DK147404C - Fremgangsmaade til fremstilling af l-asparaginsyre-n-thiocarboxyanhydrid - Google Patents

Fremgangsmaade til fremstilling af l-asparaginsyre-n-thiocarboxyanhydrid

Info

Publication number
DK147404C
DK147404C DK392080A DK392080A DK147404C DK 147404 C DK147404 C DK 147404C DK 392080 A DK392080 A DK 392080A DK 392080 A DK392080 A DK 392080A DK 147404 C DK147404 C DK 147404C
Authority
DK
Denmark
Prior art keywords
thiocarboxyan
anhyride
preparing
asparaginic acid
asparaginic
Prior art date
Application number
DK392080A
Other languages
English (en)
Other versions
DK392080A (da
DK147404B (da
Inventor
Fredric James Vinick
Original Assignee
Pfizer
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Pfizer filed Critical Pfizer
Publication of DK392080A publication Critical patent/DK392080A/da
Publication of DK147404B publication Critical patent/DK147404B/da
Application granted granted Critical
Publication of DK147404C publication Critical patent/DK147404C/da

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07DHETEROCYCLIC COMPOUNDS
    • C07D277/00Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings
    • C07D277/02Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings
    • C07D277/20Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members
    • C07D277/32Heterocyclic compounds containing 1,3-thiazole or hydrogenated 1,3-thiazole rings not condensed with other rings having two or three double bonds between ring members or between ring members and non-ring members with hetero atoms or with carbon atoms having three bonds to hetero atoms with at the most one bond to halogen, e.g. ester or nitrile radicals, directly attached to ring carbon atoms
    • C07D277/34Oxygen atoms

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Peptides Or Proteins (AREA)
  • Thiazole And Isothizaole Compounds (AREA)
  • Organic Low-Molecular-Weight Compounds And Preparation Thereof (AREA)
DK392080A 1979-10-29 1980-09-16 Fremgangsmaade til fremstilling af l-asparaginsyre-n-thiocarboxyanhydrid DK147404C (da)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US8964179 1979-10-29
US06/089,641 US4256897A (en) 1979-10-29 1979-10-29 Process for the preparation of L-aspartic acid N-thiocarboxyanhydride

Publications (3)

Publication Number Publication Date
DK392080A DK392080A (da) 1981-04-30
DK147404B DK147404B (da) 1984-07-23
DK147404C true DK147404C (da) 1985-02-04

Family

ID=22218775

Family Applications (1)

Application Number Title Priority Date Filing Date
DK392080A DK147404C (da) 1979-10-29 1980-09-16 Fremgangsmaade til fremstilling af l-asparaginsyre-n-thiocarboxyanhydrid

Country Status (17)

Country Link
US (1) US4256897A (da)
EP (1) EP0029305B1 (da)
JP (1) JPS5679682A (da)
AR (1) AR222911A1 (da)
AT (1) ATE4207T1 (da)
AU (1) AU517075B2 (da)
CA (1) CA1142528A (da)
DE (1) DE3064309D1 (da)
DK (1) DK147404C (da)
ES (1) ES496350A0 (da)
GR (1) GR70310B (da)
IE (1) IE50363B1 (da)
IN (1) IN154694B (da)
PH (1) PH15077A (da)
PL (1) PL126831B1 (da)
YU (1) YU41008B (da)
ZA (1) ZA806613B (da)

Families Citing this family (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4797298A (en) * 1980-01-21 1989-01-10 Pfizer, Inc. Branched amides of L-aspartyl-D-amino acid dipeptides
US4870190A (en) * 1980-01-21 1989-09-26 Pfizer Inc. Branched amides of L-aspartyl-D-amino acid dipeptides
US4321391A (en) * 1980-11-05 1982-03-23 Pfizer, Inc. Preparation of L-aspartic acid N-thiocarboxyanhydride
IT1196167B (it) * 1984-06-27 1988-11-10 Chemi Spa Procedimento per la preparazione di n-tiocarbossianidridi di amminoacidi

Family Cites Families (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
BE703384A (da) * 1966-12-30 1968-03-01
NL6808552A (da) * 1967-06-30 1968-12-31
US3846398A (en) * 1969-04-17 1974-11-05 Merck & Co Inc Method for controlled stepwise synthesis of polypeptides utilizing n-thiocarboxy anhydrides of amino acids as reagents

Also Published As

Publication number Publication date
YU274880A (en) 1982-10-31
GR70310B (da) 1982-09-08
IE50363B1 (en) 1986-04-02
EP0029305B1 (en) 1983-07-20
EP0029305A1 (en) 1981-05-27
AU517075B2 (en) 1981-07-09
CA1142528A (en) 1983-03-08
JPS6145988B2 (da) 1986-10-11
YU41008B (en) 1986-10-31
AU6376480A (en) 1981-05-07
AR222911A1 (es) 1981-06-30
JPS5679682A (en) 1981-06-30
DK392080A (da) 1981-04-30
PL126831B1 (en) 1983-09-30
PL227474A1 (da) 1981-09-18
ATE4207T1 (de) 1983-08-15
PH15077A (en) 1982-05-31
IE802221L (en) 1981-04-29
DK147404B (da) 1984-07-23
ZA806613B (en) 1981-10-28
ES8204429A1 (es) 1982-05-01
DE3064309D1 (en) 1983-08-25
IN154694B (da) 1984-12-08
US4256897A (en) 1981-03-17
ES496350A0 (es) 1982-05-01

Similar Documents

Publication Publication Date Title
DK229980A (da) Fremgangsmaade til fremstilling af n-heterocyclyl-thienamyciner
DK140480A (da) Fremgangsmaade til fremstilling af mercaptoacyldipeptider
DK277880A (da) Fremgangsmaade til fremstilling af dipeptider
DK152752C (da) Fremgangsmaade til fremstilling af l-sulpirid
DK479981A (da) Fremgangsmaade til fremstilling af 3-aryl-3-hydroxyphthalimidiner
DK232080A (da) Fremgangsmaade til fremstilling af hydroxyaminoeburnanderivater
DK300781A (da) Fremgangsmaade til fremstilling af halogenfenylpyridyllylamin-derivater
DK147404C (da) Fremgangsmaade til fremstilling af l-asparaginsyre-n-thiocarboxyanhydrid
DK153469C (da) Fremgangsmaade til fremstilling af fluorerede alkenylaminer
DK36379A (da) Fremgangsmaade til fremstilling af n-ethylethylendiamin
DK143107C (da) Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin
DK144280A (da) Fremgangsmaade til fremstilling af 2-aminopyraziner
DK341980A (da) Fremgangsmaade til fremstilling af 2-isopropylaminopyrimidin
DK149472C (da) Fremgangsmaade til fremstilling af phosphorchloridthiolater
DK158038C (da) Fremgangsmaade til fremstilling af di-n-propylacetonitril
DK274480A (da) Fremgangsmaade til fremstilling af pyrenzepin
DK147420C (da) Fremgangsmaade til fremstilling af acylcyanider
DK160294C (da) Fremgangsmaade til fremstilling af 3-oxycyclopentener
DK545280A (da) Fremgangsmaade til fremstilling af nitrothiazolinforbindelser
DK158678A (da) Fremgangsmaade til fremstilling af d-homosteroider
DK159262C (da) Fremgangsmaade til fremstilling af phenylethanolaminer
DK146533C (da) Fremgangsmaade til fremstilling af 4-nitrothioanisol
DK87180A (da) Fremgangsmaade til fremstilling af 3-formylcyproheptadiner
DK195979A (da) Fremgangsmaade til fremstilling af d-homosteroider
DK153146C (da) Fremgangsmaade til fremstilling af l-asparaginsyre-n-thiocarboxyanhydrid

Legal Events

Date Code Title Description
PUP Patent expired