US20150118264A1 - Pharmaceutical composition comprising a polymeric carrier cargo complex and at least one protein or peptide antigen - Google Patents
Pharmaceutical composition comprising a polymeric carrier cargo complex and at least one protein or peptide antigen Download PDFInfo
- Publication number
- US20150118264A1 US20150118264A1 US14/375,215 US201314375215A US2015118264A1 US 20150118264 A1 US20150118264 A1 US 20150118264A1 US 201314375215 A US201314375215 A US 201314375215A US 2015118264 A1 US2015118264 A1 US 2015118264A1
- Authority
- US
- United States
- Prior art keywords
- protein
- antigen
- arg
- polymeric carrier
- nucleic acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 102000036639 antigens Human genes 0.000 title claims abstract description 264
- 108091007433 antigens Proteins 0.000 title claims abstract description 264
- 239000000427 antigen Substances 0.000 title claims abstract description 257
- 239000008194 pharmaceutical composition Substances 0.000 title claims abstract description 42
- 108090000765 processed proteins & peptides Proteins 0.000 title claims description 271
- 108090000623 proteins and genes Proteins 0.000 title claims description 254
- 102000004169 proteins and genes Human genes 0.000 title claims description 236
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 311
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 302
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 302
- 125000002091 cationic group Chemical group 0.000 claims abstract description 188
- 239000002671 adjuvant Substances 0.000 claims abstract description 69
- 239000012634 fragment Substances 0.000 claims abstract description 68
- 244000052769 pathogen Species 0.000 claims abstract description 53
- 230000001717 pathogenic effect Effects 0.000 claims abstract description 39
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 34
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 21
- 208000026935 allergic disease Diseases 0.000 claims abstract description 18
- 208000015181 infectious disease Diseases 0.000 claims abstract description 18
- 208000035473 Communicable disease Diseases 0.000 claims abstract description 16
- 201000011510 cancer Diseases 0.000 claims abstract description 14
- 206010020751 Hypersensitivity Diseases 0.000 claims abstract description 13
- 230000007815 allergy Effects 0.000 claims abstract description 13
- 208000023275 Autoimmune disease Diseases 0.000 claims abstract description 11
- 235000018102 proteins Nutrition 0.000 claims description 235
- 235000001014 amino acid Nutrition 0.000 claims description 179
- 150000001413 amino acids Chemical class 0.000 claims description 160
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 120
- 210000004027 cell Anatomy 0.000 claims description 102
- 108091032973 (ribonucleotides)n+m Proteins 0.000 claims description 93
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 claims description 51
- 230000003308 immunostimulating effect Effects 0.000 claims description 46
- 241000700605 Viruses Species 0.000 claims description 19
- 102000005962 receptors Human genes 0.000 claims description 19
- 108020003175 receptors Proteins 0.000 claims description 19
- 235000018417 cysteine Nutrition 0.000 claims description 16
- 241000700584 Simplexvirus Species 0.000 claims description 9
- 241000701806 Human papillomavirus Species 0.000 claims description 8
- 241000725643 Respiratory syncytial virus Species 0.000 claims description 8
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 claims description 8
- 238000002560 therapeutic procedure Methods 0.000 claims description 8
- 239000004475 Arginine Substances 0.000 claims description 7
- 239000004472 Lysine Substances 0.000 claims description 7
- 108010038807 Oligopeptides Proteins 0.000 claims description 7
- 102000015636 Oligopeptides Human genes 0.000 claims description 7
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 claims description 7
- 244000137850 Marrubium vulgare Species 0.000 claims description 6
- 108020000999 Viral RNA Proteins 0.000 claims description 6
- 239000011159 matrix material Substances 0.000 claims description 6
- 241000700721 Hepatitis B virus Species 0.000 claims description 5
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 claims description 5
- 102000018697 Membrane Proteins Human genes 0.000 claims description 5
- 108010052285 Membrane Proteins Proteins 0.000 claims description 5
- 241001465754 Metazoa Species 0.000 claims description 5
- 150000001945 cysteines Chemical class 0.000 claims description 5
- 238000013518 transcription Methods 0.000 claims description 5
- 230000035897 transcription Effects 0.000 claims description 5
- 241000193738 Bacillus anthracis Species 0.000 claims description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 claims description 4
- 241000187479 Mycobacterium tuberculosis Species 0.000 claims description 4
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 claims description 4
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 claims description 4
- 241000711798 Rabies lyssavirus Species 0.000 claims description 4
- 229940065181 bacillus anthracis Drugs 0.000 claims description 4
- 229960003104 ornithine Drugs 0.000 claims description 4
- 108060002716 Exonuclease Proteins 0.000 claims description 3
- 102000013165 exonuclease Human genes 0.000 claims description 3
- 230000004927 fusion Effects 0.000 claims description 3
- 230000002209 hydrophobic effect Effects 0.000 claims description 3
- 230000035800 maturation Effects 0.000 claims description 3
- 241000712461 unidentified influenza virus Species 0.000 claims description 3
- 108050003558 Interleukin-17 Proteins 0.000 claims description 2
- 102000013691 Interleukin-17 Human genes 0.000 claims description 2
- 230000033228 biological regulation Effects 0.000 claims description 2
- 108090000288 Glycoproteins Proteins 0.000 claims 9
- 102000003886 Glycoproteins Human genes 0.000 claims 9
- 101710186352 Probable membrane antigen 3 Proteins 0.000 claims 7
- 101710181078 Probable membrane antigen 75 Proteins 0.000 claims 7
- 101710178472 Tegument protein Proteins 0.000 claims 7
- 102100038222 60 kDa heat shock protein, mitochondrial Human genes 0.000 claims 3
- 108010058432 Chaperonin 60 Proteins 0.000 claims 3
- 101710128560 Initiator protein NS1 Proteins 0.000 claims 3
- 102000004895 Lipoproteins Human genes 0.000 claims 3
- 108090001030 Lipoproteins Proteins 0.000 claims 3
- 101710144127 Non-structural protein 1 Proteins 0.000 claims 3
- 101710199667 Nuclear export protein Proteins 0.000 claims 3
- 102000011931 Nucleoproteins Human genes 0.000 claims 3
- 108010061100 Nucleoproteins Proteins 0.000 claims 3
- 101710194807 Protective antigen Proteins 0.000 claims 3
- 210000002845 virion Anatomy 0.000 claims 3
- 102100030802 Beta-2-glycoprotein 1 Human genes 0.000 claims 2
- 101150026402 DBP gene Proteins 0.000 claims 2
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 claims 2
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 claims 2
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 claims 2
- 201000010046 Dilated cardiomyopathy Diseases 0.000 claims 2
- 102100038132 Endogenous retrovirus group K member 6 Pro protein Human genes 0.000 claims 2
- 101710154606 Hemagglutinin Proteins 0.000 claims 2
- 102000029746 Histidine-tRNA Ligase Human genes 0.000 claims 2
- 101710177011 Histidine-tRNA ligase, cytoplasmic Proteins 0.000 claims 2
- 101000685886 Homo sapiens RNA-binding protein RO60 Proteins 0.000 claims 2
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 claims 2
- 101710184277 Insulin-like growth factor 1 receptor Proteins 0.000 claims 2
- 101710173994 Latency-related protein 1 Proteins 0.000 claims 2
- 101710173993 Latency-related protein 2 Proteins 0.000 claims 2
- 102000002233 Myelin-Oligodendrocyte Glycoprotein Human genes 0.000 claims 2
- 108010000123 Myelin-Oligodendrocyte Glycoprotein Proteins 0.000 claims 2
- 101150098384 NEC2 gene Proteins 0.000 claims 2
- 102000005348 Neuraminidase Human genes 0.000 claims 2
- 108010006232 Neuraminidase Proteins 0.000 claims 2
- 101710144128 Non-structural protein 2 Proteins 0.000 claims 2
- 101710093908 Outer capsid protein VP4 Proteins 0.000 claims 2
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 claims 2
- 108010058514 Phosphate-Binding Proteins Proteins 0.000 claims 2
- 102000006335 Phosphate-Binding Proteins Human genes 0.000 claims 2
- 108010089430 Phosphoproteins Proteins 0.000 claims 2
- 102000007982 Phosphoproteins Human genes 0.000 claims 2
- 229920000776 Poly(Adenosine diphosphate-ribose) polymerase Polymers 0.000 claims 2
- 101710096715 Probable histidine-tRNA ligase, cytoplasmic Proteins 0.000 claims 2
- 101710176177 Protein A56 Proteins 0.000 claims 2
- 101710188315 Protein X Proteins 0.000 claims 2
- 101150093191 RIR1 gene Proteins 0.000 claims 2
- 102100023433 RNA-binding protein RO60 Human genes 0.000 claims 2
- 102100038247 Retinol-binding protein 3 Human genes 0.000 claims 2
- 102000000505 Ribonucleotide Reductases Human genes 0.000 claims 2
- 108010041388 Ribonucleotide Reductases Proteins 0.000 claims 2
- 108010023562 beta 2-Glycoprotein I Proteins 0.000 claims 2
- 108010006620 fodrin Proteins 0.000 claims 2
- 101150029683 gB gene Proteins 0.000 claims 2
- 239000000185 hemagglutinin Substances 0.000 claims 2
- 208000002672 hepatitis B Diseases 0.000 claims 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 claims 2
- 108010048996 interstitial retinol-binding protein Proteins 0.000 claims 2
- 101150023079 mpt83 gene Proteins 0.000 claims 2
- 201000006417 multiple sclerosis Diseases 0.000 claims 2
- 101150046896 trm1 gene Proteins 0.000 claims 2
- SSOORFWOBGFTHL-OTEJMHTDSA-N (4S)-5-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[2-[(2S)-2-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-6-amino-1-[[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-5-carbamimidamido-1-[[(2S)-5-carbamimidamido-1-[[(1S)-4-carbamimidamido-1-carboxybutyl]amino]-1-oxopentan-2-yl]amino]-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-1-oxohexan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]carbamoyl]pyrrolidin-1-yl]-2-oxoethyl]amino]-3-(1H-indol-3-yl)-1-oxopropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-1-oxohexan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-5-carbamimidamido-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxo-3-phenylpropan-2-yl]amino]-3-(1H-imidazol-4-yl)-1-oxopropan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-4-[[(2S)-2-[[(2S)-2-[[(2S)-2,6-diaminohexanoyl]amino]-3-methylbutanoyl]amino]propanoyl]amino]-5-oxopentanoic acid Chemical compound CC[C@H](C)[C@H](NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H]1CCCN1C(=O)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](N)CCCCN)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(C)C)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SSOORFWOBGFTHL-OTEJMHTDSA-N 0.000 claims 1
- OWMCODAXNFNLCU-UHFFFAOYSA-N 2-[[2-(1h-imidazol-5-yl)ethylamino]methyl]phenol Chemical compound OC1=CC=CC=C1CNCCC1=CN=CN1 OWMCODAXNFNLCU-UHFFFAOYSA-N 0.000 claims 1
- KISWVXRQTGLFGD-UHFFFAOYSA-N 2-[[2-[[6-amino-2-[[2-[[2-[[5-amino-2-[[2-[[1-[2-[[6-amino-2-[(2,5-diamino-5-oxopentanoyl)amino]hexanoyl]amino]-5-(diaminomethylideneamino)pentanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxypropanoyl]amino]-5-oxopentanoyl]amino]-5-(diaminomethylideneamino)p Chemical compound C1CCN(C(=O)C(CCCN=C(N)N)NC(=O)C(CCCCN)NC(=O)C(N)CCC(N)=O)C1C(=O)NC(CO)C(=O)NC(CCC(N)=O)C(=O)NC(CCCN=C(N)N)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(C(=O)NC(CC(C)C)C(O)=O)CC1=CC=C(O)C=C1 KISWVXRQTGLFGD-UHFFFAOYSA-N 0.000 claims 1
- 101710166488 6 kDa early secretory antigenic target Proteins 0.000 claims 1
- 108010031025 Alanine Dehydrogenase Proteins 0.000 claims 1
- 101710095306 Alpha-crystallin Proteins 0.000 claims 1
- 101800000270 Assembly protein Proteins 0.000 claims 1
- 201000001320 Atherosclerosis Diseases 0.000 claims 1
- 102100022717 Atypical chemokine receptor 1 Human genes 0.000 claims 1
- 101001124039 Banna virus (strain Indonesia/JKT-6423/1980) Non-structural protein 4 Proteins 0.000 claims 1
- 102100032912 CD44 antigen Human genes 0.000 claims 1
- 101150072608 CVC1 gene Proteins 0.000 claims 1
- 101150010802 CVC2 gene Proteins 0.000 claims 1
- 102100025570 Cancer/testis antigen 1 Human genes 0.000 claims 1
- 108090000565 Capsid Proteins Proteins 0.000 claims 1
- 101710132601 Capsid protein Proteins 0.000 claims 1
- 101800004861 Capsid protein VP23 Proteins 0.000 claims 1
- 101800004863 Capsid protein VP26 Proteins 0.000 claims 1
- 101710140962 Capsid scaffolding protein Proteins 0.000 claims 1
- 101710145913 Cell surface glycolipoprotein MPB83 Proteins 0.000 claims 1
- 101710178821 Cell surface glycolipoprotein MPT83 Proteins 0.000 claims 1
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 claims 1
- 101710098119 Chaperonin GroEL 2 Proteins 0.000 claims 1
- 108010009685 Cholinergic Receptors Proteins 0.000 claims 1
- 206010056370 Congestive cardiomyopathy Diseases 0.000 claims 1
- 102000003915 DNA Topoisomerases Human genes 0.000 claims 1
- 108090000323 DNA Topoisomerases Proteins 0.000 claims 1
- 101710119924 DNA helicase/primase complex protein Proteins 0.000 claims 1
- 102000003844 DNA helicases Human genes 0.000 claims 1
- 108090000133 DNA helicases Proteins 0.000 claims 1
- 101710150351 DNA polymerase processivity factor Proteins 0.000 claims 1
- 101710160937 DNA replication protein Proteins 0.000 claims 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 claims 1
- 101150040913 DUT gene Proteins 0.000 claims 1
- 102100023933 Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial Human genes 0.000 claims 1
- 101710088427 Diacylglycerol acyltransferase/mycolyltransferase Ag85C Proteins 0.000 claims 1
- 101710201734 E3 protein Proteins 0.000 claims 1
- 101150029707 ERBB2 gene Proteins 0.000 claims 1
- 101710121417 Envelope glycoprotein Proteins 0.000 claims 1
- 101710091045 Envelope protein Proteins 0.000 claims 1
- 102100036725 Epithelial discoidin domain-containing receptor 1 Human genes 0.000 claims 1
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 claims 1
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 claims 1
- 101800000342 Glycoprotein C Proteins 0.000 claims 1
- 108060003393 Granulin Proteins 0.000 claims 1
- 102000002812 Heat-Shock Proteins Human genes 0.000 claims 1
- 108010004889 Heat-Shock Proteins Proteins 0.000 claims 1
- 108010068250 Herpes Simplex Virus Protein Vmw65 Proteins 0.000 claims 1
- 101000678879 Homo sapiens Atypical chemokine receptor 1 Proteins 0.000 claims 1
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 claims 1
- 101000856237 Homo sapiens Cancer/testis antigen 1 Proteins 0.000 claims 1
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 claims 1
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 claims 1
- 101000578784 Homo sapiens Melanoma antigen recognized by T-cells 1 Proteins 0.000 claims 1
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 claims 1
- 101001024605 Homo sapiens Next to BRCA1 gene 1 protein Proteins 0.000 claims 1
- 101001136592 Homo sapiens Prostate stem cell antigen Proteins 0.000 claims 1
- 101000851018 Homo sapiens Vascular endothelial growth factor receptor 1 Proteins 0.000 claims 1
- 101000851007 Homo sapiens Vascular endothelial growth factor receptor 2 Proteins 0.000 claims 1
- 101000807236 Human cytomegalovirus (strain AD169) Membrane glycoprotein US3 Proteins 0.000 claims 1
- 101100427508 Human cytomegalovirus (strain AD169) UL39 gene Proteins 0.000 claims 1
- 101001080091 Human herpesvirus 1 (strain 17) Accessory factor US11 Proteins 0.000 claims 1
- 101100508081 Human herpesvirus 1 (strain 17) ICP34.5 gene Proteins 0.000 claims 1
- 101001042049 Human herpesvirus 1 (strain 17) Transcriptional regulator ICP22 Proteins 0.000 claims 1
- 101001080075 Human herpesvirus 1 (strain MP) RNA-binding protein Proteins 0.000 claims 1
- 101000999690 Human herpesvirus 2 (strain HG52) E3 ubiquitin ligase ICP22 Proteins 0.000 claims 1
- 101001090851 Human herpesvirus 2 Processing and transport protein Proteins 0.000 claims 1
- 101150090364 ICP0 gene Proteins 0.000 claims 1
- 101150027427 ICP4 gene Proteins 0.000 claims 1
- 101710140363 ICP47 protein Proteins 0.000 claims 1
- 101100028758 Influenza A virus (strain A/Swine/Wisconsin/1/1967 H1N1) PB1-F2 gene Proteins 0.000 claims 1
- 102000004877 Insulin Human genes 0.000 claims 1
- 108090001061 Insulin Proteins 0.000 claims 1
- 101710125507 Integrase/recombinase Proteins 0.000 claims 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 claims 1
- 102000007330 LDL Lipoproteins Human genes 0.000 claims 1
- 108010007622 LDL Lipoproteins Proteins 0.000 claims 1
- 101710084021 Large envelope protein Proteins 0.000 claims 1
- 101150047390 MCP gene Proteins 0.000 claims 1
- 108010048043 Macrophage Migration-Inhibitory Factors Proteins 0.000 claims 1
- 102100037791 Macrophage migration inhibitory factor Human genes 0.000 claims 1
- 101710179282 Major DNA-binding protein Proteins 0.000 claims 1
- 101710169680 Major capsid protein VP5 Proteins 0.000 claims 1
- 101710085938 Matrix protein Proteins 0.000 claims 1
- 102100028389 Melanoma antigen recognized by T-cells 1 Human genes 0.000 claims 1
- 101710127721 Membrane protein Proteins 0.000 claims 1
- 101710139658 Membrane protein UL20 Proteins 0.000 claims 1
- 101710139637 Membrane protein UL43 Proteins 0.000 claims 1
- 108090000015 Mesothelin Proteins 0.000 claims 1
- 102000003735 Mesothelin Human genes 0.000 claims 1
- 101710081079 Minor spike protein H Proteins 0.000 claims 1
- 108010006519 Molecular Chaperones Proteins 0.000 claims 1
- 102000005431 Molecular Chaperones Human genes 0.000 claims 1
- 102100034256 Mucin-1 Human genes 0.000 claims 1
- 108010008707 Mucin-1 Proteins 0.000 claims 1
- 102100023123 Mucin-16 Human genes 0.000 claims 1
- 101000944608 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Chaperonin GroEL 2 Proteins 0.000 claims 1
- 101100030428 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) PPE18 gene Proteins 0.000 claims 1
- 102100032965 Myomesin-2 Human genes 0.000 claims 1
- 201000002481 Myositis Diseases 0.000 claims 1
- 102100023897 NADPH-cytochrome P450 reductase Human genes 0.000 claims 1
- 101150041636 NEC1 gene Proteins 0.000 claims 1
- 102000008297 Nuclear Matrix-Associated Proteins Human genes 0.000 claims 1
- 108010035916 Nuclear Matrix-Associated Proteins Proteins 0.000 claims 1
- 108090001074 Nucleocapsid Proteins Proteins 0.000 claims 1
- 102100038485 Nucleolar transcription factor 1 Human genes 0.000 claims 1
- 206010030113 Oedema Diseases 0.000 claims 1
- 101150103639 PB1 gene Proteins 0.000 claims 1
- 101150020548 PPE14 gene Proteins 0.000 claims 1
- 101150009192 PPE68 gene Proteins 0.000 claims 1
- 102000002508 Peptide Elongation Factors Human genes 0.000 claims 1
- 108010068204 Peptide Elongation Factors Proteins 0.000 claims 1
- 101710146026 Peptidoglycan D,D-transpeptidase FtsI Proteins 0.000 claims 1
- 101710186446 Phosphate transport system permease protein PstA Proteins 0.000 claims 1
- 101710181936 Phosphate-binding protein PstS 3 Proteins 0.000 claims 1
- 102100021768 Phosphoserine aminotransferase Human genes 0.000 claims 1
- 101710102873 Polymerase basic protein 2 Proteins 0.000 claims 1
- 108050005751 Portal proteins Proteins 0.000 claims 1
- 108010076181 Proinsulin Proteins 0.000 claims 1
- 102100036735 Prostate stem cell antigen Human genes 0.000 claims 1
- 108010072866 Prostate-Specific Antigen Proteins 0.000 claims 1
- 101710183920 Protein M2-2 Proteins 0.000 claims 1
- 102000009516 Protein Serine-Threonine Kinases Human genes 0.000 claims 1
- 108010009341 Protein Serine-Threonine Kinases Proteins 0.000 claims 1
- 101710136297 Protein VP2 Proteins 0.000 claims 1
- 101800003658 Protein VP4 Proteins 0.000 claims 1
- 102100037516 Protein polybromo-1 Human genes 0.000 claims 1
- 101710150114 Protein rep Proteins 0.000 claims 1
- 102000016202 Proteolipids Human genes 0.000 claims 1
- 108010010974 Proteolipids Proteins 0.000 claims 1
- 101710185720 Putative ethidium bromide resistance protein Proteins 0.000 claims 1
- 101150030723 RIR2 gene Proteins 0.000 claims 1
- 101150027249 RL1 gene Proteins 0.000 claims 1
- 101710118046 RNA-directed RNA polymerase Proteins 0.000 claims 1
- 101710085035 RNA-directed RNA polymerase catalytic subunit Proteins 0.000 claims 1
- 101000737809 Rattus norvegicus Cadherin-related family member 5 Proteins 0.000 claims 1
- 101710205286 Replication origin-binding protein Proteins 0.000 claims 1
- 101710152114 Replication protein Proteins 0.000 claims 1
- 102000004389 Ribonucleoproteins Human genes 0.000 claims 1
- 108010081734 Ribonucleoproteins Proteins 0.000 claims 1
- 206010039710 Scleroderma Diseases 0.000 claims 1
- 102000012479 Serine Proteases Human genes 0.000 claims 1
- 108010022999 Serine Proteases Proteins 0.000 claims 1
- 101710198360 Serine/threonine-protein kinase US3 Proteins 0.000 claims 1
- 208000021386 Sjogren Syndrome Diseases 0.000 claims 1
- 101001039853 Sonchus yellow net virus Matrix protein Proteins 0.000 claims 1
- 101000815632 Streptococcus suis (strain 05ZYH33) Rqc2 homolog RqcH Proteins 0.000 claims 1
- 101150003725 TK gene Proteins 0.000 claims 1
- 101150110861 TRM2 gene Proteins 0.000 claims 1
- 101710098523 Tegument protein UL14 Proteins 0.000 claims 1
- 101710098876 Tegument protein UL21 Proteins 0.000 claims 1
- 101710098841 Tegument protein UL47 Proteins 0.000 claims 1
- 101710098491 Tegument protein UL51 Proteins 0.000 claims 1
- 101710192321 Tegument protein VP16 Proteins 0.000 claims 1
- 101710193546 Tegument protein VP16 homolog Proteins 0.000 claims 1
- 108010046722 Thrombospondin 1 Proteins 0.000 claims 1
- 102100036034 Thrombospondin-1 Human genes 0.000 claims 1
- 102000006601 Thymidine Kinase Human genes 0.000 claims 1
- 108020004440 Thymidine kinase Proteins 0.000 claims 1
- 102000003425 Tyrosinase Human genes 0.000 claims 1
- 108060008724 Tyrosinase Proteins 0.000 claims 1
- 102000018165 U1 Small Nuclear Ribonucleoprotein Human genes 0.000 claims 1
- 108010091281 U1 Small Nuclear Ribonucleoprotein Proteins 0.000 claims 1
- 101150087840 UL11 gene Proteins 0.000 claims 1
- 101150023763 UL12 gene Proteins 0.000 claims 1
- 101150093137 UL13 gene Proteins 0.000 claims 1
- 101150042088 UL16 gene Proteins 0.000 claims 1
- 101150104047 UL17 gene Proteins 0.000 claims 1
- 101150109748 UL19 gene Proteins 0.000 claims 1
- 101150118251 UL23 gene Proteins 0.000 claims 1
- 101150054371 UL24 gene Proteins 0.000 claims 1
- 101150004957 UL25 gene Proteins 0.000 claims 1
- 101150060044 UL26 gene Proteins 0.000 claims 1
- 101150003230 UL27 gene Proteins 0.000 claims 1
- 101150072074 UL28 gene Proteins 0.000 claims 1
- 101150008036 UL29 gene Proteins 0.000 claims 1
- 101150068034 UL30 gene Proteins 0.000 claims 1
- 101150019585 UL31 gene Proteins 0.000 claims 1
- 101150081727 UL32 gene Proteins 0.000 claims 1
- 101150017804 UL33 gene Proteins 0.000 claims 1
- 101150087430 UL34 gene Proteins 0.000 claims 1
- 101150085237 UL36 gene Proteins 0.000 claims 1
- 101150036065 UL37 gene Proteins 0.000 claims 1
- 101150100826 UL40 gene Proteins 0.000 claims 1
- 101150044021 UL41 gene Proteins 0.000 claims 1
- 101150099321 UL42 gene Proteins 0.000 claims 1
- 101150048066 UL45 gene Proteins 0.000 claims 1
- 101150053996 UL47 gene Proteins 0.000 claims 1
- 101150004685 UL48 gene Proteins 0.000 claims 1
- 101150066971 UL49 gene Proteins 0.000 claims 1
- 101150011902 UL52 gene Proteins 0.000 claims 1
- 101150009795 UL54 gene Proteins 0.000 claims 1
- 101150081415 UL55 gene Proteins 0.000 claims 1
- 101150015312 UL56 gene Proteins 0.000 claims 1
- 102000006275 Ubiquitin-Protein Ligases Human genes 0.000 claims 1
- 108010083111 Ubiquitin-Protein Ligases Proteins 0.000 claims 1
- 108010072685 Uracil-DNA Glycosidase Proteins 0.000 claims 1
- 102100037111 Uracil-DNA glycosylase Human genes 0.000 claims 1
- 101150010086 VP24 gene Proteins 0.000 claims 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims 1
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 claims 1
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 claims 1
- 108700020467 WT1 Proteins 0.000 claims 1
- 101150084041 WT1 gene Proteins 0.000 claims 1
- 102100022748 Wilms tumor protein Human genes 0.000 claims 1
- 108091006550 Zinc transporters Proteins 0.000 claims 1
- 102000034337 acetylcholine receptors Human genes 0.000 claims 1
- 206010003246 arthritis Diseases 0.000 claims 1
- 201000004982 autoimmune uveitis Diseases 0.000 claims 1
- 210000000234 capsid Anatomy 0.000 claims 1
- 230000000747 cardiac effect Effects 0.000 claims 1
- 108030003002 dUTP diphosphatases Proteins 0.000 claims 1
- 206010012601 diabetes mellitus Diseases 0.000 claims 1
- 201000011304 dilated cardiomyopathy 1A Diseases 0.000 claims 1
- 239000000428 dust Substances 0.000 claims 1
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 claims 1
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 claims 1
- 101150079015 esxB gene Proteins 0.000 claims 1
- 102000036072 fibronectin binding proteins Human genes 0.000 claims 1
- 239000000706 filtrate Substances 0.000 claims 1
- 235000013305 food Nutrition 0.000 claims 1
- 235000013922 glutamic acid Nutrition 0.000 claims 1
- 239000004220 glutamic acid Substances 0.000 claims 1
- 102000005396 glutamine synthetase Human genes 0.000 claims 1
- 108020002326 glutamine synthetase Proteins 0.000 claims 1
- 229940046528 grass pollen Drugs 0.000 claims 1
- 239000002919 insect venom Substances 0.000 claims 1
- 229940125396 insulin Drugs 0.000 claims 1
- 206010022498 insulinoma Diseases 0.000 claims 1
- 210000004153 islets of langerhan Anatomy 0.000 claims 1
- 231100000518 lethal Toxicity 0.000 claims 1
- 230000001665 lethal effect Effects 0.000 claims 1
- 206010025135 lupus erythematosus Diseases 0.000 claims 1
- 101710121537 mRNA (guanine-N(7))-methyltransferase Proteins 0.000 claims 1
- 101710130522 mRNA export factor Proteins 0.000 claims 1
- 101150047914 mpt51 gene Proteins 0.000 claims 1
- 101150076681 mpt63 gene Proteins 0.000 claims 1
- 101150014428 mpt64 gene Proteins 0.000 claims 1
- 101150014352 mtb12 gene Proteins 0.000 claims 1
- 206010028417 myasthenia gravis Diseases 0.000 claims 1
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 claims 1
- 210000000633 nuclear envelope Anatomy 0.000 claims 1
- 108010062490 p27 antigen Proteins 0.000 claims 1
- 208000021255 pancreatic insulinoma Diseases 0.000 claims 1
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 claims 1
- 108010066381 preproinsulin Proteins 0.000 claims 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 claims 1
- 201000003068 rheumatic fever Diseases 0.000 claims 1
- 108010040614 terminase Proteins 0.000 claims 1
- 108010040073 transcription factor UBF Proteins 0.000 claims 1
- 108091006106 transcriptional activators Proteins 0.000 claims 1
- 229940046536 tree pollen allergenic extract Drugs 0.000 claims 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 claims 1
- 231100000611 venom Toxicity 0.000 claims 1
- 230000029812 viral genome replication Effects 0.000 claims 1
- 230000006698 induction Effects 0.000 abstract description 36
- 230000033289 adaptive immune response Effects 0.000 abstract description 27
- 229960005486 vaccine Drugs 0.000 abstract description 25
- 238000011282 treatment Methods 0.000 abstract description 5
- 239000000306 component Substances 0.000 description 286
- 229940024606 amino acid Drugs 0.000 description 171
- 125000003729 nucleotide group Chemical group 0.000 description 68
- 239000002773 nucleotide Substances 0.000 description 65
- 108020004999 messenger RNA Proteins 0.000 description 56
- -1 t-butyloxycarbonyl Chemical group 0.000 description 56
- 230000028993 immune response Effects 0.000 description 50
- 238000000034 method Methods 0.000 description 50
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 46
- 229920000642 polymer Polymers 0.000 description 45
- 230000004048 modification Effects 0.000 description 44
- 238000012986 modification Methods 0.000 description 44
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical class NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 41
- 108020004414 DNA Proteins 0.000 description 35
- 229920006317 cationic polymer Polymers 0.000 description 35
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 32
- 239000003446 ligand Substances 0.000 description 32
- 238000001890 transfection Methods 0.000 description 32
- 210000001744 T-lymphocyte Anatomy 0.000 description 31
- 230000015788 innate immune response Effects 0.000 description 30
- 230000027455 binding Effects 0.000 description 28
- 150000001875 compounds Chemical class 0.000 description 27
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 26
- 238000001727 in vivo Methods 0.000 description 26
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 25
- 125000003275 alpha amino acid group Chemical group 0.000 description 24
- 230000000694 effects Effects 0.000 description 22
- 229940035893 uracil Drugs 0.000 description 22
- 102000004127 Cytokines Human genes 0.000 description 20
- 108090000695 Cytokines Proteins 0.000 description 20
- 102000002689 Toll-like receptor Human genes 0.000 description 20
- 108020000411 Toll-like receptor Proteins 0.000 description 20
- 229940104302 cytosine Drugs 0.000 description 20
- 230000006870 function Effects 0.000 description 20
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 19
- 108091028043 Nucleic acid sequence Proteins 0.000 description 19
- 108010076504 Protein Sorting Signals Proteins 0.000 description 19
- 108010051109 Cell-Penetrating Peptides Proteins 0.000 description 18
- 102000020313 Cell-Penetrating Peptides Human genes 0.000 description 18
- 108020004705 Codon Proteins 0.000 description 18
- 108020004566 Transfer RNA Proteins 0.000 description 18
- 230000004913 activation Effects 0.000 description 18
- 238000013459 approach Methods 0.000 description 18
- 238000006243 chemical reaction Methods 0.000 description 17
- 210000000987 immune system Anatomy 0.000 description 17
- 238000000338 in vitro Methods 0.000 description 17
- 239000000126 substance Substances 0.000 description 17
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 16
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 16
- 241000282414 Homo sapiens Species 0.000 description 16
- 229940029575 guanosine Drugs 0.000 description 16
- 125000005647 linker group Chemical group 0.000 description 16
- 229920002851 polycationic polymer Polymers 0.000 description 16
- 230000004044 response Effects 0.000 description 16
- 210000003719 b-lymphocyte Anatomy 0.000 description 15
- UHDGCWIWMRVCDJ-ZAKLUEHWSA-N cytidine Chemical class O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-ZAKLUEHWSA-N 0.000 description 15
- 210000002540 macrophage Anatomy 0.000 description 15
- 210000001519 tissue Anatomy 0.000 description 15
- 108091026890 Coding region Proteins 0.000 description 14
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 14
- 238000009833 condensation Methods 0.000 description 14
- 230000005494 condensation Effects 0.000 description 14
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 14
- 230000014509 gene expression Effects 0.000 description 14
- 239000003022 immunostimulating agent Substances 0.000 description 14
- 239000003795 chemical substances by application Substances 0.000 description 13
- 210000005007 innate immune system Anatomy 0.000 description 13
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical group O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 12
- 210000005006 adaptive immune system Anatomy 0.000 description 12
- 230000000890 antigenic effect Effects 0.000 description 12
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 12
- 238000004132 cross linking Methods 0.000 description 12
- 210000004443 dendritic cell Anatomy 0.000 description 12
- 238000004519 manufacturing process Methods 0.000 description 12
- 238000006116 polymerization reaction Methods 0.000 description 12
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 12
- 229940045145 uridine Drugs 0.000 description 12
- 108010047761 Interferon-alpha Proteins 0.000 description 11
- 102000006992 Interferon-alpha Human genes 0.000 description 11
- 108010058846 Ovalbumin Proteins 0.000 description 11
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Chemical compound OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 11
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 11
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical class O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 11
- 229940092253 ovalbumin Drugs 0.000 description 11
- 238000002255 vaccination Methods 0.000 description 11
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 1-beta-D-Xylofuranosyl-NH-Cytosine Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 10
- UHDGCWIWMRVCDJ-PSQAKQOGSA-N Cytidine Natural products O=C1N=C(N)C=CN1[C@@H]1[C@@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-PSQAKQOGSA-N 0.000 description 10
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 10
- 108700026244 Open Reading Frames Proteins 0.000 description 10
- 230000003044 adaptive effect Effects 0.000 description 10
- 239000000872 buffer Substances 0.000 description 10
- 230000001413 cellular effect Effects 0.000 description 10
- 238000003780 insertion Methods 0.000 description 10
- 230000037431 insertion Effects 0.000 description 10
- 239000000203 mixture Substances 0.000 description 10
- 238000006068 polycondensation reaction Methods 0.000 description 10
- 229920001184 polypeptide Polymers 0.000 description 10
- 239000004055 small Interfering RNA Substances 0.000 description 10
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 9
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 9
- 241000725303 Human immunodeficiency virus Species 0.000 description 9
- 108091054437 MHC class I family Proteins 0.000 description 9
- 108091054438 MHC class II family Proteins 0.000 description 9
- 108020004459 Small interfering RNA Proteins 0.000 description 9
- 230000024932 T cell mediated immunity Effects 0.000 description 9
- 239000000969 carrier Substances 0.000 description 9
- 230000036039 immunity Effects 0.000 description 9
- 230000001965 increasing effect Effects 0.000 description 9
- 230000003993 interaction Effects 0.000 description 9
- 150000002632 lipids Chemical class 0.000 description 9
- 230000004807 localization Effects 0.000 description 9
- 230000007935 neutral effect Effects 0.000 description 9
- 235000013930 proline Nutrition 0.000 description 9
- 230000000087 stabilizing effect Effects 0.000 description 9
- 230000001225 therapeutic effect Effects 0.000 description 9
- 238000010668 complexation reaction Methods 0.000 description 8
- 230000001976 improved effect Effects 0.000 description 8
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 description 8
- 239000002777 nucleoside Substances 0.000 description 8
- 125000003835 nucleoside group Chemical group 0.000 description 8
- 102000007863 pattern recognition receptors Human genes 0.000 description 8
- 108010089193 pattern recognition receptors Proteins 0.000 description 8
- 238000002360 preparation method Methods 0.000 description 8
- 125000006239 protecting group Chemical group 0.000 description 8
- 150000003839 salts Chemical class 0.000 description 8
- 238000006467 substitution reaction Methods 0.000 description 8
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 8
- 238000012546 transfer Methods 0.000 description 8
- 239000013603 viral vector Substances 0.000 description 8
- 230000003612 virological effect Effects 0.000 description 8
- 241000894006 Bacteria Species 0.000 description 7
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 7
- 102000053602 DNA Human genes 0.000 description 7
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 7
- 229960005305 adenosine Drugs 0.000 description 7
- 150000001412 amines Chemical class 0.000 description 7
- 230000015572 biosynthetic process Effects 0.000 description 7
- 230000015556 catabolic process Effects 0.000 description 7
- 238000006731 degradation reaction Methods 0.000 description 7
- 238000011161 development Methods 0.000 description 7
- 230000018109 developmental process Effects 0.000 description 7
- 201000010099 disease Diseases 0.000 description 7
- 239000012636 effector Substances 0.000 description 7
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 7
- 230000028996 humoral immune response Effects 0.000 description 7
- 230000003834 intracellular effect Effects 0.000 description 7
- 239000002245 particle Substances 0.000 description 7
- 229920000729 poly(L-lysine) polymer Polymers 0.000 description 7
- VTIYIXJVHDMAGD-GWTDSMLYSA-N 2-amino-3,7-dihydropurin-6-one;2-amino-9-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-3h-purin-6-one Chemical class O=C1NC(N)=NC2=C1NC=N2.C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O VTIYIXJVHDMAGD-GWTDSMLYSA-N 0.000 description 6
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 6
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Chemical group O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 6
- 101000669402 Homo sapiens Toll-like receptor 7 Proteins 0.000 description 6
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 6
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 6
- 101100368144 Mus musculus Synb gene Proteins 0.000 description 6
- 108010077850 Nuclear Localization Signals Proteins 0.000 description 6
- 239000002202 Polyethylene glycol Substances 0.000 description 6
- 101710192266 Tegument protein VP22 Proteins 0.000 description 6
- 102100039390 Toll-like receptor 7 Human genes 0.000 description 6
- 150000001337 aliphatic alkines Chemical class 0.000 description 6
- 210000000612 antigen-presenting cell Anatomy 0.000 description 6
- 230000002238 attenuated effect Effects 0.000 description 6
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Chemical group O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 6
- 230000000295 complement effect Effects 0.000 description 6
- 230000000536 complexating effect Effects 0.000 description 6
- 231100000433 cytotoxic Toxicity 0.000 description 6
- 230000001472 cytotoxic effect Effects 0.000 description 6
- 238000004108 freeze drying Methods 0.000 description 6
- 238000001476 gene delivery Methods 0.000 description 6
- 238000010348 incorporation Methods 0.000 description 6
- 239000004615 ingredient Substances 0.000 description 6
- 108010011110 polyarginine Proteins 0.000 description 6
- 229920001223 polyethylene glycol Polymers 0.000 description 6
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 6
- 230000028327 secretion Effects 0.000 description 6
- ATHGHQPFGPMSJY-UHFFFAOYSA-N spermidine Chemical compound NCCCCNCCCN ATHGHQPFGPMSJY-UHFFFAOYSA-N 0.000 description 6
- PFNFFQXMRSDOHW-UHFFFAOYSA-N spermine Chemical compound NCCCNCCCCNCCCN PFNFFQXMRSDOHW-UHFFFAOYSA-N 0.000 description 6
- 230000000638 stimulation Effects 0.000 description 6
- 235000000346 sugar Nutrition 0.000 description 6
- 229940104230 thymidine Drugs 0.000 description 6
- 230000014616 translation Effects 0.000 description 6
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical class NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 5
- 101000763579 Homo sapiens Toll-like receptor 1 Proteins 0.000 description 5
- 101000800483 Homo sapiens Toll-like receptor 8 Proteins 0.000 description 5
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 5
- 241000737052 Naso hexacanthus Species 0.000 description 5
- 108091000054 Prion Proteins 0.000 description 5
- 239000008156 Ringer's lactate solution Substances 0.000 description 5
- 210000000447 Th1 cell Anatomy 0.000 description 5
- 102100033110 Toll-like receptor 8 Human genes 0.000 description 5
- 230000003213 activating effect Effects 0.000 description 5
- 230000002776 aggregation Effects 0.000 description 5
- 125000000129 anionic group Chemical group 0.000 description 5
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 5
- 230000001580 bacterial effect Effects 0.000 description 5
- 230000004888 barrier function Effects 0.000 description 5
- 230000001086 cytosolic effect Effects 0.000 description 5
- 210000003162 effector t lymphocyte Anatomy 0.000 description 5
- 210000001163 endosome Anatomy 0.000 description 5
- 230000001747 exhibiting effect Effects 0.000 description 5
- 230000005847 immunogenicity Effects 0.000 description 5
- 239000000178 monomer Substances 0.000 description 5
- 239000001301 oxygen Substances 0.000 description 5
- 229910052760 oxygen Inorganic materials 0.000 description 5
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 5
- 238000012643 polycondensation polymerization Methods 0.000 description 5
- 230000002441 reversible effect Effects 0.000 description 5
- 108020004418 ribosomal RNA Proteins 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 230000001988 toxicity Effects 0.000 description 5
- 231100000419 toxicity Toxicity 0.000 description 5
- 239000013598 vector Substances 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- HCZMHWVFVZAHCR-UHFFFAOYSA-N 2-[2-(2-sulfanylethoxy)ethoxy]ethanethiol Chemical compound SCCOCCOCCS HCZMHWVFVZAHCR-UHFFFAOYSA-N 0.000 description 4
- 108020005345 3' Untranslated Regions Proteins 0.000 description 4
- 229930024421 Adenine Natural products 0.000 description 4
- 102000004506 Blood Proteins Human genes 0.000 description 4
- 108010017384 Blood Proteins Proteins 0.000 description 4
- 108700010070 Codon Usage Proteins 0.000 description 4
- 239000004971 Cross linker Substances 0.000 description 4
- 241000709661 Enterovirus Species 0.000 description 4
- 101000699762 Homo sapiens RNA 3'-terminal phosphate cyclase Proteins 0.000 description 4
- 101000763537 Homo sapiens Toll-like receptor 10 Proteins 0.000 description 4
- 101000831496 Homo sapiens Toll-like receptor 3 Proteins 0.000 description 4
- 241000701085 Human alphaherpesvirus 3 Species 0.000 description 4
- 108060003951 Immunoglobulin Proteins 0.000 description 4
- 102000002227 Interferon Type I Human genes 0.000 description 4
- 108010014726 Interferon Type I Proteins 0.000 description 4
- 101100481579 Mus musculus Tlr11 gene Proteins 0.000 description 4
- 101100481580 Mus musculus Tlr12 gene Proteins 0.000 description 4
- 108091034117 Oligonucleotide Proteins 0.000 description 4
- 229910019142 PO4 Inorganic materials 0.000 description 4
- 102000007079 Peptide Fragments Human genes 0.000 description 4
- 108010033276 Peptide Fragments Proteins 0.000 description 4
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 4
- 102000029797 Prion Human genes 0.000 description 4
- 102100029143 RNA 3'-terminal phosphate cyclase Human genes 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 108091008874 T cell receptors Proteins 0.000 description 4
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 4
- 108010060818 Toll-Like Receptor 9 Proteins 0.000 description 4
- 102100027010 Toll-like receptor 1 Human genes 0.000 description 4
- 102100027009 Toll-like receptor 10 Human genes 0.000 description 4
- 102100024324 Toll-like receptor 3 Human genes 0.000 description 4
- 102100033117 Toll-like receptor 9 Human genes 0.000 description 4
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 4
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 4
- 239000002253 acid Substances 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 229960000643 adenine Drugs 0.000 description 4
- 238000005054 agglomeration Methods 0.000 description 4
- 150000001336 alkenes Chemical class 0.000 description 4
- 230000002009 allergenic effect Effects 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 230000000840 anti-viral effect Effects 0.000 description 4
- 230000001363 autoimmune Effects 0.000 description 4
- 210000004369 blood Anatomy 0.000 description 4
- 239000008280 blood Substances 0.000 description 4
- 230000024203 complement activation Effects 0.000 description 4
- 210000000172 cytosol Anatomy 0.000 description 4
- 238000012217 deletion Methods 0.000 description 4
- 230000037430 deletion Effects 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 230000008105 immune reaction Effects 0.000 description 4
- 230000002163 immunogen Effects 0.000 description 4
- 102000018358 immunoglobulin Human genes 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 230000002147 killing effect Effects 0.000 description 4
- 210000003563 lymphoid tissue Anatomy 0.000 description 4
- 238000012423 maintenance Methods 0.000 description 4
- 210000004962 mammalian cell Anatomy 0.000 description 4
- 238000005259 measurement Methods 0.000 description 4
- 108010043655 penetratin Proteins 0.000 description 4
- MCYTYTUNNNZWOK-LCLOTLQISA-N penetratin Chemical compound C([C@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CCCNC(N)=N)[C@@H](C)CC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(N)=O)C1=CC=CC=C1 MCYTYTUNNNZWOK-LCLOTLQISA-N 0.000 description 4
- 238000010647 peptide synthesis reaction Methods 0.000 description 4
- 235000021317 phosphate Nutrition 0.000 description 4
- 230000004962 physiological condition Effects 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 230000003389 potentiating effect Effects 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 150000003148 prolines Chemical class 0.000 description 4
- 230000004224 protection Effects 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 238000004366 reverse phase liquid chromatography Methods 0.000 description 4
- FSYKKLYZXJSNPZ-UHFFFAOYSA-N sarcosine Chemical compound C[NH2+]CC([O-])=O FSYKKLYZXJSNPZ-UHFFFAOYSA-N 0.000 description 4
- 210000002966 serum Anatomy 0.000 description 4
- 239000007858 starting material Substances 0.000 description 4
- 229940113082 thymine Drugs 0.000 description 4
- 238000010361 transduction Methods 0.000 description 4
- 230000026683 transduction Effects 0.000 description 4
- 230000032258 transport Effects 0.000 description 4
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 3
- 108700031308 Antennapedia Homeodomain Proteins 0.000 description 3
- 108060001064 Calcitonin Proteins 0.000 description 3
- 108010012236 Chemokines Proteins 0.000 description 3
- 102000019034 Chemokines Human genes 0.000 description 3
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 3
- 108700006830 Drosophila Antp Proteins 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 101150021185 FGF gene Proteins 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- 208000009889 Herpes Simplex Diseases 0.000 description 3
- 102000006947 Histones Human genes 0.000 description 3
- 108010033040 Histones Proteins 0.000 description 3
- 101000831567 Homo sapiens Toll-like receptor 2 Proteins 0.000 description 3
- 101000669447 Homo sapiens Toll-like receptor 4 Proteins 0.000 description 3
- 101000669460 Homo sapiens Toll-like receptor 5 Proteins 0.000 description 3
- 101000669406 Homo sapiens Toll-like receptor 6 Proteins 0.000 description 3
- 241000713772 Human immunodeficiency virus 1 Species 0.000 description 3
- 102100037850 Interferon gamma Human genes 0.000 description 3
- 108010074328 Interferon-gamma Proteins 0.000 description 3
- 108010063045 Lactoferrin Proteins 0.000 description 3
- 102100032241 Lactotransferrin Human genes 0.000 description 3
- 108010047702 MPG peptide Proteins 0.000 description 3
- 238000006845 Michael addition reaction Methods 0.000 description 3
- 241001529936 Murinae Species 0.000 description 3
- 101100481581 Mus musculus Tlr13 gene Proteins 0.000 description 3
- 101710163270 Nuclease Proteins 0.000 description 3
- 108010088535 Pep-1 peptide Proteins 0.000 description 3
- 108091093037 Peptide nucleic acid Proteins 0.000 description 3
- 206010057249 Phagocytosis Diseases 0.000 description 3
- 108091036407 Polyadenylation Proteins 0.000 description 3
- 229920002873 Polyethylenimine Polymers 0.000 description 3
- 102000007327 Protamines Human genes 0.000 description 3
- 108010007568 Protamines Proteins 0.000 description 3
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010045517 Serum Amyloid P-Component Proteins 0.000 description 3
- 108020004682 Single-Stranded DNA Proteins 0.000 description 3
- 230000005867 T cell response Effects 0.000 description 3
- 210000004241 Th2 cell Anatomy 0.000 description 3
- 102100024333 Toll-like receptor 2 Human genes 0.000 description 3
- 102100039360 Toll-like receptor 4 Human genes 0.000 description 3
- 102100039357 Toll-like receptor 5 Human genes 0.000 description 3
- 102100039387 Toll-like receptor 6 Human genes 0.000 description 3
- 150000001408 amides Chemical class 0.000 description 3
- 125000003118 aryl group Chemical group 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 108010025307 buforin II Proteins 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 210000000170 cell membrane Anatomy 0.000 description 3
- 230000007969 cellular immunity Effects 0.000 description 3
- 230000004700 cellular uptake Effects 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- 238000007385 chemical modification Methods 0.000 description 3
- 230000004154 complement system Effects 0.000 description 3
- 229920001577 copolymer Polymers 0.000 description 3
- 230000004069 differentiation Effects 0.000 description 3
- 230000002349 favourable effect Effects 0.000 description 3
- 230000009368 gene silencing by RNA Effects 0.000 description 3
- 238000001415 gene therapy Methods 0.000 description 3
- 230000004727 humoral immunity Effects 0.000 description 3
- 229940042795 hydrazides for tuberculosis treatment Drugs 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 229940072221 immunoglobulins Drugs 0.000 description 3
- 239000012678 infectious agent Substances 0.000 description 3
- CSSYQJWUGATIHM-IKGCZBKSSA-N l-phenylalanyl-l-lysyl-l-cysteinyl-l-arginyl-l-arginyl-l-tryptophyl-l-glutaminyl-l-tryptophyl-l-arginyl-l-methionyl-l-lysyl-l-lysyl-l-leucylglycyl-l-alanyl-l-prolyl-l-seryl-l-isoleucyl-l-threonyl-l-cysteinyl-l-valyl-l-arginyl-l-arginyl-l-alanyl-l-phenylal Chemical compound C([C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 CSSYQJWUGATIHM-IKGCZBKSSA-N 0.000 description 3
- 229940078795 lactoferrin Drugs 0.000 description 3
- 235000021242 lactoferrin Nutrition 0.000 description 3
- 239000010410 layer Substances 0.000 description 3
- 230000015654 memory Effects 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 229910052757 nitrogen Inorganic materials 0.000 description 3
- 210000004940 nucleus Anatomy 0.000 description 3
- 230000008782 phagocytosis Effects 0.000 description 3
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 3
- 239000010452 phosphate Substances 0.000 description 3
- 230000000379 polymerizing effect Effects 0.000 description 3
- 230000035755 proliferation Effects 0.000 description 3
- 229940048914 protamine Drugs 0.000 description 3
- 230000001681 protective effect Effects 0.000 description 3
- 230000000630 rising effect Effects 0.000 description 3
- 230000019491 signal transduction Effects 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 229940063673 spermidine Drugs 0.000 description 3
- 229940063675 spermine Drugs 0.000 description 3
- 238000003860 storage Methods 0.000 description 3
- 230000008093 supporting effect Effects 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- PBKWZFANFUTEPS-CWUSWOHSSA-N transportan Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@H](C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(C)C)C(N)=O)[C@@H](C)CC)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)CN)[C@@H](C)O)C1=CC=C(O)C=C1 PBKWZFANFUTEPS-CWUSWOHSSA-N 0.000 description 3
- 108010062760 transportan Proteins 0.000 description 3
- HOZBSSWDEKVXNO-BXRBKJIMSA-N (2s)-2-azanylbutanedioic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O.OC(=O)[C@@H](N)CC(O)=O HOZBSSWDEKVXNO-BXRBKJIMSA-N 0.000 description 2
- WHTVZRBIWZFKQO-AWEZNQCLSA-N (S)-chloroquine Chemical compound ClC1=CC=C2C(N[C@@H](C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-AWEZNQCLSA-N 0.000 description 2
- MYRTYDVEIRVNKP-UHFFFAOYSA-N 1,2-Divinylbenzene Chemical compound C=CC1=CC=CC=C1C=C MYRTYDVEIRVNKP-UHFFFAOYSA-N 0.000 description 2
- SXGMVGOVILIERA-UHFFFAOYSA-N 2,3-diaminobutanoic acid Chemical compound CC(N)C(N)C(O)=O SXGMVGOVILIERA-UHFFFAOYSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- FUOOLUPWFVMBKG-UHFFFAOYSA-N 2-Aminoisobutyric acid Chemical compound CC(C)(N)C(O)=O FUOOLUPWFVMBKG-UHFFFAOYSA-N 0.000 description 2
- PECYZEOJVXMISF-UHFFFAOYSA-N 3-aminoalanine Chemical compound [NH3+]CC(N)C([O-])=O PECYZEOJVXMISF-UHFFFAOYSA-N 0.000 description 2
- DKIDEFUBRARXTE-UHFFFAOYSA-N 3-mercaptopropanoic acid Chemical compound OC(=O)CCS DKIDEFUBRARXTE-UHFFFAOYSA-N 0.000 description 2
- CYWHLOXWVAWMFO-UHFFFAOYSA-N 3-sulfanyl-1h-pyridine-2-thione Chemical compound SC1=CC=CN=C1S CYWHLOXWVAWMFO-UHFFFAOYSA-N 0.000 description 2
- JJMDCOVWQOJGCB-UHFFFAOYSA-N 5-aminopentanoic acid Chemical compound [NH3+]CCCCC([O-])=O JJMDCOVWQOJGCB-UHFFFAOYSA-N 0.000 description 2
- 108010083359 Antigen Receptors Proteins 0.000 description 2
- 102100037435 Antiviral innate immune response receptor RIG-I Human genes 0.000 description 2
- 101710127675 Antiviral innate immune response receptor RIG-I Proteins 0.000 description 2
- DIIGDGJKTMLQQW-IHRRRGAJSA-N Arg-Lys-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCN=C(N)N)N DIIGDGJKTMLQQW-IHRRRGAJSA-N 0.000 description 2
- 108090001008 Avidin Proteins 0.000 description 2
- 241000589968 Borrelia Species 0.000 description 2
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 2
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 2
- 108090000994 Catalytic RNA Proteins 0.000 description 2
- 102000053642 Catalytic RNA Human genes 0.000 description 2
- 229920001661 Chitosan Polymers 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 2
- 241000193468 Clostridium perfringens Species 0.000 description 2
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 2
- 241001115402 Ebolavirus Species 0.000 description 2
- 102100031780 Endonuclease Human genes 0.000 description 2
- 108010042407 Endonucleases Proteins 0.000 description 2
- 241001529459 Enterovirus A71 Species 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- 108010088729 HLA-A*02:01 antigen Proteins 0.000 description 2
- 208000028782 Hereditary disease Diseases 0.000 description 2
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 description 2
- 241000700588 Human alphaherpesvirus 1 Species 0.000 description 2
- 241000701074 Human alphaherpesvirus 2 Species 0.000 description 2
- 241000701041 Human betaherpesvirus 7 Species 0.000 description 2
- 241000046923 Human bocavirus Species 0.000 description 2
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 2
- 241000701027 Human herpesvirus 6 Species 0.000 description 2
- 241000342334 Human metapneumovirus Species 0.000 description 2
- 208000026350 Inborn Genetic disease Diseases 0.000 description 2
- 102100027353 Interferon-induced helicase C domain-containing protein 1 Human genes 0.000 description 2
- 101710085994 Interferon-induced helicase C domain-containing protein 1 Proteins 0.000 description 2
- 102100030703 Interleukin-22 Human genes 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- 125000000393 L-methionino group Chemical group [H]OC(=O)[C@@]([H])(N([H])[*])C([H])([H])C(SC([H])([H])[H])([H])[H] 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 208000016604 Lyme disease Diseases 0.000 description 2
- 241000712899 Lymphocytic choriomeningitis mammarenavirus Species 0.000 description 2
- 108010074338 Lymphokines Proteins 0.000 description 2
- 102000008072 Lymphokines Human genes 0.000 description 2
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical group O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 2
- 208000024556 Mendelian disease Diseases 0.000 description 2
- 241000700560 Molluscum contagiosum virus Species 0.000 description 2
- 102000013967 Monokines Human genes 0.000 description 2
- 108010050619 Monokines Proteins 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 102100031789 Myeloid-derived growth factor Human genes 0.000 description 2
- KSPIYJQBLVDRRI-UHFFFAOYSA-N N-methylisoleucine Chemical compound CCC(C)C(NC)C(O)=O KSPIYJQBLVDRRI-UHFFFAOYSA-N 0.000 description 2
- 102000007399 Nuclear hormone receptor Human genes 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 108010077895 Sarcosine Proteins 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 102000039471 Small Nuclear RNA Human genes 0.000 description 2
- 208000001203 Smallpox Diseases 0.000 description 2
- 241000191940 Staphylococcus Species 0.000 description 2
- 230000029662 T-helper 1 type immune response Effects 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- 241000710771 Tick-borne encephalitis virus Species 0.000 description 2
- 101710120037 Toxin CcdB Proteins 0.000 description 2
- 102000040945 Transcription factor Human genes 0.000 description 2
- 108091023040 Transcription factor Proteins 0.000 description 2
- 108091023045 Untranslated Region Proteins 0.000 description 2
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 229940127024 acid based drug Drugs 0.000 description 2
- 150000007513 acids Chemical class 0.000 description 2
- 208000037919 acquired disease Diseases 0.000 description 2
- 150000001252 acrylic acid derivatives Chemical class 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 150000003838 adenosines Chemical class 0.000 description 2
- 238000009098 adjuvant therapy Methods 0.000 description 2
- 230000002411 adverse Effects 0.000 description 2
- 150000001298 alcohols Chemical class 0.000 description 2
- 150000001299 aldehydes Chemical class 0.000 description 2
- 239000013566 allergen Substances 0.000 description 2
- 229960004784 allergens Drugs 0.000 description 2
- 238000010640 amide synthesis reaction Methods 0.000 description 2
- 230000000845 anti-microbial effect Effects 0.000 description 2
- 230000005875 antibody response Effects 0.000 description 2
- 230000030741 antigen processing and presentation Effects 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- 150000001540 azides Chemical class 0.000 description 2
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 2
- 230000001588 bifunctional effect Effects 0.000 description 2
- 230000008827 biological function Effects 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 239000001110 calcium chloride Substances 0.000 description 2
- 229910001628 calcium chloride Inorganic materials 0.000 description 2
- 125000002915 carbonyl group Chemical group [*:2]C([*:1])=O 0.000 description 2
- 150000001735 carboxylic acids Chemical class 0.000 description 2
- 150000001768 cations Chemical class 0.000 description 2
- 230000036755 cellular response Effects 0.000 description 2
- 229960003677 chloroquine Drugs 0.000 description 2
- WHTVZRBIWZFKQO-UHFFFAOYSA-N chloroquine Natural products ClC1=CC=C2C(NC(C)CCCN(CC)CC)=CC=NC2=C1 WHTVZRBIWZFKQO-UHFFFAOYSA-N 0.000 description 2
- 238000001142 circular dichroism spectrum Methods 0.000 description 2
- 238000005056 compaction Methods 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 230000016396 cytokine production Effects 0.000 description 2
- 108091007930 cytoplasmic receptors Proteins 0.000 description 2
- 230000007423 decrease Effects 0.000 description 2
- 230000007850 degeneration Effects 0.000 description 2
- 238000001212 derivatisation Methods 0.000 description 2
- 238000004090 dissolution Methods 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 230000000763 evoking effect Effects 0.000 description 2
- 230000002538 fungal effect Effects 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 108060003196 globin Proteins 0.000 description 2
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 210000003494 hepatocyte Anatomy 0.000 description 2
- 229920006158 high molecular weight polymer Polymers 0.000 description 2
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 2
- 150000002429 hydrazines Chemical class 0.000 description 2
- 150000002466 imines Chemical class 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 201000006747 infectious mononucleosis Diseases 0.000 description 2
- 230000000977 initiatory effect Effects 0.000 description 2
- 108091008582 intracellular receptors Proteins 0.000 description 2
- 102000027411 intracellular receptors Human genes 0.000 description 2
- 230000002427 irreversible effect Effects 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- 229940001447 lactate Drugs 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 230000007774 longterm Effects 0.000 description 2
- 210000005210 lymphoid organ Anatomy 0.000 description 2
- 230000034701 macropinocytosis Effects 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 210000001806 memory b lymphocyte Anatomy 0.000 description 2
- 239000000693 micelle Substances 0.000 description 2
- 210000003097 mucus Anatomy 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 210000000822 natural killer cell Anatomy 0.000 description 2
- 238000006386 neutralization reaction Methods 0.000 description 2
- 125000004433 nitrogen atom Chemical group N* 0.000 description 2
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 2
- 108091027963 non-coding RNA Proteins 0.000 description 2
- 102000042567 non-coding RNA Human genes 0.000 description 2
- 238000001668 nucleic acid synthesis Methods 0.000 description 2
- 230000014207 opsonization Effects 0.000 description 2
- 230000003571 opsonizing effect Effects 0.000 description 2
- 210000005134 plasmacytoid dendritic cell Anatomy 0.000 description 2
- 210000004180 plasmocyte Anatomy 0.000 description 2
- 229920000962 poly(amidoamine) Polymers 0.000 description 2
- 239000001103 potassium chloride Substances 0.000 description 2
- 235000011164 potassium chloride Nutrition 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 235000019419 proteases Nutrition 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 108091092562 ribozyme Proteins 0.000 description 2
- 230000003248 secreting effect Effects 0.000 description 2
- 108091029842 small nuclear ribonucleic acid Proteins 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 238000010532 solid phase synthesis reaction Methods 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- BDHFUVZGWQCTTF-UHFFFAOYSA-N sulfonic acid Chemical class OS(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-N 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 150000003573 thiols Chemical class 0.000 description 2
- 239000012096 transfection reagent Substances 0.000 description 2
- 239000001226 triphosphate Substances 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- YPJJGMCMOHDOFZ-ZETCQYMHSA-N (2s)-2-(1-benzothiophen-3-ylamino)propanoic acid Chemical compound C1=CC=C2C(N[C@@H](C)C(O)=O)=CSC2=C1 YPJJGMCMOHDOFZ-ZETCQYMHSA-N 0.000 description 1
- BVAUMRCGVHUWOZ-ZETCQYMHSA-N (2s)-2-(cyclohexylazaniumyl)propanoate Chemical compound OC(=O)[C@H](C)NC1CCCCC1 BVAUMRCGVHUWOZ-ZETCQYMHSA-N 0.000 description 1
- IYKLZBIWFXPUCS-VIFPVBQESA-N (2s)-2-(naphthalen-1-ylamino)propanoic acid Chemical compound C1=CC=C2C(N[C@@H](C)C(O)=O)=CC=CC2=C1 IYKLZBIWFXPUCS-VIFPVBQESA-N 0.000 description 1
- MRTPISKDZDHEQI-YFKPBYRVSA-N (2s)-2-(tert-butylamino)propanoic acid Chemical compound OC(=O)[C@H](C)NC(C)(C)C MRTPISKDZDHEQI-YFKPBYRVSA-N 0.000 description 1
- NPDBDJFLKKQMCM-SCSAIBSYSA-N (2s)-2-amino-3,3-dimethylbutanoic acid Chemical compound CC(C)(C)[C@H](N)C(O)=O NPDBDJFLKKQMCM-SCSAIBSYSA-N 0.000 description 1
- LJRDOKAZOAKLDU-UDXJMMFXSA-N (2s,3s,4r,5r,6r)-5-amino-2-(aminomethyl)-6-[(2r,3s,4r,5s)-5-[(1r,2r,3s,5r,6s)-3,5-diamino-2-[(2s,3r,4r,5s,6r)-3-amino-4,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-hydroxycyclohexyl]oxy-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl]oxyoxane-3,4-diol;sulfuric ac Chemical compound OS(O)(=O)=O.N[C@@H]1[C@@H](O)[C@H](O)[C@H](CN)O[C@@H]1O[C@H]1[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](N)C[C@@H](N)[C@@H]2O)O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)N)O[C@@H]1CO LJRDOKAZOAKLDU-UDXJMMFXSA-N 0.000 description 1
- UKAUYVFTDYCKQA-UHFFFAOYSA-N -2-Amino-4-hydroxybutanoic acid Natural products OC(=O)C(N)CCO UKAUYVFTDYCKQA-UHFFFAOYSA-N 0.000 description 1
- NDMFETHQFUOIQX-UHFFFAOYSA-N 1-(3-chloropropyl)imidazolidin-2-one Chemical compound ClCCCN1CCNC1=O NDMFETHQFUOIQX-UHFFFAOYSA-N 0.000 description 1
- KSXTUUUQYQYKCR-LQDDAWAPSA-M 2,3-bis[[(z)-octadec-9-enoyl]oxy]propyl-trimethylazanium;chloride Chemical compound [Cl-].CCCCCCCC\C=C/CCCCCCCC(=O)OCC(C[N+](C)(C)C)OC(=O)CCCCCCC\C=C/CCCCCCCC KSXTUUUQYQYKCR-LQDDAWAPSA-M 0.000 description 1
- OGNSCSPNOLGXSM-UHFFFAOYSA-N 2,4-diaminobutyric acid Chemical compound NCCC(N)C(O)=O OGNSCSPNOLGXSM-UHFFFAOYSA-N 0.000 description 1
- 125000001917 2,4-dinitrophenyl group Chemical group [H]C1=C([H])C(=C([H])C(=C1*)[N+]([O-])=O)[N+]([O-])=O 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- NYEZZYQZRQDLEH-UHFFFAOYSA-N 2-ethyl-4,5-dihydro-1,3-oxazole Chemical compound CCC1=NCCO1 NYEZZYQZRQDLEH-UHFFFAOYSA-N 0.000 description 1
- NYCRCTMDYITATC-UHFFFAOYSA-N 2-fluorophenylalanine Chemical compound OC(=O)C(N)CC1=CC=CC=C1F NYCRCTMDYITATC-UHFFFAOYSA-N 0.000 description 1
- CYDQOEWLBCCFJZ-UHFFFAOYSA-N 4-(4-fluorophenyl)oxane-4-carboxylic acid Chemical compound C=1C=C(F)C=CC=1C1(C(=O)O)CCOCC1 CYDQOEWLBCCFJZ-UHFFFAOYSA-N 0.000 description 1
- CMUHFUGDYMFHEI-QMMMGPOBSA-N 4-amino-L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N)C=C1 CMUHFUGDYMFHEI-QMMMGPOBSA-N 0.000 description 1
- XWHHYOYVRVGJJY-QMMMGPOBSA-N 4-fluoro-L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(F)C=C1 XWHHYOYVRVGJJY-QMMMGPOBSA-N 0.000 description 1
- 108020003589 5' Untranslated Regions Proteins 0.000 description 1
- 108091027075 5S-rRNA precursor Proteins 0.000 description 1
- SLXKOJJOQWFEFD-UHFFFAOYSA-N 6-aminohexanoic acid Chemical compound NCCCCCC(O)=O SLXKOJJOQWFEFD-UHFFFAOYSA-N 0.000 description 1
- 241000588626 Acinetobacter baumannii Species 0.000 description 1
- 206010069754 Acquired gene mutation Diseases 0.000 description 1
- 241000606646 Anaplasma Species 0.000 description 1
- 241000605281 Anaplasma phagocytophilum Species 0.000 description 1
- 241001511271 Ancylostoma braziliense Species 0.000 description 1
- 241000498253 Ancylostoma duodenale Species 0.000 description 1
- 102000006306 Antigen Receptors Human genes 0.000 description 1
- 108700042778 Antimicrobial Peptides Proteins 0.000 description 1
- 102000044503 Antimicrobial Peptides Human genes 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 102000009515 Arachidonate 15-Lipoxygenase Human genes 0.000 description 1
- 108010048907 Arachidonate 15-lipoxygenase Proteins 0.000 description 1
- 241001135700 Arcanobacterium haemolyticum Species 0.000 description 1
- 241000244185 Ascaris lumbricoides Species 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 241001533362 Astroviridae Species 0.000 description 1
- NOWKCMXCCJGMRR-UHFFFAOYSA-N Aziridine Chemical class C1CN1 NOWKCMXCCJGMRR-UHFFFAOYSA-N 0.000 description 1
- 241000223836 Babesia Species 0.000 description 1
- 241000193755 Bacillus cereus Species 0.000 description 1
- 108020000946 Bacterial DNA Proteins 0.000 description 1
- 108010077805 Bacterial Proteins Proteins 0.000 description 1
- 241001518086 Bartonella henselae Species 0.000 description 1
- 241000726107 Blastocystis hominis Species 0.000 description 1
- 241000228405 Blastomyces dermatitidis Species 0.000 description 1
- BTBUEUYNUDRHOZ-UHFFFAOYSA-N Borate Chemical compound [O-]B([O-])[O-] BTBUEUYNUDRHOZ-UHFFFAOYSA-N 0.000 description 1
- 241000588832 Bordetella pertussis Species 0.000 description 1
- 241000589969 Borreliella burgdorferi Species 0.000 description 1
- 241000589562 Brucella Species 0.000 description 1
- 241000244038 Brugia malayi Species 0.000 description 1
- 241001453380 Burkholderia Species 0.000 description 1
- 241000589513 Burkholderia cepacia Species 0.000 description 1
- 241000722910 Burkholderia mallei Species 0.000 description 1
- 241001136175 Burkholderia pseudomallei Species 0.000 description 1
- 239000008001 CAPS buffer Substances 0.000 description 1
- 108010029697 CD40 Ligand Proteins 0.000 description 1
- 102100032937 CD40 ligand Human genes 0.000 description 1
- 239000008000 CHES buffer Substances 0.000 description 1
- 241000714198 Caliciviridae Species 0.000 description 1
- 102100021868 Calnexin Human genes 0.000 description 1
- 108010056891 Calnexin Proteins 0.000 description 1
- 102100029968 Calreticulin Human genes 0.000 description 1
- 108090000549 Calreticulin Proteins 0.000 description 1
- 241000589876 Campylobacter Species 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 241000222122 Candida albicans Species 0.000 description 1
- 241001647372 Chlamydia pneumoniae Species 0.000 description 1
- 241001647378 Chlamydia psittaci Species 0.000 description 1
- 241000606153 Chlamydia trachomatis Species 0.000 description 1
- 208000017667 Chronic Disease Diseases 0.000 description 1
- 241001327965 Clonorchis sinensis Species 0.000 description 1
- 241000193163 Clostridioides difficile Species 0.000 description 1
- 241000193403 Clostridium Species 0.000 description 1
- 241000193155 Clostridium botulinum Species 0.000 description 1
- 241000193449 Clostridium tetani Species 0.000 description 1
- 241000223203 Coccidioides Species 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 241000711573 Coronaviridae Species 0.000 description 1
- 241000186227 Corynebacterium diphtheriae Species 0.000 description 1
- 241000606678 Coxiella burnetii Species 0.000 description 1
- 208000020406 Creutzfeldt Jacob disease Diseases 0.000 description 1
- 208000003407 Creutzfeldt-Jakob Syndrome Diseases 0.000 description 1
- 208000010859 Creutzfeldt-Jakob disease Diseases 0.000 description 1
- 241000150230 Crimean-Congo hemorrhagic fever orthonairovirus Species 0.000 description 1
- 201000007336 Cryptococcosis Diseases 0.000 description 1
- 241000221204 Cryptococcus neoformans Species 0.000 description 1
- 241000223935 Cryptosporidium Species 0.000 description 1
- 206010050685 Cytokine storm Diseases 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- 150000008574 D-amino acids Chemical class 0.000 description 1
- 108020001019 DNA Primers Proteins 0.000 description 1
- 239000003155 DNA primer Substances 0.000 description 1
- 239000003298 DNA probe Substances 0.000 description 1
- 241000710829 Dengue virus group Species 0.000 description 1
- 241000702421 Dependoparvovirus Species 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 241000157306 Dientamoeba fragilis Species 0.000 description 1
- 101100316028 Drosophila melanogaster Uggt gene Proteins 0.000 description 1
- 241000244160 Echinococcus Species 0.000 description 1
- 241000605314 Ehrlichia Species 0.000 description 1
- 241000605310 Ehrlichia chaffeensis Species 0.000 description 1
- 241000605282 Ehrlichia ewingii Species 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 208000032163 Emerging Communicable disease Diseases 0.000 description 1
- 241000224432 Entamoeba histolytica Species 0.000 description 1
- 241000194033 Enterococcus Species 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 241001480035 Epidermophyton Species 0.000 description 1
- 241001646719 Escherichia coli O157:H7 Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 241000204939 Fasciola gigantica Species 0.000 description 1
- 241000242711 Fasciola hepatica Species 0.000 description 1
- 108010008177 Fd immunoglobulins Proteins 0.000 description 1
- NIGWMJHCCYYCSF-UHFFFAOYSA-N Fenclonine Chemical compound OC(=O)C(N)CC1=CC=C(Cl)C=C1 NIGWMJHCCYYCSF-UHFFFAOYSA-N 0.000 description 1
- 241000244009 Filarioidea Species 0.000 description 1
- 241000710831 Flavivirus Species 0.000 description 1
- 241000589602 Francisella tularensis Species 0.000 description 1
- 108010058643 Fungal Proteins Proteins 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 241000605909 Fusobacterium Species 0.000 description 1
- 244000168141 Geotrichum candidum Species 0.000 description 1
- 235000017388 Geotrichum candidum Nutrition 0.000 description 1
- 241000224467 Giardia intestinalis Species 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 241000880292 Gnathostoma Species 0.000 description 1
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 241000190708 Guanarito mammarenavirus Species 0.000 description 1
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 241000606768 Haemophilus influenzae Species 0.000 description 1
- 241000590002 Helicobacter pylori Species 0.000 description 1
- 241000893570 Hendra henipavirus Species 0.000 description 1
- 241000035314 Henipavirus Species 0.000 description 1
- 241000711549 Hepacivirus C Species 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 241000724675 Hepatitis E virus Species 0.000 description 1
- 208000037262 Hepatitis delta Diseases 0.000 description 1
- 241000724709 Hepatitis delta virus Species 0.000 description 1
- 241000709721 Hepatovirus A Species 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 description 1
- 241000228404 Histoplasma capsulatum Species 0.000 description 1
- 101001002470 Homo sapiens Interferon lambda-1 Proteins 0.000 description 1
- 101000853002 Homo sapiens Interleukin-25 Proteins 0.000 description 1
- 101000853000 Homo sapiens Interleukin-26 Proteins 0.000 description 1
- 101000998139 Homo sapiens Interleukin-32 Proteins 0.000 description 1
- 101001128431 Homo sapiens Myeloid-derived growth factor Proteins 0.000 description 1
- 101000911513 Homo sapiens Uncharacterized protein FAM215A Proteins 0.000 description 1
- 241000308514 Hortaea werneckii Species 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 206010020429 Human ehrlichiosis Diseases 0.000 description 1
- 241000702617 Human parvovirus B19 Species 0.000 description 1
- 241000829111 Human polyomavirus 1 Species 0.000 description 1
- PMMYEEVYMWASQN-DMTCNVIQSA-N Hydroxyproline Chemical compound O[C@H]1CN[C@H](C(O)=O)C1 PMMYEEVYMWASQN-DMTCNVIQSA-N 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 102100026720 Interferon beta Human genes 0.000 description 1
- 108090000467 Interferon-beta Proteins 0.000 description 1
- 102100034170 Interferon-induced, double-stranded RNA-activated protein kinase Human genes 0.000 description 1
- 101710089751 Interferon-induced, double-stranded RNA-activated protein kinase Proteins 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000000589 Interleukin-1 Human genes 0.000 description 1
- 108010002352 Interleukin-1 Proteins 0.000 description 1
- 102000003814 Interleukin-10 Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 102000013462 Interleukin-12 Human genes 0.000 description 1
- 108010065805 Interleukin-12 Proteins 0.000 description 1
- 102000003816 Interleukin-13 Human genes 0.000 description 1
- 108090000176 Interleukin-13 Proteins 0.000 description 1
- 102000003812 Interleukin-15 Human genes 0.000 description 1
- 108090000172 Interleukin-15 Proteins 0.000 description 1
- 102000049772 Interleukin-16 Human genes 0.000 description 1
- 101800003050 Interleukin-16 Proteins 0.000 description 1
- 102000003810 Interleukin-18 Human genes 0.000 description 1
- 108090000171 Interleukin-18 Proteins 0.000 description 1
- 102100039879 Interleukin-19 Human genes 0.000 description 1
- 108050009288 Interleukin-19 Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 102000013264 Interleukin-23 Human genes 0.000 description 1
- 108010065637 Interleukin-23 Proteins 0.000 description 1
- 102100036679 Interleukin-26 Human genes 0.000 description 1
- 108010066979 Interleukin-27 Proteins 0.000 description 1
- 108010002386 Interleukin-3 Proteins 0.000 description 1
- 102000000646 Interleukin-3 Human genes 0.000 description 1
- 102100021596 Interleukin-31 Human genes 0.000 description 1
- 101710181613 Interleukin-31 Proteins 0.000 description 1
- 102100033501 Interleukin-32 Human genes 0.000 description 1
- 108010067003 Interleukin-33 Proteins 0.000 description 1
- 102000017761 Interleukin-33 Human genes 0.000 description 1
- 102000004388 Interleukin-4 Human genes 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 102000000743 Interleukin-5 Human genes 0.000 description 1
- 102000004889 Interleukin-6 Human genes 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 102000000704 Interleukin-7 Human genes 0.000 description 1
- 102000004890 Interleukin-8 Human genes 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 102000000585 Interleukin-9 Human genes 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 101150008942 J gene Proteins 0.000 description 1
- 241000701460 JC polyomavirus Species 0.000 description 1
- 241000710842 Japanese encephalitis virus Species 0.000 description 1
- 241000712890 Junin mammarenavirus Species 0.000 description 1
- 241000589014 Kingella kingae Species 0.000 description 1
- 241001534216 Klebsiella granulomatis Species 0.000 description 1
- QUOGESRFPZDMMT-UHFFFAOYSA-N L-Homoarginine Natural products OC(=O)C(N)CCCCNC(N)=N QUOGESRFPZDMMT-UHFFFAOYSA-N 0.000 description 1
- ZGUNAGUHMKGQNY-ZETCQYMHSA-N L-alpha-phenylglycine zwitterion Chemical compound OC(=O)[C@@H](N)C1=CC=CC=C1 ZGUNAGUHMKGQNY-ZETCQYMHSA-N 0.000 description 1
- 150000008575 L-amino acids Chemical class 0.000 description 1
- RHGKLRLOHDJJDR-BYPYZUCNSA-N L-citrulline Chemical compound NC(=O)NCCC[C@H]([NH3+])C([O-])=O RHGKLRLOHDJJDR-BYPYZUCNSA-N 0.000 description 1
- QUOGESRFPZDMMT-YFKPBYRVSA-N L-homoarginine Chemical compound OC(=O)[C@@H](N)CCCCNC(N)=N QUOGESRFPZDMMT-YFKPBYRVSA-N 0.000 description 1
- FFFHZYDWPBMWHY-VKHMYHEASA-N L-homocysteine Chemical compound OC(=O)[C@@H](N)CCS FFFHZYDWPBMWHY-VKHMYHEASA-N 0.000 description 1
- UKAUYVFTDYCKQA-VKHMYHEASA-N L-homoserine Chemical compound OC(=O)[C@@H](N)CCO UKAUYVFTDYCKQA-VKHMYHEASA-N 0.000 description 1
- QEFRNWWLZKMPFJ-ZXPFJRLXSA-N L-methionine (R)-S-oxide Chemical compound C[S@@](=O)CC[C@H]([NH3+])C([O-])=O QEFRNWWLZKMPFJ-ZXPFJRLXSA-N 0.000 description 1
- QEFRNWWLZKMPFJ-UHFFFAOYSA-N L-methionine sulphoxide Natural products CS(=O)CCC(N)C(O)=O QEFRNWWLZKMPFJ-UHFFFAOYSA-N 0.000 description 1
- LRQKBLKVPFOOQJ-YFKPBYRVSA-N L-norleucine Chemical compound CCCC[C@H]([NH3+])C([O-])=O LRQKBLKVPFOOQJ-YFKPBYRVSA-N 0.000 description 1
- 101150048357 Lamp1 gene Proteins 0.000 description 1
- 241000712902 Lassa mammarenavirus Species 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- 241000589242 Legionella pneumophila Species 0.000 description 1
- 241000222722 Leishmania <genus> Species 0.000 description 1
- 241000589902 Leptospira Species 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 102100026894 Lymphotoxin-beta Human genes 0.000 description 1
- 108090000362 Lymphotoxin-beta Proteins 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 102000043131 MHC class II family Human genes 0.000 description 1
- 239000007993 MOPS buffer Substances 0.000 description 1
- 241000712898 Machupo mammarenavirus Species 0.000 description 1
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100028123 Macrophage colony-stimulating factor 1 Human genes 0.000 description 1
- 241000555676 Malassezia Species 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 241001115401 Marburgvirus Species 0.000 description 1
- 241000712079 Measles morbillivirus Species 0.000 description 1
- 241001660197 Metagonimus Species 0.000 description 1
- DBTDEFJAFBUGPP-UHFFFAOYSA-N Methanethial Chemical compound S=C DBTDEFJAFBUGPP-UHFFFAOYSA-N 0.000 description 1
- 241000243190 Microsporidia Species 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- 101100198353 Mus musculus Rnasel gene Proteins 0.000 description 1
- 241000186362 Mycobacterium leprae Species 0.000 description 1
- 241000178382 Mycobacterium lepromatosis Species 0.000 description 1
- 241000187917 Mycobacterium ulcerans Species 0.000 description 1
- 241000202934 Mycoplasma pneumoniae Species 0.000 description 1
- VEYYWZRYIYDQJM-ZETCQYMHSA-N N(2)-acetyl-L-lysine Chemical compound CC(=O)N[C@H](C([O-])=O)CCCC[NH3+] VEYYWZRYIYDQJM-ZETCQYMHSA-N 0.000 description 1
- FSVCELGFZIQNCK-UHFFFAOYSA-N N,N-bis(2-hydroxyethyl)glycine Chemical compound OCCN(CCO)CC(O)=O FSVCELGFZIQNCK-UHFFFAOYSA-N 0.000 description 1
- AKCRVYNORCOYQT-YFKPBYRVSA-N N-methyl-L-valine Chemical compound CN[C@@H](C(C)C)C(O)=O AKCRVYNORCOYQT-YFKPBYRVSA-N 0.000 description 1
- JOCBASBOOFNAJA-UHFFFAOYSA-N N-tris(hydroxymethyl)methyl-2-aminoethanesulfonic acid Chemical compound OCC(CO)(CO)NCCS(O)(=O)=O JOCBASBOOFNAJA-UHFFFAOYSA-N 0.000 description 1
- 102000012064 NLR Proteins Human genes 0.000 description 1
- 108091005686 NOD-like receptors Proteins 0.000 description 1
- 241000224438 Naegleria fowleri Species 0.000 description 1
- RHGKLRLOHDJJDR-UHFFFAOYSA-N Ndelta-carbamoyl-DL-ornithine Natural products OC(=O)C(N)CCCNC(N)=O RHGKLRLOHDJJDR-UHFFFAOYSA-N 0.000 description 1
- 241000498270 Necator americanus Species 0.000 description 1
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 1
- 241000588650 Neisseria meningitidis Species 0.000 description 1
- 241000526636 Nipah henipavirus Species 0.000 description 1
- 241000187654 Nocardia Species 0.000 description 1
- 241000187678 Nocardia asteroides Species 0.000 description 1
- 108091092724 Noncoding DNA Proteins 0.000 description 1
- 241000243985 Onchocerca volvulus Species 0.000 description 1
- 108700022034 Opsonin Proteins Proteins 0.000 description 1
- 241000606693 Orientia tsutsugamushi Species 0.000 description 1
- 241000150452 Orthohantavirus Species 0.000 description 1
- 241000712464 Orthomyxoviridae Species 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 239000007990 PIPES buffer Substances 0.000 description 1
- 241000526686 Paracoccidioides brasiliensis Species 0.000 description 1
- 241001480233 Paragonimus Species 0.000 description 1
- 241001480234 Paragonimus westermani Species 0.000 description 1
- 208000002606 Paramyxoviridae Infections Diseases 0.000 description 1
- 241000606860 Pasteurella Species 0.000 description 1
- 241000150350 Peribunyaviridae Species 0.000 description 1
- 241000255964 Pieridae Species 0.000 description 1
- 241000224016 Plasmodium Species 0.000 description 1
- 241000142787 Pneumocystis jirovecii Species 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 108010042038 Protozoan Proteins Proteins 0.000 description 1
- 108091005685 RIG-I-like receptors Proteins 0.000 description 1
- 108090000944 RNA Helicases Proteins 0.000 description 1
- 102000004409 RNA Helicases Human genes 0.000 description 1
- 108020004422 Riboswitch Proteins 0.000 description 1
- 241000606701 Rickettsia Species 0.000 description 1
- 241000606723 Rickettsia akari Species 0.000 description 1
- 241000606697 Rickettsia prowazekii Species 0.000 description 1
- 241000606695 Rickettsia rickettsii Species 0.000 description 1
- 241000606726 Rickettsia typhi Species 0.000 description 1
- 241000713124 Rift Valley fever virus Species 0.000 description 1
- 241000702670 Rotavirus Species 0.000 description 1
- 241000710799 Rubella virus Species 0.000 description 1
- 241000315672 SARS coronavirus Species 0.000 description 1
- 102100027720 SH2 domain-containing protein 1A Human genes 0.000 description 1
- 241000192617 Sabia mammarenavirus Species 0.000 description 1
- 241000607142 Salmonella Species 0.000 description 1
- 241000509427 Sarcoptes scabiei Species 0.000 description 1
- 241000242678 Schistosoma Species 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- 241000150288 Sin Nombre orthohantavirus Species 0.000 description 1
- 108091027967 Small hairpin RNA Proteins 0.000 description 1
- 241001149963 Sporothrix schenckii Species 0.000 description 1
- 241000193985 Streptococcus agalactiae Species 0.000 description 1
- 241000193998 Streptococcus pneumoniae Species 0.000 description 1
- 241000193996 Streptococcus pyogenes Species 0.000 description 1
- 241000244177 Strongyloides stercoralis Species 0.000 description 1
- 108010008038 Synthetic Vaccines Proteins 0.000 description 1
- 239000007994 TES buffer Substances 0.000 description 1
- 241000244155 Taenia Species 0.000 description 1
- 241000244157 Taenia solium Species 0.000 description 1
- 102100028082 Tapasin Human genes 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- 108010060752 Toll-Like Receptor 8 Proteins 0.000 description 1
- 102000008208 Toll-Like Receptor 8 Human genes 0.000 description 1
- 241000244030 Toxocara canis Species 0.000 description 1
- 241000244020 Toxocara cati Species 0.000 description 1
- 241000223997 Toxoplasma gondii Species 0.000 description 1
- 108091032917 Transfer-messenger RNA Proteins 0.000 description 1
- 241000589884 Treponema pallidum Species 0.000 description 1
- 241000243777 Trichinella spiralis Species 0.000 description 1
- 241000224527 Trichomonas vaginalis Species 0.000 description 1
- 241000223238 Trichophyton Species 0.000 description 1
- 241001489145 Trichuris trichiura Species 0.000 description 1
- 239000007997 Tricine buffer Substances 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 241000209140 Triticum Species 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- 241000223105 Trypanosoma brucei Species 0.000 description 1
- 241000223109 Trypanosoma cruzi Species 0.000 description 1
- 208000034953 Twin anemia-polycythemia sequence Diseases 0.000 description 1
- 108091000117 Tyrosine 3-Monooxygenase Proteins 0.000 description 1
- 102000048218 Tyrosine 3-monooxygenases Human genes 0.000 description 1
- 102100026728 Uncharacterized protein FAM215A Human genes 0.000 description 1
- 241000202921 Ureaplasma urealyticum Species 0.000 description 1
- 208000018756 Variant Creutzfeldt-Jakob disease Diseases 0.000 description 1
- 241000710959 Venezuelan equine encephalitis virus Species 0.000 description 1
- 241000607626 Vibrio cholerae Species 0.000 description 1
- 108010067390 Viral Proteins Proteins 0.000 description 1
- 241000710886 West Nile virus Species 0.000 description 1
- 241000710951 Western equine encephalitis virus Species 0.000 description 1
- 241000244005 Wuchereria bancrofti Species 0.000 description 1
- 241000269368 Xenopus laevis Species 0.000 description 1
- 241000710772 Yellow fever virus Species 0.000 description 1
- 241000607447 Yersinia enterocolitica Species 0.000 description 1
- 241000607479 Yersinia pestis Species 0.000 description 1
- 241000607477 Yersinia pseudotuberculosis Species 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 241000606834 [Haemophilus] ducreyi Species 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 102000035181 adaptor proteins Human genes 0.000 description 1
- 108091005764 adaptor proteins Proteins 0.000 description 1
- 230000000240 adjuvant effect Effects 0.000 description 1
- 230000009824 affinity maturation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 229940037003 alum Drugs 0.000 description 1
- 125000003368 amide group Chemical group 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 239000002269 analeptic agent Substances 0.000 description 1
- 235000021120 animal protein Nutrition 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000003266 anti-allergic effect Effects 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 239000003146 anticoagulant agent Substances 0.000 description 1
- 229940127219 anticoagulant drug Drugs 0.000 description 1
- 239000004019 antithrombin Substances 0.000 description 1
- 230000005975 antitumor immune response Effects 0.000 description 1
- 239000003443 antiviral agent Substances 0.000 description 1
- 230000007416 antiviral immune response Effects 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 150000001541 aziridines Chemical class 0.000 description 1
- 201000008680 babesiosis Diseases 0.000 description 1
- 229940092524 bartonella henselae Drugs 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 1
- 229940000635 beta-alanine Drugs 0.000 description 1
- 239000007998 bicine buffer Substances 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 125000006367 bivalent amino carbonyl group Chemical group [H]N([*:1])C([*:2])=O 0.000 description 1
- 229940011597 blastocystis hominis Drugs 0.000 description 1
- 230000017531 blood circulation Effects 0.000 description 1
- 239000012503 blood component Substances 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 230000003139 buffering effect Effects 0.000 description 1
- 229940074375 burkholderia mallei Drugs 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 229940095731 candida albicans Drugs 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 125000006355 carbonyl methylene group Chemical group [H]C([H])([*:2])C([*:1])=O 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 210000004671 cell-free system Anatomy 0.000 description 1
- 238000012412 chemical coupling Methods 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 229940038705 chlamydia trachomatis Drugs 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 238000002983 circular dichroism Methods 0.000 description 1
- 229960002173 citrulline Drugs 0.000 description 1
- 235000013477 citrulline Nutrition 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 230000009918 complex formation Effects 0.000 description 1
- 238000006482 condensation reaction Methods 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 239000002577 cryoprotective agent Substances 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 206010052015 cytokine release syndrome Diseases 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000005860 defense response to virus Effects 0.000 description 1
- 229940124447 delivery agent Drugs 0.000 description 1
- 239000000412 dendrimer Substances 0.000 description 1
- 229920000736 dendritic polymer Polymers 0.000 description 1
- 210000004207 dermis Anatomy 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 208000035475 disorder Diseases 0.000 description 1
- PMMYEEVYMWASQN-UHFFFAOYSA-N dl-hydroxyproline Natural products OC1C[NH2+]C(C([O-])=O)C1 PMMYEEVYMWASQN-UHFFFAOYSA-N 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 230000005684 electric field Effects 0.000 description 1
- 230000008030 elimination Effects 0.000 description 1
- 238000003379 elimination reaction Methods 0.000 description 1
- 230000012202 endocytosis Effects 0.000 description 1
- 230000000021 endosomolytic effect Effects 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 229940007078 entamoeba histolytica Drugs 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 238000003114 enzyme-linked immunosorbent spot assay Methods 0.000 description 1
- 210000003743 erythrocyte Anatomy 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 210000002744 extracellular matrix Anatomy 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 125000002485 formyl group Chemical group [H]C(*)=O 0.000 description 1
- 229940118764 francisella tularensis Drugs 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 238000003197 gene knockdown Methods 0.000 description 1
- 230000012178 germinal center formation Effects 0.000 description 1
- 102000018146 globin Human genes 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 210000002288 golgi apparatus Anatomy 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 229940047650 haemophilus influenzae Drugs 0.000 description 1
- 230000035876 healing Effects 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 229940037467 helicobacter pylori Drugs 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 231100000086 high toxicity Toxicity 0.000 description 1
- 102000056142 human TLR1 Human genes 0.000 description 1
- 210000005260 human cell Anatomy 0.000 description 1
- 230000008348 humoral response Effects 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 125000004029 hydroxymethyl group Chemical group [H]OC([H])([H])* 0.000 description 1
- 229960002591 hydroxyproline Drugs 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 230000006054 immunological memory Effects 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 238000009830 intercalation Methods 0.000 description 1
- 230000002687 intercalation Effects 0.000 description 1
- 230000010468 interferon response Effects 0.000 description 1
- 229940047124 interferons Drugs 0.000 description 1
- 102000004114 interleukin 20 Human genes 0.000 description 1
- 108090000681 interleukin 20 Proteins 0.000 description 1
- 108010074108 interleukin-21 Proteins 0.000 description 1
- 108010074109 interleukin-22 Proteins 0.000 description 1
- 102000003898 interleukin-24 Human genes 0.000 description 1
- 108090000237 interleukin-24 Proteins 0.000 description 1
- 229940047122 interleukins Drugs 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 108010028930 invariant chain Proteins 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 1
- 206010023497 kuru Diseases 0.000 description 1
- 150000003951 lactams Chemical group 0.000 description 1
- 239000004816 latex Substances 0.000 description 1
- 229920000126 latex Polymers 0.000 description 1
- 229940115932 legionella pneumophila Drugs 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 229920006008 lipopolysaccharide Polymers 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000007791 liquid phase Substances 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 230000005923 long-lasting effect Effects 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- VWHRYODZTDMVSS-QMMMGPOBSA-N m-fluoro-L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC(F)=C1 VWHRYODZTDMVSS-QMMMGPOBSA-N 0.000 description 1
- 230000000873 masking effect Effects 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 210000003071 memory t lymphocyte Anatomy 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 108091070501 miRNA Proteins 0.000 description 1
- 239000002679 microRNA Substances 0.000 description 1
- 230000003641 microbiacidal effect Effects 0.000 description 1
- 230000002438 mitochondrial effect Effects 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- 210000000865 mononuclear phagocyte system Anatomy 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- OKPYIWASQZGASP-UHFFFAOYSA-N n-(2-hydroxypropyl)-2-methylprop-2-enamide Chemical compound CC(O)CNC(=O)C(C)=C OKPYIWASQZGASP-UHFFFAOYSA-N 0.000 description 1
- DAZSWUUAFHBCGE-KRWDZBQOSA-N n-[(2s)-3-methyl-1-oxo-1-pyrrolidin-1-ylbutan-2-yl]-3-phenylpropanamide Chemical compound N([C@@H](C(C)C)C(=O)N1CCCC1)C(=O)CCC1=CC=CC=C1 DAZSWUUAFHBCGE-KRWDZBQOSA-N 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 231100000956 nontoxicity Toxicity 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- VQWNELVFHZRFIB-UHFFFAOYSA-N odn 1826 Chemical compound O=C1NC(=O)C(C)=CN1C(O1)CC(O)C1COP(O)(=O)OC1CC(N2C(NC(=O)C(C)=C2)=O)OC1COP(O)(=O)OC1CC(N2C3=C(C(NC(N)=N3)=O)N=C2)OC1COP(O)(=O)OC1CC(N2C(N=C(N)C=C2)=O)OC1COP(O)(=O)OC1CC(N2C3=NC=NC(N)=C3N=C2)OC1COP(O)(=O)OC1CC(N2C3=C(C(NC(N)=N3)=O)N=C2)OC1COP(O)(=O)OC1CC(N2C(NC(=O)C(C)=C2)=O)OC1COP(O)(=O)OC1CC(N2C(N=C(N)C=C2)=O)OC1COP(O)(=O)OC1CC(N2C(N=C(N)C=C2)=O)OC1COP(O)(=O)OC1CC(N2C(NC(=O)C(C)=C2)=O)OC1COP(O)(=O)OC(C(O1)COP(O)(=O)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=O)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=O)OC2C(OC(C2)N2C3=NC=NC(N)=C3N=C2)COP(O)(=O)OC2C(OC(C2)N2C3=C(C(NC(N)=N3)=O)N=C2)COP(O)(=O)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=O)OC2C(OC(C2)N2C3=NC=NC(N)=C3N=C2)COP(O)(=O)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=O)OC2C(OC(C2)N2C(N=C(N)C=C2)=O)COP(O)(=O)OC2C(OC(C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(O)=O)CC1N1C=C(C)C(=O)NC1=O VQWNELVFHZRFIB-UHFFFAOYSA-N 0.000 description 1
- 238000000853 optical rotatory dispersion Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 239000007800 oxidant agent Substances 0.000 description 1
- 230000001590 oxidative effect Effects 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- 229960001639 penicillamine Drugs 0.000 description 1
- 229940023041 peptide vaccine Drugs 0.000 description 1
- 125000001151 peptidyl group Chemical group 0.000 description 1
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 1
- 239000012466 permeate Substances 0.000 description 1
- 230000007479 persistent immune response Effects 0.000 description 1
- 210000001539 phagocyte Anatomy 0.000 description 1
- PETXWIMJICIQTQ-UHFFFAOYSA-N phenylmethoxymethanol Chemical group OCOCC1=CC=CC=C1 PETXWIMJICIQTQ-UHFFFAOYSA-N 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 238000000053 physical method Methods 0.000 description 1
- 230000004983 pleiotropic effect Effects 0.000 description 1
- 229920000724 poly(L-arginine) polymer Polymers 0.000 description 1
- 229920000083 poly(allylamine) Polymers 0.000 description 1
- 229920002246 poly[2-(dimethylamino)ethyl methacrylate] polymer Polymers 0.000 description 1
- 229920000515 polycarbonate Polymers 0.000 description 1
- 239000004417 polycarbonate Substances 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 150000004804 polysaccharides Chemical class 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 229910001414 potassium ion Inorganic materials 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 229940023143 protein vaccine Drugs 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000009711 regulatory function Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 210000001995 reticulocyte Anatomy 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 210000003705 ribosome Anatomy 0.000 description 1
- 229940046939 rickettsia prowazekii Drugs 0.000 description 1
- 229940075118 rickettsia rickettsii Drugs 0.000 description 1
- 238000010850 salt effect Methods 0.000 description 1
- 239000012266 salt solution Substances 0.000 description 1
- 229940043230 sarcosine Drugs 0.000 description 1
- 238000013341 scale-up Methods 0.000 description 1
- 238000007423 screening assay Methods 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 229910001415 sodium ion Inorganic materials 0.000 description 1
- 239000001540 sodium lactate Substances 0.000 description 1
- 229940005581 sodium lactate Drugs 0.000 description 1
- 235000011088 sodium lactate Nutrition 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 230000000392 somatic effect Effects 0.000 description 1
- 230000037439 somatic mutation Effects 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 108010059434 tapasin Proteins 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 238000011191 terminal modification Methods 0.000 description 1
- CNHYKKNIIGEXAY-UHFFFAOYSA-N thiolan-2-imine Chemical compound N=C1CCCS1 CNHYKKNIIGEXAY-UHFFFAOYSA-N 0.000 description 1
- ATGUDZODTABURZ-UHFFFAOYSA-N thiolan-2-ylideneazanium;chloride Chemical compound Cl.N=C1CCCS1 ATGUDZODTABURZ-UHFFFAOYSA-N 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- FGMPLJWBKKVCDB-UHFFFAOYSA-N trans-L-hydroxy-proline Natural products ON1CCCC1C(O)=O FGMPLJWBKKVCDB-UHFFFAOYSA-N 0.000 description 1
- 238000003151 transfection method Methods 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 229940096911 trichinella spiralis Drugs 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 235000011178 triphosphate Nutrition 0.000 description 1
- UNXRWKVEANCORM-UHFFFAOYSA-N triphosphoric acid Chemical compound OP(O)(=O)OP(O)(=O)OP(O)(O)=O UNXRWKVEANCORM-UHFFFAOYSA-N 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 230000029069 type 2 immune response Effects 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 241000701161 unidentified adenovirus Species 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 229940125575 vaccine candidate Drugs 0.000 description 1
- 201000006266 variola major Diseases 0.000 description 1
- 201000000627 variola minor Diseases 0.000 description 1
- 208000014016 variola minor infection Diseases 0.000 description 1
- 229940118696 vibrio cholerae Drugs 0.000 description 1
- 230000007810 virus-infected cell apoptotic process Effects 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
- 229940051021 yellow-fever virus Drugs 0.000 description 1
- 229940098232 yersinia enterocolitica Drugs 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001103—Receptors for growth factors
- A61K39/001104—Epidermal growth factor receptors [EGFR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001103—Receptors for growth factors
- A61K39/001106—Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ErbB4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
- A61K39/001103—Receptors for growth factors
- A61K39/001109—Vascular endothelial growth factor receptors [VEGFR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/00113—Growth factors
- A61K39/001135—Vascular endothelial growth factor [VEGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001148—Regulators of development
- A61K39/00115—Apoptosis related proteins, e.g. survivin or livin
- A61K39/001151—Apoptosis related proteins, e.g. survivin or livin p53
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001152—Transcription factors, e.g. SOX or c-MYC
- A61K39/001153—Wilms tumor 1 [WT1]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001154—Enzymes
- A61K39/001156—Tyrosinase and tyrosinase related proteinases [TRP-1 or TRP-2]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001154—Enzymes
- A61K39/001157—Telomerase or TERT [telomerase reverse transcriptase]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001154—Enzymes
- A61K39/001164—GTPases, e.g. Ras or Rho
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001166—Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
- A61K39/001168—Mesothelin [MSLN]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001169—Tumor associated carbohydrates
- A61K39/00117—Mucins, e.g. MUC-1
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/00118—Cancer antigens from embryonic or fetal origin
- A61K39/001182—Carcinoembryonic antigen [CEA]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001184—Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
- A61K39/001186—MAGE
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001184—Cancer testis antigens, e.g. SSX, BAGE, GAGE or SAGE
- A61K39/001188—NY-ESO
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/00119—Melanoma antigens
- A61K39/001191—Melan-A/MART
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/00119—Melanoma antigens
- A61K39/001192—Glycoprotein 100 [Gp100]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001193—Prostate associated antigens e.g. Prostate stem cell antigen [PSCA]; Prostate carcinoma tumor antigen [PCTA]; PAP or PSGR
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001193—Prostate associated antigens e.g. Prostate stem cell antigen [PSCA]; Prostate carcinoma tumor antigen [PCTA]; PAP or PSGR
- A61K39/001194—Prostate specific antigen [PSA]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001193—Prostate associated antigens e.g. Prostate stem cell antigen [PSCA]; Prostate carcinoma tumor antigen [PCTA]; PAP or PSGR
- A61K39/001195—Prostate specific membrane antigen [PSMA]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/145—Orthomyxoviridae, e.g. influenza virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/205—Rhabdoviridae, e.g. rabies virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
- A61K39/29—Hepatitis virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/35—Allergens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A61K47/48246—
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/645—Polycationic or polyanionic oligopeptides, polypeptides or polyamino acids, e.g. polylysine, polyarginine, polyglutamic acid or peptide TAT
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
- A61K47/646—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent the entire peptide or protein drug conjugate elicits an immune response, e.g. conjugate vaccines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
- A61K48/0008—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition
- A61K48/0025—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the non-active part clearly interacts with the delivered nucleic acid
- A61K48/0041—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'non-active' part of the composition delivered, e.g. wherein such 'non-active' part is not delivered simultaneously with the 'active' part of the composition wherein the non-active part clearly interacts with the delivered nucleic acid the non-active part being polymeric
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
- A61P31/06—Antibacterial agents for tuberculosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
- A61P31/22—Antivirals for DNA viruses for herpes viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/08—Antiallergic agents
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N7/00—Viruses; Bacteriophages; Compositions thereof; Preparation or purification thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5252—Virus inactivated (killed)
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/53—DNA (RNA) vaccination
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55516—Proteins; Peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/555—Medicinal preparations containing antigens or antibodies characterised by a specific combination antigen/adjuvant
- A61K2039/55511—Organic adjuvants
- A61K2039/55561—CpG containing adjuvants; Oligonucleotide containing adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/572—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/575—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 humoral response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/60—Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
- A61K2039/6093—Synthetic polymers, e.g. polyethyleneglycol [PEG], Polymers or copolymers of (D) glutamate and (D) lysine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/30—Macromolecular organic or inorganic compounds, e.g. inorganic polyphosphates
- A61K47/42—Proteins; Polypeptides; Degradation products thereof; Derivatives thereof, e.g. albumin, gelatin or zein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20071—Demonstrated in vivo effect
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2730/00—Reverse transcribing DNA viruses
- C12N2730/00011—Details
- C12N2730/10011—Hepadnaviridae
- C12N2730/10111—Orthohepadnavirus, e.g. hepatitis B virus
- C12N2730/10134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2730/00—Reverse transcribing DNA viruses
- C12N2730/00011—Details
- C12N2730/10011—Hepadnaviridae
- C12N2730/10111—Orthohepadnavirus, e.g. hepatitis B virus
- C12N2730/10171—Demonstrated in vivo effect
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/16011—Orthomyxoviridae
- C12N2760/16111—Influenzavirus A, i.e. influenza A virus
- C12N2760/16134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/16011—Orthomyxoviridae
- C12N2760/16111—Influenzavirus A, i.e. influenza A virus
- C12N2760/16171—Demonstrated in vivo effect
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/20011—Rhabdoviridae
- C12N2760/20111—Lyssavirus, e.g. rabies virus
- C12N2760/20134—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2760/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses negative-sense
- C12N2760/00011—Details
- C12N2760/20011—Rhabdoviridae
- C12N2760/20111—Lyssavirus, e.g. rabies virus
- C12N2760/20171—Demonstrated in vivo effect
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- the present invention is directed to a pharmaceutical composition
- a pharmaceutical composition comprising a polymeric carrier cargo complex and at least one antigen.
- the polymeric carrier cargo complex preferably comprises a carrier and a cargo, wherein the carrier is a disulfide-crosslinked cationic component and the cargo at least one nucleic acid molecule.
- the at least one antigen is preferably selected from an antigen from a pathogen associated with infectious disease, an antigen associated with allergy or allergic disease, an antigen associated with autoimmune disease, or an antigen associated with a cancer or tumour disease, or in each case a fragment, variant and/or derivative of said antigen.
- Such an inventive pharmaceutical composition may be, e.g., a vaccine wherein the polymeric carrier cargo complex may serve as an adjuvant to support an immune response to the antigen. Accordingly, such a pharmaceutical composition allows for efficient induction of an adaptive immune response directed against the at least one antigen comprised therein, particularly of a Th1-shifted immune response.
- kits or kits of parts comprising the components of the inventive pharmaceutical composition, as well as the use of the inventive pharmaceutical composition or the inventive kit or kit of parts as a vaccine, particularly in the treatment of infectious diseases, allergies, autoimmune diseases and tumour or cancer diseases.
- the invention provides: (a) a polymeric carrier cargo complex for use in therapy in combination with at least one antigen or a fragment, variant and/or derivative thereof; and (b) at least one antigen or a fragment, variant and/or derivative thereof for use in therapy in combination with a polymeric carrier cargo complex, in each case (a) and (b), particularly for use in therapy of infectious diseases, allergies, autoimmune diseases and tumour or cancer diseases.
- Vaccines are often inefficient for the very young and the very old; many vaccines need to be given several times, and the protection they confer wanes over time, requiring booster administrations, and, for some diseases such as HIV, development of efficient vaccines is urgently needed. As generally accepted, many of these vaccines would be enabled or improved if they could elicit a stronger and more durable immune response.
- compositions that include adjuvants for vaccination purposes which support induction and maintenance of an adaptive immune response by initiating or boosting a parallel innate immune response represents a main challenging problem.
- Adjuvants are usually defined as compounds that can increase and/or modulate the intrinsic immunogenicity of an antigen. To reduce negative side effects, new vaccines have a more defined composition that often leads to lower immunogenicity compared with previous whole-cell or virus-based vaccines. Adjuvants are therefore required to assist new vaccines to induce potent and persistent immune responses, with the additional benefit that less antigen and fewer injections are needed. Now it is clear that the adaptive immune response mainly depends on the level and specificity of the initial danger signals perceived by innate immune cells following infection or vaccination (Guy, B. (2007), Nat Rev Microbiol 5(7): 505-17.). In particular for new generation vaccine candidates, which will increasingly comprise highly purified recombinant proteins and, although very safe, are poorly immunogenic, efficient adjuvants will become increasingly necessary.
- the new vaccine targets are usually more difficult to develop and—due to their specifically tailored immune responses—require more potent adjuvants to enable success.
- more potent pharmaceutical compositions that include adjuvants and such targets will be necessary. Therefore, the new adjuvants in such compositions will need to offer advantages, including more heterologous antibody responses, covering pathogen diversity, induction of potent functional antibody responses, ensuring pathogen killing or neutralization and induction of more effective T cell responses, for direct and indirect pathogen killing, particularly the induction of cytotoxic T cells which are part of a Th1 immune response.
- adjuvants may be necessary to achieve more pragmatic effects, including antigen dose reduction and overcoming antigen competition in combination vaccines.
- new adjuvants will be necessary to overcome the natural deterioration of the immune response with age (O'Hagan, D. T. and E. De Gregorio (2009), Drug Discov Today 14(11-12): 541-51.).
- new efficient and safe pharmaceutical compositions that include immunostimulating agents or adjuvants are required, which are preferably efficient in inducing an innate immune response, particularly in inducing the anti-viral cytokine IFN-alpha; and which are also efficient in supporting an adaptive immune response; safe, i.e. not associated with any long-term effects; which are well tolerated; which are available via a simple synthetic pathway; which exhibit low cost storage conditions (particularly feasible lyophilisation); which require simple and inexpensive components; which are biodegradable; which are compatible with many different kinds of vaccine antigens; which are capable of codelivery of antigen and immune potentiator, etc.
- adjuvants or immunostimulating agents usually act via their capability to induce an innate immune response.
- the innate immune system forms the dominant system of host defense in most organisms and comprises barriers such as humoral and chemical barriers including, e.g., inflammation, the complement system and cellular barriers.
- the innate immune system is typically based on a small number of receptors, called pattern recognition receptors. They recognize conserved molecular patterns that distinguish foreign organisms, like viruses, bacteria, fungi and parasites, from cells of the host.
- Such pathogen-associated molecular patterns include viral nucleic acids, components of bacterial and fungal walls, flagellar proteins, and more.
- TLR Toll-like receptor
- PAMP receptors pattern recognition receptors
- TLRs are transmembrane proteins which recognize ligands of the extracellular milieu or of the lumen of endosomes. Following ligand-binding they transduce the signal via cytoplasmic adaptor proteins which leads to triggering of a host-defence response and entailing production of antimicrobial peptides, proinflammatory chemokines and cytokines, antiviral cytokines, etc. (see e.g. Meylan, E.,). Tschopp, et at (2006), Nature 442(7098): 39-44). Further relevant components of the immune system include e.g.
- the immunostimulating agents or adjuvants are defined herein preferably as inducers of an innate immune response, which activate pattern recognition receptors (PAMP receptors).
- PAMP receptors pattern recognition receptors
- a cascade of signals is elicited, which e.g. may result in the release of cytokines (e.g. IFN-alpha) supporting the innate immune response.
- cytokines e.g. IFN-alpha
- such as an agent or adjuvant additionally supports the adaptive immune response by e.g. shifting the immune response such that the preferred class of Th cells is activated.
- a shift to a Th1-based immune response may be preferred or, in other cases, a shift to a Th2 immune response may be preferred.
- nucleic acids like CpG DNA oligonucleotides or isRNA (immunostimulating RNA) turned out to be promising candidates for new immunostimulating agents or adjuvants as they allow the therapeutic or prophylactic induction of an innate immune response.
- nucleic acid based adjuvants usually have to be delivered effectively to the site of action to allow induction of an effective innate immune response without unnecessary loss of adjuvant activity and, in some cases, without the necessity to increase the administered volume above systemically tolerated levels.
- One approach to solve this issue may be the transfection of cells which are part of the innate immune system (e.g. dendritic cells, plasmacytoid dendritic cells (pDCs)) with immunostimulatory nucleic acids, which are ligands of PAMP receptors, (e.g. Toll-like receptors (TLRs)), and thus may lead to immunostimulation by the nucleic acid ligand.
- Further approaches may be the direct transfection of nucleic acid based adjuvants. All of these approaches, however, are typically impaired by inefficient delivery of the nucleic acid and consequently diminished adjuvant activity, in particular when administered locally.
- nucleic acid based adjuvant approaches until today is their limited ability to cross the plasma membrane of mammalian cells, resulting in poor cellular access and inadequate therapeutic efficacy.
- this hurdle represents a major challenge for nucleic acid transfection based applications, e.g. biomedical developments and accordingly the commercial success of many biopharmaceuticals (see e.g. Foerg, C. & Merkle, H. P., J Pharm Sci 97, 144-62 (2008).
- transfection methods Even if a lot of transfection methods are known in the art, transfer or insertion of nucleic acids or genes into an individual's cells still represents a major challenge today and is not yet solved satisfactorily. To address this complex issue a variety of methods were developed in the last decade. These include transfection by calcium phosphate, cationic lipids, cationic polymers, and liposomes. Further methods for transfection are electroporation and viral transduction.
- nucleic acids or genes have to fulfil several requirements for in vivo applications which include efficient nucleic acid delivery into an individual's cells with high functionality, protection of the nucleic acid against ubiquitously occurring nucleases, release of the nucleic acid in the cell, no safety concerns, feasible manufacturing in a commercially acceptable form amenable to scale-up and storage stability under low cost conditions (e.g feasible lyophilisation). These requirements are to be added to the complex requirements of an adjuvant particularly if it is in the form of a nucleic acid as outlined above.
- viral vectors such as adenoviruses, adeno-associated viruses, retroviruses, and herpes viruses.
- Viral vectors are able to mediate gene transfer with high efficiency and the possibility of long-term gene expression.
- cytokine storm the acute immune response
- immunogenicity the immunogenicity
- insertion mutagenesis uncovered in gene therapy clinical trials have raised serious safety concerns about some commonly used viral vectors.
- non-viral vectors are not as efficient as viral vectors, many non-viral vectors have been developed to provide a safer alternative.
- Methods of non-viral nucleic acid delivery have been explored using physical (carrier-free nucleic acid delivery) and chemical approaches (synthetic vector-based nucleic acid delivery).
- Physical approaches usually include needle injection, electroporation, gene gun, ultrasound, and hydrodynamic delivery, employ a physical force that permeates the cell membrane and facilitates intracellular gene transfer.
- the chemical approaches typically use synthetic or naturally occurring compounds (e.g.
- transfection agents typically have been used successfully solely in in vitro reactions.
- nucleic acids for application of nucleic acids in vivo, however, further requirements have to be fulfilled.
- complexes between nucleic acids and transfection agents have to be stable in physiological salt solutions with respect to agglomerisation.
- complexes typically must not interact with parts of the complement system of the host and thus must not be immunogenic itself as the carrier itself shall not induce an adaptive immune response in the individual.
- the complex shall protect the nucleic acid from early extracellular degradation by ubiquitously occurring nucleases.
- transfection reagents are available, especially cationic lipids, which show excellent transfection activity in cell culture.
- most of these transfection reagents do not perform well in the presence of serum, and only a few are active in vivo.
- a dramatic change in size, surface charge, and lipid composition occurs when lipoplexes are exposed to the overwhelming amount of negatively charged and often amphipathic proteins and polysaccharides that are present in blood, mucus, epithelial lining fluid, or tissue matrix.
- lipoplexes tend to interact with negatively charged blood components and form large aggregates that could be absorbed onto the surface of circulating red blood cells, trapped in a thick mucus layer, or embolized in microvasculatures, preventing them from reaching the intended target cells in the distal location. Some even undergo dissolution after they are introduced to the blood circulation (see e.g. Gao, X., Kim, K. & Liu, D., AAPS P9, E92-104 (2007)).
- Cationic polymers turned out to be efficient in transfection of nucleic acids, as they can tightly complex and condense a negatively charged nucleic acid.
- cationic polymers include polyethylenimine (PEI), polyamidoamine and polypropylamine dendrimers, polyallylamine, cationic dextran, chitosan, cationic proteins and cationic peptides.
- PEI polyethylenimine
- polyamidoamine and polypropylamine dendrimers polyallylamine
- cationic dextran cationic proteins
- cationic proteins cationic proteins
- cationic peptides cationic peptides.
- most cationic polymers share the function of condensing DNA into small particles and facilitate cellular uptake via endocytosis through charge-charge interaction with anionic sites on cell surfaces, their transfection activity and toxicity differs dramatically.
- cationic polymers exhibit better transfection efficiency with rising molecular weight.
- a rising molecular weight also leads to a rising toxicity of the cationic polymer.
- PEI high molecular weight
- PEI is perhaps the most active and most studied polymer for transfection of nucleic acids, in particular for gene delivery purposes.
- it exhibits the same drawback due to its non-biodegradable nature and toxicity.
- polyplexes formed by high molecular weight polymers exhibit improved stability under physiological conditions, data have indicated that such polymers can hinder vector unpacking.
- Read et al. see Read, M. L. et al., J Gene Med. 5, 232-245 (2003); and Read, M. L.
- nucleic acid-based drugs e.g. the transfection of nucleic acids into cells or tissues, particularly if the expression of an encoded protein or peptide or transcription of an RNA of the transfected nucleic acid is intended.
- nucleic acid means typically any DNA- or RNA-molecule and is used synonymous with polynucleotide. Furthermore, modifications or derivatives of the nucleic acid as defined herein are explicitly included in the general term “nucleic acid”. For example, PNA is also included in the term “nucleic acid”.
- a monocistronic RNA may typically be a RNA, preferably a mRNA, that encodes only one open reading frame.
- An open reading frame in this context is a sequence of several nucleotide triplets (codons) that can be translated into a peptide or protein.
- Bi-/multicistronic RNA RNA, preferably a mRNA, that typically may have two (bicistronic) or more (multicistronic) open reading frames (ORF).
- An open reading frame in this context is a sequence of several nucleotide triplets (codons) that can be translated into a peptide or protein.
- a 5′ Cap is typically a modified nucleotide, particularly a guanine nucleotide, added to the 5′-end of a RNA-molecule.
- the 5′-Cap is added using a 5′-5′-triphosphate linkage.
- a poly(C) sequence is typically a long sequence of cytosine nucleotides, typically about 10 to about 200 cytidine nucleotides, preferably about 10 to about 100 cytidine nucleotides, more preferably about 10 to about 70 cytidine nucleotides or even more preferably about 20 to about 50 or even about 20 to about 30 cytidine nucleotides.
- a poly(C) sequence may preferably be located 3′ of the coding region comprised by a nucleic acid.
- a poly(A) tail also called “3′-poly(A) tail” is typically a long sequence of adenine nucleotides of up to about 400 adenosine nucleotides, e.g. from about 25 to about 400, preferably from about 50 to about 400, more preferably from about 50 to about 300, even more preferably from about 50 to about 250, most preferably from about 60 to about 250 adenosine nucleotides, added to the 3′-end of a RNA.
- Stabilized nucleic acid typically, may be essentially resistant to in vivo degradation (e.g. degradation by an exo- or endo-nuclease) and/or ex vivo degradation (e.g. by the manufacturing process prior to vaccine administration, e.g. in the course of the preparation of the vaccine solution to be administered).
- Stabilization of mRNA can, e.g., be achieved by providing a 5′-Cap structure, a Poly(A) tail, a poly (C) tail, or any other UTR modification. It can also be achieved by backbone modification or modification of the G/C-content of the nucleic acid.
- Various other methods are conceivable in the context of the invention.
- Modification of a nucleic acid typically may contain backbone modifications, sugar modifications or base modifications.
- a backbone modification in connection with the present invention is, typically, a modification in which phosphates of the backbone of the nucleotides contained in the nucleic acid molecule may be chemically modified.
- a sugar modification in connection with the present invention typically, may be a chemical modification of the sugar of the nucleotides of the nucleic acid.
- a base modification in connection with the present invention typically, may be a chemical modification of the base moiety of the nucleotides of the nucleic acid molecule.
- a modified nucleic acid may also be defined herein as a nucleic acid molecule which may include nucleotide analogues. Furthermore a modification of a nucleic acid molecule may contain a lipid modification. Such a lipid-modified nucleic acid typically may comprise a nucleic acid as defined herein. Such a lipid-modified nucleic acid molecule typically may further comprise at least one linker covalently linked with that nucleic acid molecule, and at least one lipid covalently linked with the respective linker.
- the lipid-modified nucleic acid molecule may comprise at least one nucleic acid molecule as defined herein and at least one (bifunctional) lipid covalently linked (without a linker) with that nucleic acid molecule.
- the lipid-modified nucleic acid molecule may comprise a nucleic acid molecule as defined herein, at least one linker covalently linked with that nucleic acid molecule, and at least one lipid covalently linked with the respective linker, and also at least one (bifunctional) lipid covalently linked (without a linker) with that nucleic acid molecule.
- a modification of a nucleic acid may also comprise the modification of the G/C content of the coding region of a nucleic acid molecule, especially if the nucleic acid molecule is in the form of an mRNA.
- the G/C content of the coding region of the nucleic acid molecule is increased, compared to the G/C content of the coding region of its particular wild type coding sequence, i.e. the unmodified mRNA.
- the encoded amino acid sequence of the nucleic acid sequence is preferably not modified compared to the coded amino acid sequence of the particular wild type mRNA.
- the modification of the G/C-content of the nucleic acid molecule is based on the fact that the sequence of any mRNA region to be translated is important for efficient translation of that mRNA.
- the composition and the sequence of various nucleotides are important.
- sequences having an increased G (guanosine)/C (cytosine) content are more stable than sequences having an increased A (adenosine)/U (uracil) content.
- the codons of the coding sequence or mRNA are therefore varied compared to its wild type coding sequence or mRNA, while retaining the translated amino acid sequence, such that they include an increased amount of G/C nucleotides.
- the most favourable codons for the stability can be determined (so-called alternative codon usage).
- the G/C content of the coding region of the nucleic acid molecule is increased by at least 7%, more preferably by at least 15%, particularly preferably by at least 20%, compared to the G/C content of the coded region of the wild type mRNA.
- At least 5%, 10%, 20%, 30%, 40%, 50%, 60%, more preferably at least 70%, even more preferably at least 80% and most preferably at least 90%, 95% or even 100% of the substitutable codons in the region coding for a protein or peptide as defined herein or its fragment, variant and/or derivative thereof or the whole sequence of the wild type mRNA sequence or coding sequence are substituted, thereby increasing the G/C content of said sequence.
- a modification of the nucleic acid is based on the finding that the translation efficiency is also determined by a different frequency in the occurrence of tRNAs in cells.
- the frequency in the occurrence of tRNAs in a cell, and thus the codon usage in said cell is dependent on the species the cell is derived from. Accordingly, a yeast cell generally exhibits a different codon usage than a mammalian cell, such as a human cell.
- nucleic acid molecule if so-called “rare codons” are present in the nucleic acid molecule (with respect to the respective expression system), especially if the nucleic acid is in the form of an mRNA or codes for an mRNA, to an increased extent, the corresponding modified nucleic acid molecule is translated to a significantly poorer degree than in the case where codons coding for relatively “frequent” tRNAs are present.
- the coding region of the modified nucleic acid is preferably modified compared to the corresponding region of the wild type mRNA or coding sequence such that at least one codon of the wild type sequence which codes for a tRNA which is relatively rare in the cell is exchanged for a codon which codes for a tRNA which is relatively frequent in the cell and carries the same amino acid as the relatively rare tRNA.
- the sequences of the nucleic acid molecule is modified such that codons for which frequently occurring tRNAs are available are inserted.
- the codons which use for the particular amino acid the tRNA which occurs the most frequently are particularly preferred.
- This preferred embodiment allows provision of a particularly efficiently translated and stabilized (modified) nucleic acid, especially if the nucleic acid is in the form of an mRNA or codes for an mRNA.
- a derivative of a nucleic acid molecule may typically be understood herein as a modified nucleic acid, as defined above.
- Nucleotide analogues typically, are nucleotides structurally similar (analogue) to naturally occurring nucleotides which include phosphate backbone modifications, sugar modifications, or modifications of the nucleobase.
- UTR modification is, typically, a modification of the 5′ and/or 3′ region of a nucleic acid molecule, particularly a coding nucleic acid molecule.
- UTR typically means “untranslated region”.
- An UTR may, e.g., contain, comprise or consist of a stabilizing sequence (UTR modification). These stabilizing sequences in the 5′ and/or 3′ untranslated regions may have the effect of increasing the half-life of the nucleic acid in the cytosol. These stabilizing sequences may have 100% sequence identity to naturally occurring sequences which occur in viruses, bacteria and eukaryotes, but may also be partly or completely synthetic.
- the untranslated sequences (UTR) of the (alpha-) globin gene e.g. from Homo sapiens or Xenopus laevis may be mentioned as an example of stabilizing sequences which may be used for a stabilized nucleic acid.
- Another example of a stabilizing sequence has the general formula (C/U)CCAN x CCC(U/A)Py x UC(C/U)CC which is contained in the 3′UTR of the very stable RNA which codes for (alpha-)globin, type(I)-collagen, 15-lipoxygenase or for tyrosine hydroxylase (cf. Holcik et al., Proc. Natl. Acad. Sci.
- a UTR modification preferably means a modification of a coding nucleic acid, such as a gene or mRNA, by adding or exchanging a 5′- and/or 3′-UTR, preferably by adding or exchanging for a stabilizing 5′- and/or 3′-UTR, e.g., as specified above.
- Nucleic acid molecules used according to the invention as defined herein may be prepared using any method known in the art, including synthetic methods such as e.g. solid phase synthesis, as well as in vitro methods, such as in vitro transcription reactions.
- a corresponding DNA molecule may, e.g., be transcribed in vitro.
- This DNA matrix preferably comprises a suitable promoter, e.g. a T7 or SP6 promoter, for in vitro transcription, which is followed by the desired nucleotide sequence coding for the nucleic acid molecule, e.g. mRNA, to be prepared, and a termination signal for in vitro transcription.
- the DNA molecule, which forms the matrix of the at least one RNA of interest may be prepared by fermentative proliferation and subsequent isolation as part of a plasmid which can be replicated in bacteria.
- Plasmids which may be mentioned as suitable for the present invention are e.g. the plasmids pT7 Ts (GenBank accession number U26404; Lai et al, Development 1995, 121: 2349 to 2360), pGEM® series, e.g. pGEM®-1 (GenBank accession number X65300; from Promega) and pSP64 (GenBank accession number X65327); cf. also Mezei and Storts, Purification of PCR Products, in: Griffin and Griffin (ed.), PCR Technology: Current Innovation, CRC Press, Boca Raton, Fla., 2001.
- a protein typically consists of one or more polypeptides folded into 3-dimensional form, facilitating a biological function.
- a peptide is typically a short polymer of amino acid monomers, linked by peptide bonds. It typically contains less than 50 monomer units. Nevertheless, the term peptide is not a disclaimer for molecules having more than 50 monomer units. Long peptides are also called polypeptides, typically having between 50 and 600 monomeric units, more specifically between 50 and 300 monomeric units. Furthermore a “peptide” is defined herein also to include any peptidyl molecule, including peptide analogues.
- a peptide analogue may, typically, comprise naturally or non-naturally occurring amino acids which may be used for the purpose of the invention.
- they can comprise amino acids selected from an isostere or a chiral analog (D-amino acid or L-amino acid) of an amino acid.
- the analog may comprise one or more amino acids, preferably selected from hydroxyproline, ⁇ -alanine, 2,3-diaminopropionic acid, ⁇ -aminoisobutyric acid, N-methylglycine (sarcosine), ornithine, citrulline, t-butylalanine, t-butylglycine, N-methyl isoleucine, phenylglycine, cyclohexylalanine, norleucine, naphthylalanine, pyridylananine 3-benzothienyl alanine 4-chlorophenylalanine, 2-fluorophenylalanine, 3-fluorophenylalanine, 4-fluorophenylalanine, penicillamine, 1,2,3,4-tetrahydro-tic isoquinoline-3-carboxylic acid [beta]-2-thienylalanine, methionine sulfoxide, homoarginine, N-acet
- a peptide analogue as defined herein may further contain modified peptides.
- the term specifically includes peptide back-bone modifications (i.e., amide bond mimetics) known to those skilled in the art. Such modifications include modifications of the amide nitrogen, the ⁇ -carbon, amide carbonyl, complete replacement of the amide bond, extensions, deletions or backbone crosslinks.
- peptide backbone modifications include ⁇ [CH2S], ⁇ CH2NH], ⁇ [CSNH2], ⁇ [NHCO], ⁇ [COCH2], and ⁇ [(E) or (Z) CH ⁇ CH]. In the nomenclature used above, indicates the absence of an amide bond. The structure that replaces the amide group is specified within the brackets.
- modifications include, for example, an N-alkyl (or aryl) substitution ( ⁇ [CONR]), or backbone crosslinking to construct lactams and other cyclic structures, C-terminal hydroxymethyl modifications, O-modified modifications (e.g., C-terminal hydroxymethyl benzyl ether), N-terminal modifications including substituted amides such as alkylaniides and hydrazides.
- a peptide, a peptide analogue, or a derivative thereof is preferably synthesized using a chemical method known to the skilled artisan.
- synthetic peptides are prepared using known techniques of solid phase, liquid phase, or peptide condensation, or any combination thereof, and can include natural and/or unnatural amino acids.
- chemical synthesis methods comprise the sequential addition of one or more amino acids to a growing peptide chain. Normally, either the amino or carboxyl group of the first amino acid is protected by a suitable protecting group.
- the protected or derivatized amino acid can then be either attached to an inert solid support or utilized in solution by adding the next amino acid in the sequence having the complementary (amino or carboxyl) group suitably protected, under conditions that allow for the formation of an amide linkage.
- the protecting group is then removed from the newly added amino acid residue and the next amino acid (suitably protected) is then added, and so forth.
- any remaining protecting groups and any solid support, if solid phase synthesis techniques are used) are removed sequentially or concurrently, to render the final polypeptide.
- Typical protecting groups include t-butyloxycarbonyl (Boc), 9-fluorenylmethoxycarbonyl (Fmoc) benzyloxycarbonyl (Cbz); p-toluenesulfonyl (Tx); 2,4-dinitrophenyl; benzyl (Bzl); biphenylisopropyloxycarboxy-carbonyl, t-amyloxycarbonyl, isobornyloxycarbonyl, o-bromobenzyloxycarbonyl, cyclohexyl, isopropyl, acetyl, o-nitrophenylsulfonyl and the like.
- Typical solid supports are cross-linked polymeric supports.
- divinylbenzene cross-linked-styrene-based polymers for example, divinylbenzene-hydroxymethylstyrene copolymers, divinylbenzene-chloromethylstyrene copolymers and divinylbenzene-benzhydrylaminopolystyrene copolymers.
- Recombinant peptide or protein production A peptide or protein or derivative thereof may be produced using recombinant protein or peptide production.
- at least one nucleic acid encoding the same is preferably isolated or synthesized.
- the nucleic acid encoding the recombinant protein or peptide is isolated using a known method, such as, for example, amplification (e.g., using PCR) or isolated from nucleic acid from an organism using one or more restriction enzymes or isolated from a library of nucleic acids.
- a protein/peptide-encoding nucleic acid is placed in operable connection with a promoter or other regulatory sequence capable of regulating expression in a cell-free system or cellular system.
- nucleic acid comprising a sequence that encodes a peptide or protein is placed in operable connection with a suitable promoter and maintained in a suitable cell for a time and under conditions sufficient for expression to occur.
- Typical expression vectors for in vitro expression, cell-free expression or cell-based expression have been described and are well known for the skilled person.
- cell-free expression systems may include E.
- coli S30 fraction, rabbit reticulocyte lysate and wheat germ extract and a cellular system may be selected from bacterial (e.g. E. coli ), insect, plant, or mammalian cells (e.g., 293, COS, CHO, 1OT cells, 293T cells).
- bacterial e.g. E. coli
- insect e.g., insect, plant
- mammalian cells e.g., 293, COS, CHO, 1OT cells, 293T cells.
- Secretory signal peptide Such signal peptides are sequences, which typically exhibit a length of about 15 to 30 amino acids and are preferably located at the N-terminus of the encoded peptide, without being limited thereto. Signal peptides as defined herein preferably allow the transport of the protein or peptide into a defined cellular compartment, preferably the cell surface, the endoplasmic reticulum (ER) or the endosomal-lysosomal compartment.
- ER endoplasmic reticulum
- Carrier/polymeric carrier A carrier in the context of the invention may typically be a compound that facilitates transport and/or complexation of another compound.
- a polymeric carrier is typically a carrier that is formed of a polymer.
- a carrier, in the context of the present invention is preferably suitable as carrier for nucleic acid molecules, e.g. for mediating dissolution in physiological acceptable liquids, transport and cellular uptake of the nucleic acid molecules or a vector.
- a carrier in the context of the present invention, may be a component which may be suitable for depot and delivery of a nucleic acid molecule or vector.
- Such carriers may be, for example, cationic or polycationic carriers or compounds which may serve as transfection or complexation agent.
- Particularly preferred carriers or polymeric carriers in this context are cationic or polycationic compounds, including protamine, nucleoline, spermine or spermidine, or other cationic peptides or proteins, such as poly-L-lysine (PLL), poly-arginine, basic polypeptides, cell penetrating peptides (CPPs), including HIV-binding peptides, HIV-1 Tat (HIV), Tat-derived peptides, Penetratin, VP22 derived or analog peptides, HSV VP22 (Herpes simplex), MAP, KALA or protein transduction domains (PTDs), PpT620, prolin-rich peptides, arginine-rich peptides, lysine-rich peptides, MPG-peptide(s), Pep-1, L-oligomers, Calcitonin peptide(s), Antennapedia-derived peptides (particularly from Drosophila antennapedia ), pAnt
- such cationic or polycationic carriers are preferably cationic or polycationic peptides or proteins, which preferably comprise or are additionally modified to comprise at least one moiety, which is capable of forming a disulfide bond, preferably an —SH moiety.
- Cationic component typically refers to a charged molecule, which is positively charged (cation) at a pH value of about typically 1 to 9, preferably of a pH value of or below 9 (e.g. 5 to 9), of or below 8 (e.g. 5 to 8), of or below 7 (e.g. 5 to 7), most preferably at physiological pH values, e.g. about 7.3 to 7.4. Accordingly, a cationic peptide, protein or polymer according to the present invention is positively charged under physiological conditions, particularly under physiological salt conditions of the cell in vivo.
- a cationic peptide or protein contains a larger number of cationic amino acids, e.g.
- a cationic peptide or protein in the context of the present invention contains a larger number of cationic amino acids, e.g. a larger number of Arg, His, Lys or Orn, than other residues.
- cationic may also refer to “polycationic” components.
- the charge of a compound, complex or component, such as the cationic component or the polymeric carrier cargo complex (A) as defined herein is preferably determined or assessed under physiological conditions, e.g. at a pH of between about 5.5 and 7.5, preferably at a pH of between about 6.0 and 7.4, such as about 7.0, at a temperature of between about 25° C. and 40° C., preferably at a temperature of about 35 and 38° C., such as about 37° C., at a physiological salt concentration of, e.g. between about 130 and 160 mM, preferably between about 137 mM and 150 mM, such as at about 137 mM.
- Particularly preferred conditions for determining or assessing the charge of a compound, complex or component as defined herein are the conditions found in a 100% Ringer lactate solution at 25° C.
- Zetapotential is a widely used parameter for the electrical surface charge of a particle. It is typically determined by moving the charged particle through an electrical field.
- the zetapotential is the preferred parameter for characterizing the charge of a particle, e.g. of complex (A) of the pharmaceutical compositions according to the present invention.
- the charge of a particle is preferably determined by determining the zetapotential by the laser Doppler electrophoresis method using a Zetasizer Nano instrument (Malvern Instruments, Malvern, UK) at 25° C. and a scattering angle of 173°.
- the surface charge of a given particle also depends on the ionic strength of the utilized matrix (e.g. salt containing buffer) and the pH of the solution. Therefore, the actual zetapotential of a given complex (A) at a charge ratio (N/P) may differ slightly between different buffers used for injection.
- the particles, such as complex (A) of the pharmaceutical compositions according to the present invention are preferably suspended in Ringer Lactate solution.
- the present invention claims therefore the use of a negativley charged complex (A) under the conditions of a given injection buffer, preferably under the conditions of a Ringer lactate solution, assessed by its Zetapotential.
- a Ringer lactate solution according to the present invention preferably contains 130 mmol/L sodium ions, 109 mmol/L chloride ions, 28 mmol/L lactate, 4 mmol/L potassium ions and 1.5 mmol/L stirum ion.
- the sodium, chloride, potassium and lactate typically come from NaCl (sodium chloride), NaC 3 H 5 O 3 (sodium lactate), CaCl 2 (calcium chloride), and KCl (potassium chloride).
- the osmolarity of the Ringer lactate solution is 273 mOsm/L and the pH is adjusted to 6.5.
- a pharmaceutically effective amount in the context of the invention is typically understood to be an amount that is sufficient to induce an immune response.
- the immune system may protect organisms, for example, from infection. If a pathogen breaks through a physical barrier of an organism and enters this organism, the innate immune system provides an immediate, but non-specific response. If pathogens evade this innate response, vertebrates possess a second layer of protection, the adaptive immune system. Here, the immune system adapts its response during an infection to improve its recognition of the pathogen. This improved response is then retained after the pathogen has been eliminated, in the form of an immunological memory, and allows the adaptive immune system to mount faster and stronger attacks each time this pathogen is encountered. According to this, the immune system comprises the innate and the adaptive immune system. Each of these two parts contains so called humoral and cellular components.
- Immune response An immune response may typically either be a specific reaction of the adaptive immune system to a particular antigen (so called specific or adaptive immune response) or an unspecific reaction of the innate immune system (so called unspecific or innate immune response).
- specific or adaptive immune response an antigen of the adaptive immune system
- unspecific or innate immune response an unspecific reaction of the innate immune system
- the invention is associated with specific reactions (adaptive immune responses) of the adaptive immune system.
- this specific response can be supported by an additional unspecific reaction (innate immune response). Therefore, the invention also relates to a compound or composition for simultaneous stimulation of the innate and the adaptive immune system to evoke an efficient adaptive immune response.
- the adaptive immune response is typically understood to be antigen-specific. Antigen specificity allows for the generation of responses that are tailored to specific antigens, antigen-expressing cells, pathogens or pathogen-infected cells. The ability to mount these tailored responses is maintained in the body by “memory cells”. Should a pathogen infect the body more than once, these specific memory cells are used to quickly eliminate it.
- the first step of an adaptive immune response is the activation of na ⁇ ve antigen-specific T cells or different immune cells able to induce an antigen-specific immune response by antigen-presenting cells. This occurs in the lymphoid tissues and organs through which na ⁇ ve T cells are constantly passing.
- Dendritic cells that can serve as antigen-presenting cells are inter alia dendritic cells, macrophages, and B cells. Each of these cells has a distinct function in eliciting immune responses.
- Dendritic cells take up antigens by phagocytosis and macropinocytosis and are stimulated by contact with e.g. a foreign antigen to migrate to the local lymphoid tissue, where they differentiate into mature dendritic cells.
- Macrophages ingest particulate antigens such as bacteria and are induced by infectious agents or other appropriate stimuli to express MHC molecules.
- the unique ability of B cells to bind and internalize soluble protein antigens via their receptors may also be important to induce T cells.
- T cells which induces their proliferation and differentiation into armed effector T cells.
- the most important function of effector T cells is the killing of infected cells by CD8+ cytotoxic T cells and the activation of macrophages by Th1 cells which together make up cell-mediated immunity, and the activation of B cells by both Th2 and Th1 cells to produce different classes of antibody, thus driving the humoral immune response.
- T cells recognize an antigen by their T cell receptors which do not recognize and bind antigen directly, but instead recognize short peptide fragments e.g. of pathogen-derived protein antigens, which are bound to MHC molecules on the surfaces of other cells.
- the adaptive immune system is, typically, composed of highly specialized, systemic cells and processes that eliminate or prevent pathogenic growth.
- the adaptive immune response provides the vertebrate immune system with the ability to recognize and remember specific pathogens (to generate immunity), and to mount stronger attacks each time the pathogen is encountered.
- the system is highly adaptable because of somatic hypermutation (a process of accelerated somatic mutations), and V(D)) recombination (an irreversible genetic recombination of antigen receptor gene segments). This mechanism allows a small number of genes to generate a vast number of different antigen receptors, which are then uniquely expressed on each individual lymphocyte.
- Immune network theory is a theory of how the adaptive immune system works, that is based on interactions between the variable regions of the receptors of T cells, B cells and of molecules made by T cells and B cells that have variable regions.
- the innate immune system also known as non-specific immune system, is understood to comprise the cells and mechanisms that defend the host from infection by other organisms in a non-specific manner. This means that the cells of the innate system recognize and respond to pathogens in a generic way, but unlike the adaptive immune system, it does not confer long-lasting or protective immunity to the host.
- the innate immune system may be e.g. activated by ligands of pathogen-associated molecular patterns (PAMP) receptors, e.g.
- PAMP pathogen-associated molecular patterns
- TLRs Toll-like receptors
- auxiliary substances such as lipopolysaccharides, TNF-alpha, CD40 ligand, or cytokines, monokines, lymphokines, interleukins or chemokines, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, IFN-alpha, IFN-beta, IFN-gamma, GM-CSF, G-CSF, M-CSF, LT-beta, TNF-alpha, growth factors, and hGH
- a response of the innate immune system includes recruiting immune cells to sites of infection, through the production of chemical factors, including specialized chemical mediators, called cytokines; activation of the complement cascade; identification and removal of foreign substances present in organs, tissues, the blood and lymph, by specialized white blood cells; activation of the adaptive immune system through a process known as antigen presentation; and/or acting as a physical and chemical barrier to infectious agents.
- Cellular immunity/cellular immune response relates typically to the activation of macrophages, natural killer cells (NK), antigen-specific cytotoxic T-lymphocytes, and the release of various cytokines in response to an antigen.
- cellular immunity is not related to antibodies but to the activation of cells of the immune system.
- a cellular immune response is characterized e.g.
- cytotoxic T-lymphocytes that are able to induce apoptosis in body cells displaying epitopes of an antigen on their surface, such as virus-infected cells, cells with intracellular bacteria, and cancer cells displaying tumor antigens; activating macrophages and natural killer cells, enabling them to destroy pathogens; and stimulating cells to secrete a variety of cytokines that influence the function of other cells involved in adaptive immune responses and innate immune responses.
- Humoral immunity refers typically to antibody production and the accessory processes that may accompany it.
- a humoral immune response may be typically characterized, e.g., by Th2 activation and cytokine production, germinal center formation and isotype switching, affinity maturation and memory cell generation.
- Humoral immunity also typically may refer to the effector functions of antibodies, which include pathogen and toxin neutralization, classical complement activation, and opsonin promotion of phagocytosis and pathogen elimination.
- the term “antigen” refers typically to a substance which may be recognized by the immune system and may be capable of triggering an antigen-specific immune response, e.g. by formation of antibodies or antigen-specific T-cells as part of an adaptive immune response.
- an antigen is a protein or peptide, but may also be a sugar, lipid, nucleic acid etc. structure.
- the first step of an adaptive immune response is the activation of na ⁇ ve antigen-specific T cells by antigen-presenting cells. This occurs in the lymphoid tissues and organs through which na ⁇ ve T cells are constantly passing.
- the three cell types that can serve as antigen-presenting cells are dendritic cells, macrophages, and B cells. Each of these cells has a distinct function in eliciting immune responses. Tissue dendritic cells take up antigens by phagocytosis and macropinocytosis and are stimulated by infection to migrate to the local lymphoid tissue, where they differentiate into mature dendritic cells. Macrophages ingest particulate antigens such as bacteria and are induced by infectious agents to express MHC class II molecules. The unique ability of B cells to bind and internalize soluble protein antigens via their receptors may be important to induce T cells.
- T cells By presenting the antigen on MHC molecules leads to activation of T cells which induces their proliferation and differentiation into armed effector T cells.
- the most important function of effector T cells is the killing of infected cells by CD8 + cytotoxic T cells and the activation of macrophages by TH1 cells which together make up cell-mediated immunity, and the activation of B cells by both TH2 and TH1 cells to produce different classes of antibody, thus driving the humoral immune response.
- T cells recognize an antigen by their T cell receptors which does not recognize and bind antigen directly, but instead recognize short peptide fragments e.g. of pathogens' protein antigens, which are bound to MHC molecules on the surfaces of other cells.
- T cells fall into two major classes that have different effector functions.
- the two classes are distinguished by the expression of the cell-surface proteins CD4 and CD8. These two types of T cells differ in the class of MHC molecule that they recognize.
- MHC molecules There are two classes of MHC molecules—MHC class I and MHC class II molecules—which differ in their structure and expression pattern on tissues of the body.
- CD4+T cells bind to a MHC class II molecule and CD8 + T cells to a MHC class I molecule.
- MHC class I and MHC class II molecules have distinct distributions among cells that reflect the different effector functions of the T cells that recognize them.
- MHC class I molecules present peptides from pathogens, commonly viruses to CD8 + T cells, which differentiate into cytotoxic T cells that are specialized to kill any cell that they specifically recognize. Almost all cells express MHC class I molecules, although the level of constitutive expression varies from one cell type to the next. But not only pathogenic peptides from viruses are presented by MHC class I molecules, also self-antigens like tumour antigens are presented by them. MHC class I molecules bind peptides from proteins degraded in the cytosol and transported in the endoplasmic reticulum. Thereby MHC class I molecules on the surface of cells infected with viruses or other cytosolic pathogens display peptides from these pathogen.
- CD8+T cells that recognize MHC class I:peptide complexes are specialized to kill any cells displaying foreign peptides and so rid the body of cells infected with viruses and other cytosolic pathogens.
- the main function of CD4 + T cells (CD4 + helper T cells) that recognize MHC class II molecules is to activate other effector cells of the immune system.
- MHC class II molecules are normally found on B lymphocytes, dendritic cells, and macrophages, cells that participate in immune responses, but not on other tissue cells. Macrophages, for example, are activated to kill the intravesicular pathogens they harbour, and B cells to secrete immunoglobulins against foreign molecules.
- MHC class II molecules are prevented from binding to peptides in the endoplasmic reticulum and thus MHC class II molecules bind peptides from proteins which are degraded in endosomes. They can capture peptides from pathogens that have entered the vesicular system of macrophages, or from antigens internalized by immature dendritic cells or the immunoglobulin receptors of B cells. Pathogens that accumulate in large numbers inside macrophage and dendritic cell vesicles tend to stimulate the differentiation of TH1 cells, whereas extracellular antigens tend to stimulate the production of TH2 cells.
- TH1 cells activate the microbicidal properties of macrophages and induce B cells to make IgG antibodies that are very effective of opsonising extracellular pathogens for ingestion by phagocytic cells
- TH2 cells initiate the humoral response by activating na ⁇ ve B cells to secrete IgM, and induce the production of weakly opsonising antibodes such as IgG1 and IgG3 (mouse) and IgG2 and IgG4 (human) as well as IgA and IgE (mouse and human).
- a vaccine is typically understood to be a prophylactic or therapeutic material providing at least one antigen or antigenic function.
- the antigen or antigenic function may stimulate the body's adaptive immune system to provide an adaptive immune response.
- Immunostimulating agent is typically understood not to include agents as e.g. antigens (of whatever chemical structure), which elicit an adaptive/cytotoxic immune response, e.g. a “humoral” or “cellular” immune response, in other words elicit immune responses (and confer immunity by themselves) which are characterized by a specific response to structural properties of an antigen recognized to be foreign by immune competent cells. Rather, by “immunostimulating agent”, it is typically understood to mean agents/compounds/complexes which do not trigger any adaptive/cytotoxic immune response by themselves, but which may exclusively enhance such an adaptive/cytotoxic immune reponse in an unspecific way, by e.g.
- any immunostimulation by agents e.g. antigens
- agents which evoke an adaptive and/or cytotoxic immune response by themselves (conferring immunity by themselves directly or indirectly) is typically disclaimed by the phrase “immunostimulating agent”.
- Adjuvant is typically understood not to comprise agents which confer immunity by themselves. Accordingly, adjuvants may, typically, not confer immunity by themselves, but assist the immune system in various ways to enhance the antigen-specific immune response by e.g. promoting presentation of an antigen to the immune system. Hereby, an adjuvant may preferably e.g. modulate the antigen-specific immune response by e.g. shifting the dominating Th1-based antigen specific response to a more Th2-based antigen specific response or vice versa.
- the terms “immunostimulating agent” and “adjuvant” in the context of the present invention are typically understood to mean agents, compounds or complexes which do not confer immunity by themselves, but exclusively support the immune reponse in an unspecific way (in contrast to an antigen-specific immune response) by effects, which modulate the antigen-specific (adaptive cellular and/or humoral immune response) by unspecific measures, e.g. cytokine expression/secretion, improved antigen presentation, shifting the nature of the arms of the immune response etc. Accordingly, any agents evoking by themselves immunity are typically disclaimed by the terms “adjuvant” or “immunostimulating agent”.
- Immunostimulatory RNA in the context of the invention may typically be a RNA that is able to induce an innate immune response itself. It usually does not have an open reading frame and thus does not provide a peptide-antigen but elicits an innate immune response e.g. by binding to a specific kind of pathogen-associated molecular patterns (PAMP) receptors (e.g. Toll-like-receptor (MR) or other suitable receptors).
- PAMP pathogen-associated molecular patterns
- MR Toll-like-receptor
- mRNAs having an open reading frame and coding for a peptide/protein may induce an innate immune response.
- Fragment of a sequence is typically a shorter portion of a full-length sequence of e.g. a nucleic acid sequence or an amino acid sequence. Accordingly, a fragment of a sequence, typically, consists of a sequence that is identical to the corresponding stretch or corresponding stretches within the full-length sequence.
- a preferred fragment of a sequence in the context of the present invention consists of a continuous stretch of entities, such as nucleotides or amino acids, corresponding to a continuous stretch of entities in the molecule the fragment is derived from, which represents at least 5%, preferably at least 20%, preferably at least 30%, more preferably at least 40%, more preferably at least 50%, even more preferably at least 60%, even more preferably at least 70%, and most preferably at least 80% of the total (i.e. full-length) molecule from which the fragment is derived.
- entities such as nucleotides or amino acids
- a fragment of a protein or peptide antigen preferably corresponds to a continuous stretch of entities in the protein or peptide antigen the fragment is derived from, which represents at least 5%, preferably at least 20%, preferably at least 30%, more preferably at least 40%, more preferably at least 50%, even more preferably at least 60%, even more preferably at least 70%, and most preferably at least 80% of the total (i.e. full-length) protein or peptide antigen.
- the fragment of a sequence is a functional fragment, i.e. that the fragment fulfills one or more of the functions fulfilled by the sequence the fragment is derived from.
- a fragment of a protein or peptide antigen preferably exhibits at least one antigenic function (e.g. is capable of eliciting a specific immune reaction against at least one antigen determinant in said protein or peptide antigen) of the protein or peptide antigen the fragment is derived from.
- Fragments of proteins or peptides in the context of the present invention may, typically, comprise a sequence of a protein or peptide as defined herein, which is, with regard to its amino acid sequence (or its encoding nucleic acid molecule), N-terminally, C-terminally and/or intrasequentially truncated compared to the amino acid sequence of the original (native) protein (or its encoded nucleic acid molecule). Such truncation may thus occur either on the amino acid level or correspondingly on the nucleic acid level.
- a sequence identity with respect to such a fragment as defined herein may therefore preferably refer to the entire protein or peptide as defined herein or to the entire (coding) nucleic acid molecule of such a protein or peptide.
- fragments of nucleic acid sequences in the context of the present invention may comprise a sequence of a nucleic acid as defined herein, which is, with regard to its nucleic acid molecule 5′-, 3′- and/or intrasequentially truncated compared to the nucleic acid molecule of the original (native) nucleic acid molecule.
- a sequence identity with respect to such a fragment as defined herein may therefore preferably refer to the entire nucleic acid as defined herein.
- Preferred fragments of proteins or peptides in the context of the present invention may furthermore comprise a sequence of a protein or peptide as defined herein, which has a length of about 6 to about 20 or even more amino acids, e.g. fragments as processed and presented by MHC class I molecules, preferably having a length of about 8 to about 10 amino acids, e.g. 8, 9, or 10, (or even 6, 7, 11, or 12 amino acids), or fragments as processed and presented by MHC class II molecules, preferably having a length of about 13 or more amino acids, e.g. 13, 14, 15, 16, 17, 18, 19, 20 or even more amino acids, wherein these fragments may be selected from any part of the amino acid sequence.
- fragments are typically recognized by T-cells in form of a complex consisting of the peptide fragment and an MHC molecule, i.e. the fragments are typically not recognized in their native form. Fragments of proteins or peptides may comprise at least one epitope of those proteins or peptides. Furthermore, also domains of a protein, like the extracellular domain, the intracellular domain or the transmembrane domain and shortened or truncated versions of a protein may be understood to comprise a fragment of a protein.
- T cell epitopes or parts of the proteins in the context of the present invention may comprise fragments preferably having a length of about 6 to about 20 or even more amino acids, e.g. fragments as processed and presented by MHC class I molecules, preferably having a length of about 8 to about 10 amino acids, e.g. 8, 9, or 10, (or even 11, or 12 amino acids), or fragments as processed and presented by MHC class II molecules, preferably having a length of about 13 or more amino acids, e.g. 13, 14, 15, 16, 17, 18, 19, 20 or even more amino acids, wherein these fragments may be selected from any part of the amino acid sequence.
- These fragments are typically recognized by T cells in form of a complex consisting of the peptide fragment and an MHC molecule, i.e. the fragments are typically not recognized in their native form.
- B cell epitopes are typically fragments located on the outer surface of (native) protein or peptide antigens as defined herein, preferably having 5 to 15 amino acids, more preferably having 5 to 12 amino acids, even more preferably having 6 to 9 amino acids, which may be recognized by antibodies, i.e. in their native form.
- Such epitopes of proteins or peptides may furthermore be selected from any of the herein mentioned variants of such proteins or peptides.
- antigenic determinants can be conformational or discontinuous epitopes which are composed of segments of the proteins or peptides as defined herein that are discontinuous in the amino acid sequence of the proteins or peptides as defined herein but are brought together in the three-dimensional structure or continuous or linear epitopes which are composed of a single polypeptide chain.
- a variant of an entity such as a variant of a sequence, e.g. of a nucleotide or amino acid sequence, refers to a modified entity, such as a modified sequence, e.g. a modified nucleotide or amino acid sequence.
- a variant of a sequence may exhibit one or more nucleotide or amino acid deletions, insertions, additions and/or substitutions compared to the sequence the variant is derived from.
- a variant of a sequence in the context of the present invention is at least 40%, preferably at least 50%, more preferably at least 60%, more preferably at least 70%, even more preferably at least 80%, even more preferably at least 90%, most preferably at least 95% identical to the sequence the variant is derived from.
- a variant of a peptide or protein antigen in the context of the present invention is preferably at least 40%, preferably at least 50%, more preferably at least 60%, more preferably at least 70%, even more preferably at least 80%, even more preferably at least 90%, most preferably at least 95% identical to the sequence of the protein or peptide antigen the variant is derived from.
- the variant is a functional variant, i.e.
- a variant of a protein or peptide antigen preferably exhibits at least one antigenic function (e.g. is capable of eliciting a specific immune reaction against at least one antigen determinant in said protein or peptide antigen) of the protein or peptide antigen the variant is derived from.
- “Variants” of proteins or peptides as defined in the context of the present invention may be generated, having an amino acid sequence which differs from the original sequence in one or more mutation(s), such as one or more substituted, inserted and/or deleted amino acid(s). Preferably, these fragments and/or variants have the same biological function or specific activity compared to the full-length native protein, e.g. its specific antigenic property. “Variants” of proteins or peptides as defined in the context of the present invention may, e.g., comprise conservative amino acid substitution(s) compared to their native, i.e. non-mutated physiological, sequence.
- amino acids as well as their encoding nucleotide sequences in particular fall under the term variants as defined herein.
- Substitutions in which amino acids, which originate from the same class, are exchanged for one another are called conservative substitutions.
- an amino acid having a polar side chain is replaced by another amino acid having a likewise polar side chain, or, for example, an amino acid characterized by a hydrophobic side chain is substituted by another amino acid having a likewise hydrophobic side chain (e.g. serine (threonine) by threonine (serine) or leucine (isoleucine) by isoleucine (leucine)).
- Insertions and substitutions are possible, in particular, at those sequence positions which cause no modification to the three-dimensional structure or do not affect the binding region. Modifications to a three-dimensional structure by insertion(s) or deletion(s) can easily be determined e.g.
- CD spectra circular dichroism spectra
- variants of proteins or peptides may comprise peptide analogues as defined herein.
- variants of proteins or peptides as defined herein, which may be encoded by a nucleic acid molecule may also comprise those sequences, wherein nucleotides of the nucleic acid are exchanged according to the degeneration of the genetic code, without leading to an alteration of the respective amino acid sequence of the protein or peptide, i.e. the amino acid sequence or at least part thereof may not differ from the original sequence in one or more mutation(s) within the above meaning.
- Sequence identity In order to determine the percentage to which two sequences are identical, e.g. nucleic acid sequences or amino acid sequences as defined herein, such as the amino acid sequences encoded by a nucleic acid sequence of the polymeric carrier cargo complex or a nucleic acid sequence or amino acid sequence of an antigen as defined herein, the cargo nucleic acid sequence or the amino acid sequences themselves, the sequences can be aligned in order to be subsequently compared to one another. Therefore, e.g. a position of a first sequence may be compared with the corresponding position of the second sequence. If a position in the first sequence is occupied by the same component as is the case at a position in the second sequence, the two sequences are identical at this position.
- the sequences differ at this position. If insertions occur in the second sequence in comparison to the first sequence, gaps can be inserted into the first sequence to allow a further alignment. If deletions occur in the second sequence in comparison to the first sequence, gaps can be inserted into the second sequence to allow a further alignment.
- the percentage to which two sequences are identical is then a function of the number of identical positions divided by the total number of positions including those positions which are only occupied in one sequence. The percentage to which two sequences are identical can be determined using a mathematical algorithm. A preferred, but not limiting, example of a mathematical algorithm which can be used is the algorithm of Karlin et al.
- a “variant” of a protein or peptide may have, e.g., at least 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% amino acid identity over a stretch of 10, 20, 30, 50, 75 or 100 amino acids, preferably over the full length sequence, of such protein or peptide.
- a “variant” of a nucleic acid sequence may have, e.g., at least 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% nucleotide identity over a stretch of 10, 20, 30, 50, 75 or 100 nucleotides, preferably over the full length sequence, of such nucleic acid sequence.
- a derivative of a peptide or protein is typically understood to be a molecule that is derived from another molecule, such as said peptide or protein.
- a “derivative” of a peptide or protein also encompasses fusions comprising a peptide or protein used in the present invention.
- the fusion comprises a label, such as, for example, an epitope, e.g., a FLAG epitope or a V5 epitope or an HA epitope.
- the epitope is a FLAG epitope.
- Such a tag is useful for, for example, purifying the fusion protein.
- derivatives of a peptide or protein also encompasses a derivatised peptide or protein, such as, for example, a peptide or protein modified to contain one or more-chemical moieties other than an amino acid.
- the chemical moiety may be linked covalently to the peptide or protein e.g., via an amino terminal amino acid residue, a carboxyl terminal amino acid residue, or at an internal amino acid residue.
- modifications include the addition of a protective or capping group on a reactive moiety in the peptide or protein, addition of a detectable label, and other changes that do not adversely destroy the activity of the peptide or protein compound.
- a derivative may comprise a PEG moiety, radionuclide, coloured latex, etc.
- a derivative generally possesses or exhibits an improved characteristic relative to a e.g., enhanced protease resistance and/or longer half-life and/or enhanced transportability between cells or tissues of the human or animal body and/or reduced adverse effect(s) and/or enhanced affinity or immunogenicity.
- WO 2010/003193 describes various methodologies to provide peptide or protein derivatives which may be employed separately or in combination using standard procedures known to the person of ordinary skill, including derivatisation of a protein or peptide by e.g. PEGylation, HESylation, or glycosylation.
- a pharmaceutical composition including:
- component (B) is not covalently linked, in particular not by a disulfide bond, with component (A).
- component (B) is preferably not covalently linked, such as by a disulfide bond, to the polymeric carrier and/or the at least one nucleic acid molecule.
- the at least one antigen is not covalently linked to the polymeric carrier cargo complex, in particular not to the polymeric carrier of the polymeric carrier cargo complex.
- the at least one antigen such as a protein or peptide antigen, is not covalently linked to the polymeric carrier cargo complex, such as to the polymeric carrier, by a disulfide bond.
- component (A) and component (B) are linked via disulfide bonds
- linkage is preferably not realized via a crosslinker, such as via a 3,6-Dioxa-1,8-octanedithiol (DODT) crosslinker.
- component (B) is preferably not ovalbumine or a fragment of ovalbumine.
- component (B), e.g. a protein antigen, not being covalently linked to the polymeric carrier is that the structure of the antigen, e.g. the protein antigen, will not be disturbed and its immunogenicity will be preserved. If the antigen, e.g. the protein antigen, is covalently linked to the polymeric carrier, e.g. by disulfide bonds, the tertiary structure of the antigen may be changed, or even denatured, which may destroy the structure of conformational epitopes and may render the protein less immunogenic or non-immunogenic.
- Epitopes that are recognized by the immune system may be linear epitopes consisting of a continuous stretch of amino acids, or conformational epitopes that have a specific three-dimensional shape consisting of amino acids from distinct parts of the protein.
- the polymeric carrier, in particular the cationic components of the polymeric carrier, and the at least one nucleic acid molecule of the polymeric carrier cargo complex are not covalently linked, but are preferably associated via other bonds than covalent bonds, such as by ionic bonds and/or van der Waals bonds.
- the polymeric carrier cargo complex only the cationic components are covalently linked with each other, but that the nucleic acid molecules are associated non-covalently with the polymeric carrier.
- components (A) and (B) do not form a micelle structure together, in particular, the polmeric carrier preferably does not form a micelle structure.
- the polymeric carrier cargo complex is for use as an adjuvant.
- it is used as an adjuvant, and/or has adjuvant properties, as may be readily determined by the person of ordinary skill using routine methodologies, and including methodologies as described herein.
- the inventive pharmaceutical composition includes (e.g. as an adjuvant) at least one polymeric carrier cargo complex, comprising
- the polymeric carrier cargo complex comprised in the inventive pharmaceutical composition allows provision of a more efficient and/or safer adjuvant for vaccination purposes.
- the polymeric carrier cargo complex is suited for in vivo delivery of nucleic acids, in particular for compacting and stabilizing a nucleic acid for the purposes of nucleic acid transfection, such as exhibiting one or more reduced negative side effects of high-molecular weight polymers as discussed above, such as poor biodegradability or high toxicity, agglomeration, low transfection activity in vivo, etc.
- the polymeric carrier cargo complex also provides for improved nucleic acid transfer in vivo particularly via intradermal or intramuscular routes, including serum stability, salt stability, efficiency of uptake, reduced complement activation, nucleic acid release, etc.
- Such a polymeric carrier cargo complex furthermore may support induction and maintenance of an adaptive immune response by initiating or boosting a parallel innate immune response. Additionally, the polymeric carrier cargo complex may exhibit improved storage stability, particularly during lyophilisation.
- the polymeric carrier cargo complex as defined above comprises as one component a polymeric carrier formed by disulfide-crosslinked cationic components.
- cationic component typically refers to a charged molecule, which is positively charged (cation) at a pH value of about 1 to 9, preferably of a pH value of or below 9, of or below 8, of or below 7, most preferably at physiological pH values, e.g. about 7.3 to 7.4. Accordingly, a cationic peptide, protein or polymer according to the present invention is positively charged under physiological conditions, particularly under physiological salt conditions of the cell in vivo.
- the definition “cationic” may also refer to “polycationic” components.
- the cationic components which form basis for the polymeric carrier of the polymeric carrier cargo complex by disulfide-crosslinkage, are typically selected from any suitable cationic or polycationic peptide, protein or polymer suitable for this purpose, particular any cationic or polycationic peptide, protein or polymer capable to complex a nucleic acid as defined according to the present invention, and thereby preferably condensing the nucleic acid.
- the cationic or polycationic peptide, protein or polymer is preferably a linear molecule, however, branched cationic or polycationic peptides, proteins or polymers may also be used.
- Each cationic or polycationic protein, peptide or polymer of the polymeric carrier contains at least one —SH moiety, most preferably at least one cysteine residue or any further chemical group exhibiting an —SH moiety, capable to form a disulfide linkage upon condensation with at least one further cationic or polycationic protein, peptide or polymer as cationic component of the polymeric carrier as mentioned herein.
- Each cationic or polycationic protein, peptide or polymer or any further component of the polymeric carrier is preferably linked to its neighbouring component(s) (cationic proteins, peptides, polymers or other components) via disulfide-crosslinking.
- the disulfide-crosslinking is a (reversible) disulfide bond (—S—S—) between at least one cationic or polycationic protein, peptide or polymer and at least one further cationic or polycationic protein, peptide or polymer or other component of the polymeric carrier.
- the disulfide-crosslinking is typically formed by condensation of —SH-moieties of the components of the polymeric carrier particularly of the cationic components.
- Such an —SH-moiety may be part of the structure of the cationic or polycationic protein, peptide or polymer or any further component of the polymeric carrier prior to disulfide-crosslinking or may be added prior to disulfide-crosslinking by a modification as defined below.
- the sulphurs adjacent to one component of the polymeric carrier, necessary for providing a disulfide bond may be provided by the component itself, e.g. by a —SH moiety as defined herein or may be provided by modifying the component accordingly to exhibit a —SH moiety.
- These —SH-moieties are typically provided by each of the component, e.g.
- the cationic component or any further component of the polymeric carrier is a peptide or protein it is preferred that the —SH moiety is provided by at least one cysteine residue.
- the component of the polymeric carrier may be modified accordingly with a —SH moiety, preferably via a chemical reaction with a compound carrying a —SH moiety, such that each of the components of the polymeric carrier carries at least one such —SH moiety.
- a compound carrying a —SH moiety may be e.g.
- an (additional) cysteine or any further (modified) amino acid or compound of the component of the polymeric carrier, which carries a —SH moiety may also be any non-amino compound or moiety, such as a non amino acid compound or moiety, which contains or allows to introduce a —SH moiety into the component as defined herein.
- Such non-amino compounds e.g. non amino acid compounds, may be attached to the component of the polymeric carrier according to the present invention via chemical reactions or binding of compounds, e.g. by binding of a 3-thio propionic acid or 2-iminothiolane (Traut's reagent), by amide formation (e.g.
- alkenes or alkines alkenes or alkines
- imine or hydrozone formation aldehydes or ketons, hydrazins, hydroxylamins, amines
- complexation reactions avidin, biotin, protein G
- S n -type substitution reactions e.g halogenalkans, thiols, alcohols, amines, hydrazines, hydrazides, sulphonic acid esters, oxyphosphonium salts
- the —SH moiety may be masked by protecting groups during chemical attachment to the component. Such protecting groups are known in the art and may be removed after chemical coupling.
- the —SH moiety e.g. of a cysteine or of any further (modified) amino acid or compound, may be present at the terminal ends or internally at any position of the component of the polymeric carrier.
- each of the components of the polymeric carrier preferably each of the cationic components of the polymeric carrier, typically exhibits at least one —SH-moiety, but may also contain two, three, four, five, or even more —SH-moieties.
- the polymeric carrier, the cargo nucleic acid molecule and/or the antigen, such as the protein or peptide antigen are not modified by introducing new coupling sites for forming disulfide bonds, such as by introducing new —SH-moieties, in particular the polymeric carrier, the cargo nucleic acid molecule and/or the antigen, such as the protein or peptide antigen, are preferably not modified by dithiopyridine.
- the polymeric carrier, the cargo nucleic acid molecule and/or the antigen do not comprise dithiopyridine.
- the polymeric carrier does not comprise a polyethylene glycol (PEG) moiety, in particular preferably the cationic components of the polymeric carrier preferably do not comprise a PEG moiety.
- the cationic component is preferably not poly-L-lysine.
- a —SH moiety may be used to attach further components to the polymeric carrier as defined herein, particularly an amino acid component, e.g. antigen epitopes, antigens, antibodies, cell penetrating peptides (e.g. TAT), ligands, etc.
- an amino acid component e.g. antigen epitopes, antigens, antibodies, cell penetrating peptides (e.g. TAT), ligands, etc.
- the polymeric carrier comprises further components in addition to the cationic components, it is preferred that the additional component is not ovalbumin or a fragment of ovalbumin, in particular, if the additional component is an amino acid component.
- the polymeric carrier of the polymeric carrier cargo complex is formed by disulfide-crosslinked cationic (or polycationic) components.
- At least one cationic (or polycationic) component of the polymeric carrier may be selected from cationic or polycationic peptides or proteins.
- Such cationic or polycationic peptides or proteins preferably exhibit a length of about 3 to 100 amino acids, preferably a length of about 3 to 50 amino acids, more preferably a length of about 3 to 25 amino acids, e.g. a length of about 3 to 10; 5 to 20; 5 to 15; 8 to 15, 16 or 17; 10 to 15, 16, 17, 18, 19, or 20; or 15 to 25 amino acids.
- such cationic or polycationic peptides or proteins may exhibit a molecular weight of about 0.01 kDa to about 100 kDa, including a molecular weight of about 0.5 kDa to about 100 kDa, preferably of about 10 kDa to about 50 kDa, even more preferably of about 10 kDa to about 30 kDa.
- analogues and derivatives of proteins or peptides as defined herein are explicitly encompassed.
- the cationic component of the polymeric carrier comprises or consists of a cationic or polycationic peptide or protein
- the cationic properties of the cationic or polycationic peptide or protein or of the entire polymeric carrier may be determined based on its content of cationic amino acids, in particular based on its content of cationic amino acids in excess over anionic or neutral amino acids, and thus, based on its net positive charge.
- the content of cationic amino acids in the cationic or polycationic peptide or protein and/or the polymeric carrier is at least 10%, 20%, or 30%, preferably at least 40%, more preferably at least 50%, 60% or 70%, but also preferably at least 80%, 90%, or even 95%, 96%, 97%, 98%, 99% or 100%, most preferably at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100%, or may be in the range of about 10% to 90%, more preferably in the range of about 15% to 75%, even more preferably in the range of about 20% to 50%, e.g.
- cationic amino acids are preferably the naturally occurring amino acids Arg (Arginine), Lys (Lysine), His (Histidine), and Orn (Ornithin).
- Arg Arginine
- Lys Lys
- His Histidine
- Orn Ornithin
- those cationic amino acids are preferred which comprise side chains which are positively charged under physiological pH conditions.
- these amino acids are Arg, Lys, and Orn.
- such cationic or polycationic peptides or proteins of the polymeric carrier which comprise or are additionally modified to comprise at least one —SH moeity, are selected from, without being restricted thereto, cationic peptides or proteins such as protamine, nucleoline, spermine or spermidine, oligo- or poly-L-lysine (PLL), basic polypeptides, oligo or poly-arginine, cell penetrating peptides (CPPs), chimeric CPPs, such as Transportan, or MPG peptides, HIV-binding peptides, Tat, HIV-1 Tat (HIV), Tat-derived peptides, members of the 0 family, e.g.
- cationic peptides or proteins such as protamine, nucleoline, spermine or spermidine, oligo- or poly-L-lysine (PLL), basic polypeptides, oligo or poly-arginine, cell penetrating peptides (CP
- Penetratin Antennapedia-derived peptides (particularly from Drosophila antennapedia ), pAntp, pIsI, etc., antimicrobial-derived CPPs e.g. Buforin-2, Bac715-24, SynB, SynB(1), pVEC, hCT-derived peptides, SAP, MAP, KALA, PpTG20, Loligomere, FGF, Lactoferrin, histones, VP22 derived or analog peptides, HSV, VP22 (Herpes simplex), MAP, KALA or protein transduction domains (PTDs, PpT620, prolin-rich peptides, arginine-rich peptides, lysine-rich peptides, Pep-1, L-oligomers, Calcitonin peptide(s), etc.
- PTDs PpT620, prolin-rich peptides, arginine-rich peptides, lysine-
- such cationic or polycationic peptides or proteins of the polymeric carrier which comprise or are additionally modified to comprise at least one —SH moeity, are selected from, without being restricted thereto, following cationic peptides having the following sum formula (I):
- l+m+n+o+x 3-100
- Any of amino acids Arg, Lys, His, Orn and Xaa may be positioned at any place of the peptide.
- cationic peptides or proteins in the range of 7-30 amino acids are particular preferred.
- Even more preferred peptides of this formula are oligoarginines such as e.g. Arg 7 , Arg 8 , Arg 9 , Arg 12 , His 3 Arg 9 , Arg 9 His 3 , His 3 Arg 9 His 3 , His 6 Arg 9 His 6 His 3 Arg 4 His 3 , His 6 Arg 4 His 6 , TyrSer 2 Arg 9 Ser 2 Tyr, (ArgLysHis) 4 , Tyr(ArgLysHis) 2 Arg, etc.
- such cationic or polycationic peptides or proteins of the polymeric carrier having the empirical sum formula (I) as shown above may, without being restricted thereto, comprise at least one of the following subgroup of formulae:
- cationic or polycationic peptides or proteins of the polymeric carrier having the empirical sum formula (I) as shown above and which comprise or are additionally modified to comprise at least one —SH moeity, may be preferably selected from, without being restricted thereto, at least one of the following subgroup of formulae.
- the following formulae do not specify any amino acid order, but are intended to reflect empirical formulae by exclusively specifying the (number of) amino acids as components of the respective peptide. Accordingly, as an example, empirical formula Arg (7-29) Lys 1 is intended to mean that peptides falling under this formula contain 7 to 19 Arg residues and 1 Lys residue of whatsoever order.
- the Lys residue may therefore be positioned anywhere in the e.g. 8 amino acid long sequence composed of 7 Arg and 1 Lys residues.
- the subgroup preferably comprises:
- cationic or polycationic peptides or proteins of the polymeric carrier having the empirical sum formula (I) as shown above and which comprise or are additionally modified to comprise at least one —SH moeity, may be, without being restricted thereto, selected from the subgroup consisting of generic formulas Arg 7 , (also termed as R 7 ), Arg 9 (also termed R 9 ), Arg 12 (also termed as R 12 ).
- the cationic or polycationic peptide or protein of the polymeric carrier when defined according to formula ⁇ (Arg) l ;(Lys) m ;(His) n ;(Orn) o ;(Xaa) x ⁇ (formula (I)) as shown above and which comprise or are additionally modified to comprise at least one —SH moeity, may be, without being restricted thereto, selected from subformula (Ia):
- This embodiment may apply to situations, wherein the cationic or polycationic peptide or protein of the polymeric carrier, e.g. when defined according to empirical formula (Arg) l ;(Lys) m ;(His) n ;(Orn) o ;(Xaa) x (formula (I)) as shown above, comprises or has been modified with at least one cysteine as —SH moiety in the above meaning such that the cationic or polycationic peptide as cationic component carries at least one cysteine, which is capable to form a disulfide bond with other components of the polymeric carrier.
- the cationic or polycationic peptide or protein of the polymeric carrier e.g. when defined according to empirical formula (Arg) l ;(Lys) m ;(His) n ;(Orn) o ;(Xaa) x (formula (I)) as shown above, comprises or has been modified with at least one cysteine
- the cationic or polycationic peptide or protein of the polymeric carrier when defined according to formula ⁇ (Arg) l ;(Lys) m ;(His) n ;(Orn) o ;(Xaa) x ⁇ (formula (I)) as shown above, may be, without being restricted thereto, selected from subformula (Ib):
- This embodiment may apply to situations, wherein the cationic or polycationic peptide or protein of the polymeric carrier, e.g. when defined according to empirical formula (Arg) l ;(Lys) m ;(His) n ;(Orn) o ;(Xaa) x (formula (I)) as shown above, has been modified with at least two cysteines as —SH moieties in the above meaning such that the cationic or polycationic peptide of the polymeric carrier cargo complex as cationic component carries at least two (terminal) cysteines, which are capable to form a disulfide bond with other components of the polymeric carrier.
- At least one cationic (or polycationic) component of the polymeric carrier may be selected from e.g. any (non-peptidic) cationic or polycationic polymer suitable in this context, provided that this (non-peptidic) cationic or polycationic polymer exhibits or is modified to exhibit at least one —SH-moiety, which provide for a disulfide bond linking the cationic or polycationic polymer with another component of the polymeric carrier as defined herein.
- the polymeric carrier may comprise the same or different cationic or polycationic polymers.
- the cationic component of the polymeric carrier comprises a (non-peptidic) cationic or polycationic polymer
- the cationic properties of the (non-peptidic) cationic or polycationic polymer may be determined upon its content of cationic charges when compared to the overall charges of the components of the cationic polymer.
- the content of cationic charges preferably the net cationic charges (i.e.
- cationic polymer at a (physiological) pH as defined herein is at least 10%, 20%, or 30%, preferably at least 40%, more preferably at least 50%, 60% or 70%, but also preferably at least 80%, 90%, or even 95%, 96%, 97%, 98%, 99% or 100%, most preferably at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100%, or may be in the range of about 10% to 90%, more preferably in the range of about 30% to 100%, even preferably in the range of about 50% to 100%, e.g.
- the (non-peptidic) cationic component of the polymeric carrier represents a cationic or polycationic polymer, typically exhibiting a molecular weight of about 0.1 or 0.5 kDa to about 100 kDa, preferably of about 1 kDa to about 75 kDa, more preferably of about 5 kDa to about 50 kDa, even more preferably of about 5 kDa to about 30 kDa, or a molecular weight of about 10 kDa to about 50 kDa, even more preferably of about 10 kDa to about 30 kDa.
- non-peptidic cationic or polycationic polymer typically exhibits at least one ⁇ SH-moiety, which is capable to form a disulfide linkage upon condensation with either other cationic components or other components of the polymeric carrier as defined herein.
- Said cationic or polycationic peptides or proteins may be prepared by all methods known to a person of ordinary skill or by recombinant peptide or protein production or by peptide synthesis as described herein.
- the (non-peptidic) cationic component of the polymeric carrier may be selected from acrylates, modified acrylates, such as pDMAEMA (poly(dimethylaminoethyl methylacrylate)), chitosanes, aziridines or 2-ethyl-2-oxazoline (forming oligo ethylenimines or modifed oligoethylenimines), polymers obtained by reaction of bisacrylates with amines forming oligo beta aminoesters or poly amido amines, or other polymers like polyesters, polycarbonates, etc.
- pDMAEMA poly(dimethylaminoethyl methylacrylate)
- chitosanes such as aziridines or 2-ethyl-2-oxazoline (forming oligo ethylenimines or modifed oligoethylenimines)
- Each molecule of these (non-peptidic) cationic or polycationic polymers typically exhibits at least one —SH-moiety, wherein these at least one —SH-moiety may be introduced into the (non-peptidic) cationic or polycationic polymer by chemical modifications, e.g. using imonothiolan, 3-thio propionic acid or introduction of —SH-moieties containing amino acids, such as cysteine or any further (modified) amino acid.
- —SH-moieties are preferably as already defined above.
- the cationic components which form basis for the polymeric carrier by disulfide-crosslinkage, may be the same or different from each other. It is also particularly preferred that the polymeric carrier of the present invention comprises mixtures of cationic peptides, proteins or polymers and optionally further components as defined herein, which are crosslinked by disulfide bonds as described herein. Particularly preferred cationic components of the polymeric carrier in the context of the present invention are cationic peptides or proteins.
- the polymeric carrier cargo complex due to its variable polymeric carrier advantageously allows to combine desired properties of different (short) cationic or polycationic peptides, proteins or polymers or other components.
- the polymeric carrier e.g., allows to efficiently compact nucleic acids for the purpose of efficient transfection of nucleic acids, for adjuvant therapy, for the purposes of gene therapy, for gene knock-down or others strategies without loss of activity, particularly exhibiting an efficient transfection of a nucleic acid into different cell lines in vitro but particularly transfection in vivo.
- the polymeric carrier and thus the polymeric carrier cargo complex is furthermore not toxic to cells, provides for efficient release of its nucleic acid cargo, is stable during lyophilization and is applicable as immunostimulating agent or adjuvant.
- the polymer carrier cargo complex may induce the anti-viral cytokine IFN-alpha.
- the polymeric carrier formed by disulfide-linked cationic components allows considerably to vary its peptide or polymeric content and thus to modulate its biophysical/biochemical properties, particularly the cationic properties of the polymeric carrier, quite easily and fast, e.g. by incorporating as cationic components the same or different cationic peptide(s) or polymer(s) and optionally adding other components into the polymeric carrier.
- the polymeric carrier forms a long cationic binding sequence providing a strong condensation of the nucleic acid cargo and complex stability. Under the reducing conditions of the cytosole (e.g.
- the complex is rapidly degraded into its (cationic) components, which are further degraded (e.g. oligopeptides).
- the polymeric carrier of the polymeric carrier cargo complex may comprise different (short) cationic or polycationic peptides, proteins or polymers selected from cationic or polycationic peptides, proteins or (non-peptidic) polymers as defined above, optionally together with further components as defined herein.
- the polymeric carrier of the polymeric carrier cargo complex as defined above may be, preferably prior to the disulfide-crosslinking, modified with at least one further component.
- the polymeric carrier as such may be modified with at least one further component. It may also optionally comprise at least one further component, which typically forms the polymeric carrier disulfide together with the other (short) cationic or polycationic peptides as defined above via disulfide crosslinking.
- each of the components of the polymeric carrier may (preferably already prior to disulfide-crosslinking) also contain at least one further functional moiety, which allows attaching such further components as defined herein.
- Such functional moieties may be selected from functionalities which allow the attachment of further components, e.g. functionalities as defined herein, e.g. by amide formation (e.g. carboxylic acids, sulphonic acids, amines, etc.), by Michael addition (e.g maleinimide moieties, ⁇ , ⁇ unsatured carbonyls, etc.), by click chemistry (e.g.
- alkene/alkine methates e.g. alkenes or alkines
- imine or hydrozone formation aldehydes or ketons, hydrazins, hydroxylamins, amines
- complexation reactions avidin, biotin, protein G
- S n -type substitution reactions e.g halogenalkans, thiols, alcohols, amines, hydrazines, hydrazides, sulphonic acid esters, oxyphosphonium salts
- other chemical moieties which can be utilized in the attachment of further components.
- the further component which may be contained in the polymeric carrier or which may be used to modify the different (short) cationic or polycationic peptides or (non-peptidic) polymers forming basis for the polymeric carrier of the polymeric carrier cargo complex is an amino acid component (AA), which may e.g. modify the biophysical/biochemical properties of the polymeric carrier as defined herein.
- AA amino acid component
- the amino acid component (AA) comprises a number of amino acids preferably in a range of about 1 to 100, preferably in a range of about 1 to 50, more preferably selected from a number comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15-20, or may be selected from a range formed by any two of the afore mentioned values.
- the amino acids of amino acid component (AA) can be chosen independently from each other. For example if in the polymeric carrier two or more (AA) components are present they can be the same or can be different from each other.
- the amino acid component (AA) may contain or may be flanked (e.g. terminally) by a —SH containing moiety, which allows introducing this component (AA) via a disulfide bond into the polymeric carrier as defined herein.
- the amino acid component (AA) may also be read as -Cys-(AA)-Cys-wherein Cys represents Cysteine and provides for the necessary —SH-moiety for a disulfide bond.
- the —SH containing moiety may be also introduced into amino acid component (AA) using any of modifications or reactions as shown above for the cationic component or any of its components.
- the amino acid component (AA) may be provided with two —SH-moieties (or even more), e.g. in a form represented by formula HS-(AA)-SH to allow binding to two functionalities via disulfide bonds, e.g. if the amino acid component (AA) is used as a linker between two further components (e.g. as a linker between two cationic polymers).
- one —SH moiety is preferably protected in a first step using a protecting group as known in the art, leading to an amino acid component (AA) of formula HS-(AA)-S-protecting group.
- amino acid component (AA) may be bound to a further component of the polymeric carrier, to form a first disulfide bond via the non-protected —SH moiety.
- the protected —SH-moiety is then typically deprotected and bound to a further free —SH-moiety of a further component of the polymeric carrier to form a second disulfide bond.
- amino acid component (AA) may be provided with other functionalities as already described above for the other components of the polymeric carrier, which allow binding of the amino acid component (AA) to any of components of the polymeric carrier.
- the amino acid component (AA) is linked via disulfide bonds to the polymeric carrier
- the disulfide linkage is not realized via a crosslinker, such as a 3,6-Dioxa-1,8-octanedithiol (DODT) crosslinker.
- a crosslinker such as a 3,6-Dioxa-1,8-octanedithiol (DODT) crosslinker.
- the amino acid component (AA) may be bound to further components of the polymeric carrier with or without using a disulfide linkage. Binding without using a disulfide linkage may be accomplished by any of the reactions described above, preferably by binding the amino acid component (AA) to the other component of the polymeric carrier using an amid-chemistry as defined herein.
- the other terminus of the amino acid component (AA) e.g. the N- or C-terminus, may be used to couple another component, e.g. a ligand L.
- the other terminus of the amino acid component (AA) preferably comprises or is modified to comprise a further functionality, e.g.
- an alkyn-species (see above), which may be used to add the other component via e.g. click-chemistry. If the ligand is bound via an acid-labile bond, the bond is preferably cleaved off in the endosome and the polymeric carrier presents amino acid component (AA) at its surface.
- AA amino acid component
- the amino acid component (AA) may occur as a further component of the polymeric carrier as defined above, e.g. as a linker between cationic components e.g. as a linker between one cationic peptide and a further cationic peptide, as a linker between one cationic polymer and a further cationic polymer, as a linker between one cationic peptide and a cationic polymer, all preferably as defined herein, or as an additional component of the polymeric carrier, e.g. by binding the amino acid component (AA) to the polymeric carrier or a component thereof, e.g. via side chains, SH-moieties or via further moieties as defined herein, wherein the amino acid component (AA) is preferably accordingly modified.
- the amino acid component (AA) may be used to modify the polymeric carrier, particularly the content of cationic components in the polymeric carrier as defined above.
- the content of cationic components in the polymeric carrier is at least 10%, 20%, or 30%, preferably at least 40%, more preferably at least 50%, 60% or 70%, but also preferably at least 80%, 90%, or even 95%, 96%, 97%, 98%, 99% or 100%, most preferably at least 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100%, or may be in the range of about 30% to 100%, more preferably in the range of about 50% to 100%, even preferably in the range of about 70% to 100%, e.g. 70, 80, 90 or 100%, or in a range formed by any two of the afore mentioned values, provided, that the content of all components in the polymeric carrier is 100%.
- amino acid component (AA) may be selected from the following alternatives.
- the amino acid component (AA) may be an aromatic amino acid component (AA).
- aromatic amino acids or sequences as amino aromatic acid component (AA) into the polymeric carrier of the present invention enables a different (second) binding of the polymeric carrier to the nucleic acid due to interactions of the aromatic amino acids with the bases of the nucleic acid cargo in contrast to the binding thereof by cationic charged sequences of the polymeric carrier molecule to the phosphate backbone.
- This interaction may occur e.g. by intercalations or by minor or major groove binding.
- anionic complexing partners e.g. Heparin, Hyaluronic acids
- amino acids in the aromatic amino acid component (AA) may be selected from either the same or different aromatic amino acids e.g. selected from Tip, Tyr, or Phe.
- the aromatic amino acid component (AA) may contain or may be flanked by a —SH containing moiety, which allows introducing this component via a disulfide bond as a further part of the polymeric carrier as defined above, e.g. as a linker.
- a —SH containing moiety may be any moiety as defined herein suitable to couple one component as defined herein to a further component as defined herein.
- such a —SH containing moiety may be a cysteine.
- aromatic amino acid component (AA) may contain or represent at least one proline, which may serve as a structure breaker of longer sequences of Trp, Tyr and Phe in the aromatic amino acid component (AA), preferably two, three or more prolines.
- the amino acid component (AA) may be a hydrophilic (and preferably non charged polar) amino acid component (AA).
- hydrophilic (and preferably non charged polar) amino acids or sequences as amino hydrophilic (and preferably non charged polar) acid component (AA) into the polymeric carrier of the present invention enables a more flexible binding to the nucleic acid cargo. This leads to a more effective compaction of the nucleic acid cargo and hence to a better protection against nucleases and unwanted decompaction. It also allows provision of a (long) polymeric carrier which exhibits a reduced cationic charge over the entire carrier and in this context to better adjusted binding properties, if desired or necessary.
- amino acids in the hydrophilic (and preferably non charged polar) amino acid component (AA) may be selected from either the same or different hydrophilic (and preferably non charged polar) amino acids e.g. selected from Thr, Ser, Asn or Gln.
- hydrophilic (and preferably non-charged polar) amino acid component (AA) may contain or may be flanked by a —SH containing moiety, which allows introducing this component via a disulfide bond as a further part of generic formula (I) above, e.g. as a linker.
- a —SH containing moiety may be any moiety as defined herein suitable to couple one component as defined herein to a further component as defined herein.
- such a —SH containing moiety may be a cysteine.
- the hydrophilic (and preferably non-charged polar) amino acid component (AA) may contain at least one proline, which may serve as a structure breaker of longer sequences of Ser, Thr and Asn in the hydrophilic (and preferably non charged polar) amino acid component (AA), preferably two, three or more prolines.
- the amino acid component (AA) may be a lipohilic amino acid component (AA).
- the incorporation of lipohilic amino acids or sequences as amino lipohilic acid component (AA) into the polymeric carrier of the present invention enables a stronger compaction of the nucleic acid cargo and/or the polymeric carrier and its nucleic acid cargo when forming a complex. This is particularly due to interactions of one or more polymer strands of the polymeric carrier, particularly of lipophilic sections of lipohilic amino acid component (AA) and the nucleic acid cargo. This interaction will preferably add an additional stability to the complex between the polymeric carrier and its nucleic acid cargo. This stabilization may somehow be compared to a sort of non covalent crosslinking between different polymer strands. Especially in aqueous environment this interaction is typically strong and provides a significant effect.
- the amino acids in the lipophilic amino acid component (AA) may be selected from either the same or different lipophilic amino acids e.g. selected from Leu, Val, Ile, Ala, Met.
- the lipophilic amino acid component (AA) may contain or may be flanked by a —SH containing moiety, which allows introducing this component via a disulfide bond as a further part of the polymeric carrier above, e.g. as a linker.
- a —SH containing moiety may be any moiety as defined herein suitable to couple one component as defined herein to a further component as defined herein.
- such a —SH containing moiety may be a cysteine.
- the lipophilic amino acid component (AA) may contain at least one proline, which may serve as a structure breaker of longer sequences of Leu, Val, Ile, Ala and Met in the lipophilic amino acid component (AA), preferably two, three or more prolines.
- the amino acid component (AA) may be a weak basic amino acid component (AA).
- the incorporation of weak basic amino acids or sequences as weak basic amino acid component (AA) into the polymeric carrier of the present invention may serve as a proton sponge and facilitates endosomal escape (also called endosomal release) (proton sponge effect). Incorporation of such a weak basic amino acid component (AA) preferably enhances transfection efficiency.
- the amino acids in the weak basic amino acid component (AA) may be selected from either the same or different weak amino acids e.g. selected from histidine or aspartate (aspartic acid).
- the weak basic amino acid component (AA) may contain or may be flanked by a —SH containing moiety, which allows introducing this component via a disulfide bond as a further part of generic formula (I) above, e.g. as a linker.
- a —SH containing moiety may be any moiety as defined herein suitable to couple one component as defined herein to a further component as defined herein.
- the weak basic amino acid component (AA) may contain at least one proline, which may serve as a structure breaker of longer sequences of histidine or aspartate (aspartic acid) in the weak basic amino acid component (AA), preferably two, three or more prolines.
- the amino acid component (AA) may be a signal peptide or signal sequence, a localization signal or sequence, a nuclear localization signal or sequence (NLS), an antibody, a cell penetrating peptide, (e.g. TAT), etc.
- an amino acid component (AA) is bound to the polymeric carrier or to another component of the polymeric carrier via a (reversible) disulfide bond.
- the signal peptide or signal sequence, a localization signal or sequence, a nuclear localization signal or sequence (NLS), an antibody, a cell penetrating peptide, (e.g. TAT), etc. additionally comprises at least one —SH-moiety.
- a signal peptide, a localization signal or sequence or a nuclear localization signal or sequence may be used to direct the inventive polymeric carrier cargo complex to specific target cells (e.g. hepatocytes or antigen-presenting cells) and preferably allows a translocalization of the polymeric carrier to a specific target, e.g. into the cell, into the nucleus, into the endosomal compartment, sequences for the mitochondrial matrix, localisation sequences for the plasma membrane, localisation sequences for the Golgi apparatus, the nucleus, the cytoplasm and the cytosceleton, etc.
- specific target cells e.g. hepatocytes or antigen-presenting cells
- a translocalization of the polymeric carrier e.g. into the cell, into the nucleus, into the endosomal compartment, sequences for the mitochondrial matrix, localisation sequences for the plasma membrane, localisation sequences for the Golgi apparatus, the nucleus, the cytoplasm and the cytosceleton, etc.
- Such signal peptide, a localization signal or sequence or a nuclear localization signal may be used for the transport of any of the herein defined nucleic acids, preferably an RNA or a DNA, more preferably an shRNA or a pDNA, e.g. into the nucleus.
- a signal peptide, a localization signal or sequence or a nuclear localization signal may comprise, e.g., localisation sequences for the endoplasmic reticulum.
- secretory signal peptides as defined herein include, without being limited thereto, signal peptides of classical or non-classical MHC-molecules (e.g. signal sequences of MHC I and II molecules, e.g.
- signal peptides of MHC class I molecule HLA-A*0201 may be used according to the present invention.
- Such an additional component may be bound e.g. to a cationic polymer or to any other component of the polymeric carrier as defined herein.
- this signal peptide, localization signal or sequence or nuclear localization signal or sequence (NLS) is bound to the polymeric carrier or to another component of the polymeric carrier via a (reversible) disulfide bond.
- the (AA) component additionally comprises at least one —SH moiety as defined herein.
- the binding to any of components of the polymeric carrier may also be accomplished using an acid-labile bond, preferably via a side chain of any of components of the polymeric carrier, which allows to detach or release the additional component at lower pH-values, e.g. at physiological pH-values as defined herein.
- the amino acid component (AA) may be a functional peptide or protein, which may modulate the functionality of the polymeric carrier accordingly.
- Such functional peptides or proteins as the amino acid component (AA) preferably comprise any peptides or proteins as defined herein, e.g. as defined below as therapeutically active proteins.
- such further functional peptides or proteins may comprise so called cell penetrating peptides (CPPs) or cationic peptides for transportation. Particularly preferred are CPPs, which induce a pH-mediated conformational change in the endosome and lead to an improved release of the polymeric carrier (in complex with a nucleic acid) from the endosome by insertion into the lipid layer of the liposome.
- CPPs cell penetrating peptides
- cationic peptides for transportation may include, without being limited thereto protamine, nucleoline, spermine or spermidine, oligo- or poly-L-lysine (PLL), basic polypeptides, oligo or poly-arginine, cell penetrating peptides (CPPs), chimeric CPPs, such as Transportan, or MPG peptides, HIV-binding peptides, Tat, HIV-1 Tat (HIV), Tat-derived peptides, members of the penetratin family, e.g.
- Penetratin Antennapedia-derived peptides (particularly from Drosophila antennapedia ), pAntp, plsl, etc., antimicrobial-derived CPPs e.g. Buforin-2, Bac715-24, SynB, SynB(1), pVEC, ha-derived peptides, SAP, MAP, KALA, PpTG20, Loligomere, FGF, Lactoferrin, histones, VP22 derived or analog peptides, HSV, VP22 (Herpes simplex), MAP, KALA or protein transduction domains (PTDs, PpT620, prolin-rich peptides, arginine-rich peptides, lysine-rich peptides, Pep-1, L-oligomers, Calcitonin peptide(s), etc.
- PTDs PpT620, prolin-rich peptides, arginine-rich peptides, lysine-rich peptide
- Such an amino acid component (AA) may also be bound to any component of the polymeric carrier as defined herein. Preferably it is bound to the polymeric carrier or to another component of the polymeric carrier via a (reversible) disulfide bond.
- the amino acid component (AA) preferably comprises at least one —SH moiety as defined herein.
- the binding to any of the components of the polymeric carrier may also be accomplished using an SH-moiety or an acid-labile bond, preferably via a side chain of any of components of the polymeric carrier which allows to detach or release the additional component at lower pH-values, e.g. at physiological pH-values as defined herein.
- the amino acid component (AA) may consist of any peptide or protein which can execute any favourable function in the cell.
- peptides or proteins selected from therapeutically active proteins or peptides, from antigens, e.g. tumour antigens, pathogenic antigens (animal antigens, viral antigens, protozoan antigens, bacterial antigens, allergic antigens), autoimmune antigens, or further antigens, from allergens, from antibodies, from immunostimulatory proteins or peptides, from antigen-specific T-cell receptors, or from any other protein or peptide suitable for a specific (therapeutic) application as defined below for coding nucleic acids.
- antigens e.g. tumour antigens, pathogenic antigens (animal antigens, viral antigens, protozoan antigens, bacterial antigens, allergic antigens), autoimmune antigens, or further antigens, from allergens, from antibodies, from immunostimulatory proteins or peptides,
- peptide epitopes from the at least one antigen an antigen from a pathogen associated with infectious disease; an antigen associated with allergy or allergic disease; an antigen associated with autoimmune disease; or an antigen associated with a cancer or tumour disease
- an antigen from a pathogen associated with infectious disease an antigen associated with allergy or allergic disease; an antigen associated with autoimmune disease; or an antigen associated with a cancer or tumour disease
- the amino acid component (AA) is covalently attached to the polymeric carrier cargo complex, in particular to the polymeric carrier, the amino acid component (AA) is preferably not ovalbumin or a fragment of ovalbumin. Preferably, the amino acid component is not ovalbumin or a fragment of ovalbumin.
- said (AA) components may be prepared by all methods known to a person of ordinary skill or by recombinant peptide or protein production or by peptide synthesis as described herein.
- the polymeric carrier may comprise at least one of the above mentioned cationic or polycationic peptides, proteins or polymers or further components, e.g. (AA), wherein any of the above alternatives may be combined with each other, and may be formed by polymerizing same in a polymerization condensation reaction via their —SH-moieties.
- AA cationic or polycationic peptides, proteins or polymers or further components
- the polymeric carrier of the polymeric carrier cargo complex or single components thereof may be further modified with a ligand, preferably a carbohydrate, more preferably a sugar, even more preferably mannose.
- a ligand preferably a carbohydrate, more preferably a sugar, even more preferably mannose.
- this ligand is bound to the polymeric carrier or to a component of the polymeric carrier via a (reversible) disulfide bond or via Michael addition.
- the ligand additionally comprises at least one —SH-moiety.
- These ligands may be used to direct the polymeric carrier cargo complex to specific target cells (e.g. hepatocytes or antigen-presenting cells).
- mannose is particular preferred as ligand in the case that dendritic cells are the target especially for vaccination or adjuvant purposes.
- the polymeric carrier cargo complex may comprise (AA) components as defined above which do not comprise —SH moieties. These (AA) components can be added before or during the complexation reaction of the at least one nucleic acid molecule. Thereby, the (AA) component(s) is/are (non-covalently) incorporated into the polymeric carrier cargo complex without inclusion of the (AA) component(s) in the polymeric carrier itself by (covalent) polymerization.
- the entire polymeric carrier cargo complex may be formed by a polymerization condensation (of at least one) of the above mentioned cationic or polycationic peptides, proteins or polymers or further components, e.g. (AA), via their—SH-moieties in a first step and complexing the nucleic acid to such a polymeric carrier in a second step.
- the polymeric carrier may thus contain a number of at least one or even more of the same or different of the above defined cationic or polycationic peptides, proteins or polymers or further components, e.g. (AA), the number preferably determined by the above range.
- the polymeric carrier cargo complex is formed by carrying out the polymerization condensation of at least one of the above mentioned cationic or polycationic peptides, proteins or polymers or further components, e.g. (AA), via their —SH-moieties simultaneously to complexing the nucleic acid cargo to the (in situ prepared) polymeric carrier.
- the polymeric carrier may thus also here contain a number of at least one or even more of the same or different of the above defined cationic or polycationic peptides, proteins or polymers or further components, e.g. (AA), the number preferably determined by the above range.
- the polymeric carrier cargo complex additionally comprises as a cargo at least one nucleic acid (molecule).
- a nucleic acid molecule may be any suitable nucleic acid, selected e.g. from any (single-stranded or double-stranded) DNA, preferably, without being limited thereto, e.g. genomic DNA, single-stranded DNA molecules, double-stranded DNA molecules, coding DNA, DNA primers, DNA probes, immunostimulatory DNA, a (short) DNA oligonucleotide ((short) oligodesoxyribonucleotides), or may be selected e.g. from any PNA (peptide nucleic acid) or may be selected e.g.
- RNA from any (single-stranded or double-stranded) RNA, preferably, without being limited thereto, a (short) RNA oligonucleotide ((short) oligoribonucleotide), a coding RNA, a messenger RNA (mRNA), an immunostimulatory RNA, a small interfering RNA (siRNA), an antisense RNA, a micro RNA, a small nuclear RNA (snRNA), a small-hairpin (sh) RNA or riboswitches, ribozymes or aptamers; etc.
- mRNA messenger RNA
- siRNA small interfering RNA
- siRNA small interfering RNA
- antisense RNA a micro RNA
- snRNA small nuclear RNA
- sh small-hairpin
- the nucleic acid molecule of the polymeric carrier cargo complex may also be a ribosomal RNA (rRNA), a transfer RNA (tRNA), a messenger RNA (mRNA), or a viral RNA (vRNA).
- rRNA ribosomal RNA
- tRNA transfer RNA
- mRNA messenger RNA
- vRNA viral RNA
- the nucleic acid molecule of the polymeric carrier cargo complex is an RNA.
- the nucleic acid molecule of the polymeric carrier cargo complex is a (linear) single-stranded RNA, even more preferably an mRNA or an immunostimulatory RNA.
- an mRNA is typically an RNA, which is composed of several structural elements, e.g.
- an optional 5′-CAP structure an optional 5′-UTR region, an upstream positioned ribosomal binding site followed by a coding region, an optional 3′-UTR region, which may be followed by a poly-A tail (and/or a poly-C-tail).
- An mRNA may occur as a mono-, di-, or even multicistronic RNA, i.e. a RNA which carries the coding sequences of one, two or more proteins or peptides. Such coding sequences in di-, or even multicistronic mRNA may be separated by at least one IRES sequence, e.g. as defined herein.
- the nucleic acid of the polymeric carrier cargo complex may be a single- or a double-stranded nucleic acid (molecule) (which may also be regarded as a nucleic acid (molecule) due to non-covalent association of two single-stranded nucleic acid(s) (molecules)) or a partially double-stranded or partially single stranded nucleic acid, which are at least partially self complementary (both of these partially double-stranded or partially single stranded nucleic acid molecules are typically formed by a longer and a shorter single-stranded nucleic acid molecule or by two single stranded nucleic acid molecules, which are about equal in length, wherein one single-stranded nucleic acid molecule is in part complementary to the other single-stranded nucleic acid molecule and both thus form a double-stranded nucleic acid molecule in this region, i.e.
- nucleic acid (molecule) may be a single-stranded nucleic acid molecule.
- nucleic acid (molecule) may be a circular or linear nucleic acid molecule, preferably a linear nucleic acid molecule.
- the nucleic acid molecule of the polymeric carrier cargo complex may be a coding nucleic acid, e.g. a DNA or RNA.
- a coding DNA or RNA may be any DNA or RNA as defined herein.
- such a coding DNA or RNA may be a single- or a double-stranded DNA or RNA, more preferably a single-stranded DNA or RNA, and/or a circular or linear DNA or RNA, more preferably a linear DNA or RNA.
- the coding DNA or RNA may be a (linear) single-stranded DNA or RNA.
- the nucleic acid molecule according to the present invention may be a ((linear) single-stranded) messenger RNA (mRNA).
- mRNA messenger RNA
- Such an mRNA may occur as a mono-, di-, or even multicistronic RNA, i.e. an RNA which carries the coding sequences of one, two or more proteins or peptides.
- Such coding sequences in di-, or even multicistronic mRNA may be separated by at least one IRES sequence, e.g. as defined herein.
- the nucleic acid molecule of the polymeric carrier cargo complex may encode a protein or a peptide, which may be selected, without being restricted thereto, e.g. from therapeutically active proteins or peptides, including adjuvant proteins, from antigens, e.g. tumour antigens, pathogenic antigens (e.g.
- the coding nucleic acid may be transported into a cell, a tissue or an organism and the protein may be expressed subsequently in this cell, tissue or organism.
- the coding nucleic acid may additionally code for a signal peptide as defined herein.
- therapeutically active proteins or peptides may be encoded by the nucleic acid molecule of the herein defined polymeric carrier cargo complex.
- Therapeutically active proteins are defined herein as proteins which have an effect on healing, prevent prophylactically or treat therapeutically a disease, preferably as defined herein, or are proteins of which an individual is in need of. These may be selected from any naturally or synthetically designed occurring recombinant or isolated protein known to a skilled person from the prior art. Without being restricted thereto therapeutically active proteins may comprise proteins, capable of stimulating or inhibiting the signal transduction in the cell, e.g.
- cytokines cytokines, lymphokines, monokines, growth factors, receptors, signal transduction molecules, transcription factors, etc; anticoagulants; antithrombins; antiallergic proteins; apoptotic factors or apoptosis related proteins, therapeutic active enzymes and any protein or peptide connected with any acquired disease or any hereditary disease or favourable for the treatment of any acquired disease or any hereditary disease.
- a therapeutically active protein which may be encoded by the nucleic acid molecule of the herein defined polymeric carrier cargo complex, may also be an adjuvant protein.
- an adjuvant protein is preferably to be understood as any protein, which is capable to elicit an innate immune response as defined herein.
- an innate immune response comprises activation of a pattern recognition receptor, such as e.g. a receptor selected from the Toll-like receptor (TLR) family, including e.g. a Toll like receptor selected from human TLR1 to TLR10 or from murine Toll like receptors TLR1 to TLR13.
- TLR Toll-like receptor
- the adjuvant protein is selected from human adjuvant proteins or from pathogenic adjuvant proteins, selected from the group consisting of, without being limited thereto, bacterial proteins, protozoan proteins, viral proteins, or fungal proteins, animal proteins, in particular from bacterial adjuvant proteins.
- pathogenic adjuvant proteins selected from the group consisting of, without being limited thereto, bacterial proteins, protozoan proteins, viral proteins, or fungal proteins, animal proteins, in particular from bacterial adjuvant proteins.
- nucleic acids encoding human proteins involved in adjuvant effects e.g. ligands of pattern recognition receptors, pattern recognition receptors, proteins of the signal transduction pathways, transcription factors or cytokines may be used as well.
- the nucleic acid molecule of the herein defined polymeric carrier cargo complex may alternatively encode an antigen.
- antigens as encoded by the nucleic acid molecule of the herein defined polymeric carrier cargo complex typically comprise any antigen, antigenic epitope or antigenic peptide, falling under the above definition, more preferably protein and peptide antigens, e.g. tumour antigens, allergenic antigens, auto-immune self-antigens, pathogenic antigens, etc.
- antigens as encoded by the nucleic acid molecule of the herein defined polymeric carrier cargo complex may be antigens generated outside the cell, more typically antigens not derived from the host organism (e.g. a human) itself (i.e.
- non-self antigens but rather derived from host cells outside the host organism, e.g. viral antigens, bacterial antigens, fungal antigens, protozoological antigens, animal antigens, allergenic antigens, etc.
- Allergenic antigens are typically antigens, which cause an allergy in a human and may be derived from either a human or other sources.
- antigens as encoded by the nucleic acid molecule of the herein defined polymeric carrier cargo complex may be furthermore antigens generated inside the cell, the tissue or the body.
- antigens include antigens derived from the host organism (e.g. a human) itself, e.g.
- tumour antigens self-antigens or auto-antigens, such as auto-immune self-antigens, etc., but also (non-self) antigens as defined herein, which have been originally been derived from host cells outside the host organism, but which are fragmented or degraded inside the body, tissue or cell, e.g. by (protease) degradation, metabolism, etc.
- an antigen as encoded by the nucleic acid cargo comprised in the polymeric carrier cargo complex is defined as described below for the at least one antigen, the second ingredient of the inventive pharmaceutical composition.
- the antigen or a fragment, variant and/or derivative thereof encoded by the nucleic acid cargo is the same antigen as the at least one antigen as defined herein as comprised in the inventive pharmaceutical composition as second ingredient.
- the antigen or a fragment, variant and/or derivative thereof encoded by the nucleic acid cargo is a different antigen as the at least one antigen as defined herein as comprised in the inventive pharmaceutical composition as second ingredient.
- the nucleic acid molecule together with the polymeric carrier serves as adjuvant or imunostimulating agent to induce an unspecific innate immune response
- the encoded protein or peptide antigen which is expressed by the nucleic acid cargo serves as antigen to induce an antigen-specific adaptive immune response
- the nucleic acid molecule of the herein defined polymeric carrier cargo complex may encode an antibody or an antibody fragment.
- an antibody may be selected from any antibody, e.g. any recombinantly produced or naturally occurring antibodies, known in the art, in particular antibodies suitable for therapeutic, diagnostic or scientific purposes, or antibodies which have been identified in relation to specific cancer diseases.
- the term “antibody” is used in its broadest sense and specifically covers monoclonal and polyclonal antibodies (including agonist, antagonist, and blocking or neutralizing antibodies) and antibody species with polyepitopic specificity.
- the term “antibody” typically comprises any antibody known in the art (e.g.
- IgM, IgD, IgG, IgA and IgE antibodies such as naturally occurring antibodies, antibodies generated by immunization in a host organism, antibodies which were isolated and identified from naturally occurring antibodies or antibodies generated by immunization in a host organism and recombinantly produced by biomolecular methods known in the art, as well as chimeric antibodies, human antibodies, humanized antibodies, bispecific antibodies, intrabodies, i.e. antibodies expressed in cells and optionally localized in specific cell compartments, and fragments and variants of the aforementioned antibodies.
- an antibody consists of a light chain and a heavy chain both having variable and constant domains.
- the light chain consists of an N-terminal variable domain, V L , and a C-terminal constant domain, C L .
- the heavy chain of the IgG antibody for example, is comprised of an N-terminal variable domain, V H , and three constant domains, C H 1, C H 2 and C H 3.
- antibodies as encoded by the nucleic acid molecule of the herein defined polymeric carrier cargo complex may preferably comprise full-length antibodies, i.e. antibodies composed of the full heavy and full light chains, as described above.
- derivatives of antibodies such as antibody fragments, variants or adducts may also be encoded by the nucleic acid molecule of the herein defined polymeric carrier cargo complex.
- Antibody fragments are preferably selected from Fab, Fab′, F(ab′) 2 , Fc, Facb, pFc′, Fd and Fv fragments of the aforementioned (full-length) antibodies. In general, antibody fragments are known in the art.
- a Fab fragment, antigen binding
- a scFv single chain variable fragment
- the domains are linked by an artificial linkage, in general a polypeptide linkage such as a peptide composed of 15-25 glycine, proline and/or serine residues.
- the different chains of the antibody or antibody fragment are encoded by a multicistronic nucleic acid molecule.
- the different strains of the antibody or antibody fragment are encoded by several monocistronic nucleic acid(s) (sequences).
- the nucleic acid molecule of the herein defined polymeric carrier cargo complex may be in the form of dsRNA, preferably siRNA.
- dsRNA preferably siRNA
- a dsRNA, or a siRNA is of interest particularly in connection with the phenomenon of RNA interference.
- RNAi RNA interference
- the in vitro technique of RNA interference (RNAi) is based on double-stranded RNA molecules (dsRNA), which trigger the sequence-specific suppression of gene expression (Zamore (2001) Nat. Struct. Biol. 9: 746-750; Sharp (2001) Genes Dev. 5:485-490: Hannon (2002) Nature 41: 244-251).
- the nucleic acid molecule of the herein defined polymeric carrier cargo complex may thus be a double-stranded RNA (dsRNA) having a length of from 17 to 29, preferably from 19 to 25, and preferably is at least 90%, more preferably 95% and especially 100% (of the nucleotides of a dsRNA) complementary to a section of the nucleic acid molecule of a (therapeutically relevant) protein or antigen described (as active ingredient) hereinbefore or of any further protein as described herein, either a coding or a non-coding section, preferably a coding section.
- dsRNA double-stranded RNA
- target sequence may be any nucleic acid molecule as defined herein, preferably a genomic DNA, a cDNA, a RNA, e.g. an mRNA, etc.
- 90% complementary means that with a length of a dsRNA described herein of, for example, 20 nucleotides, the dsRNA contains not more than 2 nucleotides showing no complementarity with the corresponding section of the target sequence.
- the sequence of the double-stranded RNA used according to the invention is, however, preferably wholly complementary in its general structure with a section of the target sequence.
- the nucleic acid molecule of the polymeric carrier cargo complex may be a dsRNA having the general structure 5-(N 17-29 )-3′, preferably having the general structure 5′-(N 19-25 )-3′, more preferably having the general structure 5′-(N 19-24 )-3′, or yet more preferably having the general structure 5′-(N 21-23 )-3 wherein for each general structure each N is a (preferably different) nucleotide of a section of the target sequence, preferably being selected from a continuous number of 17 to 29 nucleotides of a section of the target sequence, and being present in the general structure 5′-(N 17-29 )-3′ in their natural order.
- dsRNAs used as nucleic acid molecule of the polymeric carrier cargo complex can also be directed against nucleotide sequences of a (therapeutically relevant) protein or antigen described (as active ingredient) hereinbefore that do not lie in the coding region, in particular in the 5′ non-coding region of the target sequence, for example, therefore, against non-coding regions of the target sequence having a regulatory function.
- the target sequence of the dsRNA used as nucleic acid molecule of the polymeric carrier cargo complex can therefore lie in the translated and untranslated region of the target sequence and/or in the region of the control elements of a protein or antigen described hereinbefore.
- the target sequence for a dsRNA used as the nucleic acid molecule of the polymeric carrier cargo complex can also lie in the overlapping region of untranslated and translated sequence; in particular, the target sequence can comprise at least one nucleotide upstream of the start triplet of the coding region, e.g. of a genomic DNA, a cDNA, a RNA, or an mRNA, etc.
- the nucleic acid molecule of the herein defined polymeric carrier cargo complex may be in the form of a(n) (immunostimulatory) CpG nucleic acid, in particular CpG-RNA or CpG-DNA, which preferably induces an innate immune response.
- a CpG-RNA or CpG-DNA used according to the invention can be a single-stranded CpG-DNA (ss CpG-DNA), a double-stranded CpG-DNA (dsDNA), a single-stranded CpG-RNA (ss CpG-RNA) or a double-stranded CpG-RNA (ds CpG-RNA).
- the CpG nucleic acid used according to the invention is preferably in the form of CpG-RNA, more preferably in the form of single-stranded CpG-RNA (ss CpG-RNA). Also preferably, such CpG nucleic acids have a length as described above. Preferably the CpG motifs are unmethylated.
- the CpG nucleic acid is not a CpG-DNA consisting of the sequence 5′TCCATGACGTTCCTGACGTT-3′ (SEQ ID NO: 123), in particular if the protein or peptide antigen is ovalbumin or a fragment of ovalbumin. In a further preferred embodiment, the CpG nucleic acid is not a sequence comprising SEQ ID NO: 123.
- the CpG nucleic acid is not a CpG-DNA.
- the polymeric carrier cargo complex does not comprise a CpG-DNA, preferably does not comprise a CpG nucleic acid.
- the pharmaceutical composition does not comprise a CpG-DNA, preferably does not comprise a CpG nucleic acid.
- the (immunostimulatory) nucleic acid molecule of the polymeric carrier cargo complex may be in the form of an immunostimulatory RNA (isRNA), which preferably elicits an innate immune response.
- an immunostimulatory RNA may be any (double-stranded or single-stranded) RNA, e.g. a coding RNA, as defined herein.
- the immunostimulatory RNA may be a single-stranded, a double-stranded or a partially double-stranded RNA, more preferably a single-stranded RNA, and/or a circular or linear RNA, more preferably a linear RNA.
- the immunostimulatory RNA may be a (linear) single-stranded RNA. Even more preferably, the immunostimulatory RNA may be a (long) (linear) single-stranded) non-coding RNA. In this context it is particular preferred that the isRNA carries a triphosphate at its 5′-end which is the case for in vitro transcribed RNA.
- An immunostimulatory RNA may also occur as a short RNA oligonucleotide as defined herein.
- An immunostimulatory RNA as used herein may furthermore be selected from any class of RNA molecules, found in nature or being prepared synthetically, and which can induce an innate immune response and may support an adaptive immune response induced by an antigen.
- an immune response may occur in various ways.
- a substantial factor for a suitable (adaptive) immune response is the stimulation of different T-cell sub-populations.
- T-lymphocytes are typically divided into two sub-populations, the T-helper 1 (Th1) cells and the T-helper 2 (Th2) cells, with which the immune system is capable of destroying intracellular (Th1) and extracellular (Th2) pathogens (e.g. antigens).
- the two Th cell populations differ in the pattern of the effector proteins (cytokines) produced by them.
- Th1 cells assist the cellular immune response by activation of macrophages and cytotoxic T-cells.
- Th2 cells promote the humoral immune response by stimulation of 6-cells for conversion into plasma cells and by formation of antibodies (e.g. against antigens).
- the Th1/Th2 ratio is therefore of great importance in the induction and maintenance of an adaptive immune response.
- the Th1/Th2 ratio of the (adaptive) immune response is preferably shifted in the direction towards the cellular response (Th1 response) and a cellular immune response is thereby induced.
- the innate immune system which may support an adaptive immune response, may be activated by ligands of Toll-like receptors (TLRs).
- TLRs are a family of highly conserved pattern recognition receptor (PRR) polypeptides that recognize pathogen-associated molecular patterns (PAMPs) and play a critical role in innate immunity in mammals.
- PRR pattern recognition receptor
- TLR1-TLR13 Toll-like receptors: TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, TLR11, TLR12 or TLR13
- TLR1-TLR13 Toll-like receptors: TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, TLR11, TLR12 or TLR13
- CpG DNA unmethylated bacterial DNA and synthetic analogs thereof
- ligands for certain TLRs include certain nucleic acid molecules and that certain types of RNA are immunostimulatory in a sequence-independent or sequence-dependent manner, wherein these various immunostimulatory RNAs may e.g. stimulate TLR3, TLR7, or TLR8, or intracellular receptors such as RIG-I, MDA-5, etc.
- these various immunostimulatory RNAs may e.g. stimulate TLR3, TLR7, or TLR8, or intracellular receptors such as RIG-I, MDA-5, etc.
- Lipford et al. determined certain G,U-containing oligoribonucleotides as immunostimulatory by acting via TLR7 and TLR8 (see WO 03/086280).
- the immunostimulatory G,U-containing oligoribonucleotides described by Lipford et al. were believed to be derivable from RNA sources including ribosomal RNA, transfer RNA, messenger RNA, and viral RNA.
- the immunostimulatory RNA (isRNA) used as the nucleic acid molecule of the herein defined polymeric carrier cargo complex may thus comprise any RNA sequence known to be immunostimulatory, including, without being limited thereto, RNA sequences representing and/or encoding ligands of TLRs, preferably selected from human family members TLR1-TLR10 or murine family members TLR1-TLR13, more preferably selected from (human) family members TLR1-TLR10, even more preferably from TLR7 and TLR8, ligands for intracellular receptors for RNA (such as RIG-I or MDA-5, etc.) (see e.g. Meylan, E., Tschopp, J. (2006).
- RNA sequences representing and/or encoding ligands of TLRs preferably selected from human family members TLR1-TLR10 or murine family members TLR1-TLR13, more preferably selected from (human) family members TLR1-TLR10, even more preferably from TLR7
- immunostimulatory RNA molecules used as the nucleic acid molecule of the polymeric carrier cargo complex may include any other RNA capable of eliciting an innate immune response.
- an immunostimulatory RNA may include ribosomal RNA (rRNA), transfer RNA (tRNA), messenger RNA (mRNA), and viral RNA (vRNA), preferably the immunostimulatory RNA is a non-coding RNA.
- Such an immunostimulatory RNA may comprise a length of 1000 to 5000, of 500 to 5000, of 5 to 5000, or of 5 to 1000, 5 to 500, 5 to 250, of 5 to 100, of 5 to 50 or of 5 to 30 nucleotides.
- such immunostimulatory nucleic acid sequence is preferably RNA preferably consisting of or comprising a nucleic acid sequence of formula (II) or (III):
- nucleotides when l>1 at least 50% of the nucleotides are guanosine or an analogue thereof;
- nucleic acids of formula (II) or (III), which may be used the nucleic acid cargo of the polymeric carrier cargo complex may be relatively short nucleic acid molecules with a typical length of approximately from 5 to 100 (but may also be longer than 100 nucleotides for specific embodiments, e.g. up to 200 nucleotides), from 5 to 90 or from 5 to 80 nucleotides, preferably a length of approximately from 5 to 70, more preferably a length of approximately from 8 to 60 and, more preferably a length of approximately from 15 to 60 nucleotides, more preferably from 20 to 60, most preferably from 30 to 60 nucleotides. If the nucleic acid of the nucleic acid cargo complex has a maximum length of e.g.
- nucleotides G in the nucleic acid of formula (II) is determined by l or n.
- a nucleotide adjacent to X m in the nucleic acid of formula (II) according to the invention is preferably not a uracil.
- the number of nucleotides C in the nucleic acid of formula (III) according to the invention is determined by l or n.
- a nucleotide adjacent to X m in the nucleic acid of formula (V) according to the invention is preferably not a uracil.
- l or n>1 at least 60%, 70%, 80%, 90% or even 100% of the nucleotides are guanosine or an analogue thereof, as defined above.
- the remaining nucleotides to 100% (when guanosine constitutes less than 100% of the nucleotides) in the flanking sequences G l and/or G n are uracil or an analogue thereof, as defined hereinbefore.
- l and n independently of one another, are each an integer from 2 to 30, more preferably an integer from 2 to 20 and yet more preferably an integer from 2 to 15.
- the lower limit of l or n can be varied if necessary and is at least 1, preferably at least 2, more preferably at least 3, 4, 5, 6, 7, 8, 9 or 10. This definition applies correspondingly to formula (III).
- nucleic acid according to any of formulas (II) or (III) above which may be used as nucleic acid of the polymeric carrier cargo complex, may be selected from a sequence consisting of or comprising any of the following sequences:
- such immunostimulatory nucleic acid sequences consist of or comprise a nucleic acid of formula (IV) or (V):
- the definition of bordering elements N u and N v is identical to the definitions given above for N u and N v .
- nucleic acid molecule according to formula (IV) comprises, preferably consists of, e.g. any of the following sequences:
- nucleic acid molecule according to formula (V) comprises, preferably consists of, e.g. any of the following sequences:
- nucleic acid sequence having at least 60%, preferably at least 70%, preferably at least 80%, more preferably at least 90%, and most preferably at least 95% identity to any of the above defined sequences.
- nucleic acid molecule of the herein defined polymeric carrier cargo complex may also occur in the form of a modified nucleic acid.
- the nucleic acid molecule of the herein defined polymeric carrier cargo complex may be provided as a “stabilized nucleic acid”, preferably as a stabilized RNA or DNA, more preferably as a RNA that is essentially resistant to in vivo degradation (e.g. by an exo- or endo-nuclease) as defined above.
- a stabilized nucleic acid preferably as a stabilized RNA or DNA, more preferably as a RNA that is essentially resistant to in vivo degradation (e.g. by an exo- or endo-nuclease) as defined above.
- the nucleic acid cargo of the herein defined polymeric carrier cargo complex may be modified as defined herein, and/or stabilized, especially if the nucleic acid molecule is in the form of a coding nucleic acid e.g. an mRNA, by modifying the G/C content of the nucleic acid molecule, particularly an mRNA, preferably of the coding region thereof as defined herein.
- a coding nucleic acid e.g. an mRNA
- Nucleic acid molecules used herein as cargo comprised in the polymeric carrier cargo complex as defined herein may be prepared using any method known in the art, including the methods for nucleic acid synthesis as defined herein.
- the present invention explicitly encloses variants and fragments of nucleic acid molecules as defined herein comprised as nucleic acid cargo in the polymeric carrier cargo complex.
- nucleic acid cargo molecules in the context of the present invention are nucleic acid molecules comprising, preferably consisting of, a nucleic acid sequence according to SEQ ID NO. 105 or 122 or a sequence which is at least 60%, preferably at least 70%, preferably at least 80%, more preferably at least 90%, and most preferably at least 95% identical to SEQ ID NO. 105 or 122.
- the cationic component of the polymeric carrier as defined herein and the nucleic acid cargo are typically provided in a molar ratio of about 1 to 10000, preferably in a molar ratio of about 5 to 5000, more preferably in a molar ratio of about 10 to 2500, even more preferably in a molar ratio of about 25 to 2000, and most preferably in a molar ratio of about 25 to 1000 of polymeric carrier to nucleic acid.
- the cationic component of the polymeric carrier as defined herein and the nucleic acid cargo are preferably provided in an N/P-ratio of at least 0.1, 0.2, 0.3, 0.4, 0.5, 0.75, 1, 1.5 or 2.
- the N/P-ratio lies within a range of about 0.1, 0.3, 0.4, 0.5, 0.75, 1.0, 1.5 or 2 to 20, preferably in a range of about 0.2 (0.5 or 0.75 or 1.0) to 12, more preferably in an N/P-ratio of about 0.4 (0.75 or 1.0) to 10, and even more preferably in an N/P ratio of about 0.4 (0.75 or 1.0) to 5.
- the N/P ratio lies in a ratio between 0.1 and 0.9.
- the N/P ratio is a measure of the ionic charge of the cationic (side chain) component of the polymeric carrier or of the polymeric carrier as such.
- the N/P ratio expresses the ratio of basic nitrogen atoms to phosphate residues in the nucleotide backbone, considering that (side chain) nitrogen atoms in the cationic component of the polymeric carrier contribute to positive charges and phosphate of the phosphate backbone of the nucleic acid contribute to the negative charge.
- one phosphate provides one negative charge, e.g. one nucleotide in the cargo nucleic acid molecule provides one negative charge.
- the N/P-ratio is defined as the nitrogen/phosphate ratio (N/P-ratio) of the entire inventive polymeric carrier cargo complex. This is typically illustrative for the content/amount of cationic components, in the polymeric carrier and characteristic for the content/amount of nucleic acids bound or complexed in the inventive polymeric carrier cargo complex. It may be calculated on the basis that, for example, 1 ⁇ g RNA typically contains about 3 nmol phosphate residues, provided that RNA exhibits a statistical distribution of bases. Additionally, 1 nmol peptide typically contains about x nmol nitrogen residues, dependent on the molecular weight and the number of its (cationic) amino acids.
- the cationic component of the polymeric carrier as defined herein and the nucleic acid cargo are provided in an N/P-ratio of at least about 1 or, preferably, of a range of about 1 to 20 for in vitro applications (e.g. in the case cells extracted from the patient would be treated in vitro with the inventive pharmaceutical composition and subsequently administered to the patient).
- an N/P ratio of at least 0.1 (0.2, 0.3, 0.4, 0.5, 0.6), preferably of a range of about 0.1 (0.2, 0.3, 0.4., 0.5, or 0.6) to 1.5 is preferred. Even more preferred is an N/P ratio range of 0.1 or 0.2 to 0.9 or an N/P ratio range of 0.5 to 0.9.
- an N/P ratio of at least 0.1 (0.2, 0.3, 0.4, 0.5, or 0.6) or an N/P ratio range of 0.1 to 1 is preferred or more preferred is an N/P ratio range of 0.1 or 0.2 to 0.9 or an N/P ratio range of 0.5 to 0.9. Otherwise, if the induction of TNF ⁇ would be intended, an N/P ratio of 1 to 20 is particularly preferred.
- the N/P ratio significantly influences the surface charge of the resulting polymeric carrier cargo complex.
- the resulting polymeric carrier cargo complex is positively charged for in vitro applications and negatively or neutrally charged for in vivo applications.
- the surface charge of the resulting polymeric carrier cargo complex can be indicated as Zetapotential which may be measured by Doppler electrophoresis method using a Zetasizer Nano (Malvern Instruments, Malvern, UK).
- an N/P ratio of below 1 results in a negative Zetapotential
- an N/P ratio of above 1 results in a positive Zetapotential (within the scope of typical measurement errors).
- the surface charge of the polymeric carrier cargo complex preferably the Zetapotential
- the surface charge of the polymeric carrier cargo complex is positive, i.e. above 0 mV, such as above 1 mV, above 2 mV, above 4 mV, above 5 mV, or above 10 mV.
- the surface charge of the polymeric carrier cargo complex preferably the Zetapotential, is negative, i.e.
- below 0 mV such as below ⁇ 1 mV, below ⁇ 2 mV, below ⁇ 4 mV, below ⁇ 5 mV, or below ⁇ 10 mV, such as between about ⁇ 1 mV and ⁇ 50 mV, between about ⁇ 2 mV and ⁇ 40 mV, or between about ⁇ 5 mV and ⁇ 30 mV.
- the polymeric carrier cargo complex as used in the present invention is preferably capable of triggering a non-antigen-specific, (innate) immune reaction (as provided by the innate immune system), preferably in an immunostimulating manner.
- innate immune reaction as provided by the innate immune system
- An immune reaction can generally be brought about in various ways.
- An important factor for a suitable immune response is the stimulation of different T-cell sub-populations.
- T-lymphocytes typically differentiate into two sub-populations, the T-helper 1 (Th1) cells and the T-helper 2 (Th2) cells, with which the immune system is capable of destroying intracellular (Th1) and extracellular (Th2) pathogens (e.g. antigens).
- Th1 cells assist the cellular immune response by activation of macrophages and cytotoxic T-cells.
- Th2 cells promote the humoral immune response by stimulation of B-cells for conversion into plasma cells and by formation of antibodies (e.g. against antigens).
- the Th1/Th2 ratio is therefore of great importance in the immune response.
- the Th1/Th2 ratio of the immune response is preferably displaced by the immune-stimulating agent, in particular the polymeric carrier cargo complex, in the direction towards the cellular response, that is to say the Th1 response, and a predominantly cellular immune response is thereby induced.
- the polymeric carrier cargo complex can induce an unspecific innate immune response, which may allow the support of a specific adaptive immune response elicited by the antigen.
- an immunostimulating agent or adjuvant in particular of a polymeric carrier cargo complex as used in the present invention
- several methods are known in the art and may be used.
- in vitro methods are advantageous to utilise for compounds as to their capacity to induce cytokines, which are (exclusively or at least typically) part of the innate immune system and thereby (as an additional arm of the immune system) typically improve the induction of an antigen-specific immune response caused by an antigen.
- cytokines which are (exclusively or at least typically) part of the innate immune system and thereby (as an additional arm of the immune system) typically improve the induction of an antigen-specific immune response caused by an antigen.
- PBMCs may be isolated from blood samples and stimulated with the particular immunostimulating agent or adjuvant. After incubation, secretion of the desired cytokines (e.g.
- cytokines may be used in the art as determinants of the induction of an innate immune response in the body.
- the secretion of TNF-alpha and IFN-alpha is preferably measured to determine the unspecific (innate immune response) evoked by a compound or complex.
- IFN-alpha plays an important role in the induction of an unspecific immune response after viral infection and can be used as an indicators of induction of a Th1-shifted adaptive immune response, which is particularly preferred in the context of the treatment of cancer or tumour diseases.
- the immunostimulatory compound or complex tested in the screening assay induces the secretion of e.g. IFN-alpha.
- a compound or complex may then be applied e.g. for the use as an immunotimualting agent (triggering the unspecific (innate) immune response) in vaccination therapies.
- IFN-alpha is part of the family of type I interferons.
- Type I interferons are pleiotropic cytokines that are essential for supporting anti-viral immune responses. They induce apoptosis of virus-infected cells and cellular resistance to viral infection, in addition to activating natural killer (NK) and T cells.
- Type I interferons have effects on a large set of cytokines and chemokines that i.a. influence immunocyte maturation, homing, effector functions and apoptosis.
- a major role of IFN-alpha is the induction of a priming state affecting the production and regulation of other mediators, including cytokines.
- IFN-alpha ⁇ signaling upregulates IFN-alpha ⁇ production by dendritic cells (DCs) and T cells and thereby favours the induction and maintenance of Th1 cells. Shifting of an immune response in direction of a Th1 immune response may become particularly important, once protein or peptide vaccines are used, because these vaccines usually induce a Th2-based immune response which consequently prevents or decreases the induction of cytotoxic T cells.
- DCs dendritic cells
- T cells dendritic cells
- Th1 immune response may become particularly important, once protein or peptide vaccines are used, because these vaccines usually induce a Th2-based immune response which consequently prevents or decreases the induction of cytotoxic T cells.
- a compound or complex to be used as an adjuvant in the context of the present invention may preferably have the property of shifting an antigen-specific immune response caused by a antigen to a Th1-based immune response.
- the direction of an immune response induced by an antigen is usually measured by determination of the induction of several subtypes of antigen-specific antibodies and the induction of antigen-specific cytotoxic CD8 + T cells.
- the subtype antibody IgG1 represents the induction of a Th2-based immune response
- the induction of the subtype antibody IgG2a and the induction of cytotoxic T cells represent the induction of a Th1-based immune response.
- the induction of antigen-specific antibodies is typically determined by measurement of the antibody titer in the blood of the vaccine by ELISA.
- the induction of antigen-specific cytotoxic T cells is typically determined by measurement of IFN-gamma secretion in splenocytes after stimulation with antigen-specific peptides by ELISPOT.
- IFN-gamma secretion provides evidence that antigen-specific cytotoxic T cells are present in the spleen and which can specifically attack cells that present epitopes of the antigen on MHC I molecules on their surface.
- the adjuvant or immunostimulatory compound or complex improves an antigen-specific immune response caused by the vaccine and, furthermore, if it can shift an antigen-specific immune response in the desired direction to display adjuvant properties.
- the induction of an anti-tumoral immune response the induction of a Th1-shifted immune response, especially the induction of cytotoxic T cells is believed to play a major role, because the induction of antigen-specific cytotoxic T cells are believed to represent an indispensable prerequisite for the successful combat of a tumour.
- the present invention relates to a method of preparing a pharmaceutical composition of the invention, said method comprising the steps of: (i) providing at least one polymeric carrier cargo complex as defined anywhere herein; (ii) providing an antigen as defined anywhere herein; and (iii) combining said polymeric carrier cargo complex and said antigen.
- the combining step of (iii) may occur briefly before administration to a patient (such as about 1, 5, 15, 30 or 60 minutes prior to, up to 72 hours before, said administration), or may occur during manufacture of said pharmaceutical composition.
- the respective person of ordinary skill e.g. a doctor or health professional, or a manufacturer
- a method of preparing the polymeric carrier cargo complex as defined herein may comprise the following steps:
- the method of preparing the polymeric carrier cargo complex as described herein may comprise a multi-step condensation polymerization or polycondensation reaction via —SH moieties of the educts e.g. cationic peptides or polymers as defined herein and optionally further amino acid components (AA) in step c).
- the condensation polymerization or polycondensation reaction which occurs simultaneously to the complexation or electrostratic binding of the nucleic acid molecule preferably leads to the polymeric carrier cargo complex wherein the polymeric carrier is a condensation polymer, wherein the single components are linked by disulfide bonds.
- At least one cationic or polycationic protein or peptide as defined herein and/or at least one cationic or polycationic polymer as defined herein are provided, preferably in the ratios indicated above.
- step c) these components are mixed in step c) with the nucleic acid molecule provided in step b), preferably in a basic or neutral milieu as defined herein, preferably in the presence of oxygen or a further starter as defined herein, preferably at a pH, and at a temperature and at a time as defined herein, and thereby condensing and thus polymerizing these components with each other via disulfide bonds (in a polymerization condensation or polycondensation) to obtain a polymeric carrier complexed to the nucleic acid molecule as defined herein.
- step a) of the method of preparing the polymeric carrier cargo complex at least one cationic or polycationic protein or peptide and/or at least one cationic or polycationic polymer are provided as defined herein, and optionally at least one amino acid component (AA), are provided in step a) as defined herein, and are used for a polymerization condensation or polycondensation and complexation reaction prior to adding the nucleic acid of step b) but using the same polymerization conditions outlined for step c).
- the polymerized polymeric carrier and the nucleic acid of step b) are then mixed in step c).
- the components are all provided in the ratios indicated above and mixed, preferably in a basic or neutral milieu as defined herein, preferably in the presence of oxygen or a further starter as defined herein, preferably at a pH, at a temperature and at time as defined herein.
- the components are condensed and thus polymerized with each other via disulfide bonds (in a polymerization condensation or polycondensation) to obtain a polymeric carrier complexed to the nucleic acid molecule as defined herein.
- different polymeric carriers particularly different peptides and/or different polymers, may be selected in the condensation polymerization as indicated above.
- the selection of different component(s) of the polymeric carrier is typically dependent upon the desired properties of the final polymeric carrier and the desired cationic strength of the final polymeric carrier.
- the content of cationic components may furthermore be “diluted” or modified in the above alternative of step a) e.g. by introducing an amino acid component (AA) as defined herein, preferably in the above defined ratios.
- AA amino acid component
- a modified polymeric carrier may be obtained, wherein the cationic character of the unmodified polymeric carrier typically remains in the limitations as defined herein.
- the properties of the final polymeric carrier may thus be adjusted as desired with properties of components (AA) by inserting amino acid component (AA) as defined herein in steps a).
- the at least one cationic or polycationic protein or peptide as defined herein and/or at least one cationic or polycationic polymer as defined herein, and optionally at least one amino acid component (AA) and the at least one nucleic acid as defined herein are preferably contained in a basic or neutral milieu in the step a) of the inventive method of preparing the inventive polymeric carrier cargo complex.
- a basic or neutral milieu typically exhibits a pH range of about 5 to about 10, preferably a pH range of about 6 to about 9, more preferably a pH range of about 7 to about 8, e.g. about 6.5, 7, 7.5, 8, 8.5, or 9 or any range selected from any two of these or the aforementioned values.
- the temperature of the solution in step c) is preferably in a range of about 5° C. to about 60° C., more preferably in a range of about 15° C. to about 40° C., even more preferably in a range of about 20° C. to about 30° C., and most preferably in a range of about 20° C. to about 25° C., e.g. about 25° C.
- buffers may be used as suitable.
- Preferred buffers may comprise, but are not limited to, preferably are selected from carbonate buffers, borate buffers, Bicine buffer, CHES buffer, CAPS buffer, Ethanolamine containing buffers, HEPES, MOPS buffer, Phosphate buffer, PIPES buffer, Tris buffer, Tricine buffer, TAPS buffer, and/or TES buffer as buffering agents.
- Particularly preferred is a carbonate buffer.
- the condensation polymerization or polycondensation reaction and the complexation of the at least one nucleic acid molecule is started.
- the mixture in step c) is preferably exposed to oxygen or may be started using a further starter, e.g. a catalytic amount of an oxidizing agent, e.g. DMSO, etc.
- condensation polymerization or polycondensation reaction of the at least one cationic or polycationic protein or peptide and/or at least one cationic or polycationic polymer and optionally at least one amino acid component (AA) as defined herein are condensed and thus polymerized with each other via disulfide bonds (polymerization condensation or polycondensation).
- AA amino acid component
- AA amino acid component
- components with more than one, preferably two free —SH-moieties may be used, which may lead to branched polymers.
- Simultaneously to the polymerization reaction the cationic polymers bind to the at least one nucleic acid molecule and thereby complexing it.
- the polymeric carrier cargo complex additionally may be modified with a component (AA) as defined herein.
- a component (AA) (e.g. a ligand) is attached to the cationic component prior to providing the cationic component in step a) via any functionality as defined herein, e.g. a —SH moiety.
- This component (AA) or (e.g. a ligand) is preferably attached to the cationic component at one terminus of these components. If the attachment is carried out via —SH bonds, the cationic components are preferably provided with two (or even more) —SH-moieties.
- the component (AA) or (e.g. a ligand) preferably carries only one —SH moiety.
- one —SH moiety of the cationic component is preferably protected in a first step using a protecting group as known in the art. Then, the cationic component may be bound to a component L to form a first disulfide bond via the non-protected —SH moiety. The protected —SH-moiety of the cationic component is then typically deprotected for further reactions.
- the above mentioned component (AA) or (e.g. a ligand) may be used in step c) to be coupled with the cationic components provided in step a) above, e.g. via disulfide bonds without blocking the free —SH moieties.
- a ligand e.g. a ligand
- all methods known to a skilled person or defined herein may be used to attach the component (AA) to the cationic component or to the polymeric carrier.
- a component (AA) or (e.g. a ligand) can be bound to the polymeric carrier cargo complex after step c) via any functionality as defined herein, e.g. a —SH moiety.
- the component (AA) e.g. a ligand
- the component (AA) is bound via free —SH moieties of the polymeric carrier components.
- step c) of the method of preparing the polymeric carrier cargo complex as described herein at least one nucleic acid molecule as defined herein is mixed with the cationic components provided in step b), preferably in the above mentioned ratios.
- the cationic components as defined herein, and the at least one nucleic acid molecule are provided in a molar ratio of about 5 to 10000, preferably in a molar ratio of about 5 to 5000, more preferably in a molar ratio of about 10 to 2500, even more preferably in a molar ratio of about 10 to 1000 cationic polymer to nucleic acid.
- the N/P ratios are preferably as indicated above. In this context, it is particularly preferred that the N/P ratios are selected thereby avoiding agglomeration and toxicity in vivo.
- (AA) components as defined above which do not comprise —SH moieties can be added in step c) which are thereby incorporated into the polymeric carrier cargo complex without polymerization by (terminal) —SH moieties.
- these (AA) components are typically not covalently linked and included non-covalently in the complex as a further component.
- Particularly preferred in this context is the incorporation of the at least one antigen or a fragment, variant and/or derivative thereof, provided as protein or peptide in the polymeric carrier cargo complex as (AA) component. This embodiment is particularly preferred if AA is ovalbumin or a fragment of ovalbumin.
- AA is ovalbumin or a fragment thereof, AA is not covalently linked to the polymeric carrier cargo complex, for example, AA is not covalently linked to the polymeric carrier cargo complex by disulfide bonds.
- the polymeric carrier cargo complex obtained according to step c) is optionally purified. Purification may occur by using chromatographic methods, such as HPLC, FPLC, GPS, dialysis, etc.
- the polymeric carrier cargo complex obtained according to step c) or d) is optionally lyophilized.
- any suitable cryoprotectant or lyoprotectant may be added to the polymeric carrier cargo complex obtained in step c) or d).
- the method of preparing the polymeric carrier cargo complex as defined herein is particularly suitable to adapt the chemical properties of the desired polymeric carrier cargo complex due to specific selection of its components of the polymeric carrier thereby avoiding agglomeration and toxicity in vivo.
- the inventive pharmaceutical′ composition comprises at least one antigen selected from an antigen from a pathogen associated with infectious disease; an antigen associated with allergy or allergic disease; an antigen associated with autoimmune disease; or an antigen associated with a cancer or tumour disease, or in each case a fragment, variant and/or derivative of said antigen.
- This at least one antigen can be provided as protein or peptide, as nucleic acid coding for the at least one antigen, or as antigenic cells, antigenic cellular fragments, cellular fractions; cell wall components modified, attenuated or inactivated (e.g. chemically or by irradiation) pathogens (virus, bacteria etc.) comprising the at least one antigen.
- the antigen included as a second ingredient in the pharmaceutical composition is a peptide or protein antigen, or a fragment, variant and/or derivative of said peptide or protein antigen.
- Antigens from a pathogen associated with infectious disease are derived from a pathogen which is associated with the induction of an infectious disease.
- said antigen is a peptide or protein antigen, or a fragment, variant and/or derivative of said peptide or protein antigen, and/or is comprised in, provided as and/or derived from (e.g. a preparation of) inactivated or attenuated said pathogen, (e.g. a virus such as any one described herein).
- the (e.g. peptide or protein) antigen may be comprised in provided as and/or derived from (e.g. a preparation of) an attenuated or inactivated pathogen (e.g. a virus such as any one described herein) associated with infectious disease.
- an antigen e.g. a peptide or protein antigen used in the present invention is not one comprised in (e.g. a preparation of) inactivated or attenuated virus (such as any one described herein, or any pathogen described herein); and/or is one that is not provided as (e.g. a preparation of) inactivated or attenuated said virus or pathogen; and/or is one that is not derived from (e.g. a preparation of) inactivated or attenuated said virus or pathogen.
- the antigen used in any aspect of the present invention may be, or may be provided as, an isolated and/or purified protein or peptide antigen.
- an isolated (and/or purified) antigen includes such antigens that are present (or provided) in a (starting) composition that has less than about 40%, 30%, 20%, 10%, 5%, 2% or 1% non-desired or specified other components such as other proteins/peptides or impurities.
- the (e.g. protein or peptide) antigen used in the present invention is a recombinant antigen, for example one that is prepared using recombinant production, such as using those methodologies described herein.
- the (e.g. protein or peptide) antigen used in the present invention is a synthetic antigen, for example one that is prepared using peptide synthesis, such as using those methodologies described herein.
- Antigens from a pathogen associated with infectious disease are selected from antigens from the pathogens Acinetobacter baumannii, Anaplasma genus, Anaplasma phagocytophilum, Ancylostoma braziliense, Ancylostoma duodenale, Arcanobacterium haemolyticum, Ascaris lumbricoides, Aspergillus genus, Astroviridae, Babesia genus, Bacillus anthracis, Bacillus cereus, Bartonella henselae , BK virus, Blastocystis hominis, Blastomyces dermatitidis, Bordetella pertussis, Borrelia burgdorferi, Borrelia genus, Borrelia spp, Brucella genus, Brugia malayi , Bunyaviridae family, Burkholderia cepacia and other Burkholderia species, Burkholderia mallei, Burkholderia
- antigens from the pathogens selected from Rabies virus, Hepatitis B virus, human Papilloma virus (hPV), Bacillus anthracis , respiratory syncytial virus (RSV), herpes simplex virus (HSV), Influenza virus and Mycobacterium tuberculosis.
- the antigen from a pathogen associated with infectious disease may be selected from the following antigens: Outer membrane protein A OmpA, biofilm associated protein Bap, transport protein MucK ( Acinetobacter baumannii, Acinetobacter infections)); variable surface glycoprotein VSG, microtubule-associated protein MAPP15, trans-sialidase TSA ( Trypanosoma brucei , African sleeping sickness (African trypanosomiasis)); HIV p24 antigen, HIV Eenvelope proteins (Gp120, Gp41, Gp160), polyprotein GAG, negative factor protein Nef, trans-activator of transcription Tat (HIV (Human immunodeficiency virus), AIDS (Acquired immunodeficiency syndrome)); galactose-inhibitable adherence protein GIAP, 29 kDa antigen Eh29, GaVGaINAc lectin, protein CRT, 125 kDa immunodominant antigen, protein M17, adhesin ADH112, protein
- antigens of pathogens associated with infectious disease are particularly preferred:
- one further class of antigens comprises allergenic antigens.
- allergenic antigens may be selected from antigens derived from different sources, e.g. from animals, plants, fungi, bacteria, etc.
- Sources of allergens in this context include e.g. grasses, pollens, molds, drugs, or numerous environmental triggers, etc.
- Allergenic antigens typically belong to different classes of compounds, such as nucleic acids and their fragments, proteins or peptides and their fragments, carbohydrates, polysaccharides, sugars, lipids, phospholipids, etc.
- protein or peptide antigens and their fragments or epitopes or nucleic acids and their fragments, particularly nucleic acids and their fragments, encoding such protein or peptide antigens and their fragments or epitopes.
- said antigen is a peptide or protein antigen, or a fragment, variant and/or derivative of said peptide or protein antigen, such as a peptide or protein antigen comprised in a preparation extracted from said source.
- a peptide or protein antigen used in the present invention is not one comprised in a preparation extracted from said source, and/or is one that is not obtained from a preparation extracted from said source.
- Antigens associated with allergy or allergic disease are preferably derived from a source selected from the list consisting of:
- Acarus spp (Aca s 1, Aca s 10, Aca s 10.0101, Aca s 13, Aca s 13.0101, Aca s 2, Aca s 3, Aca s 7, Aca s 8), Acanthocybium spp (Aca so 1), Acanthocheilonema spp (Aca v 3, Aca v 3.0101), Acetes spp (Ace ja 1), Actinidia spp (Act a 1, Act c 1, Act c 10, Act c 10.0101, Act c 2, Act c 4, Act c 5, Act c 5.0101, Act c 8, Act c 8.0101, Act c Chitinase, Act d 1, Act d 1.0101, Act d 10, Act d 10.0101, Act d 10.0201, Act d 11, Act d 11.0101, Act d 2, Act d 2.0101, Act d 3, Act d 3.0101, Act d 3.02, Act d 4, Act d 4.0101,
- brackets indicate the particular preferred allergens from the particular source.
- the antigen associated with allergy or allergic disease is preferably derived from a source selected from the list consisting of grass pollen (e.g. pollen of rye), tree pollen (e.g. pollen of hazel, birch, alder, ash), flower pollen, herb pollen (e.g. pollen of mugwort), dust mite (e.g. Der f 1, Der p 1, Eur m 1, Der m 1 Der f 2, Der p 2, Eur m 2, Tyr p 2, Lep d 2), mold (e.g.
- food e.g. allergens of fish (e.g. bass, cod, flounder), seafood (e.g. crab, lobster, shrimps), egg, wheat, nuts (e.g. peanuts, almonds, cashews
- Antigens associated with autoimmune disease are preferably selected from autoantigens asscociated with autoimmune diseases selected from Addison disease (autoimmune adrenalitis, Morbus Addison), alopecia areata, Addison's anemia (Morbus Biermer), autoimmune hemolytic anemia (AIHA), autoimmune hemolytic anemia (AIHA) of the cold type (cold hemagglutinine disease, cold autoimmune hemolytic anemia (AIHA) (cold agglutinin disease), (CHAD)), autoimmune hemolytic anemia (AIHA) of the warm type (warm AIHA, warm autoimmune haemolytic anemia (AIHA)), autoimmune hemolytic Donath-Landsteiner anemia (paroxysmal cold hemoglobinuria), antiphospholipid syndrome (APS), atherosclerosis, autoimmune arthritis, arteriitis temporalis, Takayasu arteriitis (Takayasu's disease, aortic arch disease), temporal arteriitis/giant cell arteriitis,
- autoantigens selected from:
- said antigen is associated with the respective autoimmune disease, like e.g. IL-17, heat shock proteins, and/or any idiotype pathogenic T cell or chemokine receptor which is expressed by immune cells involved in the autoimmune response in said autoimmune disease (such as any autoimmune diseases described herein).
- autoimmune disease like e.g. IL-17, heat shock proteins, and/or any idiotype pathogenic T cell or chemokine receptor which is expressed by immune cells involved in the autoimmune response in said autoimmune disease (such as any autoimmune diseases described herein).
- Tumour Antigens Associated with a Cancer or Tumour Disease
- Tumour antigens in this context are antigens which are preferably located on the surface of the (tumour) cell. Tumour antigens may also be selected from proteins, which are overexpressed in tumour cells compared to a normal cell. Furthermore, tumour antigens also include antigens expressed in cells which are (were) not themselves (or originally not themselves) degenerated but are associated with the supposed tumour. Antigens which are connected with tumour-supplying vessels or (re)formation thereof, in particular those antigens which are associated with neovascularization, e.g. growth factors, such as VEGF, bFGF etc., are also included herein. Antigens connected with a tumour furthermore include antigens from cells or tissues, typically embedding the tumour.
- tumour antigens are expressed in patients suffering (knowingly or not-knowingly) from a cancer disease and they occur in increased concentrations in the body fluids of said patients. These substances are also referred to as “tumour antigens”, however they are not antigens in the stringent meaning of an immune response inducing substance.
- the class of tumour antigens can be divided further into tumour-specific antigens (TSAs) and tumour-associated-antigens (TAAs).
- TSAs can only be presented by tumour cells and never by normal “healthy” cells. They typically result from a tumour specific mutation.
- TAAs which are more common, are usually presented by both tumour and healthy cells.
- tumour antigens can also occur on the surface of the tumour in the form of, e.g., a mutated receptor. In this case, they can be recognized by antibodies.
- Particular preferred tumour antigens are selected from the group consisting of 5T4, 707-AP, 9D7, AFP, AlbZIP HPG1, alpha-5-beta-1-integrin, alpha-5-beta-6-integrin, alpha-actinin-4/m, alpha-methylacyl-coenzyme A racemase, ART-4, ARTC1/m, B7H4, BAGE-1, BCL-2, bcr/abl, beta-catenin/m, BING-4, BRCA1/m, BRCA2/m, CA 15-3/CA 27-29, CA 19-9, CA72-4, CA125, calreticulin, CAMEL, CASP-8/m, cathepsin B, cathepsin L, CD19, CD20, CD22, CD25, CDE30, CD33, CD4, CD52,
- tumour antigens preferably may be selected from the group consisting of p53, CA125, EGFR, Her2/neu, hTERT, PAP, MAGE-A1, MAGE-A3, Mesothelin, MUC-1, NY-ESO-1, GP100, MART-1, Tyrosinase, PSA, PSCA, PSMA VEGF, VEGFR1, VEGFR2, Ras, CEA or WT1, and more preferably from PAP, NY-ESO-1, MAGE-A3, WT1, and MUC-1.
- the antigen associated with a cancer or tumour disease does not include (x) an idiotype immunoglobulin (an idiotype antibody or an idiotype B cell receptor); or (y) an idiotype T cell receptor, and optionally is not a fragment, variant and/or derivative of such antigen.
- the at least one antigen if provided as protein or peptide antigen is in certain embodiments not the model antigen Ovalbumine or a fragment of Ovalbumine, such as the Ovalbumine derived peptide SIINFEKL (SEQ ID NO: 116).
- the at least one antigen in the inventive pharmaceutical composition can be provided as protein or peptide or can be encoded by a nucleic acid, e.g. a DNA (e.g. a plasmid DNA or viral DNA), or an RNA (e.g. an mRNA or a viral RNA).
- a nucleic acid e.g. a DNA (e.g. a plasmid DNA or viral DNA), or an RNA (e.g. an mRNA or a viral RNA).
- the at least one antigen is provided as a protein or peptide, or a fragment, variant and/or derivative of said protein or peptide antigen.
- said protein or peptide antigen (or fragment, variant and/or derivative of said protein or peptide antigen) is comprised in, provided as or derived from a defined sample, for example a sample having a known number and or composition of components.
- said protein or peptide antigen is not comprised in; or is not provided as; or is not derived from, in each case a mixture of (e.g. undefined) other components, such as a mixture being a preparation of inactivated or attenuated virus or pathogen (such as, in either case, any one describe herein).
- the antigen used in any aspect of the present invention may be, or may be provided as, an isolated and/or purified protein or peptide antigen.
- an isolated (and/or purified) antigen includes such antigens that are present (or provided) in a (starting) composition that has less than about 40%, 30%, 20%, 10%, 5%, 2% or 1% non-desired or specified other components such as other proteins/peptides or impurities.
- Protein or peptide antigens can, for example, be prepared as follows.
- Protein or peptide antigens as described above can be prepared using recombinant production methods, such as those described herein, or e.g. with the aid of molecular biology methods known to the person of ordinary skill. Such an antigen can be described, as applicable, as a “recombinant protein antigen” and/or a “recombinant peptide antigen”.
- a protein or peptide as described above can be prepared using peptide synthesis methods such as those described herein, or e.g. with other methodologies known to the person of ordinary skill.
- peptide synthesis methods such as those described herein, or e.g. with other methodologies known to the person of ordinary skill.
- an antigen can be described, as applicable, as a “synthetic protein antigen” and/or a “synthetic peptide antigen”.
- the at least one antigen is provided as protein or peptide antigen (or a fragment, variant and/or derivative thereof)
- the peptide or protein antigen can be provided in a first alternative in a separate component of the inventive pharmaceutical composition.
- the at least one protein or peptide antigen is not part of the polymeric carrier cargo complex or in other words: in this case the polymeric carrier cargo complex does not include the at least one antigen.
- the at least one protein or peptide antigen can be provided as component of the polymeric carrier cargo complex.
- the peptide or protein antigen can be added to the polymeric carrier cargo complex during the polymerization step c) of the method of preparing of the polymeric carrier cargo complex as described herein.
- the peptide or protein antigen is integrated in the polymeric carrier cargo complex.
- the peptide or protein antigen bears at least one SH-moiety for polymerization with the other components of the polymeric carrier in the polymeric carrier cargo complex.
- a protein or peptide antigen is provided as component of the polymeric carrier of the polymeric carrier cargo complex and at least one additional protein or peptide antigen (the same or a different) is provided in a separate component of the inventive pharmaceutical composition which is not part of the polymeric carrier cargo complex.
- the at least one antigen (or a fragment, variant and/or derivative thereof) can be provided in the inventive pharmaceutical composition in the form of nucleic acids coding for the at least one antigen (or fragments, variants and/or derivatives thereof).
- nucleic acids coding for the at least one antigen are defined as disclosed above for the nucleic acid cargo comprised in the polymeric carrier cargo complex used as an adjuvant in the inventive pharmaceutical composition. Therefore, also fragments, variants, derivatives and modifications of a nucleic acid as defined herein are explicitly encompassed.
- the at least one antigen (or a fragment, variant and/or derivative thereof) if provided in the inventive pharmaceutical composition in the form of nucleic acids coding for the at least one antigen (or fragments, variants and/or derivatives thereof), can be prepared with all methods for nucleic acid synthesis known for a skilled person. Particularly preferred are methods for nucleic acid synthesis as defined herein.
- the first alternative provides the nucleic acid coding for the at least one antigen as part of the polymeric carrier cargo complex (e.g. as nucleic acid cargo molecule) and the second alternative provides the nucleic acid coding for the at least one antigen as separate component of the inventive pharmaceutical composition.
- the nucleic acid coding for the at least one antigen is not part of the polymeric carrier cargo complex.
- the at least one antigen (or a fragment, variant and/or derivative thereof) coded by a nucleic acid can be provided as part of the (adjuvant) polymeric carrier cargo complex (e.g. as nucleic acid cargo coding for the at least one antigen) and additionally an antigen coded by a nucleic acid can be provided in a separate component which is not part of the polymeric carrier cargo complex.
- the invention further provides the alternative that at least one antigen is provided as a nucleic acid (as part of the polymeric carrier cargo complex or not) and that at least one additional antigen is provided as protein or peptide antigen (as part of the polymeric carrier cargo complex or not).
- the at least one antigen if provided as protein or peptide or as a nucleic acid coding for the at least one antigen may further comprise or code for a signal peptide as defined herein.
- the pharmaceutical composition may comprise at least one additional pharmaceutically active component.
- a pharmaceutically active component in this connection is a compound that has a therapeutic effect to heal, ameliorate or prevent a particular indication, preferably tumour or cancer diseases, autoimmune disease, allergies or infectious diseases.
- Such compounds include, without implying any limitation, peptides or proteins, preferably as defined herein, nucleic acids, preferably as defined herein, (therapeutically active) low molecular weight organic or inorganic compounds (molecular weight less than 5000, preferably less than 1000), sugars, antigens or antibodies, preferably as defined herein, therapeutic agents already known in the prior art, antigenic cells, antigenic cellular fragments, cellular fractions; cell wall components (e.g. polysaccharides), modified, attenuated or de-activated (e.g. chemically or by irradiation) pathogens (virus, bacteria etc.), adjuvants, preferably as defined herein, etc.
- cell wall components e.g. polysaccharides
- the inventive pharmaceutical composition may comprise a pharmaceutically acceptable carrier and/or vehicle.
- a pharmaceutically acceptable carrier typically includes the liquid or non-liquid basis of the pharmaceutical composition. If the pharmaceutical composition is provided in liquid form, the carrier will typically be pyrogen-free water; isotonic saline or buffered (aqueous) solutions, e.g phosphate, citrate etc. buffered solutions.
- the injection buffer may be hypertonic, isotonic or hypotonic with reference to the specific reference medium, i.e.
- the buffer may have a higher, identical or lower salt content with reference to the specific reference medium, wherein preferably such concentrations of the afore mentioned salts may be used, which do not lead to damage of cells due to osmosis or other concentration effects.
- Reference media are e.g. liquids occurring in “in vivd” methods, such as blood, lymph, cytosolic liquids, or other body liquids, or e.g. liquids, which may be used as reference media in “in vitro” methods, such as common buffers or liquids. Such common buffers or liquids are known to a skilled person.
- compatible solid or liquid fillers or diluents or encapsulating compounds may be used as well for the pharmaceutical composition, which are suitable for administration to a patient to be treated.
- the term “compatible” as used here means that these constituents of the pharmaceutical composition are capable of being mixed with the polymeric carrier cargo complex as defined herein in such a manner that no interaction occurs which would substantially reduce the pharmaceutical effectiveness of the pharmaceutical composition under typical use conditions.
- Pharmaceutically acceptable carriers, fillers and diluents must, of course, have sufficiently high purity and sufficiently low toxicity to make them suitable for administration to a person to be treated.
- Some examples of compounds which can be used as pharmaceutically acceptable carriers, fillers or constituents thereof are sugars, such as, for example, lactose, glucose and sucrose; starches, such as, for example, corn starch or potato starch; cellulose and its derivatives, such as, for example, sodium carboxymethylcellulose, ethylcellulose, cellulose acetate; powdered tragacanth; malt; gelatin; tallow; solid glidants, such as, for example, stearic acid, magnesium stearate; calcium sulfate; vegetable oils, such as, for example, groundnut oil, cottonseed oil, sesame oil, olive oil, corn oil and oil from theobroma; polyols, such as, for example, polypropylene glycol, glycerol, sorbitol, mannitol and polyethylene glycol; alginic acid.
- sugars such as, for example, lactose, glucose and sucrose
- starches such as, for example, corn star
- the inventive pharmaceutical composition may comprise an (additional) adjuvant.
- an adjuvant may be understood as any compound, which is suitable to initiate or increase an immune response of the innate immune system, i.e. a non-specific immune response.
- the pharmaceutical composition when administered, typically elicits an innate immune response due to the adjuvant, optionally contained therein.
- Such an adjuvant may be selected from any adjuvant known to a skilled person and suitable for the present case, i.e. supporting the induction of an innate immune response in a mammal.
- inventive pharmaceutical composition may be administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir.
- parenteral as used herein includes subcutaneous, intravenous, intramuscular, intra-articular, intra-nodal, intra-synovial, infrasternal, intrathecal, intrahepatic, intralesional, intracranial, transdermal, intradermal, intrapulmonal, intraperitoneal, intracardial, intraarterial, and sublingual injection or infusion techniques.
- the inventive pharmaceutical composition may be administered by parenteral injection, more preferably by subcutaneous, intravenous, intramuscular, intra-articular, intra-nodal, intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional, intracranial, transdermal, intradermal, intrapulmonal, intraperitoneal, intracardial, intraarterial, and sublingual injection or via infusion techniques. Particularly preferred is intradermal, subcutaneous and intramuscular injection.
- Sterile injectable forms of the pharmaceutical compositions may be aqueous or oleaginous suspension. These suspensions may be formulated according to techniques known in the art using suitable dispersing or wetting agents and suspending agents.
- the sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally-acceptable diluent or solvent, for example as a solution in 1,3-butanediol.
- a non-toxic parenterally-acceptable diluent or solvent for example as a solution in 1,3-butanediol.
- acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution.
- sterile, fixed oils are conventionally employed as a solvent or suspending medium.
- any bland fixed oil may be employed including synthetic mono- or di-glycerides.
- Fatty acids such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions.
- These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, such as carboxymethyl cellulose or similar dispersing agents that are commonly used in the formulation of pharmaceutically acceptable dosage forms including emulsions and suspensions.
- Other commonly used surfactants such as Tweens, Spans and other emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms may also be used for the purposes of formulation of the pharmaceutical composition.
- inventive pharmaceutical composition as defined herein may also be administered orally in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions.
- carriers commonly used include lactose and corn starch.
- Lubricating agents such as magnesium stearate, are also typically added.
- useful diluents include lactose and dried cornstarch.
- the inventive pharmaceutical composition may also be administered topically, especially when the target of treatment includes areas or organs readily accessible by topical application, e.g. including diseases of the skin or of any other accessible epithelial tissue. Suitable topical formulations are readily prepared for each of these areas or organs.
- the pharmaceutical composition may be formulated in a suitable ointment, containing the polymeric carrier cargo complex suspended or dissolved in one or more carriers. Carriers for topical administration include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water.
- the pharmaceutical composition can be formulated in a suitable lotion or cream.
- suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.
- the inventive pharmaceutical composition typically comprises a “safe and effective amount” of the components of the pharmaceutical composition, particularly of the polymeric carrier cargo complex as defined herein or the nucleic acid as such.
- a “safe and effective amount” means an amount of the polymeric carrier cargo complex as such that is sufficient to significantly induce a positive modification of a disease or disorder as defined herein.
- a “safe and effective amount” is small enough to avoid serious side-effects and to permit a sensible relationship between advantage and risk. The determination of these limits typically lies within the scope of sensible medical judgment.
- a “safe and effective amount” of the components of the pharmaceutical composition, particularly of the polymeric carrier cargo complex or of the at least one antigen as defined herein, will furthermore vary in connection with the particular condition to be treated and also with the age and physical condition of the patient to be treated, the body weight, general health, sex, diet, time of administration, rate of excretion, drug combination, the activity of the polymeric carrier cargo complex or of the antigen, the severity of the condition, the duration of the treatment, the nature of the accompanying therapy, of the particular pharmaceutically acceptable carrier used, and similar factors, within the knowledge and experience of the accompanying doctor.
- the pharmaceutical composition may be used for human and also for veterinary medical purposes, preferably for human medical purposes, as a pharmaceutical composition in general or as a vaccine.
- the inventive pharmaceutical composition can additionally contain one or more auxiliary substances in order to increase its immunogenicity or immunostimulatory capacity, if desired.
- a synergistic action of the (adjuvant) polymeric carrier cargo complex as defined herein and of an auxiliary substance, which may be optionally contained in the inventive pharmaceutical composition as defined herein, is preferably achieved thereby.
- various mechanisms can come into consideration in this respect. For example, compounds that permit the maturation of dendritic cells (DCs), for example lipopolysaccharides, TNF-alpha or CD40 ligand, form a first class of suitable auxiliary substances.
- DCs dendritic cells
- TNF-alpha or CD40 ligand form a first class of suitable auxiliary substances.
- auxiliary substance any agent that influences the immune system in the manner of a “danger signal” (LPS, GP96, etc.) or cytokines, such as GM-CFS, which allow an immune response to be enhanced and/or influenced in a targeted manner.
- a “danger signal” LPS, GP96, etc.
- cytokines such as GM-CFS
- auxiliary substances are cytokines, such as monokines, lymphokines, interleukins or chemokines, that further promote the innate immune response, such as IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, IL-21, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-28, IL-29, IL-30, IL-31, IL-32, IL-33, INF-alpha, IFN-beta, INF-gamma, GM-CSF, G-CSF, M-CSF, LT-beta or TNF-alpha, growth factors, such as hGH.
- cytokines such as monokines, lymphokines, interleukins
- emulsifiers such as, for example, Tween®
- wetting agents such as, for example, sodium lauryl sulfate
- colouring agents such as, for example, sodium lauryl sulfate
- taste-imparting agents pharmaceutical carriers
- tablet-forming agents such as, for example, stabilizers; antioxidants; preservatives.
- the inventive pharmaceutical composition can also additionally contain any further compound, which is known to be immunostimulating due to its binding affinity (as ligands) to human Toll-like receptors TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, or due to its binding affinity (as ligands) to murine Toll-like receptors TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, TLR11, TLR12 or TLR13.
- any further compound which is known to be immunostimulating due to its binding affinity (as ligands) to human Toll-like receptors TLR1, TLR2, TLR3, TLR4, TLR5, TLR6, TLR7, TLR8, TLR9, TLR10, TLR11, TLR12 or TLR13.
- the inventive pharmaceutical composition can also additionally or alternatively contain an immunostimulatory RNA, i.e. an RNA derived from an immunostimulatory RNA, which triggers or increases an (innate) immune response.
- an immunostimulatory RNA i.e. an RNA derived from an immunostimulatory RNA, which triggers or increases an (innate) immune response.
- an immunostimulatory RNA may be in general be as defined hereinbefore.
- CpG nucleic acids in particular CpG-RNA or CpG-DNA.
- a CpG-RNA or CpG-DNA can be a single-stranded CpG-DNA (ss CpG-DNA), a double-stranded CpG-DNA (dsDNA), a single-stranded CpG-RNA (ss CpG-RNA) or a double-stranded CpG-RNA (ds CpG-RNA).
- the CpG nucleic acid is preferably in the form of CpG-RNA, more preferably in the form of single-stranded CpG-RNA (ss CpG-RNA).
- the CpG nucleic acid preferably contains at least one or more (mitogenic) cytosine/guanine dinucleotide sequence(s) (CpG motif(s)).
- CpG motif(s) cytosine/guanine dinucleotide sequence(s)
- at least one CpG motif contained in these sequences that is to say the C (cytosine) and the G (guanine) of the CpG motif, is unmethylated. All further cytosines or guanines optionally contained in these sequences can be either methylated or unmethylated.
- the C (cytosine) and the G (guanine) of the CpG motif can also be present in methylated form.
- the nucleic acid cargo in the polymeric carrier cargo complex comprised in the inventive pharmaceutical composition is preferably as defined above. More preferably, the nucleic acid of the polymeric carrier cargo complex, preferably contained in the pharmaceutical composition, is typically an immunostimulatory nucleic acid as defined herein, e.g. a CpG-DNA or an immunostimulatory RNA (isRNA), preferably an isRNA. Alternatively or additionally, the nucleic acid of the polymeric carrier cargo complex, preferably contained in the pharmaceutical composition, is a coding nucleic acid sequence as defined herein, preferably a cDNA or an mRNA, more preferably encoding an adjuvant protein preferably as defined herein. In this context, the polymeric carrier cargo complex, typically initiates an innate immune response in the patient to be treated.
- an adjuvant protein is a component of the polymeric carrier cargo complex and, preferably, of the polymeric carrier.
- the present invention also provides kits, particularly kits of parts, comprising as components alone or in combination with optional further ingredients, and including (as a first component):
- the antigen is comprised in a vaccine.
- the present invention furthermore provides several applications and uses of the inventive pharmaceutical composition (e.g. the adjuvanted vaccine) or of kits or kits of parts comprising same as defined anywhere herein.
- inventive pharmaceutical composition e.g. the adjuvanted vaccine
- kits or kits of parts comprising same as defined anywhere herein.
- the present invention also provides a method for transfecting and/or treating a cell, a tissue or an organism, thereby applying or administering the inventive pharmaceutical composition particularly for therapeutic purposes.
- the inventive pharmaceutical composition is preferably administered to a cell, a tissue or an organism, preferably using any of the administration modes as described herein.
- the method for transfecting and/or treating a cell may be carried out in vitro, in vivo or ex vivo.
- the present invention provides the use of a pharmaceutical composition or of kits or kits of parts in each case as defined anywhere herein, in therapy and/or as a medicament, preferably as a vaccine such as an adjuvanted vaccine.
- the at least one antigen is not selected from: (x) an idiotype immunoglobulin (an idiotype antibody or an idiotype B cell receptor); or (y) at least one idiotype T cell receptor; and optionally is not a fragment, variant and/or derivative of such antigen.
- inventive pharmaceutical composition or of the kits or kits of parts comprising same as defined herein in the treatment of infectious diseases, allergies or allergic diseases, autoimmune diseases and cancer or tumour diseases, in each case as defined anywhere herein.
- infectious diseases are preferably viral, bacterial or protozoological infectious diseases.
- infectious diseases are typically selected from the list consisting of Acinetobacter infections, African sleeping sickness (African trypanosomiasis), AIDS (Acquired immunodeficiency syndrome), Amoebiasis, Anaplasmosis, Anthrax, Appendicitis, Arcanobacterium haemolyticum infections, Argentine hemorrhagic fever, Ascariasis, Aspergillosis, Astrovirus infections, Athlete's foot, Babesiosis, Bacillus cereus infections, Bacterial meningitis, Bacterial pneumonia, Bacterial vaginosis (BV), Bacteroides infections, Balantidiasis, Baylisascaris infections, Bilharziosis, BK virus infections, Black piedra, Blastocystis hominis infections, Blastomycosis,
- Allergies or allergic diseases are preferably selected from pollen allergy (allergy against grass pollen, tree pollen (e.g. pollen of hazel, birch, alder, ash), flower pollen, herb pollen (e.g. pollen of mugwort)), dust mite allergy, mold allergy (e.g. allergy against Acremonium, Aspergillus, Cladosporium, Fusarium, Mucor, Penicillium, Rhizopus, Stachybotrys, Trichoderma , or Alternaria ), pet allergy (allergy against animals; e.g against cats, dogs, horses), food allergy (e.g. allergy against fish (e.g. bass, cod, flounder), seafood (e.g.
- insect bite allergy allergy against insect venom, e.g. venom of wasps, bees, hornets, ants, mosquitos, or ticks.
- diseases as defined herein comprise autoimmune diseases as defined in the following.
- Autoimmune diseases are preferably selected from Addison disease (autoimmune adrenalitis, Morbus Addison), alopecia areata, Addison's anemia (Morbus Biermer), autoimmune hemolytic anemia (AIHA), autoimmune hemolytic anemia (AIHA) of the cold type (cold hemagglutinine disease, cold autoimmune hemolytic anemia (AIHA) (cold agglutinin disease), (CHAD)), autoimmune hemolytic anemia (AIHA) of the warm type (warm AIHA, warm autoimmune haemolytic anemia (AIHA)), autoimmune hemolytic Donath-Landsteiner anemia (paroxysmal cold hemoglobinuria), antiphospholipid syndrome (APS), atherosclerosis, autoimmune arthritis, arteriitis temporalis, Takayasu arteriitis (Takayasu's disease, aortic arch disease), temporal arteriitis/giant cell arterii
- cervical carcinoma cervical cancer
- the present invention provides a polymeric carrier cargo complex as defined anywhere herein, such as one comprising:
- the present invention provides at least one antigen, preferably a protein or peptide antigen or a fragment, variant and/or derivative thereof, in each case as defined anywhere herein, for use in therapy in combination with a polymeric carrier cargo complex as defined anywhere herein, such as one comprising:
- the antigen is comprised in a vaccine, such as a commercially available vaccine.
- “in combination” means that the different components (the polymeric carrier cargo complex and the at least one antigen, or a fragment, variant and/or derivative thereof) can be provided together in the same composition, or can be formulated separately in different compositions, i.e. one composition comprising or representing the polymeric carrier cargo complex as defined herein, and one further composition comprising the at least one antigen, or a fragment, variant and/or derivative thereof as defined herein. If provided in different compositions the polymeric carrier cargo complex and the at least one antigen or a fragment, variant and/or derivative thereof may be administered separated in time (in a time-staggered manner) and/or may be administered at different administration sites and/or via different administration routes.
- polymeric carrier cargo complex may be administered e.g. prior, concurrent or subsequent to the at least one antigen, or fragment, variant and/or derivative thereof, or vice versa.
- Subsequent administration includes that each component used in the therapy is administered within about 48 hours, 24 hours, 12 hours, 8 hours, 6 hours, 4 hours, 2 hours, 1 hour, 30 mins, 15 mins or 5 mins of each other.
- the present invention provides a pharmaceutical package, including:
- the pharmaceutical package may further comprise at least one antigen or fragment, variant and/or derivative thereof as defined anywhere herein.
- a pharmaceutical package including:
- the pharmaceutical package may further comprise a polymeric carrier cargo complex, comprising:
- the invention furthermore provides the use of the components included in the above defined pharmaceutical packages in the treatment of the particular disease (indication) selected from an infectious disease, an allergy or allergic disease, an autoimmune disease or a cancer or tumour disease as defined above.
- the particular disease selected from an infectious disease, an allergy or allergic disease, an autoimmune disease or a cancer or tumour disease as defined above.
- the respective disease may be one as described anywhere herein.
- the invention relates to
- the invention relates to
- the invention relates to
- the invention relates to
- the invention relates to
- the invention relates to
- the invention relates to
- the invention relates to
- the invention relates to
- the invention relates to
- the invention relates to
- the invention relates to
- the invention relates to
- the invention relates to
- the antigen is associated with an autoimmune disease
- the antigen is an immunoglobulin idiotype or a T cell receptor idiotype of a lymphoid cell, preferably of a B-cell or a T-cell.
- lymphoid cells e.g. B-cells or T-cells may be responsible for destruction of body-cells, such as e.g. pancreatic beta-cells, if they are erroneously programmed to recognise and fight self-epitopes of the body.
- an immunoglobulin idiotype may be understood to be a peptide or protein having the particular molecular shape of the variable region of an immunoglobulin expressed by a particular type of B-cells.
- Such an idiotype may be used as antigen for eliciting an immune response directed against this particular type of B-cells, for example against malignant B-cells.
- a T cell receptor idiotype may be understood to be a peptide or protein having the particular molecular shape of the variable region of a T cell receptor expressed by a particular type of T-cells.
- Such an idiotype may be used as antigen for eliciting an immune response directed against this particular type of T-cells, for example against malignant T-cells.
- the inventive pharmaceutical composition may be used, for example, for vaccination against such mis-programmed lymphoid cells. E.g. treatment of a patient suffering from an autoimmune disease, such as e.g. Diabetes, Crohn's disease, Multiple sclerosis or the like, may occur by destruction of malfunctional lymphoid cells which attact the own body and subsequent vaccination with the inventive pharmaceutical composition.
- the invention relates to
- the polymeric carrier cargo complex is preferably for use as an adjuvant, wherein, more preferably, the at least one nucleic acid molecule is an immunostimulatory nucleic acid as defined herein, even more preferably the at least one nucleic acid molecule is RNA, most preferably an immunostimulatory RNA (isRNA).
- Particular preferred nucleic acid cargos in the context of the present invention are nucleic acid molecules comprising or consisting of a nucleic acid sequence according to SEQ ID NO. 105 or 122 or a nucleic acid sequence which is at least 60%, preferably at least 70%, preferably at least 80%, more preferably at least 90%, and most preferably at least 95% identical to SEQ ID NO. 105 or 122.
- the polymeric carrier cargo complex may be a polymeric carrier cargo complex wherein the cationic components of the polymeric carrier and the nucleic acid molecule cargo comprised in said polymeric carrier cargo complex are provided in a N/P ratio in the range of 0.1-20, or in the range of 0.1-5, or in the range of 0.1-1, or in the range of 0.5-0.9.
- the polymeric carrier cargo complex comprises a polymeric carrier, preferably a polymeric carrier formed by disulfide-crosslinked cationic components, and at least one nucleic acid molecule, that the pharmaceutical composition is not a composition comprising a polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and isRNA722A (SEQ ID No. 105) or isRNA722B (SEQ ID No. 122) as nucleic acid cargo to the protein vaccine Ovalbumine (OVA protein).
- a polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and isRNA722A (SEQ ID No. 105) or isRNA722B (SEQ ID No. 122) as nucleic acid cargo to the protein vaccine Ovalbumine (OVA protein).
- the polymeric carrier cargo complex comprises a polymeric carrier, preferably a polymeric carrier formed by disulfide-crosslinked cationic components, and at least one nucleic acid molecule, that the pharmaceutical composition is not a composition comprising a polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and isRNA722A (SEQ ID No. 105) or isRNA722B (SEQ ID No. 122) as nucleic acid cargo to the Ovalbumine-specific peptide vaccine SIINFEKL.
- the pharmaceutical composition is not a composition comprising a polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C (SEQ ID No. 6) as carrier and isRNA722A (SEQ ID No. 105) or isRNA722B (SEQ ID No. 122) as nucleic acid cargo and an antigen which is Ovalbumin (OVA protein) (SEQ ID No. 117).
- the pharmaceutical composition comprises a polymeric carrier cargo complex comprising a polymeric carrier formed by disulfide-crosslinked cationic components and at least one nucleic acid molecule, that the at least one antigen is not an antigen associated with a cancer or tumour disease, particularly lymphoma or a lymphoma associated disease, wherein said antigen is an immunoglobulin idiotype of a lymphoid blood cell or a T cell receptor idiotype of a lymphoid blood cell or a fragment, variant and/or derivative of such an immunoglobulin idiotype or T cell receptor idiotype.
- an immunoglobulin idiotype may be understood to be a peptide or protein having the particular molecular shape of the variable region of an immunoglobulin expressed by a particular type of B-cells. Such an idiotype may be used as antigen for eliciting an immune response directed against this particular type of B-cells, for example against malignant B-cells.
- a T cell receptor idiotype may be understood to be a peptide or protein having the particular molecular shape of the variable region of a T cell receptor expressed by a particular type of T-cells. Such an idiotype may be used as antigen for eliciting an immune response directed against this particular type of T-cells, for example against malignant T-cells.
- the pharmaceutical composition comprises a polymeric carrier cargo complex comprising a polymeric carrier formed by disulfide-crosslinked cationic components and at least one nucleic acid molecule, that the at least one antigen associated with a cancer or tumour disease is not an antigen associated with lymphoma, preferably not B-cell lymphoma, T-cell lymphoma or Non-Hodgkin's lymphoma.
- the pharmaceutical composition comprises a polymeric carrier cargo complex comprising a polymeric carrier formed by disulfide-crosslinked cationic components and at least one nucleic acid molecule, that the at least one antigen associated with a cancer or tumour disease is not an antigen derived from a malignant cell, preferably not from a malignant B cell or a malignant T cell.
- the pharmaceutical composition may comprise no further component than the components A) and B), preferably no other mRNA component (other than comprised by the components A), preferably the pharmaceutical composition may not comprise any mRNA at all.
- the pharmaceutical composition comprises mRNA (other than nucleic acid of component A), the mRNA may not be a mRNA encoding a peptide or antigen according to B), further preferred the mRNA may not be a mRNA encoding Ovalbumin, PSMA, Luciferase or STEAP.
- the pharmaceutical composition contains a mRNA (other than nucleic acid of component A), particularly mRNA encoding a peptide or antigen according to B), and/or mRNA encoding Ovalbumin, PSMA, Luciferase or STEAP, the mRNA may not be complexed with protamin, preferably not in a ratio of 2:1 or 4:1 or between 2:1 and 4:1.
- the claimed pharmaceutical composition may not be used for treatment of pancreas carcinoma or non-small cell lung carcinoma.
- the pharmaceutical composition comprises mRNA (other than nucleic acid of component A), that the mRNA may not be a free mRNA.
- the pharmaceutical composition comprises mRNA (other than nucleic acid of component A), that the mRNA may not be complexed with protamine.
- the pharmaceutical composition comprises free mRNA, that the mRNA may not encode for a therapeutically active protein and may not encode for an antibody and may not encode for an antigen.
- component A) of the inventive pharmaceutical composition it may be preferred that with respect to component A) of the inventive pharmaceutical composition, that a) may not be protamine.
- component A) of the inventive pharmaceutical composition it may be preferred that with respect to component A) of the inventive pharmaceutical composition, that the carrier protein may not be protamine.
- component A) is protamine, a) is not present in a ratio of 1:2 or 1:4 or between 1:2 and 1:4, with respect to b) of component A).
- the carrier protein of component A) is protamine, the carrier protein is not present in a ratio of 1:2 or 1:4 with respect to the nucleic acid of component A).
- the nucleic acid is not an mRNA.
- nucleic acid of component A) is an mRNA, that the mRNA does not encode Ovalbumin, PSMA, Luciferase or STEAP.
- the nucleic acid, i.e. b), of the component A) is mRNA; that the mRNA is not a free mRNA, but is exclusively complexed with the carrier protein of a).
- component (B) is not ovalbumin or a fragment of ovalbumin.
- the pharmaceutical composition, the kit, or the pharmaceutical package according to the present invention does not comprise ovalbumin or a fragment of ovalbumin or a nucleic acid sequence coding for ovalbumin or coding for a fragment of ovalbumin.
- FIG. 1 shows the raw correlation curve of polymeric carrier cargo complexes formed by the disulfide-crosslinked cationic peptides CR 12 C and CR 7 C as carrier after lyophilisation compared to complexes with non-polymerizing cationic peptides as carrier (R 12 and R 7 ) by dynamic light scattering using a Zetasizer Nano (Malvern Instruments, Malvern, UK). The hydrodynamic diameters were measured with fresh prepared complexes and with reconstituted complexes after lyophilisation The mass ratio of peptide:RNA was 1:2.
- polymeric carrier cargo complexes comprising cystein-containing peptides as cationic components which lead to a polymerization of the polymeric carrier by disulfide bonds do not change in size in contrast to the complexes formed by non-polymerizing peptides which increase in size and therefore are not stable during the lyophilization step. Therefore complexes with polymerized peptides as polymeric carriers show advantageous properties for lyophilization.
- FIG. 2 shows the Zeta-potential of polymeric carrier cargo complexes formed by the disulfide-cross-linked cationic peptide CR 12 C and the R722 as nucleic acid cargo at different w/w ratios. As can be seen, the zeta potential changes from positive to negative when the w/w ratio is changed from excess peptide to a 1:1 ratio (peptide/RNA).
- FIG. 3A shows the secretion of hIFNa cytokine (in vitro) in hPBMCs after stimulation with polymeric carrier cargo complexes formed by the disulfide-crosslinked cationic peptide CR 12 C and the CpG 2216 as nucleic acid cargo in a mass ratio of 1:2.5 (w/w) (CR 12 C/CpG 2216).
- polymeric carrier cargo complexes lead to an increase of hIFNa cytokine release in hPBMCs compared to the nucleic acid cargo alone or the cationic peptide alone.
- FIG. 3B shows the secretion of hTNFa cytokine (in vitro) in hPBMCs after stimulation with polymeric carrier cargo complexes formed by the disulfide-crosslinked cationic peptide CR 12 C and the CpG 2216 as nucleic acid cargo in a mass ratio of 1:2.5 (w/w) (CR 12 C/CpG 2216).
- polymeric carrier cargo complexes do not lead to an increase in hTNFa cytokine release in hPBMCs compared to the nucleic acid cargo alone or the cationic peptide alone.
- FIG. 4A shows the secretion of hIFNa cytokine (in vitro) in hPBMCs after stimulation with polymeric carrier cargo complexes formed by the disulfide-crosslinked cationic peptide CR 12 C and the mRNA R491 coding for luciferase as nucleic acid cargo in a mass ratio of 1:2 (w/w) (CR 12 C/R491).
- polymeric carrier cargo complexes lead to an increase of hIFNa cytokine release in hPBMCs compared to the nucleic acid cargo alone or the cationic peptide alone.
- FIG. 4B shows the secretion of hTNFa cytokine (in vitro) in hPBMCs after stimulation with polymeric carrier cargo complexes formed by the disulfide-crosslinked cationic peptide CR 12 C and the mRNA R491 coding for luciferase as nucleic acid cargo in a mass ratio of 1:2 (w/w) (CR 12 C/R491).
- polymeric carrier cargo complexes lead to an increase of hTNFa cytokine release in hPBMCs compared to the nucleic acid cargo alone or the cationic peptide alone.
- FIG. 5A shows the secretion of hIFNa cytokine (in vitro) in hPBMCs after stimulation with polymeric carrier cargo complexes formed by the disulfide-crosslinked cationic peptide CR 12 C and a short GU rich RNA oligonucleotide (short GU rich) as nucleic acid cargo in a mass ratio of 1:2.5 (w/w) (CR 12 C/short GU rich).
- the polymeric carrier cargo complexes lead to an increase of hIFNa cytokine release in hPBMCs compared to the nucleic acid cargo alone or the cationic peptide alone.
- FIG. 5B shows the secretion of hTNFa cytokine (in vitro) in hPBMCs after stimulation with polymeric carrier cargo complexes formed by the disulfide-crosslinked cationic peptide CR 12 C and a short GU rich RNA oligonucleotide (short GU rich) as nucleic acid cargo in a mass ratio of 1:2.5 (w/w) (CR 12 C/short GU rich).
- the polymeric carrier cargo complexes lead to an increase of hTNFa cytokine release in hPBMCs compared to the nucleic acid cargo alone or the cationic peptide alone.
- FIG. 6A shows the secretion of hIFNa cytokine (in vitro) in hPBMCs after stimulation with polymeric carrier cargo complexes formed by the disulfide-crosslinked cationic peptide CR 7 C and the long non-coding GU-rich isRNA R722 as nucleic acid cargo.
- the polymeric carrier cargo complexes (CR 7 C/R722) lead to an increase of hIFNa cytokine release in hPBMCs compared to cargo complexes (R 7 /R722) formed by the non-polymerized peptide R 7.
- FIG. 6B shows the secretion of hTNFa cytokine (in vitro) in hPBMCs after stimulation with polymeric carrier cargo complexes formed by the disulfide-crosslinked cationic peptide CR 7 C and the long non-coding GU-rich isRNA R722 as nucleic acid cargo.
- the polymeric carrier cargo complexes CR 7 C/R722 only leads to a weak increase of hTNFa cytokine release in hPBMCs compared to carrier cargo complexes (R 7 /R722) formed by the non-polymerized peptide R 7.
- FIG. 7A shows the secretion of hIFNa cytokine (in vitro) in hPBMCs after stimulation with polymeric carrier cargo complexes formed by the disulfide-crosslinked cationic peptide CR 9 C and the long non-coding GU-rich isRNA R722 as nucleic acid cargo.
- inventive polymeric carrier cargo complexes CR 9 C/R722
- R 9 /R722 carrier cargo complexes
- FIG. 7B shows the secretion of hTNFa cytokine (in vitro) in hPBMCs after stimulation with polymeric carrier cargo complexes formed by the disulfide-crosslinked cationic peptide CR 9 C and the long non-coding GU-rich isRNA R722 as nucleic acid cargo.
- the polymeric carrier cargo complexes (CR 9 C/R722) do not lead to an increase of hTNFa cytokine release in hPBMCs compared to carrier cargo complexes (R 9 /R722) formed by the non-polymerized peptide R 9.
- FIG. 8A shows the secretion of hIFNa cytokine (in vitro) in hPBMCs after stimulation with polymeric carrier cargo complexes formed by the disulfide-crosslinked cationic peptide CR 12 C and the isRNA R722 as nucleic acid cargo at different w/w ratios.
- the polymeric carrier cargo complexes lead to an increase in hIFNa cytokine release in hPBMCs compared to the nucleic acid cargo alone or the cationic peptide alone.
- FIG. 8B shows the secretion of hTNFa cytokine (in vitro) in hPBMCs after stimulation with polymeric carrier cargo complexes formed by the disulfide-crosslinked cationic peptide CR 12 C and the isRNA R722 as nucleic acid cargo at different w/w ratios.
- the polymeric carrier cargo complexes lead to an increase in hTNFa cytokine release in hPBMCs compared to the nucleic acid cargo alone or the cationic peptide alone.
- FIG. 9A shows the secretion of hIFNa cytokine (in vitro) in hPBMCs after stimulation with polymeric carrier complexes formed by the cationic peptides CH 6 R 4 H 6 C, CH 3 R 4 H 3 C and CHK 7 HC and the isRNA R722 as nucleic acid cargo at different N/P ratios.
- the polymeric carrier cargo complexes lead to an increase in hIFNa cytokine release in hPBMCs compared to the nucleic acid cargo alone or the cationic peptide alone.
- FIG. 9B shows the secretion of hTNFa cytokine (in vitro) in hPBMCs after stimulation with polymeric carrier complexes formed by the disulfide-crosslinked cationic peptides CH 6 R 4 H 6 C, CH 3 R 4 H 3 C and CHK 7 HC and the isRNA R722 as nucleic acid cargo at different N/P ratios.
- the polymeric carrier cargo complexes lead to an increase in hTNFa cytokine release in hPBMCs compared to the nucleic acid cargo alone or the cationic peptide alone.
- Particularly polymeric cargo complexes with an N/P ratio greater or equal 1 result in TNFalpha secretion.
- FIG. 10 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the protein antigen Ovalbumine (OVA protein) for the use as an adjuvant in tumour challenge experiments.
- OVA protein protein antigen Ovalbumine
- mice 7 female C57BL/6 mice per group were vaccinated three times in two weeks with pg 5 ⁇ g Ovalbumin protein combined with 45 ⁇ g CR 12 C/R722 (1:2; w/w). For comparison mice were injected without the polymeric cargo complexes.
- the polymeric carrier cargo complex extremely decelaterates the tumour growth compared to the protein antigen alone, which has no effect on tumor growth in comparison to the buffer control.
- FIG. 11 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the protein antigen Ovalbumine (OVA protein) for the use as an adjuvant on the induction of Ovalbumine-specific IgG2a antibodies.
- Ovalbumine Ovalbumine
- mice were vaccinated three times in two weeks with 5 ⁇ g Ovalbumin protein combined with 45 ⁇ g CR 12 C/R722 (1:2; w/w).
- mice were injected without the polymeric cargo complexes.
- the polymeric carrier cargo complex strongly increases the B-cell response, which proofs the beneficial adjuvant properties of the polymeric carrier cargo complexes, particularly in regard to the induction of a Th1-shifted immune response.
- FIG. 12 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the protein antigen Ovalbumine (OVA protein) or the Ovalbumine-specific peptide antigen SIINFEKL for the use as an adjuvant on the induction of Ovalbumine-specific cytotoxic T cells.
- OVA protein protein antigen Ovalbumine
- SIINFEKL protein antigen SIINFEKL
- mice were vaccinated three times in two weeks with 5 ⁇ g Ovalbumin protein or 50 ⁇ g SIINFEKEL peptide combined with 45 ⁇ g CR 12 C/R722 (1:2; w/w).
- mice were injected without the polymeric cargo complexes.
- the polymeric carrier cargo complex strongly increases the induction of Ovalbumin-specific cytotoxic T cells compared to the vaccination with protein or peptide alone, which further proofs the beneficial adjuvant properties of the polymeric carrier cargo complex, particularly in regard to the induction of a Th1-shifted immune response.
- FIG. 13 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the vaccine Rabipur® (comprising inactivated Rabies virus) for the use as an adjuvant on the induction of Rabies specific IgG antibodies (as represented by OD 405 nm).
- Rabipur® comprising inactivated Rabies virus
- FIG. 13 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the vaccine Rabipur® (comprising inactivated Rabies virus) for the use as an adjuvant on the induction of Rabies specific IgG antibodies (as represented by OD 405 nm).
- 8 female BALB/c mice were injected intramuscularly with the 0.1
- the polymeric carrier cargo complex strongly increases the induction of Rabies-specific IgG antibodies compared to the vaccination with Rabipur® alone, which further proofs the beneficial adjuvant properties of the polymeric carrier cargo complex.
- FIG. 14 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the vaccine Rabipur® or HDC (comprising inactivated Rabies virus) for the use as an adjuvant on the induction of Rabies specific cytotoxic T cells (as represented by number of spots in the ELISPOT assay).
- mice were injected intramuscularly with the 0.01 fold human dose of Rabipur® or HDC and 30 ⁇ g R722 and 8.1 ⁇ g CR 12 C (3.7:1 w/w). 5 days after the immunization the mice were sacrificed, the spleens were removed and the splenocytes were isolated.
- the polymeric carrier cargo complex strongly increases the induction of Rabies-specific cytotoxic T cells compared to the vaccination with Rabipur® or HDC alone, which further proofs the beneficial adjuvant properties of the polymeric carrier cargo complex, particularly in regards to the induction of a Th1-shifted immune response.
- FIG. 15 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the vaccine Rabipur® (comprising inactivated Rabies virus) for the use as an adjuvant on the induction of Rabies specific IgG antibodies. Furthermore it shows the effect of the polymeric carrier cargo complex on the induction of antibodies with high affinity to the antigen (as represented by % of bound IgG).
- mice 8 female BALB/c mice were injected intramuscularly with the 0.01 fold human dose of Rabipur® and 30 ⁇ g R722 and 8.1 ⁇ g CR 12 C (3.7:1 w/w). 7 and 21 days after the immunization blood samples were taken and analysed for total IgG antibodies directed against the Rabies virus. To examine the affinity of the generated antibodies directed against the Rabies virus, during the performance of the ELISA the bound antibodies were washed with an increasing concentration of urea.
- the polymeric carrier cargo complex strongly increases the induction of Rabies-specific IgG antibodies with high affinity to the antigen compared to the vaccination with Rabipur® alone, which further proofs the beneficial adjuvant properties of the polymeric carrier cargo complex, particularly in regards to the induction of antibodies with high affinity.
- FIG. 16 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the vaccine HDC (comprising inactivated Rabies virus) for the use as an adjuvant on the induction of Rabies virus neutralizing antibodies (as represented by IU/ml).
- the vaccine HDC comprising inactivated Rabies virus
- 8 female BALB/c mice were injected intramuscularly with the 0.01 fold human dose of HDC and 30 ⁇ g R722 and 15 ⁇ g CR 12 C (2:1 w/w). 21 days after the immunization blood samples were taken and virus neutralization was analysed.
- the polymeric carrier cargo complex strongly increases the neutralizing antibody titer compared to the vaccination with HDC alone, which further proofs the beneficial adjuvant properties of the polymeric carrier cargo complex.
- FIG. 17 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the swine flu vaccine Pandemrix® (comprising inactivated H1N1 influenza virus) for the use as an adjuvant on the induction of H1N1 influenza specific IgG2a antibodies.
- Pandemrix® comprising inactivated H1N1 influenza virus
- 5 female BALB/c mice were injected intramuscularly with 0.1 ⁇ g Pandemrix® and 30 ⁇ g R722 and 15 ⁇ g CR 12 C (2:1 w/w). 14 days after the immunization blood samples were taken and analysed for induction of IgG2a antibodies directed against H1N1 influenza virus (as represented by OD 405 nm).
- the polymeric carrier cargo complex strongly increases the induction of Influenza-specific IgG2a antibodies compared to the vaccination with Panemrix® alone, which further proofs the beneficial adjuvant properties of the polymeric carrier cargo complex, particularly in regards to the induction of a Th1-shifted immune response.
- FIG. 18 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the A(H1N1)pdm09influenza vaccine Celvapan® (comprising inactivated A(H1N1)pdm09influenza virus) for the use as an adjuvant on the induction of A(H1N1)pdm09specific cytotoxic T cells (as represented by number of spots in the ELISPOT assay).
- mice 5 female BALB/c mice were injected intramuscularly with the 0.1 ⁇ g Celvapan® and 15 ⁇ g R722 and 7.5 ⁇ g CR 12 C (2:1 w/w). 6 days after the immunization the mice were sacrificed, the spleens were removed and the splenocytes were isolated.
- the polymeric carrier cargo complex strongly increases the induction of A(H1N1)pdm09-specific cytotoxic T cells compared to the vaccination with Celvapan® alone, which further proofs the beneficial adjuvant properties of the polymeric carrier cargo complex, particularly in regards to the induction of a Th1-shifted immune response.
- FIG. 19 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the seasonal influenza vaccine Begrivac® (comprising inactivated seasonal influenza virus strains as recommended by the WHO) for the use as an adjuvant on the induction of influenza specific IgG2a antibodies (as represented by OD 405 nm).
- Begrivac® comprising inactivated seasonal influenza virus strains as recommended by the WHO
- IgG2a antibodies as represented by OD 405 nm
- 8 female BALB/c mice were injected intramuscularly with 0.1 ⁇ g Begrivac® and 30 ⁇ g R722 and 15 ⁇ g CR 12 C (2:1 w/w). 28 days after the immunization blood samples were taken and analysed for IgG2a antibodies directed against influenza virus.
- the polymeric carrier cargo complex strongly increases the induction of Influenza-specific IgG2a antibodies compared to the vaccination with Begrivac® alone, which further proofs the beneficial adjuvant properties of the polymeric carrier cargo complex, particularly in regards to the induction of a Th1-shifted immune response.
- FIG. 20 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the Hepatitis B vaccine Engerix®-B (comprising recombinant Hepatitis B Surface Antigen (HBsAg)) for the use as an adjuvant on the induction of HBsAG specific antibodies (as represented by fluorescence).
- HBsAg Hepatitis B Surface Antigen
- the polymeric carrier cargo complex strongly increases the induction of HBsAg-specific IgG2a antibodies compared to the vaccination with Engerix®-B alone, which further proofs the beneficial adjuvant properties of the polymeric carrier cargo complex, particularly in regards to the induction of a Th1-shifted immune response.
- FIG. 21 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to a human papilloma virus 16 (HPV16) derived peptide for the use as an adjuvant on the induction of HPV16 E7 specific cytotoxic T cells (as represented by number of spots in the ELISPOT assay).
- HPV16 human papilloma virus 16
- mice were injected intradermally with 100 ⁇ g of the HPV16 E7 derived peptide E7aa43-77 and 50 ⁇ g R722 and 25 ⁇ g CR 12 C (2:1 w/w). 8 days after the immunization the mice were sacrificed, the spleens were removed and the splenocytes were isolated.
- the polymeric carrier cargo complex strongly increases the induction of HPV16 E7-specific cytotoxic T cells compared to the vaccination with the peptide alone, which further proofs the beneficial adjuvant properties of the polymeric carrier cargo complex, particularly in regards to the induction of a Th1-shifted immune response.
- FIG. 22 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to a human papilloma virus 16 (HPV16) derived peptide for the use as an adjuvant on the induction of HPV16 E7 specific cytotoxic T cells (as represented by number of spots in the ELISPOT assay).
- HPV16 human papilloma virus 16
- mice 5 female C57BL/6 mice were injected intradermally with 100 ⁇ g of the HPV16 E7 derived peptide E7aa43-77 and 50 ⁇ g R722 and 25 ⁇ g CR 12 C (2:1 w/w). Furthermore mice were injected with the polymeric carrier cargo complex additionally comprising the antigenic peptide E7aa43-77. Seven days after the immunization the mice were sacrificed, the spleens were removed and the splenocytes were isolated.
- the polymeric carrier cargo complex strongly increases the induction of HPV16 E7-specific cytotoxic T cells compared to the vaccination with the peptide alone. Furthermore the results show that the inclusion of the antigenic peptide in the polymeric carrier cargo complex further improves the induction of HPV16 E7-specific cytotoxic T cells. Therefore also this experiment proofs the beneficial adjuvant properties of the polymeric carrier cargo complex, particularly in regards to the induction of a Th1-shifted immune response.
- FIG. 23 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the human NY-ESO-1 protein for the use as an adjuvant on the induction of NY-ESO-1 specific cytotoxic T cells (as represented by number of spots in the ELISPOT assay).
- mice were injected intramuscularly with 5 ⁇ g NY-ESO-1 protein and 30 ⁇ g R722 and 15 ⁇ g CR 12 C (2:1 w/w) 2 times within 15 days. 7 days after-the-last-immunization the mice were sacrificed, the spleens were removed and the splenocytes were isolated.
- the polymeric carrier cargo complex strongly increases the induction of NY-ESO-1-specific cytotoxic T cells compared to the vaccination with the protein alone, which further proofs the beneficial adjuvant properties of the polymeric carrier cargo complex, particularly in regards to the induction of a Th1-shifted immune response.
- FIG. 24 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the vaccine Rabipur® (comprising inactivated Rabies virus) for the use as an adjuvant for the enhancement of protection against lethal virus challenge infection.
- Rabipur® comprising inactivated Rabies virus
- mice 8 female BALB/c mice were injected intramuscularly with the 0.001 fold human dose of Rabipur® and 3 ⁇ g R722 and 0.81 ⁇ g CR 12 C (3.7:1 w/w). 37 days after vaccination the mice were infected with a lethal dose of rabies virus of challenge virus strain (CVS) using a 25-fold LD 50 (lethal doses 50%).
- CVS rabies virus of challenge virus strain
- the polymeric carrier cargo complex strongly increases the survival of mice against lethal Rabies virus infection compared to vaccination with Rabipur® alone, which further proofs the beneficial adjuvant properties of the polymeric carrier cargo complex.
- FIG. 25 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the human papilloma virus 16 (HPV16) derived long-chain peptide E7aa43-77 for the use as an adjuvant in tumour challenge experiments.
- HPV16 human papilloma virus 16
- mice For this purpose, 8 C57BL/6 mice per group were challenged on day 1 with 1 ⁇ 10 5 TC-1 cells which express the HPV E6 and E7 protein. Vaccination started on day 7 after tumor challenge (median tumor volume 31-48 mm 3 ). Mice were intradermally vaccinated 5 times (on day 8, 12, 15, 19 and 22) with 5 ⁇ g or 50 ⁇ g E7 peptide combined with 50 ⁇ g CR 12 C/R722 (1:2; w/w).
- mice were injected with the polymeric cargo complexes alone.
- the polymeric carrier cargo complex combined with HPV-16 derived E7 peptide E7aa43-77 even impairs the growth of tumours compared to the polymeric carrier cargo complex alone.
- FIG. 26 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the human papilloma virus 16 (HPV16) derived E7 peptide E7aa43-77 for the use as an adjuvant in tumour challenge experiments.
- HPV16 human papilloma virus 16
- mice were challenged on day 1 with 1 ⁇ 10 5 TC-1 cells. Vaccination started on day 7 after tumor challenge (median tumor volume 31-48 mm 3 ). Mice were intradermally vaccinated 5 times (on day 8, 12, 15, 19 and 22) with 5 ⁇ g or 50 ⁇ g E7 peptide E7aa43-77 combined with 50 ⁇ g CR 12 C/R722 (1:2; w/w). For comparison, mice were injected with the E7 peptide or the polymeric cargo complexes alone. Injection with PBS buffer served as negative control.
- the polymeric carrier cargo complex combined with HPV-16 derived E7 peptide strongly enhances the survival of tumor bearing mice (Mean survival time of 44.5 days for 50 ⁇ g E7 peptide+50 ⁇ g polymeric carrier cargo complex; mean survival time of 22 days 5 ⁇ g E7 peptide+50 ⁇ g polymeric carrier cargo complex) compared to the E7 peptide or 50 polymeric carrier cargo complex alone.
- FIG. 27 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the human papilloma virus 16 (HPV16) derived E7 peptide E7aa43-77 for the use as an adjuvant in tumour challenge experiments.
- HPV16 human papilloma virus 16
- mice per group were intradermally vaccinated once per week for four weeks with the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo and the E7 peptide as indicated in the Figure.
- the fourth vaccination 5 mice/group were sacrificed, splenocytes were isolated and the frequency of antigen-specific CD8 + T cells was determined by HPV-pentamer staining and flow cytometry according to example 13.
- FIG. 28 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the human papilloma virus 16 (HPV16) derived E7 peptide E7aa43-77 for the use as an adjuvant in tumour challenge experiments.
- HPV16 human papilloma virus 16
- mice per group were intradermally vaccinated once per week for four weeks with the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo and the E7 peptide as indicated in the Figure.
- the polymeric carrier cargo complex combined with the HPV-16 derived E7 peptide E7aa43-77 results in a drastic delay of tumor growth (4 complete responses for 5 ⁇ g E7 peptide+50 ⁇ g of 50 ⁇ g polymeric carrier cargo complex; 7 complete responders for 50 ⁇ g E7 peptide+50 ⁇ g of 50 ⁇ g polymeric carrier cargo complex).
- the combination of the polymeric carrier cargo complex combined with the HPV-16 derived E7 peptide induces a potent memory CD8 + T cell response.
- FIG. 29 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the seasonal influenza vaccine Mutagrip® (comprising inactivated seasonal influenza virus strains as recommended by the WHO) for the use as an adjuvant on the induction of influenza specific hemagglutinin inhibition (HI) titers (as represented by HI titer).
- HI hemagglutinin inhibition
- mice 8 female BALB/c mice were injected intramuscularly with 0.45 ⁇ g or 0.045 ⁇ g Mutagrip® and 5 ⁇ g R722+1.35 ⁇ g CR 12 C (3.7:1, w/w). 21 days after the immunization blood samples were taken and HI titers were determined in the sera.
- the HI titer is widely used as a surrogate parameter of influenza vaccine efficacy with a HI titer of ⁇ 1:40 commonly defined as the protective limit in humans.
- the polymeric carrier cargo complex strongly increases the induction of influenza A H1N1-specific HI titers (A) and H3N2-specific HI titers (B) compared to the vaccination with Mutagrip® alone, which further demonstrates the beneficial adjuvant properties of the polymeric carrier cargo complex.
- FIG. 30 shows the (in vivo) effect of the addition of the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR 12 C as carrier and the isRNA R722 as nucleic acid cargo to the seasonal influenza vaccine Mutagrip® (comprising inactivated seasonal influenza virus strains as recommended by the WHO) for the use as an adjuvant on the induction of influenza specific IgG2a antibodies (as represented by IgG2a titer).
- the seasonal influenza vaccine Mutagrip® comprising inactivated seasonal influenza virus strains as recommended by the WHO
- mice 8 female BALB/c mice were injected intramuscularly with 4.5 ⁇ g or 0.045 ⁇ g Mutagrip® and 5 ⁇ g R722+1.35 ⁇ g CR 12 C (3.7:1 w/w). 21 days after the immunization blood samples were taken and analysed for IgG2a antibodies directed against influenza A H1N1 virus.
- R2 (SEQ ID NO. 109) Arg-Arg-Arg-Arg-Arg-Arg (Arg 7 ) CR2C: (SEQ ID NO. 1) Cys-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Cys (CysArg 7 Cys)
- R9 (SEQ ID NO. 110) Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg (Arg 9 )
- R12 (SEQ ID NO. 111) Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg (Arg 12 ) CR9C: (SEQ ID NO.
- R722A long non-coding isGU-rich RNA
- R722B long non-coding isGU-rich RNA
- R491 mRNA coding for luciferase GGGAGAAAGCUUGAGGAUGGAGGACGCCAAGAACAUCAAGAAGGGCCCGGCGCCCUUCUACCCGCU GGAGGACGGGACCGCCGGCGAGCAGCUCCACAAGGCCAUGAAGCGGUACGCCCUGGUGCCGGGCAC GAUCGCCUUCACCGACGCCCACAUCGAGGUCGACAUCACCUACGCGGAGUACUUCGAGAUGAGCGU GCCUGGCCGAGGCCAUGAAGCGGUACGGCCUGAACACCAACCACCGGAUCGUGGUGUGCUCGGA GAACAGCCUGCAGUUCUUCAUGCCGGUGCUGGGCGCCCUCUUCAUCGGCGUGGCCCUUCAUCGGCGUGGCCCUUCAUCGCCGUACGCCCUGAACACCAACCACCGGAUCGUGGUGUGCUCGGA GAACAGCCUGCAGUUCUUCAUGC
- CpG 2216 CpG oligonucleotide GGGGGACGATCGTCGGGGGG (SEQ ID NO. 115)
- Short GU rich GU-rich RNA oligonucleotide GGUUUUUUUUUUUUUUUUGGG
- nucleic acid cargo R722 has been performed with the sequences R722A and/or R722B.
- Ovalbumine-derived peptide (SEQ ID NO. 116) SIINFEKL Ovalbumine: (SEQ ID NO. 117) MGSIGAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDST RTQINKVVRFDKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSF SLASRLYAEERYPILPEYLQCVKELYRGGLEPINFQTAADQARELINSWV ESQTNGIIRNVLQPSSVDSQTAMVLVNAIVFKGLWEKAFKDEDTQAMPFR VTEQESKPVQMMYQIGLFRVASMASEKMKILELPFASGTMSMLVLLPDEV SGLEQLESIINFEKLTEWTSSNVMEERKIKVYLPRMKMEEKYNLTSVLMA MGITDVFSSSANLSGISSAESLKISQAVHAAHAEINEAGREVVGSAEAGV DAASVSEEFRADHPFLFCIKHIATNAVL
- nucleic acid sequences as indicated in example 1 were prepared and used for formation of the polymerized polymeric carrier cargo complexes or for non-polymerized carrier cargo complexes for comparison. These polymeric carrier cargo complexes were used for in vitro and in vivo transaction, for in vitro immunostimulation and for particle characterizations.
- the DNA sequences, coding for the corresponding RNA sequences R1180, R722 and R491 sequences were prepared.
- the sequences of the corresponding RNAs are shown in the sequence listing (SEQ ID NOs: 112, 105, and 113).
- the short GU rich sequences and the CpG 2216 oligonucleotides were prepared by automatic solid-phase synthesis by means of phosphoramidite chemistry.
- the sequences are shown in the sequence listing (SEQ ID NOs: 115 and 114).
- the respective DNA plasmids prepared according to Example 2 for R1180, R722 and R491 were transcribed in vitro using T7-Polymerase (T7-Opti mRNA Kit, CureVac, Tubingen, Germany) following the manufactures instructions. Subsequently the mRNA was purified using PureMessenger® (CureVac, Tubingen, Germany).
- Example 1 The nucleic acid sequences defined above in Example 1 were mixed with the cationic components as defined in Example 1. Therefore, the indicated amount of nucleic acid sequence was mixed with the respective cationic component in mass ratios as indicated, thereby forming a complex. If polymerizing cationic components were used according to the present invention polymerization of the cationic components took place simultaneously to complexation of the nucleic acid cargo. Afterwards the resulting solution was adjusted with water to a final volume of 50 ⁇ l and incubated for 30 min at room temperature. The different ratios of cationic component/nucleic acid used in the experiments are shown in Table 1.
- the N/P ratio is the ratio of basic nitrogen atoms to phosphate residues, considering that nitrogen atoms confer to positive charges and phosphate of the phosphate backbone of the nucleic acid confers to the negative charge.
- N / P pmol ⁇ [ RNA ] * ratio * cationic ⁇ ⁇ AS ⁇ g ⁇ ⁇ RNA * 3 * 1000
- HPBMC cells from peripheral blood of healthy donors were isolated using a Ficoll gradient and washed subsequently with 1 ⁇ PBS (phophate-buffered saline). The cells were then seeded on 96-well microtiter plates (200 ⁇ 10/well). The hPBMC cells were incubated for 24 h with 10 pl of the polymeric carrier cargo complex from Example 3 containing the indicated amount of nucleic acid in X-VIVO 15 Medium (BioWhittaker). The immunostimulatory effect was measured by detecting the cytokine production of the hPBMCs (Tumour necrose factor alpha and Interferon alpha).
- ELISA microtiter plates (Nunc Maxisorb) were incubated over night (o/n) with binding buffer (0.02% NaN 3 , 15 mM Na 2 CO 3 , 15 mM NaHCO 3 , pH 9.7), additionally containing a specific cytokine antibody. Cells were then blocked with 1 ⁇ PBS, containing 1% BSA (bovine serum albumin). The cell supernatant was added and incubated for 4 h at 37° C. Subsequently, the microtiter plate was washed with 1 ⁇ PBS, containing 0.05% Tween-20 and then incubated with a Biotin-labelled secondary antibody (BD Pharmingen, Heidelberg, Germany).
- binding buffer 0.02% NaN 3 , 15 mM Na 2 CO 3 , 15 mM NaHCO 3 , pH 9.7
- BSA bovine serum albumin
- Streptavidin-coupled horseraddish peroxidase was added to the plate. Then, the plate was again washed with 1 ⁇ PBS, containing 0.05% Tween-20 and ABTS (2,2′-azino-bis(3-ethyl-benzthiazoline-6-sulfonic acid) was added as a substrate.
- the amount of cytokine was determined by measuring the absorption at 405 nm (OD 405) using a standard curve with recombinant cytokines (BD Pharmingen, Heidelberg , Germany) with the Sunrise ELISA-Reader from Tecan (Crailsheim, Germany). The respective results are shown in FIG. 3-9 .
- the Zeta potential of the polymeric carrier cargo complexes was evaluated by the laser Doppler electrophoresis method using a Zetasizer Nano (Malvern Instruments, Malvern, UK). The measurement was performed at 25° C. and a scattering angle of 173° was used. The results are shown in FIG. 2 .
- hydrodynamic diameters of polymeric carrier cargo complexes as prepared above were measured by dynamic light scattering using a Zetasizer Nano (Malvern Instruments, Malvern, UK) according to the manufacturer's instructions. The measurements were performed at 25° C. in buffer analysed by a cumulant method to obtain the hydrodynamic diameters and polydispersity indices of the polymeric carrier cargo complexes. Polymeric carrier cargo complexes were formed as indicated in Example 3 and the hydrodynamic diameters were measured with fresh prepared complexes and with reconstituted complexes after lyophilization. The respective results of the experiment are shown in FIG. 1 .
- Ovalbumine protein 5 ⁇ g
- Ovalbumin-specific peptide SIINFEKL 50 ⁇ g
- the vaccines Ovalbumine protein (OVA) (5 ⁇ g) or Ovalbumin-specific peptide SIINFEKL (50 ⁇ g) were combined with the polymeric cargo complexes R722/CR 12 C (in a ratio of 2:1 w/w) (30 ⁇ g R722/15 ⁇ g CR 12 C) as adjuvant and injected intradermally into female C57BL/6 mice (7 mice per group for tumour challenge and 5 mice per group for detection of an immune response). The vaccination was repeated 2 times in 2 weeks. For comparison mice were injected alone with the antigens.
- the vaccine Rabipur® or HDC (both comprise inactivated Rabies virus) (0.1, 0.01 and 0.001 fold human dose) was combined with the polymeric cargo complexes R722/CR 12 C (in a ratio of 3.7:1 w/w) (30 ⁇ g R722/8.1 ⁇ g CR 12 C) as adjuvant and injected intramuscularly into female Balb/c mice (5 or 8 mice per group; as indicated). For comparison mice were injected with Rabipur® or HDC alone.
- the vaccine Pandemrix® or Celvapan® both comprise inactivated A(H1N1)pdm09 influenza virus) (0.1 ⁇ g/dose) was combined with the polymeric cargo complexes R722/CR 12 C (in a ratio of 2:1 w/w) (15 ⁇ g R722/7.5 ⁇ g CR 12 C for Celvapan® and 30 ⁇ g R722/15 ⁇ g CR 12 C for Pandemrix®) as adjuvant and injected intramuscularly into female Balb/c mice (5 mice per group). For comparison mice were injected with Pandemrix® or Celvapan® alone.
- the seasonal influenza vaccine Begrivac® (comprises inactivated influenza virus strains as recommended by the WHO; season 2009/2010) (0.1 ⁇ g/dose) was combined with the polymeric cargo complexes R722/CR 12 C (in a ratio of 2:1 w/w) (30 ⁇ g R722/15 ⁇ g CR 12 C) as adjuvant and injected intramuscularly into female Balb/c mice (8 mice per group). For comparison mice were injected with Begrivac® alone.
- Hepatitis B vaccine Engerix®-B (comprises recombinant Hepatitis B surface antigen) (0.5 ⁇ g/dose) was combined with the polymeric cargo complexes R722/CR 12 C (in a ratio of 3.7:1 w/w) (6.25 ⁇ g R722/1.7 ⁇ g CR 12 C) as adjuvant and injected intramuscularly into female Balb/c mice (8 mice per group). For comparison mice were injected with Engerix®-B alone.
- HPV16-derived peptide E7 aa43-77 100 ⁇ g/dose
- the polymeric cargo complexes R722/C 12 C 50 ⁇ g R722/25 ⁇ g CR 12 C
- mice were injected with peptide alone.
- the HPV-derived peptide E7 aa43-77 (100 ⁇ g/dose) was combined with the polymeric cargo complexes R722/CR 12 C (in a ratio of 2:1 w/w) (50 ⁇ g R722/25 ⁇ g CR 12 C) during the polymerization step c) of the method of preparing the polymeric carrier cargo complexed as defined above. Therefore the HPV-derived peptide is part of the polymeric carrier cargo complex and is indicated as E7 aa43-77/R722/CR 12 C.
- mice were injected with peptide alone (E7 aa43-77) and the inventive pharmaceutical composition comprising the E7 aa43-77 peptide as antigen and the polymeric carrier cargo complex as adjuvant, wherein the polymeric carrier cargo complex does not comprise the antigen (E7 aa43-77+R722/CR 12 C).
- tumour antigen NY-ESO-1 protein 5 ⁇ g/dose
- polymeric cargo complexes R722/CR 12 C in a ratio of 2:1 w/w
- mice were injected 2 times within 15 days intramuscularly into female C57BL/6 mice (5 mice per group).
- mice were injected with protein alone.
- B-cell immune response Detection of an antigen specific immune response (B-cell immune response) was carried out by detecting antigen specific antibodies. Therefore, blood samples Were taken from vaccinated mice 5 days after the last vaccination and sera were prepared. MaxiSorb plates (Nalgene Nunc International) were coated with Gallus gallus ovalbumine protein. After blocking with 1 ⁇ PBS containing 0.05% Tween-20 and 1% BSA the plates were incubated with diluted mouse serum. Subsequently a biotin-coupled secondary antibody (Anti-mouse-IgG2a Pharmingen) was added.
- Anti-mouse-IgG2a Pharmingen Anti-mouse-IgG2a Pharmingen
- Detection of an antigen specific immune response was carried out by detecting Rabies virus specific total IgG antibodies. Therefore, blood samples were taken from vaccinated mice 7 and 21 days after vaccination and sera were prepared. MaxiSorb plates (Nalgene Nunc International) were coated with the commercially available rabies vaccine containing inactivated virus (HDC; 1:10000). After blocking with 1 ⁇ PBS containing 0.05% Tween-20 and 1% BSA the plates were incubated with diluted mouse serum. Subsequently a Horseradish peroxidase-coupled secondary antibody (Anti-mouse-IgG Pharmingen) was added.
- Anti-mouse-IgG Pharmingen Horseradish peroxidase-coupled secondary antibody
- Detection of the total IgG antibodies directed against Rabies virus was carried out as disclosed under b) with the differences that mouse sera were only tested at a dilution of 1:40. Furthermore after incubation with the mouse serum the plates were washed with an increasing concentration of urea (6, 7 and 8 M urea). By washing with urea only antibodies with a high affinity to the antigen can be detected. The results of this induction of antibodies upon vaccination with an inventive pharmaceutical composition are shown in FIG. 15 .
- B-cell immune response Detection of an antigen specific immune response (B-cell immune response) was carried out by detecting A(H1N1)pdm09 influenza virus specific IgG2a antibodies. Therefore, blood samples were taken from vaccinated mice 14 days after vaccination and sera were prepared. MaxiSorb plates (Nalgene Nunc International) were coated with Influenza A/California/7/09 ⁇ (H1N1)pdm09 inactivated virus (NIBSC, UK) (at 1 ⁇ g/ml). After blocking with 1 ⁇ PBS containing 0.05% Tween-20 and 1% BSA the plates were incubated with diluted mouse serum.
- Detection of an antigen specific immune response was carried out by detecting influenza virus specific IgG2a antibodies. Therefore, blood samples were taken from vaccinated mice 28 days after vaccination and sera were prepared. MaxiSorb plates (Nalgene Nunc International) were coated with Influvac 2009/10® (at 5 ⁇ g/ml) containing the same viral Influenza antigens as the Influenza vaccine used for vaccination. After blocking with 1 ⁇ PBS containing 0.05% Tween-20 and 1% BSA the plates were incubated with diluted mouse serum. Subsequently a biotin-coupled secondary antibody (Anti-mouse-IgG2a Pharmingen) was added.
- Anti-mouse-IgG2a Pharmingen Anti-mouse-IgG2a Pharmingen
- HBsAG specific immune response was carried out by detecting HBsAG specific IgG2a antibodies. Therefore, blood samples were taken from vaccinated mice 28 days after vaccination and sera were prepared. MaxiSorb plates (Nalgene Nunc International) were coated with recombinant Hepatitis B Surface Antigen (HBsAG) (Aldevron, USA) (1 ⁇ g/ml).
- a coat multiscreen plate (Millipore) was incubated overnight with coating buffer (0.1 M Carbonat-Bicarbonat Buffer pH 9.6, 10.59 g/l Na 2 CO 3 , 8.4 g/l NaHCO 3 ) comprising antibody against INF ⁇ (BD Pharmingen, Heidelberg, Germany).
- coating buffer 0.1 M Carbonat-Bicarbonat Buffer pH 9.6, 10.59 g/l Na 2 CO 3 , 8.4 g/l NaHCO 3
- the cells are incubated for 24 h at 37° C.
- the plates were washed 3 times with PBS, once with water and once with PBS/0.05% Tween-20 and afterwards incubated with a biotin-coupled secondary antibody for 11-24 h at 4° C.
- the plates were washed with PBS/0.05% Tween-20 and incubated for 2 h at room temperature with alkaline phosphatase coupled to streptavidin in blocking buffer.
- a coat multiscreen plate (Millipore) was incubated overnight with coating buffer (0.1 M Carbonat-Bicarbonat Buffer pH 9.6, 10.59 g/l Na 2 CO 3 , 8.4 g/l NaHCO 3 ) comprising antibody against INF ⁇ (BD Pharmingen, Heidelberg, Germany).
- coating buffer 0.1 M Carbonat-Bicarbonat Buffer pH 9.6, 10.59 g/l Na 2 CO 3 , 8.4 g/l NaHCO 3
- the next day 5 ⁇ 10 5 cells/well were added and re-stimulated with inactivated Rabies virus (Rabipur® 1:100 or HDC 1:100)) or buffer without peptide (BSA). Afterwards the cells are incubated for 24 h at 37° C.
- the plates were washed 3 times with PBS, for 5 minutes with water and once with PBS/0.05% Tween-20 and afterwards incubated with a biotin-coupled secondary antibody for 11-24 h at 4° C. Then the plates were washed with PBS/0.05% Tween-20 and incubated for 2 h at room temperature with alkaline phosphatase coupled to streptavidin in blocking buffer. After washing with PBS/0.05% Tween-20 the substrate (5-Bromo-4-Cloro-3-Indolyl Phosphate/Nitro Blue Tetrazolium Liquid Substrate System from Sigma Aldrich, Taufkirchen, Germany) was added to the plate and the conversion of the substrate could be detected visually.
- a coat multiscreen plate (Millipore) was incubated overnight with coating buffer (0.1 M Carbonat-Bicarbonat Buffer pH 9.6, 10.59 g/l Na 2 CO 3 , 8.4 g/l NaHCO 3 ) comprising antibody against INF ⁇ (BD Pharmingen, Heidelberg, Germany).
- coating buffer 0.1 M Carbonat-Bicarbonat Buffer pH 9.6, 10.59 g/l Na 2 CO 3 , 8.4 g/l NaHCO 3
- the next day 5 ⁇ 10 5 cells/well were added and re-stimulated with Influenza A/California/7/09 A(H1N1)pdm09 inactivated virus (NIBSC, UK) (10 ⁇ g/ml?) or buffer without peptide (BSA).
- the cells are incubated for 24 h at 37° C.
- the plates were washed 3 times with PBS, for 5 minutes with water and once with PBS/0.05% Tween-20 and afterwards incubated with a biotin-coupled secondary antibody for 11-24 h at 4° C.
- the plates were washed with PBS/0.05% Tween-20 and incubated for 2 h at room temperature with alkaline phosphatase coupled to streptavidin in blocking buffer.
- a coat multiscreen plate (Millipore) was incubated overnight with coating buffer (0.1 M Carbonat-Bicarbonat Buffer pH 9.6, 10.59 WI Na 2 CO 3 , 8.4 g/l NaHCO 3 ) comprising antibody against INF ⁇ (BD Pharmingen, Heidelberg, Germany).
- coating buffer 0.1 M Carbonat-Bicarbonat Buffer pH 9.6, 10.59 WI Na 2 CO 3 , 8.4 g/l NaHCO 3
- E7 derived peptides E7 aa43-77, E748-57, E7 aa49-57
- DMSO buffer without peptide
- the cells are incubated for 24 h at 37° C.
- the plates were washed 3 times with PBS, for 5 minutes with water and once with PBS/0.05% Tween-20 and afterwards incubated with a biotin-coupled secondary antibody for 11-24 h at 4° C.
- the plates were washed with PBS/0.05% Tween-20 and incubated for 2 h at room temperature with alkaline phosphatase coupled to streptavidin in blocking buffer.
- the substrate (5-Bromo-4-Cloro-3-Indolyl Phosphate/Nitro Blue Tetrazolium Liquid Substrate System from Sigma Aldrich, Taufkirchen, Germany) was added to the plate and the conversion of the substrate could be detected visually.
- the reaction was then stopped by washing the plates with water.
- the dried plates were then read out by an ELISPOT plate reader. For visualization of the spot levels the numbers were corrected by background subtraction.
- the plates were washed 3 times with PBS, once with water and once with PBS/0.05% Tween-20 and afterwards incubated with a biotin-coupled secondary antibody for 11-24 h at 4° C. Then the plates were washed with PBS/0.05% Tween-20 and incubated for 2 h at room temperature with alkaline phosphatase coupled to streptavidin in blocking buffer. After washing with PBS/0.05% Tween-20 the substrate (5-Bromo-4-Cloro-3-Indolyl Phosphate/Nitro Blue Tetrazolium Liquid Substrate System from Sigma Aldrich, Taufkirchen, Germany) was added to the plate and the conversion of the substrate could be detected visually.
- E.G7-OVA cells tumor cells which stably express ovalbumine
- Tumour growth was monitored by measuring the tumour size in 3 dimensions using a calliper.
- the results of the induction of an anti-tumoural response upon vaccination with an inventive pharmaceutical composition are shown in FIG. 10 .
- Detection of the virus neutralizing antibody response was carried out by the mean of virus neutralisation assay. Therefore, blood samples were taken from vaccinated mice 21 days after vaccination and sera were prepared. These sera were used in fluorescent antibody virus neutralisation (FAVN) test using the cell culture adapted challenge virus strain (CVS) of rabies virus as recommended by the OIE (World Organisation for Animal Health) and first described in Cliquet F., Aubert M. & Sagne L. (1998); J. Immunol. Methods, 212, 79-87.
- FAVN fluorescent antibody virus neutralisation
- mice in the experiment 37 days after single intramuscular immunization of mice using 0.001 fold human dose of Rabipur® and 3 ⁇ g R722 and 0.81 ⁇ g CR 12 C (3.7:1 w/w) all mice in the experiment were infected using 25-fold LD 50 of CVS strain of Rabies virus intracranially (i.c.). Mice were monitored for specific symptoms of Rabies disease and body weight development. The results of this experiment are shown in FIG. 24 .
- mice Eight C57BL/6 mice per group were challenged on day 1 with 1 ⁇ 10 5 TC-1 cells which express the HPV E6 and E7 protein. Vaccination started on day 7 after tumor challenge (median tumor volume 31-48 mm 3 ). Mice were intradermally vaccinated 5 times (on day 8, 12, 15, 19 and 22) with 5 ⁇ g or 50 ⁇ g E7 peptide combined with 50 ⁇ g CR 12 C/R722 (1:2; w/w). For comparison, mice were injected with the polymeric cargo complexes alone.
- the polymeric carrier cargo complex combined with HPV-16 derived E7 peptide E7aa43-77 even impairs the growth of tumours compared to the polymeric carrier cargo complex alone ( FIG. 25 ).
- the polymeric carrier cargo complex combined with HPV-16 derived E7 peptide strongly enhances the survival of tumor bearing mice (Mean survival time of 44.5 days for 50 ⁇ g E7 peptide+50 ⁇ g polymeric carrier cargo complex; mean survival time of 22 days for 5 ⁇ g E7 peptide+50 ⁇ g polymeric carrier cargo complex) compared to the E7 peptide or 50 polymeric carrier cargo complex alone ( FIG. 26 ).
- mice per group were intradermally vaccinated once per week for four weeks (on days 0, 7, 14 and 21) with the polymeric carrier cargo complex formed by the disulfide-crosslinked cationic peptide CR12C as carrier and the isRNA R722 as nucleic acid cargo and the E7 peptide.
- mice/group Eight weeks after the fourth vaccination, 5 mice/group were sacrificed, splenocytes were isolated and the frequency of antigen-specific CD8 + T cells was determined by HPV-pentamer staining and flow cytometry according to example 15.
- the combination of the polymeric carrier cargo complex combined with the HPV-16 derived E7 peptide induces a potent memory CD8 + T cell response ( FIG. 27 ).
- mice/group Eight weeks after the fourth vaccination 8 mice/group were challenged with 1 ⁇ 10 5 TC-1 tumor cells and tumor growth was monitored.
- the polymeric carrier cargo complex combined with the HPV-16 derived E7 peptide E7aa43-77 results in a drastic delay of tumor growth (4 complete responses for 5 ⁇ g E7 peptide+50 ⁇ g of 50 ⁇ g polymeric carrier cargo complex; 7 complete responders for 50 ⁇ g E7 peptide+50 ⁇ g of 50 ⁇ g polymeric carrier cargo complex).
- the combination of the polymeric carrier cargo complex combined with the HPV-16 derived E7 peptide induces a potent memory CD8 + T cell response ( FIG. 28 ).
- Freshly isolated splenocytes were seeded into 96-well plates (2 ⁇ 10 6 cells/well) and stained with Fc-Block (1:100, anti-CD16/CD32; BD Biosciences). After a 20 minute incubation, the H-2Db-RAHYNIVTF-Pentamer (HPV 16 E7 49-57)-Pentamer-PE (10 ⁇ l/well) was added and cells were incubated for an additional 30 minutes at 4° C.
- the seasonal influenza vaccine Mutagrip® (comprises inactivated influenza virus strains as recommended by the WHO; season 2011/2012) (4.5, 0.45 and 0.045 ⁇ g) was combined with the polymeric cargo complexes R722/CR 12 C (in a ratio of 3.7:1 w/w) (5 ⁇ g R722/1.35 ⁇ g CR 12 C) as adjuvant and injected intramuscularly into female Balb/c mice (8 mice per group). For comparison mice were injected with Mutagrip® alone.
- HI influenza virus hemagglutinin inhibition
- Detection of an antigen specific immune response was carried out by detecting influenza virus specific IgG2a antibodies. Therefore, blood samples were taken from vaccinated mice 21 days after vaccination and sera were prepared. MaxiSorb plates (Nalgene Nunc International) were coated with inactivated influenza A/California/7/2009 H1N1 (NIBSC, Potters Bar, UK) at 1 ⁇ g/ml. After blocking with 1 ⁇ PBS containing 0.05% Tween-20 and 1% BSA the plates were incubated with diluted mouse serum. Subsequently, a biotin-coupled secondary antibody (Anti-mouse-IgG2a Pharmingen) was added.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EPPCT/EP2012/000420 | 2012-01-31 | ||
PCT/EP2012/000420 WO2013113326A1 (fr) | 2012-01-31 | 2012-01-31 | Composition pharmaceutique comprenant un complexe support polymère - charge et au moins un antigène de protéine ou de peptide |
PCT/EP2013/000291 WO2013113501A1 (fr) | 2012-01-31 | 2013-01-31 | Composition pharmaceutique comprenant un complexe cargo-support polymère et au moins un antigène protéinique ou peptidique |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2013/000291 A-371-Of-International WO2013113501A1 (fr) | 2012-01-31 | 2013-01-31 | Composition pharmaceutique comprenant un complexe cargo-support polymère et au moins un antigène protéinique ou peptidique |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/555,881 Continuation US11690910B2 (en) | 2012-01-31 | 2019-08-29 | Pharmaceutical composition comprising a polymeric carrier cargo complex and at least one protein or peptide antigen |
Publications (1)
Publication Number | Publication Date |
---|---|
US20150118264A1 true US20150118264A1 (en) | 2015-04-30 |
Family
ID=47631406
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/375,215 Abandoned US20150118264A1 (en) | 2012-01-31 | 2013-01-31 | Pharmaceutical composition comprising a polymeric carrier cargo complex and at least one protein or peptide antigen |
US16/555,881 Active US11690910B2 (en) | 2012-01-31 | 2019-08-29 | Pharmaceutical composition comprising a polymeric carrier cargo complex and at least one protein or peptide antigen |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US16/555,881 Active US11690910B2 (en) | 2012-01-31 | 2019-08-29 | Pharmaceutical composition comprising a polymeric carrier cargo complex and at least one protein or peptide antigen |
Country Status (14)
Country | Link |
---|---|
US (2) | US20150118264A1 (fr) |
EP (2) | EP2809353B1 (fr) |
JP (1) | JP6175451B2 (fr) |
KR (1) | KR102095606B1 (fr) |
CN (2) | CN104080481A (fr) |
AU (1) | AU2013214572B2 (fr) |
BR (1) | BR112014017525A8 (fr) |
CA (1) | CA2856615C (fr) |
ES (1) | ES2820872T3 (fr) |
IN (1) | IN2014DN05848A (fr) |
MX (1) | MX366858B (fr) |
RU (1) | RU2617058C2 (fr) |
SG (2) | SG10201606325SA (fr) |
WO (2) | WO2013113326A1 (fr) |
Cited By (104)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20130259879A1 (en) * | 2011-02-21 | 2013-10-03 | Curevac Gmbh | Vaccine composition comprising complexed immunostimulatory nucleic acids and antigens packaged with disulfide-linked polyethyleneglycol/peptide conjugates |
US20130287808A1 (en) * | 2010-11-05 | 2013-10-31 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Vaccines for preventing meningococcal infections |
US9447431B2 (en) | 2012-02-15 | 2016-09-20 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded therapeutic protein |
US9669089B2 (en) | 2012-02-15 | 2017-06-06 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded pathogenic antigen |
US9683233B2 (en) | 2012-03-27 | 2017-06-20 | Curevac Ag | Artificial nucleic acid molecules for improved protein or peptide expression |
US9688729B2 (en) | 2013-08-21 | 2017-06-27 | Curevac Ag | Respiratory syncytial virus (RSV) vaccine |
US9839697B2 (en) | 2010-08-13 | 2017-12-12 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(a) sequence or a polyadenylation signal for increasing the expression of an encoded protein |
US9872900B2 (en) | 2014-04-23 | 2018-01-23 | Modernatx, Inc. | Nucleic acid vaccines |
US9890391B2 (en) | 2012-03-27 | 2018-02-13 | Curevac Ag | RNA vector with an open reading frame, an albumin 3′-UTR, and a histone stem loop |
KR101835697B1 (ko) | 2016-04-19 | 2018-03-08 | 경희대학교 산학협력단 | 간흡충 바이러스-유사입자, 이를 제조하기 위한 벡터, 및 이의 제조방법 |
CN107810009A (zh) * | 2015-05-15 | 2018-03-16 | 库瑞瓦格股份公司 | 涉及施用至少一种mRNA构建体的初免‑加强方案 |
US9974845B2 (en) | 2013-02-22 | 2018-05-22 | Curevac Ag | Combination of vaccination and inhibition of the PD-1 pathway |
US10000545B2 (en) | 2012-07-27 | 2018-06-19 | Institut National De La Sante Et De La Recherche Medicale | CD147 as receptor for pilus-mediated adhesion of Meningococci to vascular endothelia |
WO2018112256A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur d'il-1 |
WO2018112215A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur de l'intégrine |
WO2018112223A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un modulateur tlr |
WO2018112232A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur des interleukines il-12/il-23 libéré à l'aide d'un dispositif ingérable |
WO2018112264A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec une chimoikine/un inhibiteur du récepteur de chimiokine |
WO2018112235A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur de smad7 |
WO2018112245A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur de jak et dispositifs associés |
WO2018112240A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur du tnf |
WO2018112255A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un immunosuppresseur |
WO2018112237A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur de l'il -6 r |
US10010592B2 (en) | 2012-02-15 | 2018-07-03 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded tumour antigen |
US10047375B2 (en) | 2013-12-30 | 2018-08-14 | Curevac Ag | Artificial nucleic acid molecules |
WO2018156106A1 (fr) * | 2017-02-22 | 2018-08-30 | Ding Enyu | Vaccin à arnm contre le cancer codant pour le gm-csf humain fusionné à de multiples épitopes en tandem |
US10080809B2 (en) | 2012-03-27 | 2018-09-25 | Curevac Ag | Artificial nucleic acid molecules comprising a 5′TOP UTR |
WO2018183931A1 (fr) | 2017-03-30 | 2018-10-04 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal au moyen d'il-10 ou d'un agoniste d'il-10 |
WO2018183941A2 (fr) | 2017-03-30 | 2018-10-04 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un agent biothérapeutique vivant |
WO2018183934A1 (fr) | 2017-03-30 | 2018-10-04 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur de chst15 |
WO2018183929A1 (fr) | 2017-03-30 | 2018-10-04 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un agent immunomodulateur libéré à l'aide d'un dispositif ingérable |
WO2018183932A1 (fr) | 2017-03-30 | 2018-10-04 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal à l'aide d'un inhibiteur d'il-13 |
WO2019021049A1 (fr) * | 2017-07-25 | 2019-01-31 | Instituto Nacional De Salud | Antigènes recombinants de giardia, purification d'anticorps polyclonaux igg et igy anti-giardia et détection de giardia |
WO2019036363A1 (fr) | 2017-08-14 | 2019-02-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec le glatiramer ou un sel pharmaceutiquement acceptable de celui-ci |
US10227665B2 (en) | 2012-01-26 | 2019-03-12 | Luc Montagnier | Detection of DNA sequences as risk factors for HIV infection |
CN109468294A (zh) * | 2018-11-06 | 2019-03-15 | 青岛古高生物科技有限公司 | 一种血红素-GroEL复合体及其制备方法和应用 |
US10232024B2 (en) | 2012-02-15 | 2019-03-19 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded allergenic antigen or an autoimmune self-antigen |
US10293060B2 (en) | 2013-08-21 | 2019-05-21 | Curevac Ag | Method for increasing expression of RNA-encoded proteins |
US10293058B2 (en) | 2015-04-22 | 2019-05-21 | Curevac Ag | RNA containing composition for treatment of tumor diseases |
US10307472B2 (en) | 2014-03-12 | 2019-06-04 | Curevac Ag | Combination of vaccination and OX40 agonists |
US10369216B2 (en) | 2014-04-01 | 2019-08-06 | Curevac Ag | Polymeric carrier cargo complex for use as an immunostimulating agent or as an adjuvant |
US10501768B2 (en) | 2015-07-13 | 2019-12-10 | Curevac Ag | Method of producing RNA from circular DNA and corresponding template DNA |
US10517827B2 (en) | 2015-05-20 | 2019-12-31 | Curevac Ag | Dry powder composition comprising long-chain RNA |
US10588959B2 (en) | 2013-08-21 | 2020-03-17 | Curevac Ag | Combination vaccine |
US10648017B2 (en) | 2013-12-30 | 2020-05-12 | Curevac Real Estate Gmbh | Methods for RNA analysis |
US10653768B2 (en) | 2015-04-13 | 2020-05-19 | Curevac Real Estate Gmbh | Method for producing RNA compositions |
US10682426B2 (en) | 2013-08-21 | 2020-06-16 | Curevac Ag | Rabies vaccine |
US10729654B2 (en) | 2015-05-20 | 2020-08-04 | Curevac Ag | Dry powder composition comprising long-chain RNA |
US10760070B2 (en) | 2015-05-29 | 2020-09-01 | Curevac Real Estate Gmbh | Method for producing and purifying RNA, comprising at least one step of tangential flow filtration |
US10780054B2 (en) | 2015-04-17 | 2020-09-22 | Curevac Real Estate Gmbh | Lyophilization of RNA |
US10837018B2 (en) | 2013-07-25 | 2020-11-17 | Exicure, Inc. | Spherical nucleic acid-based constructs as immunostimulatory agents for prophylactic and therapeutic use |
US10837039B2 (en) | 2014-06-10 | 2020-11-17 | Curevac Real Estate Gmbh | Methods and means for enhancing RNA production |
US10898584B2 (en) | 2013-11-01 | 2021-01-26 | Curevac Ag | Modified RNA with decreased immunostimulatory properties |
US10988754B2 (en) | 2017-07-04 | 2021-04-27 | Cure Vac AG | Nucleic acid molecules |
US11040112B2 (en) | 2015-10-28 | 2021-06-22 | Acuitas Therapeutics, Inc. | Lipids and lipid nanoparticle formulations for delivery of nucleic acids |
US11078247B2 (en) | 2016-05-04 | 2021-08-03 | Curevac Ag | RNA encoding a therapeutic protein |
US11123294B2 (en) | 2014-06-04 | 2021-09-21 | Exicure Operating Company | Multivalent delivery of immune modulators by liposomal spherical nucleic acids for prophylactic or therapeutic applications |
US11141474B2 (en) | 2016-05-04 | 2021-10-12 | Curevac Ag | Artificial nucleic acid molecules encoding a norovirus antigen and uses thereof |
US11141476B2 (en) | 2016-12-23 | 2021-10-12 | Curevac Ag | MERS coronavirus vaccine |
US11149278B2 (en) | 2014-12-12 | 2021-10-19 | Curevac Ag | Artificial nucleic acid molecules for improved protein expression |
US11168051B2 (en) | 2015-06-29 | 2021-11-09 | Acuitas Therapeutics, Inc. | Lipids and lipid nanoparticle formulations for delivery of nucleic acids |
US11213593B2 (en) | 2014-11-21 | 2022-01-04 | Northwestern University | Sequence-specific cellular uptake of spherical nucleic acid nanoparticle conjugates |
US11225682B2 (en) | 2015-10-12 | 2022-01-18 | Curevac Ag | Automated method for isolation, selection and/or detection of microorganisms or cells comprised in a solution |
US11241493B2 (en) | 2020-02-04 | 2022-02-08 | Curevac Ag | Coronavirus vaccine |
US11248223B2 (en) | 2015-12-23 | 2022-02-15 | Curevac Ag | Method of RNA in vitro transcription using a buffer containing a dicarboxylic acid or tricarboxylic acid or a salt thereof |
US11254951B2 (en) | 2014-12-30 | 2022-02-22 | Curevac Ag | Artificial nucleic acid molecules |
US11279923B2 (en) | 2016-11-28 | 2022-03-22 | Curevac Ag | Method for purifying RNA |
US11357856B2 (en) | 2017-04-13 | 2022-06-14 | Acuitas Therapeutics, Inc. | Lipids for delivery of active agents |
US11364304B2 (en) | 2016-08-25 | 2022-06-21 | Northwestern University | Crosslinked micellar spherical nucleic acids |
US11384375B2 (en) | 2015-04-30 | 2022-07-12 | Curevac Ag | Immobilized poly(n)polymerase |
EP4035659A1 (fr) | 2016-11-29 | 2022-08-03 | PureTech LYT, Inc. | Exosomes destinés à l'administration d'agents thérapeutiques |
US11413346B2 (en) | 2015-11-09 | 2022-08-16 | Curevac Ag | Rotavirus vaccines |
US11464836B2 (en) | 2016-12-08 | 2022-10-11 | Curevac Ag | RNA for treatment or prophylaxis of a liver disease |
US11464847B2 (en) | 2016-12-23 | 2022-10-11 | Curevac Ag | Lassa virus vaccine |
US11471525B2 (en) | 2020-02-04 | 2022-10-18 | Curevac Ag | Coronavirus vaccine |
US11478552B2 (en) | 2016-06-09 | 2022-10-25 | Curevac Ag | Hybrid carriers for nucleic acid cargo |
US11525158B2 (en) | 2017-12-21 | 2022-12-13 | CureVac SE | Linear double stranded DNA coupled to a single support or a tag and methods for producing said linear double stranded DNA |
US11524066B2 (en) | 2016-12-23 | 2022-12-13 | CureVac SE | Henipavirus vaccine |
US11524932B2 (en) | 2017-08-17 | 2022-12-13 | Acuitas Therapeutics, Inc. | Lipids for use in lipid nanoparticle formulations |
US11542225B2 (en) | 2017-08-17 | 2023-01-03 | Acuitas Therapeutics, Inc. | Lipids for use in lipid nanoparticle formulations |
US11542490B2 (en) | 2016-12-08 | 2023-01-03 | CureVac SE | RNAs for wound healing |
US11596699B2 (en) | 2016-04-29 | 2023-03-07 | CureVac SE | RNA encoding an antibody |
US11602557B2 (en) | 2017-08-22 | 2023-03-14 | Cure Vac SE | Bunyavirales vaccine |
US11608513B2 (en) | 2015-05-29 | 2023-03-21 | CureVac SE | Method for adding cap structures to RNA using immobilized enzymes |
CN115925822A (zh) * | 2022-09-01 | 2023-04-07 | 广州源博医药科技有限公司 | 一种重组蛋白及其在制备呼吸道合胞病毒疫苗中的应用 |
US11634379B2 (en) | 2014-06-25 | 2023-04-25 | Acuitas Therapeutics, Inc. | Lipids and lipid nanoparticle formulations for delivery of nucleic acids |
US11639329B2 (en) | 2017-08-16 | 2023-05-02 | Acuitas Therapeutics, Inc. | Lipids for use in lipid nanoparticle formulations |
US11661634B2 (en) | 2015-05-08 | 2023-05-30 | CureVac Manufacturing GmbH | Method for producing RNA |
US11660332B2 (en) | 2017-04-27 | 2023-05-30 | The Trustees Of The University Of Pennsylvania | Nucleoside-modified mRNA-lipid nanoparticle lineage vaccine for hepatitis C virus |
US11684665B2 (en) | 2015-12-22 | 2023-06-27 | CureVac SE | Method for producing RNA molecule compositions |
US11692002B2 (en) | 2017-11-08 | 2023-07-04 | CureVac SE | RNA sequence adaptation |
US11696954B2 (en) | 2017-04-28 | 2023-07-11 | Exicure Operating Company | Synthesis of spherical nucleic acids using lipophilic moieties |
US11697816B2 (en) | 2013-12-30 | 2023-07-11 | CureVac SE | Artificial nucleic acid molecules |
US11723967B2 (en) | 2016-02-17 | 2023-08-15 | CureVac SE | Zika virus vaccine |
US11739335B2 (en) | 2017-03-24 | 2023-08-29 | CureVac SE | Nucleic acids encoding CRISPR-associated proteins and uses thereof |
CN116769786A (zh) * | 2022-09-07 | 2023-09-19 | 贵州大学 | 飞蝗气味结合蛋白LmOBP11基因及其编码蛋白与应用 |
EP4252629A2 (fr) | 2016-12-07 | 2023-10-04 | Biora Therapeutics, Inc. | Procédés, dispositifs et systèmes de détection du tractus gastro-intestinal |
US11820728B2 (en) | 2017-04-28 | 2023-11-21 | Acuitas Therapeutics, Inc. | Carbonyl lipids and lipid nanoparticle formulations for delivery of nucleic acids |
WO2023230241A1 (fr) * | 2022-05-27 | 2023-11-30 | Design-Zyme LLC | Adjuvant universel pour l'administration nasale, orale et intramusculaire de vaccins |
US11872280B2 (en) | 2020-12-22 | 2024-01-16 | CureVac SE | RNA vaccine against SARS-CoV-2 variants |
US11920174B2 (en) | 2016-03-03 | 2024-03-05 | CureVac SE | RNA analysis by total hydrolysis and quantification of released nucleosides |
US11931406B2 (en) | 2017-12-13 | 2024-03-19 | CureVac SE | Flavivirus vaccine |
US11975064B2 (en) | 2011-03-02 | 2024-05-07 | CureVac SE | Vaccination with mRNA-coded antigens |
US11976019B2 (en) | 2020-07-16 | 2024-05-07 | Acuitas Therapeutics, Inc. | Cationic lipids for use in lipid nanoparticles |
Families Citing this family (99)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2009030254A1 (fr) | 2007-09-04 | 2009-03-12 | Curevac Gmbh | Complexes d'arn et de peptides cationiques pour transfection et immunostimulation |
US20110053829A1 (en) | 2009-09-03 | 2011-03-03 | Curevac Gmbh | Disulfide-linked polyethyleneglycol/peptide conjugates for the transfection of nucleic acids |
EP2955230A1 (fr) | 2010-07-30 | 2015-12-16 | CureVac AG | Complexation d'acides nucléiques avec des polymères cationiques à réticulation disulfure pour la transfection et l'immunostimulation |
EP3578205A1 (fr) | 2010-08-06 | 2019-12-11 | ModernaTX, Inc. | Compositions pharmaceutiques a base d'acides nucléiques modifiés et leur utilisation medicale |
RU2013120302A (ru) | 2010-10-01 | 2014-11-20 | Модерна Терапьютикс, Инк. | Сконструированные нуклеиновые кислоты и способы их применения |
JP2014511687A (ja) | 2011-03-31 | 2014-05-19 | モデルナ セラピューティクス インコーポレイテッド | 工学操作された核酸の送達および製剤 |
US9464124B2 (en) | 2011-09-12 | 2016-10-11 | Moderna Therapeutics, Inc. | Engineered nucleic acids and methods of use thereof |
US9428535B2 (en) | 2011-10-03 | 2016-08-30 | Moderna Therapeutics, Inc. | Modified nucleosides, nucleotides, and nucleic acids, and uses thereof |
LT2791160T (lt) | 2011-12-16 | 2022-06-10 | Modernatx, Inc. | Modifikuotos mrnr sudėtys |
WO2013113325A1 (fr) * | 2012-01-31 | 2013-08-08 | Curevac Gmbh | Complexes chargés négativement comprenant des acides nucléiques pour l'immunostimulation |
US9254311B2 (en) | 2012-04-02 | 2016-02-09 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of proteins |
US9283287B2 (en) | 2012-04-02 | 2016-03-15 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of nuclear proteins |
US9192651B2 (en) | 2012-04-02 | 2015-11-24 | Moderna Therapeutics, Inc. | Modified polynucleotides for the production of secreted proteins |
US9572897B2 (en) | 2012-04-02 | 2017-02-21 | Modernatx, Inc. | Modified polynucleotides for the production of cytoplasmic and cytoskeletal proteins |
WO2014081507A1 (fr) | 2012-11-26 | 2014-05-30 | Moderna Therapeutics, Inc. | Arn modifié à son extrémité terminale |
EP2971010B1 (fr) | 2013-03-14 | 2020-06-10 | ModernaTX, Inc. | Formulation et administration de compositions de nucléosides, de nucléotides, et d'acides nucléiques modifiés |
EP2971161B1 (fr) | 2013-03-15 | 2018-12-26 | ModernaTX, Inc. | Purification d'acide ribonucléique |
EP2971165A4 (fr) | 2013-03-15 | 2016-11-23 | Moderna Therapeutics Inc | Elimination de fragments d'adn dans des procédés de production d'arnm |
US10590161B2 (en) | 2013-03-15 | 2020-03-17 | Modernatx, Inc. | Ion exchange purification of mRNA |
US10138507B2 (en) | 2013-03-15 | 2018-11-27 | Modernatx, Inc. | Manufacturing methods for production of RNA transcripts |
US8980864B2 (en) | 2013-03-15 | 2015-03-17 | Moderna Therapeutics, Inc. | Compositions and methods of altering cholesterol levels |
JP7019233B2 (ja) | 2013-07-11 | 2022-02-15 | モデルナティエックス インコーポレイテッド | CRISPR関連タンパク質をコードする合成ポリヌクレオチドおよび合成sgRNAを含む組成物ならびに使用方法 |
AU2014306603B2 (en) | 2013-08-13 | 2020-03-12 | Northwestern University | Peptide conjugated particles |
AU2014315287A1 (en) | 2013-09-03 | 2015-03-12 | Moderna Therapeutics, Inc. | Chimeric polynucleotides |
EP3041938A1 (fr) | 2013-09-03 | 2016-07-13 | Moderna Therapeutics, Inc. | Polynucléotides circulaires |
EP3052106A4 (fr) | 2013-09-30 | 2017-07-19 | ModernaTX, Inc. | Polynucléotides codant des polypeptides de modulation immunitaire |
EP3052511A4 (fr) | 2013-10-02 | 2017-05-31 | Moderna Therapeutics, Inc. | Molécules de polynucléotides et leurs utilisations |
CA2926218A1 (fr) | 2013-10-03 | 2015-04-09 | Moderna Therapeutics, Inc. | Polynucleotides codant pour un recepteur de lipoproteines de faible densite |
CN103695539A (zh) * | 2013-12-12 | 2014-04-02 | 苏州科技学院 | 一种用家蚕生殖腺的体外培养来检测壬基酚毒性的方法 |
EP3157573A4 (fr) | 2014-06-19 | 2018-02-21 | Moderna Therapeutics, Inc. | Molécules d'acide nucléique alternatives et leurs utilisations |
JP2017522028A (ja) | 2014-07-16 | 2017-08-10 | モデルナティエックス インコーポレイテッドModernaTX,Inc. | 環状ポリヌクレオチド |
EP3169693B1 (fr) | 2014-07-16 | 2022-03-09 | ModernaTX, Inc. | Polynucléotides chimériques |
US20170210788A1 (en) | 2014-07-23 | 2017-07-27 | Modernatx, Inc. | Modified polynucleotides for the production of intrabodies |
GB201421692D0 (en) * | 2014-12-05 | 2015-01-21 | Iquar Ltd | Vaccines based on hepatitis B core antigens |
WO2016172219A1 (fr) * | 2015-04-24 | 2016-10-27 | The Arizona Board Of Regents On Behalf Of The University Of Arizona | Procédés et compositions visant à inhiber l'inflammation à médiation par les récepteurs de type toll (tlr) |
ES2910425T3 (es) | 2015-09-17 | 2022-05-12 | Modernatx Inc | Compuestos y composiciones para la administración intracelular de agentes terapéuticos |
WO2017049286A1 (fr) | 2015-09-17 | 2017-03-23 | Moderna Therapeutics, Inc. | Polynucléotides contenant un lieur morpholino |
JP2018530587A (ja) | 2015-10-16 | 2018-10-18 | モデルナティエックス インコーポレイテッドModernaTX,Inc. | mRNAキャップ類似体およびmRNAキャッピングの方法 |
WO2017066789A1 (fr) | 2015-10-16 | 2017-04-20 | Modernatx, Inc. | Analogues de coiffe d'arnm avec sucre modifié |
WO2017066791A1 (fr) | 2015-10-16 | 2017-04-20 | Modernatx, Inc. | Analogues de coiffe d'arnm à substitution sucre |
ES2914225T3 (es) | 2015-10-16 | 2022-06-08 | Modernatx Inc | Análogos de cap de ARNm con enlace de fosfato modificado |
WO2017066782A1 (fr) | 2015-10-16 | 2017-04-20 | Modernatx, Inc. | Analogues de coiffes d'arnm hydrophobes |
US20180303929A1 (en) * | 2015-10-22 | 2018-10-25 | Moderna TX, Inc. | Herpes simplex virus vaccine |
SI3394030T1 (sl) | 2015-12-22 | 2022-04-29 | Modernatx, Inc. | Sestave za doziranje sredstev v celice |
CN108779074A (zh) | 2016-03-01 | 2018-11-09 | 分子传递有限公司 | 植物病毒移动蛋白和其使用方法 |
CN109715203A (zh) * | 2016-03-14 | 2019-05-03 | 雷德生物科技股份公司 | 用于治疗hsv的手段和方法 |
KR101881013B1 (ko) * | 2016-03-15 | 2018-07-23 | 경희대학교 산학협력단 | 톡소포자충 바이러스-유사입자, 이를 제조하기 위한 벡터, 및 이의 제조 방법 |
KR101881014B1 (ko) * | 2016-04-15 | 2018-07-23 | 경희대학교 산학협력단 | 톡소포자충 바이러스-유사입자, 이를 제조하기 위한 벡터, 및 이의 제조 방법 |
CA3027201A1 (fr) | 2016-06-14 | 2017-12-21 | Modernatx, Inc. | Formulations stabilisees de nanoparticules lipidiques |
MA45496A (fr) | 2016-06-17 | 2019-04-24 | Hoffmann La Roche | Molécules d'acide nucléique pour la réduction de l'arnm de padd5 ou pad7 pour le traitement d'une infection par l'hépatite b |
CA3025812A1 (fr) * | 2016-08-19 | 2018-02-22 | Curevac Ag | Arn pour la cancerotherapie |
EP3538067A1 (fr) | 2016-11-08 | 2019-09-18 | Modernatx, Inc. | Formulations stabilisées de nanoparticules lipidiques |
JP7078620B2 (ja) * | 2016-11-16 | 2022-05-31 | イミュノミック セラピューティックス, インコーポレイテッド | アレルギーの治療のための核酸 |
HUE060693T2 (hu) | 2017-03-15 | 2023-04-28 | Modernatx Inc | Vegyület és készítmények terápiás szerek intracelluláris bejuttatására |
US11969506B2 (en) | 2017-03-15 | 2024-04-30 | Modernatx, Inc. | Lipid nanoparticle formulation |
CN107412731B (zh) * | 2017-05-17 | 2020-06-05 | 广州弘宝元生物科技有限公司 | Ul43蛋白在制备预防和治疗线粒体功能障碍的药物中的应用 |
WO2018232120A1 (fr) | 2017-06-14 | 2018-12-20 | Modernatx, Inc. | Composés et compositions pour l'administration intracellulaire d'agents |
MA49421A (fr) | 2017-06-15 | 2020-04-22 | Modernatx Inc | Formulations d'arn |
KR101964751B1 (ko) * | 2017-07-05 | 2019-04-02 | 경희대학교 산학협력단 | 톡소포자충 바이러스-유사입자, 이를 유효성분으로 포함하는 백신 조성물, 이를 제조하기 위한 벡터, 및 이의 제조 방법 |
US20200362382A1 (en) | 2017-08-18 | 2020-11-19 | Modernatx, Inc. | Methods of preparing modified rna |
WO2019046809A1 (fr) | 2017-08-31 | 2019-03-07 | Modernatx, Inc. | Procédés de fabrication de nanoparticules lipidiques |
SG11202003461TA (en) | 2017-10-16 | 2020-05-28 | Hoffmann La Roche | NUCLEIC ACID MOLECULE FOR REDUCTION OF PAPD5 AND PAPD7 mRNA FOR TREATING HEPATITIS B INFECTION |
WO2019118919A1 (fr) * | 2017-12-15 | 2019-06-20 | Flagship Pioneering, Inc. | Compositions comprenant des polyribonucléotides circulaires et leurs utilisations |
CN108101966B (zh) * | 2017-12-26 | 2020-10-27 | 暨南大学 | 基于细胞穿膜肽的氧化还原敏感多肽及其在疫苗载体中的应用 |
WO2020061367A1 (fr) | 2018-09-19 | 2020-03-26 | Modernatx, Inc. | Composés et compositions pour l'administration intracellulaire d'agents thérapeutiques |
JP2022501367A (ja) | 2018-09-20 | 2022-01-06 | モデルナティエックス インコーポレイテッドModernaTX, Inc. | 脂質ナノ粒子の調製及びその投与方法 |
CN113840621A (zh) * | 2018-10-24 | 2021-12-24 | 德国癌症研究公共权益基金会 | 疫苗接种及抗体生成平台 |
RU2742580C2 (ru) * | 2018-12-26 | 2021-02-08 | федеральное государственное бюджетное учреждение «Национальный исследовательский центр эпидемиологии и микробиологии имени почетного академика Н.Ф. Гамалеи» Министерства здравоохранения Российской Федерации | Фармацевтическая композиция на основе PLGA для индукции эффективного мукозального иммунного ответа |
MX2021009245A (es) | 2019-01-31 | 2021-11-12 | Modernatx Inc | Metodos de preparacion de nanoparticulas lipidicas. |
MX2021009236A (es) | 2019-01-31 | 2021-11-12 | Modernatx Inc | Agitadores vorticiales y metodos, sistemas y aparatos asociados de estos. |
CN109701008B (zh) * | 2019-02-18 | 2022-06-21 | 山东兴瑞生物科技有限公司 | 针对单纯疱疹病毒的治疗性dc复合疫苗及其制备方法 |
KR102184153B1 (ko) * | 2019-02-25 | 2020-11-30 | 부산대학교 산학협력단 | 고분자 지지체 기반의 인플루엔자 바이러스 유사 구조체 및 이의 제조방법 |
EP4006057A4 (fr) * | 2019-07-11 | 2023-08-09 | Xiamen University | Complexe pour administration intracellulaire de molécules |
CN110364226B (zh) * | 2019-08-16 | 2021-03-26 | 复旦大学 | 一种用于辅助生殖供精策略的遗传风险预警方法和系统 |
CN111249444B (zh) * | 2020-03-10 | 2023-04-07 | 西北大学 | 一种用于抑制白色念珠菌的制剂 |
AU2021254312B2 (en) | 2020-04-09 | 2024-01-11 | Suzhou Abogen Biosciences Co., Ltd. | Lipid nanoparticle composition |
TW202204622A (zh) | 2020-04-09 | 2022-02-01 | 大陸商蘇州艾博生物科技有限公司 | 針對冠狀病毒之核酸疫苗 |
CN111551729B (zh) * | 2020-04-27 | 2021-02-09 | 浙江正熙生物技术股份有限公司 | 藻红蛋白免疫荧光探针制备方法 |
JP2023532707A (ja) | 2020-06-30 | 2023-07-31 | スージョウ・アボジェン・バイオサイエンシズ・カンパニー・リミテッド | 脂質化合物及び脂質ナノ粒子組成物 |
AU2021328980A1 (en) | 2020-08-20 | 2023-03-09 | Suzhou Abogen Biosciences Co., Ltd. | Lipid compounds and lipid nanoparticle compositions |
CN112321679B (zh) * | 2020-09-30 | 2022-10-14 | 四川大学 | 一种用于抑制真菌生物膜的寡肽及其应用 |
CN112831917A (zh) * | 2020-12-30 | 2021-05-25 | 淄博华士元环保科技有限公司 | Pbc/pla/tp复合抗菌敷料的制备方法 |
WO2022152109A2 (fr) | 2021-01-14 | 2022-07-21 | Suzhou Abogen Biosciences Co., Ltd. | Composés lipidiques et compositions de nanoparticules lipidiques |
CN116615472A (zh) | 2021-01-14 | 2023-08-18 | 苏州艾博生物科技有限公司 | 聚合物缀合的脂质化合物和脂质纳米颗粒组合物 |
CN112725488B (zh) * | 2021-02-04 | 2023-03-24 | 吉林大学 | 埃利希氏体病和莱姆病双重荧光定量pcr引物及试剂盒 |
CN113046328B (zh) * | 2021-04-13 | 2023-07-25 | 吉林大学 | 一株化脓隐秘杆菌噬菌体及其医用用途 |
CN113144182B (zh) * | 2021-04-22 | 2023-03-10 | 成都欧林生物科技股份有限公司 | 一种幽门螺杆菌口服缓释疫苗及其制备与应用 |
KR102490748B1 (ko) * | 2021-05-14 | 2023-01-20 | 주식회사 레메디 | 화물분자 수송 도메인 rmad1, 이의 변이체, 재조합 화물분자 및 이를 이용한 화물분자 수송 방법 |
WO2022247755A1 (fr) | 2021-05-24 | 2022-12-01 | Suzhou Abogen Biosciences Co., Ltd. | Composés lipidiques et compositions de nanoparticules lipidiques |
TW202328067A (zh) | 2021-09-14 | 2023-07-16 | 美商雷納嘉德醫療管理公司 | 環狀脂質及其使用方法 |
WO2023044343A1 (fr) | 2021-09-14 | 2023-03-23 | Renagade Therapeutics Management Inc. | Lipides acycliques et leurs procédés d'utilisation |
CN116064598B (zh) | 2021-10-08 | 2024-03-12 | 苏州艾博生物科技有限公司 | 冠状病毒的核酸疫苗 |
WO2023056917A1 (fr) | 2021-10-08 | 2023-04-13 | Suzhou Abogen Biosciences Co., Ltd. | Composés lipidiques et compositions de nanoparticules lipidiques |
AR127312A1 (es) | 2021-10-08 | 2024-01-10 | Suzhou Abogen Biosciences Co Ltd | Compuestos lipídicos ycomposiciones de nanopartículas lipídicas |
WO2023122752A1 (fr) | 2021-12-23 | 2023-06-29 | Renagade Therapeutics Management Inc. | Lipides contraints et procédés d'utilisation associés |
WO2023196931A1 (fr) | 2022-04-07 | 2023-10-12 | Renagade Therapeutics Management Inc. | Lipides cycliques et nanoparticules lipidiques (npl) pour l'apport d'acides nucléiques ou de peptides destinés à être utilisés dans la vaccination contre des agents infectieux |
WO2024037578A1 (fr) | 2022-08-18 | 2024-02-22 | Suzhou Abogen Biosciences Co., Ltd. | Composition de nanoparticules lipidiques |
CN116376848A (zh) * | 2022-12-13 | 2023-07-04 | 中国水产科学研究院黄海水产研究所 | 一种卤虫病毒及其检测方法和应用 |
CN117209574B (zh) * | 2023-07-28 | 2024-03-29 | 中国科学院动物研究所 | 特异针对蝗科害虫改造的高毒力罗伯茨绿僵菌及其制备方法和应用 |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20030133942A1 (en) * | 2001-02-21 | 2003-07-17 | Andrew Segal | Vaccine compositions and methods of modulating immune responses |
US20040019007A1 (en) * | 1995-12-13 | 2004-01-29 | Monahan Sean D. | Intravascular delivery of non-viral nucleic acid |
US20080248067A1 (en) * | 2005-04-14 | 2008-10-09 | The University Of Queensland | Immunomodulating Compositions and Uses Therefor |
Family Cites Families (118)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3906092A (en) | 1971-11-26 | 1975-09-16 | Merck & Co Inc | Stimulation of antibody response |
US4415732A (en) | 1981-03-27 | 1983-11-15 | University Patents, Inc. | Phosphoramidite compounds and processes |
US4401796A (en) | 1981-04-30 | 1983-08-30 | City Of Hope Research Institute | Solid-phase synthesis of polynucleotides |
US4373071A (en) | 1981-04-30 | 1983-02-08 | City Of Hope Research Institute | Solid-phase synthesis of polynucleotides |
DE3314999A1 (de) | 1983-04-26 | 1985-03-14 | Behringwerke Ag, 3550 Marburg | Verwendung des diterpen-derivates forskolin zur immunstimulation |
US5663163A (en) | 1987-09-07 | 1997-09-02 | Fujisawa Pharmaceutical Co., Ltd. | Cephem compounds and processes for preparation thereof |
CA1320446C (fr) | 1988-06-20 | 1993-07-20 | William A. Carter | Modulation d'etats cellulaires resistant a la lymphokine a l'aide de dsarn |
ATE147630T1 (de) | 1989-10-11 | 1997-02-15 | Hem Pharma Corp | Schutz gegen schock infolge einer schädigung durch doppelsträngige rna's |
DE69400208T2 (de) | 1993-01-25 | 1996-11-28 | Hybridon Inc | Olionukleotidalkylphosphonate und -phosphonothioate |
JPH08510720A (ja) | 1993-01-27 | 1996-11-12 | アフィマックス テクノロジーズ ナームロゼ フェンノートシャップ | 経皮的薬物送り出しのための組成物及び方法 |
US5516652A (en) | 1993-10-06 | 1996-05-14 | Merck Frosst Canada Inc. | DNA encoding prostaglandin receptor IP |
CA2184375C (fr) | 1994-03-18 | 2006-05-02 | Sergei M. Gryaznov | Synthese, composes, hybridation et proprietes de resistance aux nucleases d'oligonucleotides ayant des liaisons n3'-p5' phosphoramidates |
WO1995026204A1 (fr) | 1994-03-25 | 1995-10-05 | Isis Pharmaceuticals, Inc. | Stimulation immunitaire par des analogues d'oligonucleotides de phosphorothioate |
US5874560A (en) | 1994-04-22 | 1999-02-23 | The United States Of America As Represented By The Department Of Health And Human Services | Melanoma antigens and their use in diagnostic and therapeutic methods |
ES2366201T3 (es) | 1994-07-15 | 2011-10-18 | University Of Iowa Research Foundation | Oligonucleótidos inmunmoduladores. |
US6239116B1 (en) | 1994-07-15 | 2001-05-29 | University Of Iowa Research Foundation | Immunostimulatory nucleic acid molecules |
US6689757B1 (en) | 1996-02-12 | 2004-02-10 | M.L. Laboratories Plc | Methods for vaccination and vaccines therefor |
US6090391A (en) | 1996-02-23 | 2000-07-18 | Aviron | Recombinant tryptophan mutants of influenza |
ES2241042T3 (es) | 1996-10-11 | 2005-10-16 | The Regents Of The University Of California | Conjugados de polinucleotido inmunoestimulador/ molecula inmunomoduladora. |
EP0839912A1 (fr) | 1996-10-30 | 1998-05-06 | Instituut Voor Dierhouderij En Diergezondheid (Id-Dlo) | Clones infectieux de virus à ARN, vaccins et essais diagnostiques |
GB9623051D0 (en) | 1996-11-06 | 1997-01-08 | Schacht Etienne H | Delivery of DNA to target cells in biological systems |
EP0855184A1 (fr) | 1997-01-23 | 1998-07-29 | Grayson B. Dr. Lipford | Composition pharmaceutique comprenant un polynucléotide et un antigène notamment pour la vaccination |
US6406705B1 (en) | 1997-03-10 | 2002-06-18 | University Of Iowa Research Foundation | Use of nucleic acids containing unmethylated CpG dinucleotide as an adjuvant |
WO1998047913A2 (fr) | 1997-04-18 | 1998-10-29 | The University Of Medicine And Dentistry Of New Jersey | Inhibition d'une replication du vih-1 par un analogue peptidique tat du domaine de fixation d'arn |
ATE432348T1 (de) | 1997-06-06 | 2009-06-15 | Univ California | Inhibitoren von immunstimulatorischen dna sequenz aktivität |
EP1374894A3 (fr) | 1997-06-06 | 2004-09-22 | Dynavax Technologies Corporation | Oligonucléotides immunostimulants, compositions et utilisations correspondantes |
US20040006034A1 (en) | 1998-06-05 | 2004-01-08 | Eyal Raz | Immunostimulatory oligonucleotides, compositions thereof and methods of use thereof |
US6589940B1 (en) | 1997-06-06 | 2003-07-08 | Dynavax Technologies Corporation | Immunostimulatory oligonucleotides, compositions thereof and methods of use thereof |
ES2283070T3 (es) | 1997-09-05 | 2007-10-16 | The Regents Of The University Of California | Utilizacion de oligonucleotidos inmunoestimulantes para la prevencion o tratamiento del asma. |
US6096307A (en) | 1997-12-11 | 2000-08-01 | A. Glenn Braswell | Compositions for immunostimulation containing Echinacea angustofolia, bromelain, and lysozyme |
EP1067956B1 (fr) | 1998-04-03 | 2007-03-14 | University Of Iowa Research Foundation | Procedes et produits servant a stimuler le systeme immunitaire au moyen d'oligonucleotides et de cytokines immunotherapeutiques |
AU3758199A (en) | 1998-04-23 | 1999-11-08 | Regents Of The University Of Michigan, The | Peptides for efficient gene transfer |
US7138103B2 (en) | 1998-06-22 | 2006-11-21 | Immunomedics, Inc. | Use of bi-specific antibodies for pre-targeting diagnosis and therapy |
WO2000075304A1 (fr) | 1999-06-08 | 2000-12-14 | Aventis Pasteur | Oligonucleotide immunostimulant |
CA2312385A1 (fr) | 1999-06-22 | 2000-12-22 | Daiso Co., Ltd. | Procede pour la production de derives d'acide erythro-3-amino-2-hydroxybutyrique |
US6514948B1 (en) | 1999-07-02 | 2003-02-04 | The Regents Of The University Of California | Method for enhancing an immune response |
WO2001004135A2 (fr) | 1999-07-13 | 2001-01-18 | The Regents Of The University Of Michigan | Compositions de condensat d'adn reticule et techniques d'administration de genes |
US6770740B1 (en) | 1999-07-13 | 2004-08-03 | The Regents Of The University Of Michigan | Crosslinked DNA condensate compositions and gene delivery methods |
US20030104622A1 (en) | 1999-09-01 | 2003-06-05 | Robbins Paul D. | Identification of peptides that facilitate uptake and cytoplasmic and/or nuclear transport of proteins, DNA and viruses |
ATE289630T1 (de) | 1999-09-09 | 2005-03-15 | Curevac Gmbh | Transfer von mrnas unter verwendung von polykationischen verbindungen |
AT409085B (de) * | 2000-01-28 | 2002-05-27 | Cistem Biotechnologies Gmbh | Pharmazeutische zusammensetzung zur immunmodulation und herstellung von vakzinen |
CA2398756A1 (fr) | 2000-01-31 | 2001-08-02 | Eyal Raz | Polynucleotides immunomodulateurs dans le traitement d'une infection par un pathogene intracellulaire |
AU2001249622B2 (en) | 2000-03-30 | 2007-06-07 | Massachusetts Institute Of Technology | RNA sequence-specific mediators of RNA interference |
US20040052763A1 (en) | 2000-06-07 | 2004-03-18 | Mond James J. | Immunostimulatory RNA/DNA hybrid molecules |
ES2332444T3 (es) | 2000-06-22 | 2010-02-05 | University Of Iowa Research Foundation | Combinacion de cpg y anticuerpos dirigidos contra cd19, cd20, cd22 o cd40 para el tratamiento o prevencion de cancer. |
ES2273852T3 (es) | 2000-06-23 | 2007-05-16 | Wyeth Holdings Corporation | Proteinas v de morbillivirus modificadas. |
US6376704B1 (en) | 2000-06-28 | 2002-04-23 | 3M Innovative Properties Company | Naphthyoxyalkyl(meth)acrylates with high refractive indices and low glass transition temperatures |
US6716434B1 (en) | 2000-09-19 | 2004-04-06 | Daniel R. Ansley | Composition and method for immunostimulation in non- mammalian vertebrates |
GB0025577D0 (en) | 2000-10-18 | 2000-12-06 | Smithkline Beecham Biolog | Vaccine |
CA2329858A1 (fr) * | 2000-12-11 | 2002-06-11 | President And Fellows Of Harvard College | Clonage d'expression de proteines cibles pour phospholipides |
CA2443338A1 (fr) | 2001-04-02 | 2002-10-10 | University Of South Florida | Gene d'ancrage de type chs1/beige sensible au lps et applications therapeutiques de celui-ci |
EP2842964A1 (fr) | 2001-06-05 | 2015-03-04 | Curevac GmbH | Méthode virtuelle de détermination d'une séquence d'ARNm modifiée |
US7785610B2 (en) | 2001-06-21 | 2010-08-31 | Dynavax Technologies Corporation | Chimeric immunomodulatory compounds and methods of using the same—III |
JP2005525992A (ja) | 2001-06-25 | 2005-09-02 | イサム・リサーチ・デベロツプメント・カンパニー・オブ・ザ・ヘブルー・ユニバーシテイ・オブ・エルサレム | 生物学的物質を充填した小胞の調製法およびそれらの様々な使用 |
AR045702A1 (es) | 2001-10-03 | 2005-11-09 | Chiron Corp | Composiciones de adyuvantes. |
DE10148886A1 (de) | 2001-10-04 | 2003-04-30 | Avontec Gmbh | Inhibition von STAT-1 |
WO2003035836A2 (fr) | 2001-10-24 | 2003-05-01 | Hybridon Inc. | Modulation des proprietes immunostimulantes de composes a base d'oligonucleotides par presentation optimale d'extremites 5' |
US7276489B2 (en) | 2002-10-24 | 2007-10-02 | Idera Pharmaceuticals, Inc. | Modulation of immunostimulatory properties of oligonucleotide-based compounds by optimal presentation of 5′ ends |
DE10162480A1 (de) | 2001-12-19 | 2003-08-07 | Ingmar Hoerr | Die Applikation von mRNA für den Einsatz als Therapeutikum gegen Tumorerkrankungen |
WO2003059381A2 (fr) | 2002-01-18 | 2003-07-24 | Curevac Gmbh | Préparations immunogènes et vaccins à base d'arn |
US7741297B2 (en) | 2002-02-04 | 2010-06-22 | Oncothyreon Inc. | Immunostimulatory, covalently lipidated oligonucleotides |
CN102133407A (zh) | 2002-03-01 | 2011-07-27 | 图兰恩教育基金管理人 | 治疗剂或细胞毒性剂与生物活性肽的偶联物 |
US8153141B2 (en) | 2002-04-04 | 2012-04-10 | Coley Pharmaceutical Gmbh | Immunostimulatory G, U-containing oligoribonucleotides |
DE10229872A1 (de) | 2002-07-03 | 2004-01-29 | Curevac Gmbh | Immunstimulation durch chemisch modifizierte RNA |
EP1393745A1 (fr) | 2002-07-29 | 2004-03-03 | Hybridon, Inc. | Modulation des proprietes immunostimulatrices de composes a base d'oligonucleotides par presentation optimale des extremites 5' |
CA2508985A1 (fr) | 2002-12-23 | 2004-07-15 | Dynavax Technologies Corporation | Composes immunomodulateurs ramifies et leur procedes d'utilisation |
KR101123489B1 (ko) | 2003-01-16 | 2012-03-28 | 이데라 파마슈티칼즈, 인코포레이티드 | 개질된 면역자극성 디뉴클레오티드를 이용한 올리고뉴클레오티드-기재 화합물의 면역자극 특성의 조절 |
WO2004092329A2 (fr) | 2003-04-08 | 2004-10-28 | Galenica Pharmaceuticals, Inc. | Analogues de saponine semi-synthetiques de transport et de stimulation immunitaire pour vaccins a adn et arn |
EP1617872A4 (fr) | 2003-04-10 | 2011-09-07 | 3M Innovative Properties Co | Procedes et compositions permettant de renforcer une reponse immune |
EP1641820B1 (fr) | 2003-06-30 | 2008-05-28 | Université de Lausanne | Peptide derive de rasgap pour tuer selectivement des cellules cancereuses |
RU2375076C2 (ru) * | 2003-07-10 | 2009-12-10 | Цитос Биотехнологи Аг | Укомплектованные вирусоподобные частицы |
DE10335833A1 (de) | 2003-08-05 | 2005-03-03 | Curevac Gmbh | Transfektion von Blutzellen mit mRNA zur Immunstimulation und Gentherapie |
EP1654363B1 (fr) | 2003-08-05 | 2010-12-15 | AVI BioPharma, Inc. | Analogue d'oligonucleotide et methode de traitement des infections dues au flavivirus |
AU2004275876B2 (en) | 2003-09-25 | 2011-03-31 | Coley Pharmaceutical Gmbh | Nucleic acid-lipophilic conjugates |
DE10346721A1 (de) | 2003-10-08 | 2005-05-04 | Holger Kalthoff | Oligonukleotide, diese enthaltende Mittel und deren Verwendung |
US20050215501A1 (en) | 2003-10-24 | 2005-09-29 | Coley Pharmaceutical Group, Inc. | Methods and products for enhancing epitope spreading |
KR101138131B1 (ko) | 2003-12-08 | 2012-04-23 | 이데라 파마슈티칼즈, 인코포레이티드 | 작은 올리고뉴클레오티드-기초 화합물에 의한 면역자극특성의 조절 |
CA2551094A1 (fr) | 2003-12-22 | 2005-07-14 | The Trustees Of The University Of Pennsylvania | Methodes et compositions d'identification de proteines de liaison a l'arn |
AU2005230938A1 (en) | 2004-02-19 | 2005-10-20 | Coley Pharmaceutical Gmbh | Immunostimulatory viral RNA oligonucleotides |
CA2567789A1 (fr) | 2004-06-08 | 2006-08-03 | Coley Pharmaceutical Gmbh | Oligonucleotide abasique utilise en tant que plate-forme support pour un antigene ainsi qu'un agoniste et un antagoniste immunostimulatoire |
WO2006046978A2 (fr) | 2004-06-28 | 2006-05-04 | Argos Therapeutics, Inc. | Transformation par l'intermediaire de peptides cationiques |
DE102004035227A1 (de) | 2004-07-21 | 2006-02-16 | Curevac Gmbh | mRNA-Gemisch zur Vakzinierung gegen Tumorerkrankungen |
DE102004042546A1 (de) | 2004-09-02 | 2006-03-09 | Curevac Gmbh | Kombinationstherapie zur Immunstimulation |
US20080193468A1 (en) | 2004-09-08 | 2008-08-14 | Children's Medical Center Corporation | Method for Stimulating the Immune Response of Newborns |
CA2609788A1 (fr) | 2005-04-26 | 2006-11-02 | Coley Pharmaceutical Gmbh | Analogues d'oligoribonucleotides modifies presentant une activite d'immunostimulation amelioree |
DE102005023170A1 (de) | 2005-05-19 | 2006-11-23 | Curevac Gmbh | Optimierte Formulierung für mRNA |
EP2298829B1 (fr) | 2005-05-31 | 2017-09-20 | École Polytechnique Fédérale de Lausanne (EPFL) | Copolymères triblocs pour la fourniture cytoplasmique de médicaments à base de gènes |
EP1764107A1 (fr) | 2005-09-14 | 2007-03-21 | Gunther Hartmann | Compositions comportant les oligonucléotides d'ARN immunostimulatoire et les méthodes pour produire lesdits oligonucléotides d'ARN |
EP1924284A1 (fr) | 2005-09-14 | 2008-05-28 | Hartmann, Gunther | Compositions comprenant des oligonucleotides d'arn a activite d'immunostimulation et procedes de production associes |
JP2009511034A (ja) | 2005-10-12 | 2009-03-19 | キャンサー・リサーチ・テクノロジー・リミテッド | 免疫異常を治療するための方法および組成物 |
US8101741B2 (en) | 2005-11-02 | 2012-01-24 | Protiva Biotherapeutics, Inc. | Modified siRNA molecules and uses thereof |
US7470674B2 (en) | 2005-11-07 | 2008-12-30 | Idera Pharmaceuticals, Inc. | Immunostimulatory properties of oligonucleotide-based compounds comprising modified immunostimulatory dinucleotides |
ES2536103T3 (es) | 2005-11-25 | 2015-05-20 | Zoetis Belgium S.A. | Oligorribonucleótidos inmunoestimuladores |
WO2007069068A2 (fr) | 2005-12-16 | 2007-06-21 | Diatos | Conjugués peptidiques de pénétration cellulaire pour la délivrance d'acides nucléiques dans une cellule |
AU2007239095B2 (en) | 2006-01-09 | 2012-05-03 | The Regents Of The University Of California | Immunostimulatory combinations for vaccine adjuvants |
DE102006007433A1 (de) | 2006-02-17 | 2007-08-23 | Curevac Gmbh | Adjuvanz in Form einer Lipid-modifizierten Nukleinsäure |
EP2027158B1 (fr) | 2006-05-02 | 2012-09-19 | Carviar ApS | Méthode pour immuniser une espèce aviaire |
EP2046954A2 (fr) | 2006-07-31 | 2009-04-15 | Curevac GmbH | Acide nucléique de formule (i): gixmgn, ou(ii): cixmcn, en particulier en tant qu'agent/adjuvant immunostimulant |
DE102006035618A1 (de) | 2006-07-31 | 2008-02-07 | Curevac Gmbh | Nukleinsäure der Formel (I): GlXmGn, insbesondere als immunstimulierendes Adjuvanz |
AU2007286059A1 (en) | 2006-08-18 | 2008-02-21 | Mdrna, Inc. | Dicer substrate RNA peptide conjugates and methods for RNA therapeutics |
DE102006061015A1 (de) | 2006-12-22 | 2008-06-26 | Curevac Gmbh | Verfahren zur Reinigung von RNA im präparativen Maßstab mittels HPLC |
DE102007001370A1 (de) | 2007-01-09 | 2008-07-10 | Curevac Gmbh | RNA-kodierte Antikörper |
TR201000668T1 (tr) | 2007-07-31 | 2010-06-21 | The Board Of Supervisors Of Louisiana State University And Agricultural And Mechanical College | Neoplasti̇k veya enfeksi̇yoz bozukluklara yöneli̇k i̇mmunoprofi̇laksi̇ veya i̇mmünoterapi̇ i̇çi̇n poli̇pepti̇d-nüklei̇k asi̇t konjugati |
WO2009030254A1 (fr) | 2007-09-04 | 2009-03-12 | Curevac Gmbh | Complexes d'arn et de peptides cationiques pour transfection et immunostimulation |
WO2009046739A1 (fr) | 2007-10-09 | 2009-04-16 | Curevac Gmbh | Composition pour traiter le cancer de la prostate (pca) |
WO2009046738A1 (fr) | 2007-10-09 | 2009-04-16 | Curevac Gmbh | Composition pour traiter le cancer du poumon, notamment les cancers du poumon non à petites cellules (nsclc) |
WO2009053700A1 (fr) | 2007-10-23 | 2009-04-30 | Cancer Research Technology Limited | Modification d'entités biologiques contenant des acides nucléiques |
US20110038888A1 (en) | 2008-01-10 | 2011-02-17 | Peter Emtage | Adjuvant compositions comprising poly-ic and a cationic polymer |
KR101483715B1 (ko) | 2008-01-31 | 2015-01-19 | 큐어백 게엠바하 | 면역증강제/애주번트인 화학식(NuGlXmGnNv)a를 포함하는 핵산 및 이의 유도체 |
CA2730316A1 (fr) | 2008-07-11 | 2010-01-14 | Phylogica Limited | Inhibiteurs peptidiques de la signalisation faisant intervenir cd40l et leurs utilisations |
WO2010037408A1 (fr) | 2008-09-30 | 2010-04-08 | Curevac Gmbh | Composition comprenant un arnm complexé et un arnm nu pour déclencher ou augmenter une réponse immunostimulante chez un mammifère et utilisations de ladite composition |
US20110053829A1 (en) * | 2009-09-03 | 2011-03-03 | Curevac Gmbh | Disulfide-linked polyethyleneglycol/peptide conjugates for the transfection of nucleic acids |
WO2011069529A1 (fr) | 2009-12-09 | 2011-06-16 | Curevac Gmbh | Solution contenant du mannose pour la lyophilisation, la transfection et/ou l'injection d'acides nucléiques |
EP2955230A1 (fr) | 2010-07-30 | 2015-12-16 | CureVac AG | Complexation d'acides nucléiques avec des polymères cationiques à réticulation disulfure pour la transfection et l'immunostimulation |
US20120058154A1 (en) * | 2010-08-20 | 2012-03-08 | Selecta Biosciences, Inc. | Synthetic nanocarrier vaccines comprising peptides obtained or derived from human influenza a virus m2e |
WO2012113413A1 (fr) * | 2011-02-21 | 2012-08-30 | Curevac Gmbh | Composition de vaccin comprenant des acides nucléiques immunostimulateurs complexés et des antigènes emballés avec des conjugués de polyéthylèneglycol/peptide à liaison disulfure |
WO2013113325A1 (fr) | 2012-01-31 | 2013-08-08 | Curevac Gmbh | Complexes chargés négativement comprenant des acides nucléiques pour l'immunostimulation |
ES2719598T3 (es) | 2012-05-25 | 2019-07-11 | Curevac Ag | Inmovilización reversible y/o liberación controlada de ácidos nucleicos contenidos en nanopartículas mediante revestimientos poliméricos (biodegradables) |
-
2012
- 2012-01-31 WO PCT/EP2012/000420 patent/WO2013113326A1/fr active Application Filing
-
2013
- 2013-01-31 SG SG10201606325SA patent/SG10201606325SA/en unknown
- 2013-01-31 CN CN201380007095.3A patent/CN104080481A/zh active Pending
- 2013-01-31 MX MX2014008497A patent/MX366858B/es active IP Right Grant
- 2013-01-31 CA CA2856615A patent/CA2856615C/fr active Active
- 2013-01-31 WO PCT/EP2013/000291 patent/WO2013113501A1/fr active Application Filing
- 2013-01-31 CN CN201910393091.2A patent/CN110279853A/zh active Pending
- 2013-01-31 ES ES13702189T patent/ES2820872T3/es active Active
- 2013-01-31 SG SG11201402562YA patent/SG11201402562YA/en unknown
- 2013-01-31 EP EP13702189.5A patent/EP2809353B1/fr active Active
- 2013-01-31 JP JP2014555123A patent/JP6175451B2/ja active Active
- 2013-01-31 BR BR112014017525A patent/BR112014017525A8/pt not_active Application Discontinuation
- 2013-01-31 AU AU2013214572A patent/AU2013214572B2/en active Active
- 2013-01-31 IN IN5848DEN2014 patent/IN2014DN05848A/en unknown
- 2013-01-31 RU RU2014135475A patent/RU2617058C2/ru active
- 2013-01-31 EP EP19208208.9A patent/EP3656402A1/fr active Pending
- 2013-01-31 KR KR1020147024539A patent/KR102095606B1/ko active IP Right Grant
- 2013-01-31 US US14/375,215 patent/US20150118264A1/en not_active Abandoned
-
2019
- 2019-08-29 US US16/555,881 patent/US11690910B2/en active Active
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20040019007A1 (en) * | 1995-12-13 | 2004-01-29 | Monahan Sean D. | Intravascular delivery of non-viral nucleic acid |
US20030133942A1 (en) * | 2001-02-21 | 2003-07-17 | Andrew Segal | Vaccine compositions and methods of modulating immune responses |
US20080248067A1 (en) * | 2005-04-14 | 2008-10-09 | The University Of Queensland | Immunomodulating Compositions and Uses Therefor |
Non-Patent Citations (3)
Title |
---|
Andreu et al., "Formation of Disulfide Bonds in Synthetic Peptides and Proteins," Chapter 7, Methods in Molecular Biology, Vol. 35 Peptide Synthesis Protocols, Pennington and Dunn (1994) * |
Hwang et al., "A brain-targeted rabies virus glycoprotein-disulfide linked PEI nanocarrier for delivery of neurogenic mRNA," Biomaterials 32: 4968-4975 (2011) * |
Zhao et al., "N/P Ratio Significantly Influences the Transfection Efficiency and Cytotoxicity of a Polyethylenimine/Chitosan/DNA Complex," Biological and Pharmaceutical Bulletin," Vol. 32, No. 4: 706-710 (2009) * |
Cited By (169)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10653799B2 (en) | 2010-08-13 | 2020-05-19 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded protein |
US9839697B2 (en) | 2010-08-13 | 2017-12-12 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(a) sequence or a polyadenylation signal for increasing the expression of an encoded protein |
US20130287808A1 (en) * | 2010-11-05 | 2013-10-31 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Vaccines for preventing meningococcal infections |
US9421255B2 (en) * | 2011-02-21 | 2016-08-23 | Curevac Ag | Vaccine composition comprising complexed immunostimulatory nucleic acids and antigens packaged with disulfide-linked polyethyleneglycol/peptide conjugates |
US20130259879A1 (en) * | 2011-02-21 | 2013-10-03 | Curevac Gmbh | Vaccine composition comprising complexed immunostimulatory nucleic acids and antigens packaged with disulfide-linked polyethyleneglycol/peptide conjugates |
US20170028059A1 (en) * | 2011-02-21 | 2017-02-02 | Curevac Ag | Vaccine composition comprising complexed immunostimulatory nucleic acids and antigens packaged with disulfide-linked polyethyleneglycol/peptide conjugates |
US10568958B2 (en) * | 2011-02-21 | 2020-02-25 | Curevac Ag | Vaccine composition comprising complexed immunostimulatory nucleic acids and antigens packaged with disulfide-linked polyethyleneglycol/peptide conjugates |
US11975064B2 (en) | 2011-03-02 | 2024-05-07 | CureVac SE | Vaccination with mRNA-coded antigens |
US10227665B2 (en) | 2012-01-26 | 2019-03-12 | Luc Montagnier | Detection of DNA sequences as risk factors for HIV infection |
US10166283B2 (en) | 2012-02-15 | 2019-01-01 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded pathogenic antigen |
US10898589B2 (en) | 2012-02-15 | 2021-01-26 | Cure Vac AG | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded therapeutic protein |
US10010592B2 (en) | 2012-02-15 | 2018-07-03 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded tumour antigen |
US10682406B2 (en) | 2012-02-15 | 2020-06-16 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded pathogenic antigen |
US10610605B2 (en) | 2012-02-15 | 2020-04-07 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded therapeutic protein |
US11110156B2 (en) | 2012-02-15 | 2021-09-07 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(a) sequence or a polyadenylation signal for increasing the expression of an encoded tumour antigen |
US10232024B2 (en) | 2012-02-15 | 2019-03-19 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded allergenic antigen or an autoimmune self-antigen |
US9669089B2 (en) | 2012-02-15 | 2017-06-06 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded pathogenic antigen |
US10799577B2 (en) | 2012-02-15 | 2020-10-13 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded pathogenic antigen |
US10912826B2 (en) | 2012-02-15 | 2021-02-09 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded pathogenic antigen |
US10111968B2 (en) | 2012-02-15 | 2018-10-30 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded therapeutic protein |
US9447431B2 (en) | 2012-02-15 | 2016-09-20 | Curevac Ag | Nucleic acid comprising or coding for a histone stem-loop and a poly(A) sequence or a polyadenylation signal for increasing the expression of an encoded therapeutic protein |
US10738306B2 (en) | 2012-03-27 | 2020-08-11 | Curevac Ag | Artificial nucleic acid molecules for improved protein or peptide expression |
US9890391B2 (en) | 2012-03-27 | 2018-02-13 | Curevac Ag | RNA vector with an open reading frame, an albumin 3′-UTR, and a histone stem loop |
US10080809B2 (en) | 2012-03-27 | 2018-09-25 | Curevac Ag | Artificial nucleic acid molecules comprising a 5′TOP UTR |
US9683233B2 (en) | 2012-03-27 | 2017-06-20 | Curevac Ag | Artificial nucleic acid molecules for improved protein or peptide expression |
US10000545B2 (en) | 2012-07-27 | 2018-06-19 | Institut National De La Sante Et De La Recherche Medicale | CD147 as receptor for pilus-mediated adhesion of Meningococci to vascular endothelia |
US9974845B2 (en) | 2013-02-22 | 2018-05-22 | Curevac Ag | Combination of vaccination and inhibition of the PD-1 pathway |
US10434158B2 (en) | 2013-02-22 | 2019-10-08 | Curevac Ag | Combination of vaccination and inhibition of the PD-1 pathway |
US11458195B2 (en) | 2013-02-22 | 2022-10-04 | Curevac Ag | Combination of vaccination and inhibition of the PD-1 pathway |
US10117920B2 (en) | 2013-02-22 | 2018-11-06 | Curevac Ag | Combination of vaccination and inhibition of the PD-1 pathway |
US10894963B2 (en) | 2013-07-25 | 2021-01-19 | Exicure, Inc. | Spherical nucleic acid-based constructs as immunostimulatory agents for prophylactic and therapeutic use |
US10837018B2 (en) | 2013-07-25 | 2020-11-17 | Exicure, Inc. | Spherical nucleic acid-based constructs as immunostimulatory agents for prophylactic and therapeutic use |
US10799602B2 (en) | 2013-08-21 | 2020-10-13 | Curevac Ag | Method for increasing expression of RNA-encoded proteins |
US11739125B2 (en) | 2013-08-21 | 2023-08-29 | Cure Vac SE | Respiratory syncytial virus (RSV) vaccine |
US10588959B2 (en) | 2013-08-21 | 2020-03-17 | Curevac Ag | Combination vaccine |
US11266735B2 (en) | 2013-08-21 | 2022-03-08 | Curevac Ag | Combination vaccine |
US9688729B2 (en) | 2013-08-21 | 2017-06-27 | Curevac Ag | Respiratory syncytial virus (RSV) vaccine |
US10150797B2 (en) | 2013-08-21 | 2018-12-11 | Curevac Ag | Respiratory syncytial virus (RSV) vaccine |
US11369694B2 (en) | 2013-08-21 | 2022-06-28 | Curevac Ag | Rabies vaccine |
US10682426B2 (en) | 2013-08-21 | 2020-06-16 | Curevac Ag | Rabies vaccine |
US11034729B2 (en) | 2013-08-21 | 2021-06-15 | Curevac Ag | Respiratory syncytial virus (RSV) vaccine |
US11965000B2 (en) | 2013-08-21 | 2024-04-23 | CureVac SE | Respiratory syncytial virus (RSV) vaccine |
US10293060B2 (en) | 2013-08-21 | 2019-05-21 | Curevac Ag | Method for increasing expression of RNA-encoded proteins |
US10898584B2 (en) | 2013-11-01 | 2021-01-26 | Curevac Ag | Modified RNA with decreased immunostimulatory properties |
US11697816B2 (en) | 2013-12-30 | 2023-07-11 | CureVac SE | Artificial nucleic acid molecules |
US10047375B2 (en) | 2013-12-30 | 2018-08-14 | Curevac Ag | Artificial nucleic acid molecules |
US10648017B2 (en) | 2013-12-30 | 2020-05-12 | Curevac Real Estate Gmbh | Methods for RNA analysis |
US10307472B2 (en) | 2014-03-12 | 2019-06-04 | Curevac Ag | Combination of vaccination and OX40 agonists |
US11110157B2 (en) | 2014-03-12 | 2021-09-07 | Curevac Ag | Combination of vaccination and OX40 agonists |
US11110166B2 (en) | 2014-04-01 | 2021-09-07 | Curevac Ag | Polymeric carrier cargo complex for use as an immunostimulating agent or as an adjuvant |
US10369216B2 (en) | 2014-04-01 | 2019-08-06 | Curevac Ag | Polymeric carrier cargo complex for use as an immunostimulating agent or as an adjuvant |
US10709779B2 (en) | 2014-04-23 | 2020-07-14 | Modernatx, Inc. | Nucleic acid vaccines |
US10022435B2 (en) | 2014-04-23 | 2018-07-17 | Modernatx, Inc. | Nucleic acid vaccines |
US9872900B2 (en) | 2014-04-23 | 2018-01-23 | Modernatx, Inc. | Nucleic acid vaccines |
US11123294B2 (en) | 2014-06-04 | 2021-09-21 | Exicure Operating Company | Multivalent delivery of immune modulators by liposomal spherical nucleic acids for prophylactic or therapeutic applications |
US11957788B2 (en) | 2014-06-04 | 2024-04-16 | Exicure Operating Company | Multivalent delivery of immune modulators by liposomal spherical nucleic acids for prophylactic or therapeutic applications |
US10837039B2 (en) | 2014-06-10 | 2020-11-17 | Curevac Real Estate Gmbh | Methods and means for enhancing RNA production |
US11634379B2 (en) | 2014-06-25 | 2023-04-25 | Acuitas Therapeutics, Inc. | Lipids and lipid nanoparticle formulations for delivery of nucleic acids |
US11213593B2 (en) | 2014-11-21 | 2022-01-04 | Northwestern University | Sequence-specific cellular uptake of spherical nucleic acid nanoparticle conjugates |
US11149278B2 (en) | 2014-12-12 | 2021-10-19 | Curevac Ag | Artificial nucleic acid molecules for improved protein expression |
US11286492B2 (en) | 2014-12-12 | 2022-03-29 | Curevac Ag | Artificial nucleic acid molecules for improved protein expression |
US11761009B2 (en) | 2014-12-12 | 2023-09-19 | CureVac SE | Artificial nucleic acid molecules for improved protein expression |
US11345920B2 (en) | 2014-12-12 | 2022-05-31 | Curevac Ag | Artificial nucleic acid molecules for improved protein expression |
US11254951B2 (en) | 2014-12-30 | 2022-02-22 | Curevac Ag | Artificial nucleic acid molecules |
US10653768B2 (en) | 2015-04-13 | 2020-05-19 | Curevac Real Estate Gmbh | Method for producing RNA compositions |
US11744886B2 (en) | 2015-04-13 | 2023-09-05 | CureVac Manufacturing GmbH | Method for producing RNA compositions |
US11491112B2 (en) | 2015-04-17 | 2022-11-08 | CureVac Manufacturing GmbH | Lyophilization of RNA |
US11446250B2 (en) | 2015-04-17 | 2022-09-20 | Curevac Real Estate Gmbh | Lyophilization of RNA |
US10780054B2 (en) | 2015-04-17 | 2020-09-22 | Curevac Real Estate Gmbh | Lyophilization of RNA |
US10869935B2 (en) | 2015-04-22 | 2020-12-22 | Curevac Ag | RNA containing composition for treatment of tumor diseases |
US10918740B2 (en) | 2015-04-22 | 2021-02-16 | Curevac Ag | RNA containing composition for treatment of tumor diseases |
US10293058B2 (en) | 2015-04-22 | 2019-05-21 | Curevac Ag | RNA containing composition for treatment of tumor diseases |
US11384375B2 (en) | 2015-04-30 | 2022-07-12 | Curevac Ag | Immobilized poly(n)polymerase |
US11661634B2 (en) | 2015-05-08 | 2023-05-30 | CureVac Manufacturing GmbH | Method for producing RNA |
CN107810009A (zh) * | 2015-05-15 | 2018-03-16 | 库瑞瓦格股份公司 | 涉及施用至少一种mRNA构建体的初免‑加强方案 |
US11559570B2 (en) | 2015-05-15 | 2023-01-24 | CureVac SE | Prime-boost regimens involving administration of at least one mRNA construct |
US11534405B2 (en) | 2015-05-20 | 2022-12-27 | Curevac Ag | Dry powder composition comprising long-chain RNA |
US10729654B2 (en) | 2015-05-20 | 2020-08-04 | Curevac Ag | Dry powder composition comprising long-chain RNA |
US11433027B2 (en) | 2015-05-20 | 2022-09-06 | Curevac Ag | Dry powder composition comprising long-chain RNA |
US11179337B2 (en) | 2015-05-20 | 2021-11-23 | Curevac Ag | Dry powder composition comprising long-chain RNA |
US10517827B2 (en) | 2015-05-20 | 2019-12-31 | Curevac Ag | Dry powder composition comprising long-chain RNA |
US11834651B2 (en) | 2015-05-29 | 2023-12-05 | CureVac Manufacturing GmbH | Method for producing and purifying RNA, comprising at least one step of tangential flow filtration |
US10760070B2 (en) | 2015-05-29 | 2020-09-01 | Curevac Real Estate Gmbh | Method for producing and purifying RNA, comprising at least one step of tangential flow filtration |
US11760992B2 (en) | 2015-05-29 | 2023-09-19 | CureVac Manufacturing GmbH | Method for producing and purifying RNA, comprising at least one step of tangential flow filtration |
US11608513B2 (en) | 2015-05-29 | 2023-03-21 | CureVac SE | Method for adding cap structures to RNA using immobilized enzymes |
US11667910B2 (en) | 2015-05-29 | 2023-06-06 | CureVac Manufacturing GmbH | Method for producing and purifying RNA, comprising at least one step of tangential flow filtration |
US11274293B2 (en) | 2015-05-29 | 2022-03-15 | Curevac Real Estate Gmbh | Method for producing and purifying RNA, comprising at least one step of tangential flow filtration |
US11168051B2 (en) | 2015-06-29 | 2021-11-09 | Acuitas Therapeutics, Inc. | Lipids and lipid nanoparticle formulations for delivery of nucleic acids |
US10501768B2 (en) | 2015-07-13 | 2019-12-10 | Curevac Ag | Method of producing RNA from circular DNA and corresponding template DNA |
US11225682B2 (en) | 2015-10-12 | 2022-01-18 | Curevac Ag | Automated method for isolation, selection and/or detection of microorganisms or cells comprised in a solution |
US11648324B2 (en) | 2015-10-28 | 2023-05-16 | Acuitas Therapeutics, Inc. | Lipids and lipid nanoparticle formulations for delivery of nucleic acids |
US11040112B2 (en) | 2015-10-28 | 2021-06-22 | Acuitas Therapeutics, Inc. | Lipids and lipid nanoparticle formulations for delivery of nucleic acids |
US11786590B2 (en) | 2015-11-09 | 2023-10-17 | CureVac SE | Rotavirus vaccines |
US11413346B2 (en) | 2015-11-09 | 2022-08-16 | Curevac Ag | Rotavirus vaccines |
US11684665B2 (en) | 2015-12-22 | 2023-06-27 | CureVac SE | Method for producing RNA molecule compositions |
US11248223B2 (en) | 2015-12-23 | 2022-02-15 | Curevac Ag | Method of RNA in vitro transcription using a buffer containing a dicarboxylic acid or tricarboxylic acid or a salt thereof |
US11723967B2 (en) | 2016-02-17 | 2023-08-15 | CureVac SE | Zika virus vaccine |
US11920174B2 (en) | 2016-03-03 | 2024-03-05 | CureVac SE | RNA analysis by total hydrolysis and quantification of released nucleosides |
KR101835697B1 (ko) | 2016-04-19 | 2018-03-08 | 경희대학교 산학협력단 | 간흡충 바이러스-유사입자, 이를 제조하기 위한 벡터, 및 이의 제조방법 |
US11596699B2 (en) | 2016-04-29 | 2023-03-07 | CureVac SE | RNA encoding an antibody |
US11078247B2 (en) | 2016-05-04 | 2021-08-03 | Curevac Ag | RNA encoding a therapeutic protein |
US11141474B2 (en) | 2016-05-04 | 2021-10-12 | Curevac Ag | Artificial nucleic acid molecules encoding a norovirus antigen and uses thereof |
US11478552B2 (en) | 2016-06-09 | 2022-10-25 | Curevac Ag | Hybrid carriers for nucleic acid cargo |
US11364304B2 (en) | 2016-08-25 | 2022-06-21 | Northwestern University | Crosslinked micellar spherical nucleic acids |
US11279923B2 (en) | 2016-11-28 | 2022-03-22 | Curevac Ag | Method for purifying RNA |
EP4035659A1 (fr) | 2016-11-29 | 2022-08-03 | PureTech LYT, Inc. | Exosomes destinés à l'administration d'agents thérapeutiques |
EP4252629A2 (fr) | 2016-12-07 | 2023-10-04 | Biora Therapeutics, Inc. | Procédés, dispositifs et systèmes de détection du tractus gastro-intestinal |
US11464836B2 (en) | 2016-12-08 | 2022-10-11 | Curevac Ag | RNA for treatment or prophylaxis of a liver disease |
US11542490B2 (en) | 2016-12-08 | 2023-01-03 | CureVac SE | RNAs for wound healing |
WO2018112245A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur de jak et dispositifs associés |
EP4190318A1 (fr) | 2016-12-14 | 2023-06-07 | Biora Therapeutics, Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur de jak et dispositifs |
US11426566B2 (en) | 2016-12-14 | 2022-08-30 | Biora Therapeutics, Inc. | Treatment of a disease of the gastrointestinal tract with a TLR modulator |
WO2018112240A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur du tnf |
WO2018112237A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur de l'il -6 r |
WO2018112232A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur des interleukines il-12/il-23 libéré à l'aide d'un dispositif ingérable |
WO2018112235A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur de smad7 |
WO2018112223A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un modulateur tlr |
US11523772B2 (en) | 2016-12-14 | 2022-12-13 | Biora Therapeutics, Inc. | Treatment of a disease of the gastrointestinal tract with an immunosuppressant |
US11033490B2 (en) | 2016-12-14 | 2021-06-15 | Progenity, Inc. | Treatment of a disease of the gastrointestinal tract with a JAK inhibitor and devices |
US11597762B2 (en) | 2016-12-14 | 2023-03-07 | Biora Therapeutics, Inc. | Treatment of a disease of the gastrointestinal tract with an IL-12/IL-23 inhibitor released using an ingestible device |
WO2018112264A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec une chimoikine/un inhibiteur du récepteur de chimiokine |
EP4233902A2 (fr) | 2016-12-14 | 2023-08-30 | Biora Therapeutics, Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur de l'integrine |
WO2018112255A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un immunosuppresseur |
WO2018112256A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur d'il-1 |
US11134889B2 (en) | 2016-12-14 | 2021-10-05 | Progenity, Inc. | Treatment of a disease of the gastrointestinal tract with a SMAD7 inhibitor |
US10980739B2 (en) | 2016-12-14 | 2021-04-20 | Progenity, Inc. | Treatment of a disease of the gastrointestinal tract with a chemokine/chemokine receptor inhibitor |
WO2018112215A1 (fr) | 2016-12-14 | 2018-06-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur de l'intégrine |
US11141476B2 (en) | 2016-12-23 | 2021-10-12 | Curevac Ag | MERS coronavirus vaccine |
US11524066B2 (en) | 2016-12-23 | 2022-12-13 | CureVac SE | Henipavirus vaccine |
US11865084B2 (en) | 2016-12-23 | 2024-01-09 | CureVac SE | MERS coronavirus vaccine |
US11464847B2 (en) | 2016-12-23 | 2022-10-11 | Curevac Ag | Lassa virus vaccine |
WO2018156106A1 (fr) * | 2017-02-22 | 2018-08-30 | Ding Enyu | Vaccin à arnm contre le cancer codant pour le gm-csf humain fusionné à de multiples épitopes en tandem |
CN110418648A (zh) * | 2017-02-22 | 2019-11-05 | 丁恩雨 | 一种编码人GM-CSF与多串连表位融合的mRNA癌症疫苗 |
US11739335B2 (en) | 2017-03-24 | 2023-08-29 | CureVac SE | Nucleic acids encoding CRISPR-associated proteins and uses thereof |
WO2018183934A1 (fr) | 2017-03-30 | 2018-10-04 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un inhibiteur de chst15 |
WO2018183941A2 (fr) | 2017-03-30 | 2018-10-04 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un agent biothérapeutique vivant |
WO2018183932A1 (fr) | 2017-03-30 | 2018-10-04 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal à l'aide d'un inhibiteur d'il-13 |
WO2018183929A1 (fr) | 2017-03-30 | 2018-10-04 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un agent immunomodulateur libéré à l'aide d'un dispositif ingérable |
WO2018183931A1 (fr) | 2017-03-30 | 2018-10-04 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal au moyen d'il-10 ou d'un agoniste d'il-10 |
EP4108183A1 (fr) | 2017-03-30 | 2022-12-28 | Biora Therapeutics, Inc. | Traitement d'une maladie du tractus gastro-intestinal avec un agent immunomodulateur libéré à l'aide d'un dispositif ingérable |
US11596670B2 (en) | 2017-03-30 | 2023-03-07 | Biora Therapeutics, Inc. | Treatment of a disease of the gastrointestinal tract with IL-10 or an IL-10 agonist |
US11357856B2 (en) | 2017-04-13 | 2022-06-14 | Acuitas Therapeutics, Inc. | Lipids for delivery of active agents |
US11660332B2 (en) | 2017-04-27 | 2023-05-30 | The Trustees Of The University Of Pennsylvania | Nucleoside-modified mRNA-lipid nanoparticle lineage vaccine for hepatitis C virus |
US11696954B2 (en) | 2017-04-28 | 2023-07-11 | Exicure Operating Company | Synthesis of spherical nucleic acids using lipophilic moieties |
US11820728B2 (en) | 2017-04-28 | 2023-11-21 | Acuitas Therapeutics, Inc. | Carbonyl lipids and lipid nanoparticle formulations for delivery of nucleic acids |
US10988754B2 (en) | 2017-07-04 | 2021-04-27 | Cure Vac AG | Nucleic acid molecules |
WO2019021049A1 (fr) * | 2017-07-25 | 2019-01-31 | Instituto Nacional De Salud | Antigènes recombinants de giardia, purification d'anticorps polyclonaux igg et igy anti-giardia et détection de giardia |
US11753439B2 (en) | 2017-07-25 | 2023-09-12 | Instituto Nacional De Salud | Giardia recombinant antigens, purification of polyclonal anti-Giardia IgG and IgY antibodies and Giardia detection |
WO2019036363A1 (fr) | 2017-08-14 | 2019-02-21 | Progenity Inc. | Traitement d'une maladie du tractus gastro-intestinal avec le glatiramer ou un sel pharmaceutiquement acceptable de celui-ci |
US11639329B2 (en) | 2017-08-16 | 2023-05-02 | Acuitas Therapeutics, Inc. | Lipids for use in lipid nanoparticle formulations |
US11524932B2 (en) | 2017-08-17 | 2022-12-13 | Acuitas Therapeutics, Inc. | Lipids for use in lipid nanoparticle formulations |
US11542225B2 (en) | 2017-08-17 | 2023-01-03 | Acuitas Therapeutics, Inc. | Lipids for use in lipid nanoparticle formulations |
US11602557B2 (en) | 2017-08-22 | 2023-03-14 | Cure Vac SE | Bunyavirales vaccine |
US11692002B2 (en) | 2017-11-08 | 2023-07-04 | CureVac SE | RNA sequence adaptation |
US11931406B2 (en) | 2017-12-13 | 2024-03-19 | CureVac SE | Flavivirus vaccine |
US11525158B2 (en) | 2017-12-21 | 2022-12-13 | CureVac SE | Linear double stranded DNA coupled to a single support or a tag and methods for producing said linear double stranded DNA |
CN109468294A (zh) * | 2018-11-06 | 2019-03-15 | 青岛古高生物科技有限公司 | 一种血红素-GroEL复合体及其制备方法和应用 |
US11576966B2 (en) | 2020-02-04 | 2023-02-14 | CureVac SE | Coronavirus vaccine |
US11241493B2 (en) | 2020-02-04 | 2022-02-08 | Curevac Ag | Coronavirus vaccine |
US11596686B2 (en) | 2020-02-04 | 2023-03-07 | CureVac SE | Coronavirus vaccine |
US11964011B2 (en) | 2020-02-04 | 2024-04-23 | CureVac SE | Coronavirus vaccine |
US11964012B2 (en) | 2020-02-04 | 2024-04-23 | CureVac SE | Coronavirus vaccine |
US11471525B2 (en) | 2020-02-04 | 2022-10-18 | Curevac Ag | Coronavirus vaccine |
US11976019B2 (en) | 2020-07-16 | 2024-05-07 | Acuitas Therapeutics, Inc. | Cationic lipids for use in lipid nanoparticles |
US11872280B2 (en) | 2020-12-22 | 2024-01-16 | CureVac SE | RNA vaccine against SARS-CoV-2 variants |
US11918643B2 (en) | 2020-12-22 | 2024-03-05 | CureVac SE | RNA vaccine against SARS-CoV-2 variants |
WO2023230241A1 (fr) * | 2022-05-27 | 2023-11-30 | Design-Zyme LLC | Adjuvant universel pour l'administration nasale, orale et intramusculaire de vaccins |
CN115925822A (zh) * | 2022-09-01 | 2023-04-07 | 广州源博医药科技有限公司 | 一种重组蛋白及其在制备呼吸道合胞病毒疫苗中的应用 |
CN116769786A (zh) * | 2022-09-07 | 2023-09-19 | 贵州大学 | 飞蝗气味结合蛋白LmOBP11基因及其编码蛋白与应用 |
Also Published As
Publication number | Publication date |
---|---|
US11690910B2 (en) | 2023-07-04 |
EP3656402A1 (fr) | 2020-05-27 |
MX366858B (es) | 2019-07-26 |
BR112014017525A2 (pt) | 2018-05-15 |
KR102095606B1 (ko) | 2020-04-01 |
US20200085943A1 (en) | 2020-03-19 |
RU2617058C2 (ru) | 2017-04-19 |
CA2856615A1 (fr) | 2013-08-08 |
JP2015510504A (ja) | 2015-04-09 |
IN2014DN05848A (fr) | 2015-05-22 |
JP6175451B2 (ja) | 2017-08-02 |
CN104080481A (zh) | 2014-10-01 |
AU2013214572A1 (en) | 2014-06-12 |
SG11201402562YA (en) | 2014-09-26 |
MX2014008497A (es) | 2014-10-14 |
CN110279853A (zh) | 2019-09-27 |
AU2013214572B2 (en) | 2017-08-17 |
SG10201606325SA (en) | 2016-12-29 |
WO2013113501A1 (fr) | 2013-08-08 |
EP2809353A1 (fr) | 2014-12-10 |
EP2809353B1 (fr) | 2020-07-01 |
RU2014135475A (ru) | 2016-03-27 |
ES2820872T3 (es) | 2021-04-22 |
BR112014017525A8 (pt) | 2022-07-12 |
CA2856615C (fr) | 2020-11-24 |
WO2013113326A1 (fr) | 2013-08-08 |
KR20140120933A (ko) | 2014-10-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11690910B2 (en) | Pharmaceutical composition comprising a polymeric carrier cargo complex and at least one protein or peptide antigen | |
US20190008954A1 (en) | Negatively charged nucleic acid comprising complexes for immunostimulation | |
US20210251898A1 (en) | Lipid nanoparticle mrna vaccines | |
EP3294326B1 (fr) | Régimes posologiques de primo-immunisation/rappel impliquant l'administration d'au moins une construction d'arnm | |
EP2809354B1 (fr) | Complexes comprenant des acides nucléiques chargés négativement destinés à l'immuno-stimulation | |
US20180296663A1 (en) | Vaccine composition | |
EA041756B1 (ru) | ВАКЦИНЫ НА ОСНОВЕ мРНК В ЛИПИДНЫХ НАНОЧАСТИЦАХ |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: CUREVAC GMBH, GERMANY Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:BAUMHOF, PATRICK;KRAMPS, THOMAS;VOSS, SOHNKE;AND OTHERS;SIGNING DATES FROM 20141105 TO 20141121;REEL/FRAME:034264/0001 |
|
AS | Assignment |
Owner name: CUREVAC AG, GERMANY Free format text: CHANGE OF NAME;ASSIGNOR:CUREVAC GMBH;REEL/FRAME:037115/0430 Effective date: 20150917 |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: DOCKETED NEW CASE - READY FOR EXAMINATION |
|
STPP | Information on status: patent application and granting procedure in general |
Free format text: NON FINAL ACTION MAILED |
|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |
|
AS | Assignment |
Owner name: CUREVAC SE, GERMANY Free format text: CHANGE OF NAME;ASSIGNOR:CUREVAC AG;REEL/FRAME:062356/0473 Effective date: 20220926 |