DK140480A - Fremgangsmaade til fremstilling af mercaptoacyldipeptider - Google Patents
Fremgangsmaade til fremstilling af mercaptoacyldipeptiderInfo
- Publication number
- DK140480A DK140480A DK140480A DK140480A DK140480A DK 140480 A DK140480 A DK 140480A DK 140480 A DK140480 A DK 140480A DK 140480 A DK140480 A DK 140480A DK 140480 A DK140480 A DK 140480A
- Authority
- DK
- Denmark
- Prior art keywords
- mercaptoacyldipeptides
- preparing
- preparing mercaptoacyldipeptides
- Prior art date
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/06—Dipeptides
- C07K5/06008—Dipeptides with the first amino acid being neutral
- C07K5/06017—Dipeptides with the first amino acid being neutral and aliphatic
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/06—Dipeptides
- C07K5/06008—Dipeptides with the first amino acid being neutral
- C07K5/06017—Dipeptides with the first amino acid being neutral and aliphatic
- C07K5/06026—Dipeptides with the first amino acid being neutral and aliphatic the side chain containing 0 or 1 carbon atom, i.e. Gly or Ala
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/06—Dipeptides
- C07K5/06008—Dipeptides with the first amino acid being neutral
- C07K5/06017—Dipeptides with the first amino acid being neutral and aliphatic
- C07K5/06034—Dipeptides with the first amino acid being neutral and aliphatic the side chain containing 2 to 4 carbon atoms
- C07K5/06052—Val-amino acid
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/06—Dipeptides
- C07K5/06139—Dipeptides with the first amino acid being heterocyclic
- C07K5/06165—Dipeptides with the first amino acid being heterocyclic and Pro-amino acid; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
Landscapes
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Pharmacology & Pharmacy (AREA)
- Cardiology (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Heart & Thoracic Surgery (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US2570179A | 1979-04-02 | 1979-04-02 |
Publications (1)
Publication Number | Publication Date |
---|---|
DK140480A true DK140480A (da) | 1980-10-03 |
Family
ID=21827594
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
DK140480A DK140480A (da) | 1979-04-02 | 1980-04-01 | Fremgangsmaade til fremstilling af mercaptoacyldipeptider |
Country Status (22)
Country | Link |
---|---|
JP (1) | JPS55133345A (pt) |
AT (1) | AT373577B (pt) |
AU (1) | AU537592B2 (pt) |
BE (1) | BE882601A (pt) |
CH (1) | CH645092A5 (pt) |
DE (1) | DE3012140A1 (pt) |
DK (1) | DK140480A (pt) |
ES (1) | ES8104200A1 (pt) |
FR (1) | FR2453135A1 (pt) |
GB (1) | GB2045771B (pt) |
GR (1) | GR67752B (pt) |
HU (1) | HU181087B (pt) |
IE (1) | IE49653B1 (pt) |
IT (1) | IT1147332B (pt) |
LU (1) | LU82316A1 (pt) |
NL (1) | NL8001675A (pt) |
NO (1) | NO150360C (pt) |
NZ (1) | NZ193142A (pt) |
PH (1) | PH22024A (pt) |
PT (1) | PT71044A (pt) |
SE (1) | SE8002512L (pt) |
ZA (1) | ZA801527B (pt) |
Families Citing this family (22)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JPS5692848A (en) * | 1979-12-27 | 1981-07-27 | Dainippon Pharmaceut Co Ltd | Preparation of 1- 3-lower alaknoylthio-2-methylpropanoyl prolylphenylalanine |
JPS56139455A (en) | 1980-04-02 | 1981-10-30 | Santen Pharmaceut Co Ltd | Sulfur-containing acylaminoacid |
US4336950A (en) * | 1980-09-08 | 1982-06-29 | John Zepkowski | Sled |
US4462943A (en) * | 1980-11-24 | 1984-07-31 | E. R. Squibb & Sons, Inc. | Carboxyalkyl amino acid derivatives of various substituted prolines |
JPS57142967A (en) * | 1981-02-27 | 1982-09-03 | Dainippon Pharmaceut Co Ltd | N-(acylthioalkanoyloxy)succinimide and its use |
US4512979A (en) * | 1981-03-23 | 1985-04-23 | Merck & Co., Inc. | Dipeptides containing thialysine and related amino acids as antihypertensives |
US4382081A (en) * | 1981-06-12 | 1983-05-03 | E. R. Squibb & Sons, Inc. | Inhibitors of mammalian collagenase |
IT1195287B (it) * | 1981-11-05 | 1988-10-12 | Ausonia Farma Srl | Derivato tiazolico,procedimento per la sua preparazione e relative composizioni farmaceutiche |
US4434151A (en) * | 1982-11-08 | 1984-02-28 | Medi-Physics, Inc. | Bifunctional chelating agents |
DE3243369A1 (de) * | 1982-11-24 | 1984-05-24 | Basf Ag, 6700 Ludwigshafen | Bis-(benzoylthio)-carbonsaeuren, ihre herstellung und verwendung zur herstellung von wirkstoffen |
US4642355A (en) * | 1984-02-24 | 1987-02-10 | Otsuka Pharmaceutical Factory, Inc. | Proline derivatives |
US4560506A (en) * | 1984-05-25 | 1985-12-24 | E. R. Squibb & Sons, Inc. | Mercaptocycloalkylcarbonyl and mercaptoarylcarbonyl dipeptides |
DE3432307A1 (de) * | 1984-09-03 | 1986-04-10 | Boehringer Ingelheim KG, 6507 Ingelheim | Aminosaeurederivate, verfahren zu ihrer herstellung und pharmazeutische zusammensetzungen |
DE3436569A1 (de) * | 1984-10-05 | 1986-04-10 | Boehringer Ingelheim KG, 6507 Ingelheim | Aminosaeurederivate, verfahren zu ihrer herstellung und pharmazeutische zusammensetzungen |
WO1987002986A1 (en) * | 1985-11-15 | 1987-05-21 | The Upjohn Company | Novel renin inhibiting polypeptide analogs containing s-aryl-d- or l- or dl-cysteinyl, 3-(arylthio)lactic acid or 3-(arylthio)alkyl moieties |
US4894437A (en) * | 1985-11-15 | 1990-01-16 | The Upjohn Company | Novel renin inhibiting polypeptide analogs containing S-aryl-D- or L- or DL-cysteinyl, 3-(arylthio)lactic acid or 3-(arylthio)alkyl moieties |
JPH0662671B2 (ja) * | 1986-01-17 | 1994-08-17 | 株式会社大塚製薬工場 | プロリン誘導体 |
DE69130605T2 (de) * | 1991-02-27 | 1999-05-20 | Lacer Sa | Antihypertensive N-(alpha-substituiertes Pyridyl)-carbonyldipeptide |
FR2679564A1 (fr) * | 1991-07-23 | 1993-01-29 | Inst Nat Sante Rech Med | Nouveaux acylmercaptoalcanoldipeptides, leur preparation et les compositions qui les contiennent. |
US5504080A (en) * | 1992-10-28 | 1996-04-02 | Bristol-Myers Squibb Co. | Benzo-fused lactams |
GB9310075D0 (en) * | 1993-05-17 | 1993-06-30 | Fujisawa Pharmaceutical Co | New mercapto-amide derivatives,processes for the preparation thereof and pharmaceutical composition comprising the same |
US7390789B2 (en) * | 2005-09-13 | 2008-06-24 | William H Simmons | Thio-containing inhibitors of aminopeptidase P, and compositions thereof |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JPS559058A (en) * | 1978-07-06 | 1980-01-22 | Dainippon Pharmaceut Co Ltd | 1-(3-mercapto-2-methylpropanoyl)prolyl amino acid derivative |
-
1980
- 1980-03-12 AU AU56380/80A patent/AU537592B2/en not_active Ceased
- 1980-03-14 ZA ZA00801527A patent/ZA801527B/xx unknown
- 1980-03-14 GB GB8008696A patent/GB2045771B/en not_active Expired
- 1980-03-17 PH PH23775A patent/PH22024A/en unknown
- 1980-03-17 NZ NZ193142A patent/NZ193142A/en unknown
- 1980-03-18 GR GR61475A patent/GR67752B/el unknown
- 1980-03-21 NL NL8001675A patent/NL8001675A/nl not_active Application Discontinuation
- 1980-03-26 FR FR8006711A patent/FR2453135A1/fr active Granted
- 1980-03-28 DE DE19803012140 patent/DE3012140A1/de not_active Withdrawn
- 1980-03-28 IE IE638/80A patent/IE49653B1/en not_active IP Right Cessation
- 1980-03-31 NO NO800931A patent/NO150360C/no unknown
- 1980-04-01 SE SE8002512A patent/SE8002512L/xx not_active Application Discontinuation
- 1980-04-01 ES ES490166A patent/ES8104200A1/es not_active Expired
- 1980-04-01 LU LU82316A patent/LU82316A1/fr unknown
- 1980-04-01 PT PT71044A patent/PT71044A/pt not_active IP Right Cessation
- 1980-04-01 HU HU8080774A patent/HU181087B/hu not_active IP Right Cessation
- 1980-04-01 CH CH257180A patent/CH645092A5/de not_active IP Right Cessation
- 1980-04-01 DK DK140480A patent/DK140480A/da not_active IP Right Cessation
- 1980-04-01 IT IT21110/80A patent/IT1147332B/it active
- 1980-04-02 BE BE0/200091A patent/BE882601A/fr not_active IP Right Cessation
- 1980-04-02 AT AT0179480A patent/AT373577B/de not_active IP Right Cessation
- 1980-04-02 JP JP4402080A patent/JPS55133345A/ja active Pending
Also Published As
Publication number | Publication date |
---|---|
ATA179480A (de) | 1983-06-15 |
ES490166A0 (es) | 1981-04-01 |
PT71044A (en) | 1980-05-01 |
IT1147332B (it) | 1986-11-19 |
CH645092A5 (de) | 1984-09-14 |
IE800638L (en) | 1980-10-02 |
GB2045771B (en) | 1983-01-26 |
HU181087B (en) | 1983-05-30 |
IT8021110A0 (it) | 1980-04-01 |
NO800931L (no) | 1980-10-03 |
FR2453135A1 (fr) | 1980-10-31 |
AU5638080A (en) | 1980-10-09 |
NZ193142A (en) | 1984-08-24 |
FR2453135B1 (pt) | 1983-06-17 |
NL8001675A (nl) | 1980-10-06 |
AU537592B2 (en) | 1984-07-05 |
NO150360C (no) | 1984-10-03 |
ZA801527B (en) | 1981-03-25 |
BE882601A (fr) | 1980-10-02 |
AT373577B (de) | 1984-02-10 |
NO150360B (no) | 1984-06-25 |
DE3012140A1 (de) | 1980-10-23 |
SE8002512L (sv) | 1980-10-03 |
GB2045771A (en) | 1980-11-05 |
PH22024A (en) | 1988-05-13 |
IE49653B1 (en) | 1985-11-13 |
ES8104200A1 (es) | 1981-04-01 |
GR67752B (pt) | 1981-09-18 |
LU82316A1 (fr) | 1980-12-16 |
JPS55133345A (en) | 1980-10-17 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
DK158679C (da) | Fremgangsmaade til fremstilling af ethanol | |
DK229980A (da) | Fremgangsmaade til fremstilling af n-heterocyclyl-thienamyciner | |
DK140480A (da) | Fremgangsmaade til fremstilling af mercaptoacyldipeptider | |
DK160679A (da) | Fremgangsmaade til fremstilling af derivater af 4-desacetyl-vincaleucoblastin-c-3-carboxhydrazid | |
DK277880A (da) | Fremgangsmaade til fremstilling af dipeptider | |
DK232080A (da) | Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater | |
DK300781A (da) | Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater | |
DK152752C (da) | Fremgangsmaade til fremstilling af l-sulpirid | |
DK226579A (da) | Fremgangsmaade til fremstilling af metaboliter | |
DK36379A (da) | Fremgangsmaade til fremstilling af n-ethylethylendiamin | |
DK153469C (da) | Fremgangsmaade til fremstilling af fluorerede alkenylaminer | |
DK183880A (da) | Fremgangsmaade til fremstilling af hydroxyderivater af isopropyrimidin | |
DK143107C (da) | Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin | |
DK341980A (da) | Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin | |
DK144280A (da) | Fremgangsmaade til fremstilling af 2-aminopyraziner | |
DK147404C (da) | Fremgangsmaade til fremstilling af l-asparaginsyre-n-thiocarboxyanhydrid | |
DK149472C (da) | Fremgangsmaade til fremstilling af phosphorchloridthiolater | |
DK158038C (da) | Fremgangsmaade til fremstilling af di-n-propylacetonitril | |
DK311480A (da) | Fremgangsmaade til fremstilling af 1,1-dichloralkener | |
DK274480A (da) | Fremgangsmaade til fremstilling af pyrenzepin | |
DK147420C (da) | Fremgangsmaade til fremstilling af acylcyanider | |
DK160294C (da) | Fremgangsmaade til fremstilling af 3-oxycyclopentener | |
DK158678A (da) | Fremgangsmaade til fremstilling af d-homosteroider | |
DK545280A (da) | Fremgangsmaade til fremstilling af nitrothiazolinforbindelser | |
DK146533C (da) | Fremgangsmaade til fremstilling af 4-nitrothioanisol |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AHS | Application shelved for other reasons than non-payment | ||
PBP | Patent lapsed |