-02 2023-11-21 Arcus Biosciences, Inc. Antibodies to TIGIT
US11845798B2 (en) 2017-05-02 2023-12-19 Merck Sharp & Dohme Llc Formulations of anti-LAG3 antibodies and co-formulations of anti-LAG3 antibodies and anti-PD-1 antibodies
US11883432B2 (en) 2020-12-18 2024-01-30 Century Therapeutics, Inc. Chimeric antigen receptor system with adaptable receptor specificity
US20240050646A1 (en) * 2020-12-22 2024-02-15 Regina E. HERZLINGER Methods, systems, and apparatus for administering an antibody treatment via infusion
US11993653B2 (en) 2016-12-07 2024-05-28 Agenus Inc. Antibodies and methods of use thereof
EP4192883A4 (en) * 2020-08-05 2024-12-04 Crystal Bioscience Inc. Anti-tigit antibody and methods of use thereof
RU2833669C2 (ru) * 2018-11-05 2025-01-28 МЕРК ШАРП И ДОУМ ЭлЭлСи Режим введения антитела к tigit для лечения рака
US12319735B2 (en) 2018-11-07 2025-06-03 Merck Sharp & Dohme Llc Co-formulations of anti-LAG3 antibodies and anti-PD-1 antibodies

Families Citing this family (128)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2535354B1 (en) 2007-06-18 2017-01-11 Merck Sharp & Dohme B.V. Antibodies to human programmed death receptor pd-1
EP3605088A1 (en) 2008-04-09 2020-02-05 Genentech, Inc. Compositions and methods for the treatment of immune related diseases
DK3485903T5 (da) 2011-09-23 2024-09-02 Mereo Biopharma 5 Inc Vegf/dll4-bindende midler og anvendelser deraf
PL3081576T3 (pl) 2013-12-12 2020-03-31 Shanghai Hengrui Pharmaceutical Co., Ltd. Przeciwciało anty pd-1, jego fragment wiążący antygen i ich zastosowanie medyczne
GB201403775D0 (en) 2014-03-04 2014-04-16 Kymab Ltd Antibodies, uses & methods
TW202132337A (zh) 2014-05-28 2021-09-01 美商艾吉納斯公司 抗糖皮質素誘導性tnfr家族相關性受體(gitr)抗體類及使用彼等之方法
JP6180663B2 (ja) 2014-12-23 2017-08-16 ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company Tigitに対する抗体
JP6861418B2 (ja) 2015-09-02 2021-04-28 イッサム リサーチ デベロップメント カンパニー オブ ザ ヘブリュー ユニバーシティー オブ エルサレム リミテッド ヒトt細胞免疫グロブリン及びitimドメイン(tigit)に特異的な抗体
ES2968074T3 (es) 2015-09-23 2024-05-07 Mereo Biopharma 5 Inc Anticuerpo bi-específico anti-VEGF/DLL4 para su uso en el tratamiento del cáncer de ovario resistente al platino
KR102220275B1 (ko) 2015-11-18 2021-02-26 머크 샤프 앤드 돔 코포레이션 Pd1 및/또는 lag3 결합제
PH12018502203B1 (en) * 2016-04-15 2024-05-15 Immunext Inc Anti-human vista antibodies and use thereof
TWI895621B (zh) 2016-05-27 2025-09-01 美商艾吉納斯公司 抗-tim-3抗體及其使用方法
JP7461741B2 (ja) 2016-06-20 2024-04-04 カイマブ・リミテッド 抗pd-l1およびil-2サイトカイン
US9567399B1 (en) 2016-06-20 2017-02-14 Kymab Limited Antibodies and immunocytokines
JP7198752B2 (ja) 2016-08-09 2023-01-04 カイマブ・リミテッド 抗icos抗体
WO2018041120A1 (en) 2016-08-31 2018-03-08 Beijing Biocytogen Co., Ltd Genetically modified non-human animal with human or chimeric tigit
CN107815467B (zh) 2016-08-31 2021-03-16 百奥赛图(北京)医药科技股份有限公司 人源化基因改造动物模型的制备方法及应用
EP3534947A1 (en) 2016-11-03 2019-09-11 Kymab Limited Antibodies, combinations comprising antibodies, biomarkers, uses & methods
WO2018102746A1 (en) * 2016-12-02 2018-06-07 Rigel Pharmaceuticals, Inc. Antigen binding molecules to tigit
US10232053B2 (en) 2016-12-30 2019-03-19 Trieza Therapeutics, Inc. Immunomodulatory oncolytic adenoviral vectors, and methods of production and use thereof for treatment of cancer
MX2019010458A (es) * 2017-03-03 2020-01-20 Rinat Neuroscience Corp Anticuerpos anti-gitr y metodos de uso de los mismos.
WO2018187191A1 (en) 2017-04-03 2018-10-11 Jounce Therapeutics, Inc Compositions and methods for the treatment of cancer
CN110621341A (zh) 2017-04-26 2019-12-27 百时美施贵宝公司 使二硫键还原最小化的抗体生产方法
LT3618863T (lt) 2017-05-01 2023-10-10 Agenus Inc. Anti-tigit antikūnai ir jų panaudojimo būdai
WO2018229163A1 (en) 2017-06-14 2018-12-20 King's College London Methods of activating v delta 2 negative gamma delta t cells
GB201709808D0 (en) * 2017-06-20 2017-08-02 Kymab Ltd Antibodies
BE1025333B1 (fr) * 2017-07-27 2019-01-23 Iteos Therapeutics S.A. Anticorps anti-tigit
WO2019023504A1 (en) 2017-07-27 2019-01-31 Iteos Therapeutics Sa ANTI-TIGIT ANTIBODIES
EP3689909A4 (en) * 2017-09-29 2021-12-29 Jiangsu Hengrui Medicine Co., Ltd. Tigit antibody, antigen-binding fragment thereof, and medical use thereof
GB201721338D0 (en) 2017-12-19 2018-01-31 Kymab Ltd Anti-icos Antibodies
US11629189B2 (en) 2017-12-19 2023-04-18 Kymab Limited Bispecific antibody for ICOS and PD-L1
TWI816729B (zh) 2017-12-30 2023-10-01 英屬開曼群島商百濟神州有限公司 抗tigit抗體及其作為治療和診斷的用途
US11708410B2 (en) 2018-01-15 2023-07-25 Nanjing Legend Biotech Co., Ltd. Antibodies and variants thereof against TIGIT
EP3746119A4 (en) * 2018-02-01 2021-11-10 Merck Sharp & Dohme Corp. METHOD OF TREATMENT FOR CANCER OR INFECTION USING A COMBINATION OF ANTI-PD-1 ANTIBODY, ANTI-LAG3 ANTIBODY, AND ANTI-TIGITE ANTIBODY
WO2019154415A1 (en) * 2018-02-06 2019-08-15 I-Mab Antibodies to t cell immunoreceptor with ig and itim domains (tigit) and uses thereof
MX2020008795A (es) * 2018-02-28 2020-10-08 Yuhan Corp Anti cuerpos anti tigit y usos de los mismos.
JP7611700B2 (ja) 2018-03-27 2025-01-10 ブリストル-マイヤーズ スクイブ カンパニー 紫外線シグナルを使用した力価のリアルタイムモニタリング
US20190300610A1 (en) * 2018-03-29 2019-10-03 Hummingbird Bioscience Pte. Ltd. Vista antigen-binding molecules
AR114789A1 (es) * 2018-04-18 2020-10-14 Hoffmann La Roche Anticuerpos anti-hla-g y uso de los mismos
KR102892725B1 (ko) 2018-05-09 2025-12-01 이슘 리서치 디벨롭먼트 컴퍼니 오브 더 히브루 유니버시티 오브 예루살렘 엘티디. 인간 넥틴4에 특이적인 항체
MX2020012797A (es) 2018-06-01 2021-03-25 Compugen Ltd Anticuerpos biespecificos anti-pvrig/anti-tigit y métodos de uso.
US11370837B2 (en) 2018-07-25 2022-06-28 Innovent Biologics (Suzhou) Co., Ltd. Anti-TIGIT antibody and use thereof
CN110511912B (zh) * 2018-08-30 2024-03-22 浙江煦顼技术有限公司 免疫细胞的功能调节
AU2019328575B2 (en) 2018-08-30 2024-07-11 Immunitybio, Inc. Single-chain and multi-chain chimeric polypeptides and uses thereof
JP7407822B2 (ja) 2018-08-30 2024-01-04 エイチシーダブリュー バイオロジックス インコーポレイテッド 単鎖キメラポリペプチドおよびその使用
CA3108949A1 (en) 2018-08-30 2020-03-05 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
CN113614109A (zh) 2018-12-21 2021-11-05 Ose免疫疗法公司 双功能抗pd-1/il-7分子
CA3125800A1 (en) * 2019-01-07 2020-07-16 iTeos Belgium SA Anti-tigit antibodies
WO2020165374A1 (en) 2019-02-14 2020-08-20 Ose Immunotherapeutics Bifunctional molecule comprising il-15ra
US20220135619A1 (en) 2019-02-24 2022-05-05 Bristol-Myers Squibb Company Methods of isolating a protein
US20220135682A1 (en) 2019-03-11 2022-05-05 Jounce Therapeutics, Inc. Anti-ICOS Antibodies for the Treatment of Cancer
CN111744007B (zh) * 2019-03-29 2023-05-12 江苏恒瑞医药股份有限公司 一种抗tigit抗体药物组合物及其用途
CN111744013B (zh) * 2019-03-29 2022-07-26 江苏恒瑞医药股份有限公司 抗tigit抗体联合pd-1抑制剂治疗疾病的方法和药物组合
US20220220430A1 (en) 2019-05-23 2022-07-14 Bristol-Myers Squibb Company Methods of monitoring cell culture media
AU2020290916A1 (en) * 2019-06-13 2021-11-04 Green Cross Corporation Antibody to TIGIT and use thereof
WO2020257639A1 (en) 2019-06-21 2020-12-24 HCW Biologics, Inc. Multi-chain chimeric polypeptides and uses thereof
CA3146986A1 (en) 2019-07-15 2021-01-21 Shanghai Junshi Biosciences Co., Ltd. Anti-tigit antibodies and application thereof
US11667709B2 (en) 2019-09-24 2023-06-06 Industrial Technology Research Institute Anti-TIGIT antibodies and methods of use
AU2020355614B2 (en) * 2019-09-27 2024-12-05 Glaxosmithkline Intellectual Property Development Limited Antigen binding proteins
US20220340660A1 (en) * 2019-10-01 2022-10-27 Merck Sharp & Dohme Corp. Biomarkers for anti-tigit antibody treatment
JP2022554270A (ja) 2019-11-05 2022-12-28 ジョンス セラピューティクス, インコーポレイテッド 抗pd-1抗体による癌を治療する方法
IL292757A (en) 2019-11-05 2022-07-01 Merck Patent Gmbh Anti-tigit antibodies and uses thereof
TW202124452A (zh) * 2019-11-14 2021-07-01 中國大陸商上海藥明生物技術有限公司 抗tigit的新型抗體
US20230057899A1 (en) 2019-12-05 2023-02-23 Compugen Ltd. Anti-pvrig and anti-tigit antibodies for enhanced nk-cell based tumor killing
WO2021122866A1 (en) 2019-12-17 2021-06-24 Ose Immunotherapeutics Bifunctional molecules comprising an il-7 variant
KR20220124718A (ko) 2020-01-07 2022-09-14 더 보드 오브 리젠츠 오브 더 유니버시티 오브 텍사스 시스템 암 치료를 위한 개선된 인간 메틸 티오아데노신/아데노신 고갈 효소 변이체
WO2021163369A2 (en) 2020-02-11 2021-08-19 HCW Biologics, Inc. Methods of treating age-related and inflammatory diseases
US12187763B2 (en) 2020-02-11 2025-01-07 Immunitybio, Inc. Chromatography resin and uses thereof
CA3169243A1 (en) 2020-02-11 2021-08-19 HCW Biologics, Inc. Methods of activating regulatory t cells
WO2021180205A1 (zh) 2020-03-13 2021-09-16 江苏恒瑞医药股份有限公司 Pvrig结合蛋白及其医药用途
WO2021216468A1 (en) * 2020-04-19 2021-10-28 Askgene Pharma Inc. Human tigit specific single domain antibodies and methods of use
JP7734693B2 (ja) 2020-04-29 2025-09-05 イミュニティーバイオ インコーポレイテッド 抗cd26タンパク質及びそれらの使用法
CN115943312A (zh) 2020-05-07 2023-04-07 法国居里学院 免疫抑制性成纤维细胞群体的生物标志物antxr1及其在预测对免疫疗法的反应中的用途
CN114507284B (zh) * 2020-05-09 2023-05-26 华博生物医药技术(上海)有限公司 抗tigit的抗体、其制备方法和应用
WO2021247003A1 (en) 2020-06-01 2021-12-09 HCW Biologics, Inc. Methods of treating aging-related disorders
US12024545B2 (en) 2020-06-01 2024-07-02 HCW Biologics, Inc. Methods of treating aging-related disorders
IL298608A (en) 2020-06-01 2023-01-01 Hcw Biologics Inc Methods of treating aging-related disorders
BR112022025801A2 (pt) 2020-06-18 2023-10-03 Hoffmann La Roche Métodos para tratar um paciente e para tratar um paciente com escc avançado, kit, anticorpo, uso de um anticorpo e uso de um antagonista de ligação
WO2021258337A1 (en) * 2020-06-24 2021-12-30 Huahui Health Ltd. Human monoclonal antibodies against tigit for immune related diseases
CN111718415B (zh) * 2020-07-03 2021-02-23 上海洛启生物医药技术有限公司 一种抗tigit纳米抗体及其应用
TW202216778A (zh) 2020-07-15 2022-05-01 美商安進公司 Tigit及cd112r阻斷
WO2022044010A1 (en) 2020-08-26 2022-03-03 Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. Anti-t-cell immunoglobulin and itim domain (tigit) antibodies for the treatment of fungal infections
JP2023544410A (ja) 2020-10-05 2023-10-23 ブリストル-マイヤーズ スクイブ カンパニー タンパク質を濃縮するための方法
US20230374128A1 (en) * 2020-10-09 2023-11-23 Keio University Therapeutic agent for immune/inflammatory disease
EP4240415A1 (en) 2020-11-08 2023-09-13 Seagen Inc. Combination-therapy antibody drug conjugate with immune cell inhibitor
WO2022112198A1 (en) 2020-11-24 2022-06-02 Worldwide Innovative Network Method to select the optimal immune checkpoint therapies
TW202222345A (zh) * 2020-11-26 2022-06-16 大陸商信達生物製藥(蘇州)有限公司 包含抗tigit/pd-1雙特異性抗體的製劑及其製備方法和用途
WO2022117572A2 (en) 2020-12-02 2022-06-09 Oncurious Nv An ltbr agonist in combination therapy against cancer
WO2022124864A1 (ko) * 2020-12-10 2022-06-16 주식회사 유틸렉스 항-tigit 항체 및 이의 용도
WO2022148781A1 (en) 2021-01-05 2022-07-14 Institut Curie Combination of mcoln activators and immune checkpoint inhibitors
AU2022207020A1 (en) 2021-01-14 2023-08-31 Shanghai Junshi Biosciences Co., Ltd. Anti-tigit antibody pharmaceutical composition and application thereof
CN114984227A (zh) * 2021-03-02 2022-09-02 百奥泰生物制药股份有限公司 抗tigit抗体在联合用药中的应用
CN114989300A (zh) * 2021-03-02 2022-09-02 百奥泰生物制药股份有限公司 抗tigit抗体在治疗肿瘤或癌症中的应用
WO2022204309A1 (en) * 2021-03-24 2022-09-29 Twist Bioscience Corporation Variant nucleic acid libraries for tigit
EP4320156A1 (en) 2021-04-09 2024-02-14 Ose Immunotherapeutics Scaffold for bifunctioanl molecules comprising pd-1 or cd28 and sirp binding domains
AU2022254727A1 (en) 2021-04-09 2023-10-12 Seagen Inc. Methods of treating cancer with anti-tigit antibodies
WO2022214653A1 (en) 2021-04-09 2022-10-13 Ose Immunotherapeutics New scaffold for bifunctional molecules with improved properties
TW202304965A (zh) 2021-05-04 2023-02-01 美商艾吉納斯公司 抗tigit抗體、抗cd96抗體及其使用方法
BR112023023453A8 (pt) * 2021-05-10 2024-02-15 Medimabbio Inc Anticorpo anti-tigit ou um fragmento de ligação ao antígeno deste, composições farmacêuticas e usos do referido anticorpo anti-tigit ou um fragmento de ligação ao antígeno deste
US20240239887A1 (en) * 2021-05-18 2024-07-18 Suzhou Kanova Biopharmaceutical Co., Ltd. Anti-tigit antibodies and their use
WO2023010094A2 (en) 2021-07-28 2023-02-02 Genentech, Inc. Methods and compositions for treating cancer
JP2024535768A (ja) 2021-09-15 2024-10-02 江蘇恒瑞医薬股▲ふん▼有限公司 抗pvrig/tigit二重特異性抗体を含む医薬組成物
KR20240055080A (ko) 2021-09-15 2024-04-26 지앙수 헨그루이 파마슈티컬스 컴퍼니 리미티드 Pd-1에 특이적으로 결합하는 단백질 및 그의 약학적 용도
CN115838424A (zh) * 2021-09-22 2023-03-24 上海康岱生物医药技术股份有限公司 靶向tigit的单克隆抗体
TW202321308A (zh) 2021-09-30 2023-06-01 美商建南德克公司 使用抗tigit抗體、抗cd38抗體及pd—1軸結合拮抗劑治療血液癌症的方法
WO2023108609A1 (en) * 2021-12-17 2023-06-22 Shanghai Nigene Biological Science And Technology Co., Ltd. Tigit antibodies and uses thereof
CN114181310B (zh) * 2022-02-14 2022-07-05 中山康方生物医药有限公司 抗tigit抗体、其药物组合物及用途
JP2025508939A (ja) 2022-03-02 2025-04-10 イミュニティーバイオ インコーポレイテッド 膵臓癌の治療方法
WO2023173011A1 (en) 2022-03-09 2023-09-14 Bristol-Myers Squibb Company Transient expression of therapeutic proteins
MX2024011278A (es) 2022-03-15 2024-09-25 Compugen Ltd Anticuerpos antagonistas de il-18bp y su uso en monoterapia y terapia de combinacion en el tratamiento del cancer.
US20250195645A1 (en) 2022-03-16 2025-06-19 Daiichi Sankyo Company, Limited Combination of multispecific molecule and immune checkpoint inhibitor
AU2023264591A1 (en) 2022-05-02 2024-11-07 Arcus Biosciences, Inc. Anti-tigit antibodies and uses of the same
AU2023284422A1 (en) 2022-06-07 2024-12-19 Genentech, Inc. Method for determining the efficacy of a lung cancer treatment comprising an anti-pd-l1 antagonist and an anti-tigit antagonist antibody
KR102769147B1 (ko) * 2022-06-10 2025-02-20 메디맵바이오 주식회사 Tigit에 특이적으로 결합하는 항체 및 인터류킨-15를 포함하는 융합 단백질 및 이의 용도
WO2023239228A1 (ko) * 2022-06-10 2023-12-14 메디맵바이오 주식회사 항-tigit 항체, 인터류킨-15, 및 인터류킨-15 수용체 알파 스시 도메인을 포함하는 융합 단백질 및 이의 용도
WO2024003360A1 (en) 2022-07-01 2024-01-04 Institut Curie Biomarkers and uses thereof for the treatment of neuroblastoma
WO2024028386A1 (en) 2022-08-02 2024-02-08 Ose Immunotherapeutics Multifunctional molecule directed against cd28
CN120076829A (zh) 2022-10-18 2025-05-30 明治制果药业株式会社 T细胞肿瘤的治疗剂
WO2024191807A1 (en) 2023-03-10 2024-09-19 Seagen Inc. Methods of treating cancer with anti-tigit antibodies
WO2024200823A1 (en) 2023-03-30 2024-10-03 Ose Immunotherapeutics Lipid-based nanoparticle targeted at activated immune cells for the expression of immune cell enhancing molecule and use thereof
WO2024200820A1 (en) 2023-03-30 2024-10-03 Ose Immunotherapeutics Method of synthesis of targeted lipid nanoparticle and uses thereof
TW202515608A (zh) 2023-06-26 2025-04-16 以色列商坎布根有限公司 Il—18bp拮抗抗體及其於癌症治療之單一療法及組合療法的用途
WO2025068452A1 (en) 2023-09-29 2025-04-03 Negio Therapeutics Guanfacine derivatives and their use in treating cancer
WO2025068461A1 (en) 2023-09-29 2025-04-03 Negio Therapeutics Guanfacine derivatives and their use in treating cancer
WO2025132831A1 (en) 2023-12-19 2025-06-26 Universite D'aix-Marseille N-heteroaryl derivatives and uses thereof for treating cancer
KR102872375B1 (ko) * 2024-01-24 2025-10-24 메디맵바이오 주식회사 Tigit에 특이적으로 결합하는 항-tigit 항체, 상기 항체 및 인터루킨-10를 포함하는 융합 단백질 및 이들의 용도
WO2025242835A1 (en) 2024-05-22 2025-11-27 Ose Immunotherapeutics Molecules comprising masking linkers and uses thereof for the treatment of cancer
WO2025242836A1 (en) 2024-05-22 2025-11-27 Ose Immunotherapeutics Molecules comprising masking linkers and uses thereof for the treatment of auto-immune or inflammatory diseases and disorders

Family Cites Families (103)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4399216A (en) 1980-02-25 1983-08-16 The Trustees Of Columbia University Processes for inserting DNA into eucaryotic cells and for producing proteinaceous materials
US4447233A (en) 1981-04-10 1984-05-08 Parker-Hannifin Corporation Medication infusion pump
US4439196A (en) 1982-03-18 1984-03-27 Merck & Co., Inc. Osmotic drug delivery system
US4447224A (en) 1982-09-20 1984-05-08 Infusaid Corporation Variable flow implantable infusion apparatus
US4487603A (en) 1982-11-26 1984-12-11 Cordis Corporation Implantable microinfusion pump system
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4740461A (en) 1983-12-27 1988-04-26 Genetics Institute, Inc. Vectors and methods for transformation of eucaryotic cells
DE3572982D1 (en) 1984-03-06 1989-10-19 Takeda Chemical Industries Ltd Chemically modified lymphokine and production thereof
US4596556A (en) 1985-03-25 1986-06-24 Bioject, Inc. Hypodermic injection apparatus
CA1319120C (en) 1985-04-01 1993-06-15 John Henry Kenten Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same
GB8601597D0 (en) 1986-01-23 1986-02-26 Wilson R H Nucleotide sequences
US4959455A (en) 1986-07-14 1990-09-25 Genetics Institute, Inc. Primate hematopoietic growth factors IL-3 and pharmaceutical compositions
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
EP0281604B1 (en) 1986-09-02 1993-03-31 Enzon Labs Inc. Single polypeptide chain binding molecules
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US4912040A (en) 1986-11-14 1990-03-27 Genetics Institute, Inc. Eucaryotic expression system
DE3883899T3 (de) 1987-03-18 1999-04-22 Sb2, Inc., Danville, Calif. Geänderte antikörper.
US4941880A (en) 1987-06-19 1990-07-17 Bioject, Inc. Pre-filled ampule and non-invasive hypodermic injection device assembly
US4790824A (en) 1987-06-19 1988-12-13 Bioject, Inc. Non-invasive hypodermic injection device
GB8717430D0 (en) 1987-07-23 1987-08-26 Celltech Ltd Recombinant dna product
US5677425A (en) 1987-09-04 1997-10-14 Celltech Therapeutics Limited Recombinant antibody
JP2989002B2 (ja) 1988-12-22 1999-12-13 キリン―アムジエン・インコーポレーテツド 化学修飾顆粒球コロニー刺激因子
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
DE3920358A1 (de) 1989-06-22 1991-01-17 Behringwerke Ag Bispezifische und oligospezifische, mono- und oligovalente antikoerperkonstrukte, ihre herstellung und verwendung
US5064413A (en) 1989-11-09 1991-11-12 Bioject, Inc. Needleless hypodermic injection device
US5312335A (en) 1989-11-09 1994-05-17 Bioject Inc. Needleless hypodermic injection device
EP0617706B1 (en) 1991-11-25 2001-10-17 Enzon, Inc. Multivalent antigen-binding proteins
US5932448A (en) 1991-11-29 1999-08-03 Protein Design Labs., Inc. Bispecific antibody heterodimers
US5714350A (en) 1992-03-09 1998-02-03 Protein Design Labs, Inc. Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region
US6129914A (en) 1992-03-27 2000-10-10 Protein Design Labs, Inc. Bispecific antibody effective to treat B-cell lymphoma and cell line
EP0640094A1 (en) 1992-04-24 1995-03-01 The Board Of Regents, The University Of Texas System Recombinant production of immunoglobulin-like domains in prokaryotic cells
US5383851A (en) 1992-07-24 1995-01-24 Bioject Inc. Needleless hypodermic injection device
DE69330523D1 (de) 1992-08-21 2001-09-06 Vrije Universiteit Brussel Bru Immunoglobuline ohne leichte ketten
US6005079A (en) 1992-08-21 1999-12-21 Vrije Universiteit Brussels Immunoglobulins devoid of light chains
ES2162863T3 (es) 1993-04-29 2002-01-16 Unilever Nv Produccion de anticuerpos o fragmentos (funcionalizados) de los mismos derivados de inmunoglobulinas de cadena pesada de camelidae.
WO1994029351A2 (en) 1993-06-16 1994-12-22 Celltech Limited Antibodies
US5532210A (en) 1994-06-08 1996-07-02 E. I. Du Pont De Nemours And Company High temperature superconductor dielectric slow wave structures for accelerators and traveling wave tubes
US6121022A (en) 1995-04-14 2000-09-19 Genentech, Inc. Altered polypeptides with increased half-life
US5869046A (en) 1995-04-14 1999-02-09 Genentech, Inc. Altered polypeptides with increased half-life
US6277375B1 (en) 1997-03-03 2001-08-21 Board Of Regents, The University Of Texas System Immunoglobulin-like domains with increased half-lives
ATE319745T1 (de) 1997-05-21 2006-03-15 Biovation Ltd Verfahren zur herstellung von nicht-immunogenen proteinen
US6194551B1 (en) 1998-04-02 2001-02-27 Genentech, Inc. Polypeptide variants
US20030175884A1 (en) 2001-08-03 2003-09-18 Pablo Umana Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity
GB9818110D0 (en) 1998-08-19 1998-10-14 Weston Medical Ltd Needleless injectors and other devices
US6096002A (en) 1998-11-18 2000-08-01 Bioject, Inc. NGAS powered self-resetting needle-less hypodermic jet injection apparatus and method
MXPA01005515A (es) 1998-12-01 2003-07-14 Protein Design Labs Inc Anticuerpos humanizados para gamma-interferon.
KR101077001B1 (ko) 1999-01-15 2011-10-26 제넨테크, 인크. 효과기 기능이 변화된 폴리펩티드 변이체
US7368527B2 (en) 1999-03-12 2008-05-06 Human Genome Sciences, Inc. HADDE71 polypeptides
CA2368467A1 (en) 1999-03-26 2000-10-05 Human Genome Sciences, Inc. 50 human secreted proteins
AU3672800A (en) 1999-04-09 2000-11-14 Kyowa Hakko Kogyo Co. Ltd. Method for controlling the activity of immunologically functional molecule
EP1229125A4 (en) 1999-10-19 2005-06-01 Kyowa Hakko Kogyo Kk PROCESS FOR PREPARING A POLYPEPTIDE
US7029872B2 (en) 2000-06-28 2006-04-18 Glycofi, Inc Methods for producing modified glycoproteins
US7449308B2 (en) 2000-06-28 2008-11-11 Glycofi, Inc. Combinatorial DNA library for producing modified N-glycans in lower eukaryotes
US6946292B2 (en) 2000-10-06 2005-09-20 Kyowa Hakko Kogyo Co., Ltd. Cells producing antibody compositions with increased antibody dependent cytotoxic activity
US6374470B1 (en) 2000-10-06 2002-04-23 Milliken & Company Face plate for spun-like textured yarn
US7408041B2 (en) 2000-12-08 2008-08-05 Alexion Pharmaceuticals, Inc. Polypeptides and antibodies derived from chronic lymphocytic leukemia cells and uses thereof
JP2005535290A (ja) 2002-02-22 2005-11-24 ジェネンテック・インコーポレーテッド 免疫関連疾患の治療のための組成物と方法
US7193069B2 (en) 2002-03-22 2007-03-20 Research Association For Biotechnology Full-length cDNA
US20070134247A9 (en) 2002-04-12 2007-06-14 Ramot At Tel Aviv University Ltd. Prevention of brain inflammation as a result of induced autoimmune response
US20040121370A1 (en) 2002-09-11 2004-06-24 Genentech, Inc. Novel composition and methods for the treatment of immune related diseases
CA2497337A1 (en) 2002-09-11 2004-03-25 Genentech, Inc. Novel composition and methods for the treatment of psoriasis
DK1551876T3 (da) 2002-10-16 2011-06-14 Purdue Pharma Lp Antistoffer, der binder til celle-associerede ca 125/0722P og fremgangsmåder til anvendelse deraf
US20090047213A1 (en) * 2003-04-14 2009-02-19 Young David S F Cytotoxicity mediation of cells evidencing surface expression of CD59
US7410483B2 (en) 2003-05-23 2008-08-12 Novare Surgical Systems, Inc. Hand-actuated device for remote manipulation of a grasping tool
US7312320B2 (en) 2003-12-10 2007-12-25 Novimmune Sa Neutralizing antibodies and methods of use thereof
US20110142858A1 (en) 2004-06-07 2011-06-16 Ramot At Tel Aviv University Ltd. Method of Passsive Immunization Against Disease or Disorder Charcterized by Amyloid Aggregation with Diminished Risk of Neuroinflammation
WO2006014679A1 (en) 2004-07-21 2006-02-09 Glycofi, Inc. Immunoglobulins comprising predominantly a glcnac2man3glcnac2 glycoform
CN101023102B (zh) * 2004-09-17 2013-05-29 霍夫曼-拉罗奇有限公司 抗-ox40l抗体
WO2006124667A2 (en) 2005-05-12 2006-11-23 Zymogenetics, Inc. Compositions and methods for modulating immune responses
DK1904104T3 (da) 2005-07-08 2013-11-11 Biogen Idec Inc SP35-antistoffer og anvendelser heraf
WO2008047914A1 (fr) * 2006-10-20 2008-04-24 Forerunner Pharma Research Co., Ltd. Agent anticancéreux comprenant un anticorps anti-hb-egf en tant qu'ingrédient actif
EA200970477A1 (ru) * 2006-11-15 2009-12-30 Медарекс, Инк. Человеческие моноклональные антитела к btla и способы применения
MX2009008140A (es) * 2007-02-02 2009-10-26 Baylor Res Inst Vacunas a base de antigeno dirigido a dcir expresado en celulas que presentan antigeno.
ATE554791T1 (de) * 2007-02-23 2012-05-15 Schering Corp Gentechnisch hergestellte anti-il-23p19- antikörper
HUE040467T2 (hu) 2007-04-03 2019-03-28 Amgen Res Munich Gmbh Keresztfaj-specifikus kötõdomén
EP3605088A1 (en) * 2008-04-09 2020-02-05 Genentech, Inc. Compositions and methods for the treatment of immune related diseases
AU2015202123B2 (en) 2008-04-09 2017-06-15 Genentech, Inc. Novel compositions and methods for the treatment of immune related diseases
ES2624835T3 (es) 2009-08-06 2017-07-17 Immunas Pharma, Inc. Anticuerpos que se unen específicamente a los oligómeros A beta y uso de los mismos
JP2013507378A (ja) 2009-10-09 2013-03-04 メルク・シャープ・エンド・ドーム・コーポレイション 抗her3抗体の製造、特徴づけ及びその用途
US8968750B2 (en) 2009-12-05 2015-03-03 Ruprecht-Karls-Universität Heidelberg Malaria vaccines based on apicomplexan ferlins, ferlin-like proteins and other C2-domain containing proteins
BR112012026227A2 (pt) 2010-04-13 2020-08-04 Celldex Therapeutics, Inc. anticorpo monoclonal humano ou humanizado, molécula biespecífica, vetor de expressão, célula transformada, composição, e, usos de um anticorpo
BR112012031329A2 (pt) 2010-06-09 2016-10-11 Zymogenetics Inc proteínas de fusão diméricas vstm3 e composições e métodos relacionados
EA031849B1 (ru) 2010-08-23 2019-03-29 Борд Оф Риджентс, Дзе Юниверсити Оф Техас Систем Антитела к ox40 и способы их применения
UA112434C2 (uk) 2011-05-27 2016-09-12 Ґлаксо Ґруп Лімітед Антигензв'язувальний білок, який специфічно зв'язується з всма
US9205144B2 (en) 2011-06-03 2015-12-08 Dana-Farber Cancer Institute, Inc. Identification of conserved peptide blocks in homologous polypeptides
KR20130062168A (ko) 2011-12-02 2013-06-12 고려대학교 산학협력단 재조합 형광 단백질 나노입자
CA2865501A1 (en) 2012-02-29 2013-09-06 Gilead Biologics, Inc. Antibodies to matrix metalloproteinase 9
WO2013148316A1 (en) 2012-03-29 2013-10-03 Biogen Idec Ma Inc. Biomarkers for use in integrin therapy applications
US9637740B2 (en) 2012-04-02 2017-05-02 President And Fellows Of Harvard College Cancer treatment and immune system regulation through FAT10 pathway inhibition
EP2858673A4 (en) 2012-06-06 2016-06-22 Oncomed Pharm Inc BINDING AGENTS MODULATING THE HIPPO SIGNALING PATH AND USES THEREOF
CN104968364A (zh) 2012-12-03 2015-10-07 百时美施贵宝公司 强化免疫调变性Fc融合蛋白的抗癌活性
AR093788A1 (es) * 2012-12-04 2015-06-24 Oncomed Pharm Inc Inmunoterapia con agentes de enlace
CN103073644B (zh) * 2012-12-31 2014-03-12 中国科学技术大学 特异性抗小鼠tigit的单克隆抗体及其制备方法、鉴定及应用
US20140314741A1 (en) 2013-04-18 2014-10-23 Developmen Center For Biotechnology Human Antibody against Interleukin-20 and Treatment for Inflammatory Diseases
RU2702108C2 (ru) 2013-07-16 2019-10-04 Дженентек, Инк. Способы лечения рака с использованием антагонистов, связывающих с осью pd-1, и ингибиторов tigit
EP3107937A4 (en) 2014-02-21 2017-11-15 MedImmune, LLC Anti-pcsk9~glp-1 fusions and methods for use
MX2016017288A (es) 2014-07-16 2017-06-27 Genentech Inc Metodos para tratar el cancer con inhibidores de tigit y agentes contra el cancer.
US20160355589A1 (en) 2014-08-19 2016-12-08 Merck Sharp & Dohme Corp. Anti-tigit antibodies
WO2016073282A1 (en) 2014-11-06 2016-05-12 Genentech, Inc. Combination therapy comprising ox40 binding agonists and tigit inhibitors
HRP20201756T8 (hr) 2014-11-21 2021-08-20 Bristol-Myers Squibb Company Antitijela koja sadrže modificirane regije teškog lanca
JP6180663B2 (ja) 2014-12-23 2017-08-16 ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company Tigitに対する抗体
TWI715587B (zh) 2015-05-28 2021-01-11 美商安可美德藥物股份有限公司 Tigit結合劑和彼之用途
MY186016A (en) 2015-09-25 2021-06-14 Genentech Inc Anti-tigit antibodies and methods of use

Cited By (92)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12509509B2 (en) 2013-12-09 2025-12-30 Merck Sharp & Dohme Llc Solution formulations of engineered anti-IL-23p19 antibodies
US12102680B2 (en) 2014-08-19 2024-10-01 Merck Sharp & Dohme Llc Anti-TIGIT antibodies
US10618958B2 (en) 2014-08-19 2020-04-14 Merck Sharp & Dohme Corp. Anti-TIGIT antibodies
US11795220B2 (en) 2015-02-19 2023-10-24 Compugen Ltd. Anti-PVRIG antibodies and methods of use
US12312404B2 (en) 2015-02-19 2025-05-27 Compugen Ltd. Anti-PVRIG antibodies and methods of use
US11795209B2 (en) 2015-02-19 2023-10-24 Compugen Ltd. PVRIG polypeptides and methods of treatment
US11623955B2 (en) 2015-02-19 2023-04-11 Compugen Ltd. Anti-PVRIG antibodies and methods of use
US10259882B2 (en) 2015-05-07 2019-04-16 Agenus Inc. Anti-OX40 antibodies
US11332536B2 (en) 2015-05-07 2022-05-17 Agenus Inc. Vectors comprising nucleic acids encoding anti-OX40 antibodies
US10626181B2 (en) 2015-05-07 2020-04-21 Agenus Inc. Nucleic acids encoding anti-OX40 antibodies
US11136404B2 (en) 2015-05-07 2021-10-05 Agenus Inc. Anti-OX40 antibodies
US11472883B2 (en) 2015-05-07 2022-10-18 Agenus Inc. Methods of administering anti-OX40 antibodies
US10112997B2 (en) 2015-05-28 2018-10-30 Oncomed Pharmaceuticals, Inc. Tight-binding agents and uses thereof
US10544219B2 (en) 2015-05-28 2020-01-28 Oncomed Pharmaceuticals, Inc. TIGIT-binding agents and uses thereof
US11958902B2 (en) 2015-08-14 2024-04-16 Merck Sharp & Dohme Llc Anti-TIGIT antibodies
US10766957B2 (en) 2015-08-14 2020-09-08 Merck Sharp & Dohme Corp Anti-TIGIT antibodies
US10450373B2 (en) 2015-09-01 2019-10-22 Agenus Inc. Anti-PD-1 antibodies and methods of use thereof
US11345755B2 (en) 2015-09-01 2022-05-31 Agenus Inc. Anti-PD-1 antibodies and methods of use thereof
US10323091B2 (en) 2015-09-01 2019-06-18 Agenus Inc. Anti-PD-1 antibodies and methods of use thereof
US11590224B2 (en) 2015-10-01 2023-02-28 Potenza Therapeutics, Inc. Anti-TIGIT antigen-binding proteins and methods of uses thereof
US10507244B2 (en) 2015-10-01 2019-12-17 Potenza Therapeutics, Inc. Anti-TIGIT antigen-binding proteins and methods of use thereof
US20170165366A1 (en) * 2015-10-01 2017-06-15 Potenza Therapeutics, Inc. Anti-TIGIT Antigen-Binding Proteins and Methods of Use Thereof
US9713641B2 (en) * 2015-10-01 2017-07-25 Potenza Therapeutics, Inc. Anti-TIGIT antigen-binding proteins and methods of use thereof
US11447557B2 (en) 2015-12-02 2022-09-20 Agenus Inc. Antibodies and methods of use thereof
US10836830B2 (en) 2015-12-02 2020-11-17 Agenus Inc. Antibodies and methods of use thereof
US11723971B2 (en) * 2016-03-04 2023-08-15 JN Biosciences, LLC Antibodies to TIGIT
US10894823B2 (en) 2016-03-24 2021-01-19 Gensun Biopharma Inc. Trispecific inhibitors for cancer treatment
US10751415B2 (en) 2016-08-17 2020-08-25 Compugen Ltd. Anti-TIGIT antibodies, anti-PVRIG antibodies and combinations thereof
US10124061B2 (en) 2016-08-17 2018-11-13 Compugen Ltd. Anti-TIGIT antibodies, anti-PVRIG antibodies and combinations thereof
US11701424B2 (en) 2016-08-17 2023-07-18 Compugen Ltd. Anti-TIGIT antibodies, anti-PVRIG antibodies and combinations thereof
US10213505B2 (en) 2016-08-17 2019-02-26 Compugen Ltd. Anti-TIGIT anibodies, anti-PVRIG antibodies and combinations thereof
US11993651B2 (en) 2016-10-11 2024-05-28 Agenus Inc. Anti-lag-3 antibodies and methods of use thereof
US12187795B2 (en) 2016-10-11 2025-01-07 Agenus Inc. Anti-LAG-3 antibodies and methods of use thereof
US10844119B2 (en) 2016-10-11 2020-11-24 Agenus Inc. Anti-LAG-3 antibodies and methods of use thereof
US10882908B2 (en) 2016-10-11 2021-01-05 Agenus Inc. Anti-LAG-3 antibodies and methods of use thereof
EP4545093A2 (en) 2016-11-04 2025-04-30 Aximmune, Inc. Beta-alethine, immune modulatos, and uses thereof
WO2018085698A1 (en) 2016-11-04 2018-05-11 Aximmune, Inc. Beta-alethine, immune modulators, and uses thereof
US11359028B2 (en) 2016-11-09 2022-06-14 Agenus Inc. Anti-OX40 antibodies and anti-GITR antibodies
US11136384B2 (en) 2016-11-30 2021-10-05 Mereo Biopharma 5, Inc. Methods for treatment of cancer comprising TIGIT-binding agents
US11230596B2 (en) 2016-11-30 2022-01-25 Mereo Biopharma 5, Inc. Methods for treatment of cancer comprising TIGIT-binding agents
US11993653B2 (en) 2016-12-07 2024-05-28 Agenus Inc. Antibodies and methods of use thereof
WO2018128939A1 (en) * 2017-01-05 2018-07-12 Gensun Biopharma Inc. Checkpoint regulator antagonists
US12350333B2 (en) 2017-01-05 2025-07-08 Gensun Biopharma Inc. Checkpoint regulator antagonists
CN109071656A (zh) * 2017-01-05 2018-12-21 源晟生物制药股份有限公司 检查点调节物拮抗剂
US11517623B2 (en) 2017-01-05 2022-12-06 Gensun Biopharma, Inc. Anti-PD-1 antibodies, antigen-binding portions thereof and checkpoint regulator antogonists comprising the same
US10537637B2 (en) 2017-01-05 2020-01-21 Gensun Biopharma Inc. Checkpoint regulator antagonists
US11453720B2 (en) 2017-03-30 2022-09-27 Potenza Therapeutics, Inc. Anti-TIGIT antigen-binding proteins and methods of use thereof
EP4286009A2 (en) 2017-04-21 2023-12-06 Sillajen, Inc. Oncolytic vaccinia virus and checkpoint inhibitor combination therapy
WO2018195552A1 (en) 2017-04-21 2018-10-25 Sillajen, Inc. Oncolytic vaccinia virus and checkpoint inhibitor combination therapy
IL270175B2 (en) * 2017-05-02 2023-09-01 Merck Sharp & Dohme Stable formulations of anti-tigit antibodies alone, and in combination with programmed death receptor 1 (pd-1) antibodies, and methods of using them
CN110603052A (zh) * 2017-05-02 2019-12-20 默沙东公司 单独的和与程序性死亡受体1(pd-1)抗体组合的抗tigit抗体的稳定制剂及其使用方法
US11633476B2 (en) 2017-05-02 2023-04-25 Merck Sharp & Dohme Llc Stable formulations of programmed death receptor 1 (PD-1) antibodies and methods of use thereof
IL270175B1 (en) * 2017-05-02 2023-05-01 Merck Sharp & Dohme Stable formulations of anti-tigit antibodies alone, and in combination with programmed death receptor 1 (pd-1) antibodies, and methods of using them
WO2018204405A1 (en) * 2017-05-02 2018-11-08 Merck Sharp & Dohme Corp. Stable formulations of anti-tigit antibodies alone and in combination with programmed death receptor 1 (pd-1) antibodies and methods of use thereof
US11845798B2 (en) 2017-05-02 2023-12-19 Merck Sharp & Dohme Llc Formulations of anti-LAG3 antibodies and co-formulations of anti-LAG3 antibodies and anti-PD-1 antibodies
US12152084B2 (en) 2017-06-01 2024-11-26 Compugen Ltd. Triple combination antibody therapies
US11225523B2 (en) 2017-06-01 2022-01-18 Compugen Ltd. Triple combination antibody therapies
CN110997720A (zh) * 2017-07-27 2020-04-10 Iteos治疗公司 抗tigit抗体
US20210054071A1 (en) * 2017-12-28 2021-02-25 Nanjing Legend Biotech Co., Ltd. Single-domain antibodies and variants thereof against tigit
US11905327B2 (en) * 2017-12-28 2024-02-20 Nanjing Legend Biotech Co., Ltd. Single-domain antibodies and variants thereof against TIGIT
US11851493B2 (en) 2018-06-29 2023-12-26 Gensun Biopharma, Inc. Trispecific antagonists
US11667716B2 (en) 2018-06-29 2023-06-06 Gensun Biopharma, Inc. Bispecific antagonist comprising a LAG-3 binding domain
US12404336B2 (en) 2018-06-29 2025-09-02 Gensun Biopharma, Inc. Bispecific antagonist comprising a LAG-3 binding domain
US11001635B2 (en) 2018-06-29 2021-05-11 Gensun Biopharma Inc. Antitumor antagonists
US11945873B2 (en) 2018-06-29 2024-04-02 Gensun Biopharma, Inc. Antitumor antagonists
US10597453B2 (en) 2018-06-29 2020-03-24 Gensun Biopharma, Inc. Antitumor immune checkpoint regulator antagonists
US11518813B2 (en) 2018-06-29 2022-12-06 Gensun Biopharma, Inc. Trispecific antagonists
US10647773B2 (en) 2018-06-29 2020-05-12 Gensun Biopharma, Inc. Trispecific antagonists
US11401339B2 (en) 2018-08-23 2022-08-02 Seagen Inc. Anti-TIGIT antibodies
WO2020096915A1 (en) * 2018-11-05 2020-05-14 Merck Sharp & Dohme Corp. Dosing regimen of anti-tigit antibody for treatment of cancer
RU2833669C2 (ru) * 2018-11-05 2025-01-28 МЕРК ШАРП И ДОУМ ЭлЭлСи Режим введения антитела к tigit для лечения рака
US12319735B2 (en) 2018-11-07 2025-06-03 Merck Sharp & Dohme Llc Co-formulations of anti-LAG3 antibodies and anti-PD-1 antibodies
WO2020242919A1 (en) 2019-05-29 2020-12-03 Eli Lilly And Company Tigit and pd-1/tigit-binding molecules
US10851157B2 (en) 2019-07-01 2020-12-01 Gensun Biopharma, Inc. Antagonists targeting the TGF-β pathway
US12018073B2 (en) 2019-07-01 2024-06-25 Gensun Biopharma, Inc. Antagonists targeting the TGF-β pathway
WO2021021767A1 (en) * 2019-07-30 2021-02-04 Merck Sharp & Dohme Corp. Anti-pd-1/lag3/tigit trispecific antibodies and anti-pd-1/lag3 bispecific antibodies
US20230235037A1 (en) * 2020-04-22 2023-07-27 Chemomab Ltd. Method of treatment using anti-ccl24 antibody
WO2021217893A1 (zh) 2020-04-29 2021-11-04 广州昂科免疫生物技术有限公司 结合tigit抗原的抗体及其制备方法与应用
US12415854B2 (en) 2020-06-02 2025-09-16 Arcus Biosciences, Inc. Antibodies to TIGIT
US11820824B2 (en) 2020-06-02 2023-11-21 Arcus Biosciences, Inc. Antibodies to TIGIT
EP4192883A4 (en) * 2020-08-05 2024-12-04 Crystal Bioscience Inc. Anti-tigit antibody and methods of use thereof
US11028172B1 (en) * 2020-11-10 2021-06-08 Lepu Biopharma Co., Ltd. Anti-TIGIT antibodies and uses thereof
US11883432B2 (en) 2020-12-18 2024-01-30 Century Therapeutics, Inc. Chimeric antigen receptor system with adaptable receptor specificity
US12133966B2 (en) * 2020-12-22 2024-11-05 Regina E. HERZLINGER Methods, systems, and apparatus for administering an antibody treatment via infusion
US20220379026A1 (en) * 2020-12-22 2022-12-01 Regina E. HERZLINGER Methods, systems, and apparatus for administering an antibody treatment via infusion
US20220193236A1 (en) * 2020-12-22 2022-06-23 Regina E. HERZLINGER Methods, systems, and apparatus for administering a monoclonal and/or polyclonal antibody treatment via rapid infusion
US11806507B2 (en) * 2020-12-22 2023-11-07 Regina E. HERZLINGER Methods, systems, and apparatus for administering an antibody treatment via infusion
US20240050646A1 (en) * 2020-12-22 2024-02-15 Regina E. HERZLINGER Methods, systems, and apparatus for administering an antibody treatment via infusion
US11806397B2 (en) * 2020-12-22 2023-11-07 Regina E. HERZLINGER Methods, systems, and apparatus for administering a monoclonal and/or polyclonal antibody treatment via rapid infusion
WO2022257279A1 (en) * 2021-06-10 2022-12-15 Beijing Mabworks Biotech Co., Ltd. Antibodies binding tigit and uses thereof
WO2023036340A1 (en) * 2021-09-13 2023-03-16 Biocytogen Pharmaceuticals (Beijing) Co., Ltd. Protein complexes targeting il21 pathway
WO2023170606A1 (en) 2022-03-08 2023-09-14 Alentis Therapeutics Ag Use of anti-claudin-1 antibodies to increase t cell availability

Also Published As

Publication number Publication date
EP3183267A1 (en) 2017-06-28
JOP20200192A1 (ar) 2022-10-30
JO3664B1 (ar) 2020-08-27
US10618958B2 (en) 2020-04-14
CO2017001561A2 (es) 2017-05-19
ZA201700955B (en) 2022-11-30
JP2017532007A (ja) 2017-11-02
AP2017009765A0 (en) 2017-02-28
GT201700033A (es) 2019-09-30
US20180066055A1 (en) 2018-03-08
AU2015305754A1 (en) 2017-02-23
NZ729162A (en) 2024-08-30
CA2957722A1 (en) 2016-02-25
JP7066777B2 (ja) 2022-05-13
CN107148430A (zh) 2017-09-08
JP2020162614A (ja) 2020-10-08
SG11201701161QA (en) 2017-03-30
IL250583B (en) 2022-07-01
CL2019001926A1 (es) 2019-11-29
JP2022105108A (ja) 2022-07-12
MD4733B1 (ro) 2020-12-31
AU2019200426B2 (en) 2021-01-21
CA2957722C (en) 2022-05-31
TWI724997B (zh) 2021-04-21
BR112017003108A2 (pt) 2017-12-05
CN113583131A (zh) 2021-11-02
MX2017002229A (es) 2017-05-09
AU2015305754B2 (en) 2018-10-25
US20250064924A1 (en) 2025-02-27
MD20170032A2 (ro) 2017-08-31
CN113583131B (zh) 2024-09-03
MA40475A (fr) 2017-06-28
JP6920194B2 (ja) 2021-08-18
MX389684B (es) 2025-03-20
KR102050082B1 (ko) 2019-11-29
NZ766881A (en) 2024-08-30
TN2017000024A1 (en) 2018-07-04
TW202144422A (zh) 2021-12-01
CN107148430B (zh) 2021-08-27
MD4733C1 (ro) 2021-07-31
JP7487256B2 (ja) 2024-05-20
MY184288A (en) 2021-03-30
AU2019200426A1 (en) 2019-02-07
AU2021202360A1 (en) 2021-05-13
BR112017003108A8 (pt) 2023-04-11
US20170198042A1 (en) 2017-07-13
KR20170041272A (ko) 2017-04-14
NI201700019A (es) 2017-03-08
GEP20217331B (en) 2021-12-10
EA201790413A1 (ru) 2017-08-31
PH12017500296A1 (en) 2017-06-28
KR20190133078A (ko) 2019-11-29
CR20170060A (es) 2017-04-18
US20200270346A1 (en) 2020-08-27
PH12017500296B1 (en) 2017-06-28
TW201609813A (zh) 2016-03-16
WO2016028656A1 (en) 2016-02-25
MY198017A (en) 2023-07-26
US12102680B2 (en) 2024-10-01
IL250583A0 (en) 2017-04-30
CL2017000310A1 (es) 2017-08-18
UA122395C2 (uk) 2020-11-10
TWI790593B (zh) 2023-01-21
KR102321168B1 (ko) 2021-11-02
AU2021202360B2 (en) 2024-08-08
PE20170289A1 (es) 2017-04-05
EA036311B1 (ru) 2020-10-26
MX2022001105A (es) 2022-02-14
DOP2017000046A (es) 2017-08-31

Similar Documents

Publication Publication Date Title
US20250064924A1 (en) Anti-tigit antibodies
US11958902B2 (en) Anti-TIGIT antibodies
US11278620B2 (en) Anti-LAG3 antibodies and antigen-binding fragments
CA2994555C (en) Anti-tigit antibodies

Legal Events

Date Code Title Description
AS Assignment

Owner name: MERCK SHARP & DOHME CORP., NEW JERSEY

Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:WILLIAMS, SYBIL M. G.;LA FACE, DRAKE;FAYADAT-DILMAN, LAURENCE;AND OTHERS;SIGNING DATES FROM 20150722 TO 20150727;REEL/FRAME:040013/0301

STCB Information on status: application discontinuation

Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION