DE60306503T2 - Statin-therapie zur verbesserung der aufrechterhaltung der kognitiven funktion - Google Patents
Statin-therapie zur verbesserung der aufrechterhaltung der kognitiven funktion Download PDFInfo
- Publication number
- DE60306503T2 DE60306503T2 DE60306503T DE60306503T DE60306503T2 DE 60306503 T2 DE60306503 T2 DE 60306503T2 DE 60306503 T DE60306503 T DE 60306503T DE 60306503 T DE60306503 T DE 60306503T DE 60306503 T2 DE60306503 T2 DE 60306503T2
- Authority
- DE
- Germany
- Prior art keywords
- galantamine
- statin
- amount
- dementia
- active ingredient
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Lifetime
Links
- 229940121710 HMGCoA reductase inhibitor Drugs 0.000 title claims abstract description 81
- 238000012423 maintenance Methods 0.000 title description 3
- 230000003920 cognitive function Effects 0.000 title description 2
- 238000002560 therapeutic procedure Methods 0.000 title description 2
- ASUTZQLVASHGKV-JDFRZJQESA-N galanthamine Chemical compound O1C(=C23)C(OC)=CC=C2CN(C)CC[C@]23[C@@H]1C[C@@H](O)C=C2 ASUTZQLVASHGKV-JDFRZJQESA-N 0.000 claims abstract description 130
- 229960003980 galantamine Drugs 0.000 claims abstract description 64
- ASUTZQLVASHGKV-UHFFFAOYSA-N galanthamine hydrochloride Natural products O1C(=C23)C(OC)=CC=C2CN(C)CCC23C1CC(O)C=C2 ASUTZQLVASHGKV-UHFFFAOYSA-N 0.000 claims abstract description 64
- 206010012289 Dementia Diseases 0.000 claims abstract description 45
- 239000004480 active ingredient Substances 0.000 claims abstract description 18
- 208000026139 Memory disease Diseases 0.000 claims abstract description 15
- 238000002360 preparation method Methods 0.000 claims abstract description 10
- 238000000034 method Methods 0.000 claims abstract description 7
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 6
- RYMZZMVNJRMUDD-UHFFFAOYSA-N SJ000286063 Natural products C12C(OC(=O)C(C)(C)CC)CC(C)C=C2C=CC(C)C1CCC1CC(O)CC(=O)O1 RYMZZMVNJRMUDD-UHFFFAOYSA-N 0.000 claims description 11
- 229960002855 simvastatin Drugs 0.000 claims description 11
- RYMZZMVNJRMUDD-HGQWONQESA-N simvastatin Chemical compound C([C@H]1[C@@H](C)C=CC2=C[C@H](C)C[C@@H]([C@H]12)OC(=O)C(C)(C)CC)C[C@@H]1C[C@@H](O)CC(=O)O1 RYMZZMVNJRMUDD-HGQWONQESA-N 0.000 claims description 11
- 230000001225 therapeutic effect Effects 0.000 claims description 11
- 150000003839 salts Chemical class 0.000 claims description 10
- PCZOHLXUXFIOCF-UHFFFAOYSA-N Monacolin X Natural products C12C(OC(=O)C(C)CC)CC(C)C=C2C=CC(C)C1CCC1CC(O)CC(=O)O1 PCZOHLXUXFIOCF-UHFFFAOYSA-N 0.000 claims description 8
- 239000002253 acid Substances 0.000 claims description 8
- 229960004844 lovastatin Drugs 0.000 claims description 8
- PCZOHLXUXFIOCF-BXMDZJJMSA-N lovastatin Chemical compound C([C@H]1[C@@H](C)C=CC2=C[C@H](C)C[C@@H]([C@H]12)OC(=O)[C@@H](C)CC)C[C@@H]1C[C@@H](O)CC(=O)O1 PCZOHLXUXFIOCF-BXMDZJJMSA-N 0.000 claims description 8
- QLJODMDSTUBWDW-UHFFFAOYSA-N lovastatin hydroxy acid Natural products C1=CC(C)C(CCC(O)CC(O)CC(O)=O)C2C(OC(=O)C(C)CC)CC(C)C=C21 QLJODMDSTUBWDW-UHFFFAOYSA-N 0.000 claims description 8
- 238000004519 manufacturing process Methods 0.000 claims description 8
- XUKUURHRXDUEBC-KAYWLYCHSA-N Atorvastatin Chemical compound C=1C=CC=CC=1C1=C(C=2C=CC(F)=CC=2)N(CC[C@@H](O)C[C@@H](O)CC(O)=O)C(C(C)C)=C1C(=O)NC1=CC=CC=C1 XUKUURHRXDUEBC-KAYWLYCHSA-N 0.000 claims description 6
- XUKUURHRXDUEBC-UHFFFAOYSA-N Atorvastatin Natural products C=1C=CC=CC=1C1=C(C=2C=CC(F)=CC=2)N(CCC(O)CC(O)CC(O)=O)C(C(C)C)=C1C(=O)NC1=CC=CC=C1 XUKUURHRXDUEBC-UHFFFAOYSA-N 0.000 claims description 6
- 229960005370 atorvastatin Drugs 0.000 claims description 6
- 239000003814 drug Substances 0.000 claims description 6
- 239000000203 mixture Substances 0.000 claims description 6
- ZGGHKIMDNBDHJB-NRFPMOEYSA-M (3R,5S)-fluvastatin sodium Chemical compound [Na+].C12=CC=CC=C2N(C(C)C)C(\C=C\[C@@H](O)C[C@@H](O)CC([O-])=O)=C1C1=CC=C(F)C=C1 ZGGHKIMDNBDHJB-NRFPMOEYSA-M 0.000 claims description 5
- TUZYXOIXSAXUGO-UHFFFAOYSA-N Pravastatin Natural products C1=CC(C)C(CCC(O)CC(O)CC(O)=O)C2C(OC(=O)C(C)CC)CC(O)C=C21 TUZYXOIXSAXUGO-UHFFFAOYSA-N 0.000 claims description 5
- 239000002552 dosage form Substances 0.000 claims description 5
- 229960003765 fluvastatin Drugs 0.000 claims description 5
- 229960002965 pravastatin Drugs 0.000 claims description 5
- TUZYXOIXSAXUGO-PZAWKZKUSA-N pravastatin Chemical compound C1=C[C@H](C)[C@H](CC[C@@H](O)C[C@@H](O)CC(O)=O)[C@H]2[C@@H](OC(=O)[C@@H](C)CC)C[C@H](O)C=C21 TUZYXOIXSAXUGO-PZAWKZKUSA-N 0.000 claims description 5
- 229940079593 drug Drugs 0.000 claims description 4
- 229960000672 rosuvastatin Drugs 0.000 claims description 4
- BPRHUIZQVSMCRT-VEUZHWNKSA-N rosuvastatin Chemical compound CC(C)C1=NC(N(C)S(C)(=O)=O)=NC(C=2C=CC(F)=CC=2)=C1\C=C\[C@@H](O)C[C@@H](O)CC(O)=O BPRHUIZQVSMCRT-VEUZHWNKSA-N 0.000 claims description 4
- 238000009097 single-agent therapy Methods 0.000 claims description 4
- 229960002024 galantamine hydrobromide Drugs 0.000 claims 3
- QORVDGQLPPAFRS-XPSHAMGMSA-N galantamine hydrobromide Chemical compound Br.O1C(=C23)C(OC)=CC=C2CN(C)CC[C@]23[C@@H]1C[C@@H](O)C=C2 QORVDGQLPPAFRS-XPSHAMGMSA-N 0.000 claims 3
- 239000003937 drug carrier Substances 0.000 claims 1
- 208000024827 Alzheimer disease Diseases 0.000 abstract description 21
- 239000002471 hydroxymethylglutaryl coenzyme A reductase inhibitor Substances 0.000 description 23
- 230000000694 effects Effects 0.000 description 12
- OIPILFWXSMYKGL-UHFFFAOYSA-N acetylcholine Chemical compound CC(=O)OCC[N+](C)(C)C OIPILFWXSMYKGL-UHFFFAOYSA-N 0.000 description 11
- 229960004373 acetylcholine Drugs 0.000 description 11
- 208000024891 symptom Diseases 0.000 description 9
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 8
- 230000003542 behavioural effect Effects 0.000 description 7
- 108010022752 Acetylcholinesterase Proteins 0.000 description 6
- 102100033639 Acetylcholinesterase Human genes 0.000 description 6
- 229940022698 acetylcholinesterase Drugs 0.000 description 6
- 230000001149 cognitive effect Effects 0.000 description 6
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 6
- 210000004556 brain Anatomy 0.000 description 5
- 150000001875 compounds Chemical class 0.000 description 5
- 102000004190 Enzymes Human genes 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- 150000007513 acids Chemical class 0.000 description 4
- 235000012000 cholesterol Nutrition 0.000 description 4
- 239000000544 cholinesterase inhibitor Substances 0.000 description 4
- 201000010099 disease Diseases 0.000 description 4
- 229940088598 enzyme Drugs 0.000 description 4
- 239000000902 placebo Substances 0.000 description 4
- 229940068196 placebo Drugs 0.000 description 4
- 230000000946 synaptic effect Effects 0.000 description 4
- 229940124596 AChE inhibitor Drugs 0.000 description 3
- 208000000044 Amnesia Diseases 0.000 description 3
- 102000013455 Amyloid beta-Peptides Human genes 0.000 description 3
- 108010090849 Amyloid beta-Peptides Proteins 0.000 description 3
- 230000019771 cognition Effects 0.000 description 3
- 238000009826 distribution Methods 0.000 description 3
- 230000006984 memory degeneration Effects 0.000 description 3
- 208000023060 memory loss Diseases 0.000 description 3
- 230000036651 mood Effects 0.000 description 3
- 210000002569 neuron Anatomy 0.000 description 3
- 208000007848 Alcoholism Diseases 0.000 description 2
- 206010006002 Bone pain Diseases 0.000 description 2
- 206010012735 Diarrhoea Diseases 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- 238000008214 LDL Cholesterol Methods 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 208000000112 Myalgia Diseases 0.000 description 2
- ATUOYWHBWRKTHZ-UHFFFAOYSA-N Propane Chemical compound CCC ATUOYWHBWRKTHZ-UHFFFAOYSA-N 0.000 description 2
- 201000007930 alcohol dependence Diseases 0.000 description 2
- DZHSAHHDTRWUTF-SIQRNXPUSA-N amyloid-beta polypeptide 42 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 DZHSAHHDTRWUTF-SIQRNXPUSA-N 0.000 description 2
- 239000001961 anticonvulsive agent Substances 0.000 description 2
- 230000037007 arousal Effects 0.000 description 2
- 230000006399 behavior Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 230000002301 combined effect Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000006735 deficit Effects 0.000 description 2
- 230000007850 degeneration Effects 0.000 description 2
- 208000035475 disorder Diseases 0.000 description 2
- ADEBPBSSDYVVLD-UHFFFAOYSA-N donepezil Chemical compound O=C1C=2C=C(OC)C(OC)=CC=2CC1CC(CC1)CCN1CC1=CC=CC=C1 ADEBPBSSDYVVLD-UHFFFAOYSA-N 0.000 description 2
- -1 hydrohalic acids Chemical class 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 210000000225 synapse Anatomy 0.000 description 2
- HVYWMOMLDIMFJA-UHFFFAOYSA-N 3-cholesterol Natural products C1C=C2CC(O)CCC2(C)C2C1C1CCC(C(C)CCCC(C)C)C1(C)CC2 HVYWMOMLDIMFJA-UHFFFAOYSA-N 0.000 description 1
- 208000004998 Abdominal Pain Diseases 0.000 description 1
- 206010000087 Abdominal pain upper Diseases 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 206010067484 Adverse reaction Diseases 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 241000234270 Amaryllidaceae Species 0.000 description 1
- 208000019901 Anxiety disease Diseases 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 208000008035 Back Pain Diseases 0.000 description 1
- 206010065369 Burnout syndrome Diseases 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 108010053652 Butyrylcholinesterase Proteins 0.000 description 1
- 241001631457 Cannula Species 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 108010009685 Cholinergic Receptors Proteins 0.000 description 1
- 102100032404 Cholinesterase Human genes 0.000 description 1
- 229940122041 Cholinesterase inhibitor Drugs 0.000 description 1
- 208000017667 Chronic Disease Diseases 0.000 description 1
- 208000019888 Circadian rhythm sleep disease Diseases 0.000 description 1
- 235000005979 Citrus limon Nutrition 0.000 description 1
- 244000131522 Citrus pyriformis Species 0.000 description 1
- RGJOEKWQDUBAIZ-IBOSZNHHSA-N CoASH Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCS)O[C@H]1N1C2=NC=NC(N)=C2N=C1 RGJOEKWQDUBAIZ-IBOSZNHHSA-N 0.000 description 1
- 208000031124 Dementia Alzheimer type Diseases 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 201000011240 Frontotemporal dementia Diseases 0.000 description 1
- 241000234283 Galanthus nivalis Species 0.000 description 1
- 206010019196 Head injury Diseases 0.000 description 1
- 206010019233 Headaches Diseases 0.000 description 1
- 208000023105 Huntington disease Diseases 0.000 description 1
- 102100030643 Hydroxycarboxylic acid receptor 2 Human genes 0.000 description 1
- 208000035150 Hypercholesterolemia Diseases 0.000 description 1
- 208000031226 Hyperlipidaemia Diseases 0.000 description 1
- 206010061216 Infarction Diseases 0.000 description 1
- 208000001456 Jet Lag Syndrome Diseases 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 208000034800 Leukoencephalopathies Diseases 0.000 description 1
- 208000009829 Lewy Body Disease Diseases 0.000 description 1
- 201000002832 Lewy body dementia Diseases 0.000 description 1
- 206010026749 Mania Diseases 0.000 description 1
- 208000027382 Mental deterioration Diseases 0.000 description 1
- 206010027374 Mental impairment Diseases 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 208000007101 Muscle Cramp Diseases 0.000 description 1
- 208000010428 Muscle Weakness Diseases 0.000 description 1
- 206010028372 Muscular weakness Diseases 0.000 description 1
- 206010028813 Nausea Diseases 0.000 description 1
- 206010057852 Nicotine dependence Diseases 0.000 description 1
- 108700010041 Nicotinic acid receptor Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- 206010037180 Psychiatric symptoms Diseases 0.000 description 1
- 208000028017 Psychotic disease Diseases 0.000 description 1
- XSVMFMHYUFZWBK-NSHDSACASA-N Rivastigmine Chemical compound CCN(C)C(=O)OC1=CC=CC([C@H](C)N(C)C)=C1 XSVMFMHYUFZWBK-NSHDSACASA-N 0.000 description 1
- 206010041243 Social avoidant behaviour Diseases 0.000 description 1
- 208000025569 Tobacco Use disease Diseases 0.000 description 1
- 201000004810 Vascular dementia Diseases 0.000 description 1
- 206010047700 Vomiting Diseases 0.000 description 1
- 125000000218 acetic acid group Chemical group C(C)(=O)* 0.000 description 1
- 102000034337 acetylcholine receptors Human genes 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 230000006838 adverse reaction Effects 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 230000003281 allosteric effect Effects 0.000 description 1
- 238000000540 analysis of variance Methods 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 208000022531 anorexia Diseases 0.000 description 1
- 230000003556 anti-epileptic effect Effects 0.000 description 1
- 229940125681 anticonvulsant agent Drugs 0.000 description 1
- 239000000935 antidepressant agent Substances 0.000 description 1
- 229940005513 antidepressants Drugs 0.000 description 1
- 229960003965 antiepileptics Drugs 0.000 description 1
- 239000000164 antipsychotic agent Substances 0.000 description 1
- 229940005529 antipsychotics Drugs 0.000 description 1
- 230000036506 anxiety Effects 0.000 description 1
- 239000002249 anxiolytic agent Substances 0.000 description 1
- 230000000949 anxiolytic effect Effects 0.000 description 1
- 229940005530 anxiolytics Drugs 0.000 description 1
- 230000002917 arthritic effect Effects 0.000 description 1
- 208000013404 behavioral symptom Diseases 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 230000006931 brain damage Effects 0.000 description 1
- 231100000874 brain damage Toxicity 0.000 description 1
- 208000029028 brain injury Diseases 0.000 description 1
- 229960000623 carbamazepine Drugs 0.000 description 1
- FFGPTBGBLSHEPO-UHFFFAOYSA-N carbamazepine Chemical compound C1=CC2=CC=CC=C2N(C(=O)N)C2=CC=CC=C21 FFGPTBGBLSHEPO-UHFFFAOYSA-N 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- 230000001713 cholinergic effect Effects 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- RGJOEKWQDUBAIZ-UHFFFAOYSA-N coenzime A Natural products OC1C(OP(O)(O)=O)C(COP(O)(=O)OP(O)(=O)OCC(C)(C)C(O)C(=O)NCCC(=O)NCCS)OC1N1C2=NC=NC(N)=C2N=C1 RGJOEKWQDUBAIZ-UHFFFAOYSA-N 0.000 description 1
- 239000005516 coenzyme A Substances 0.000 description 1
- 229940093530 coenzyme a Drugs 0.000 description 1
- 208000010877 cognitive disease Diseases 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000001054 cortical effect Effects 0.000 description 1
- 206010061428 decreased appetite Diseases 0.000 description 1
- 230000000593 degrading effect Effects 0.000 description 1
- 208000017004 dementia pugilistica Diseases 0.000 description 1
- KDTSHFARGAKYJN-UHFFFAOYSA-N dephosphocoenzyme A Natural products OC1C(O)C(COP(O)(=O)OP(O)(=O)OCC(C)(C)C(O)C(=O)NCCC(=O)NCCS)OC1N1C2=NC=NC(N)=C2N=C1 KDTSHFARGAKYJN-UHFFFAOYSA-N 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- NIJJYAXOARWZEE-UHFFFAOYSA-N di-n-propyl-acetic acid Natural products CCCC(C(O)=O)CCC NIJJYAXOARWZEE-UHFFFAOYSA-N 0.000 description 1
- 229960003530 donepezil Drugs 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 231100000869 headache Toxicity 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 230000001771 impaired effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 230000007574 infarction Effects 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 238000000185 intracerebroventricular administration Methods 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000007914 intraventricular administration Methods 0.000 description 1
- 208000033915 jet lag type circadian rhythm sleep disease Diseases 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000003340 mental effect Effects 0.000 description 1
- 230000003924 mental process Effects 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 230000003387 muscular Effects 0.000 description 1
- 201000000585 muscular atrophy Diseases 0.000 description 1
- 230000008693 nausea Effects 0.000 description 1
- 210000005036 nerve Anatomy 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 230000004770 neurodegeneration Effects 0.000 description 1
- 208000015122 neurodegenerative disease Diseases 0.000 description 1
- 230000000926 neurological effect Effects 0.000 description 1
- 239000002858 neurotransmitter agent Substances 0.000 description 1
- 230000000474 nursing effect Effects 0.000 description 1
- 235000016709 nutrition Nutrition 0.000 description 1
- 230000035764 nutrition Effects 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 230000037081 physical activity Effects 0.000 description 1
- 230000008092 positive effect Effects 0.000 description 1
- 230000001242 postsynaptic effect Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 201000002212 progressive supranuclear palsy Diseases 0.000 description 1
- 230000002035 prolonged effect Effects 0.000 description 1
- 239000001294 propane Substances 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 108090000623 proteins and genes Proteins 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 229960004136 rivastigmine Drugs 0.000 description 1
- 201000000980 schizophrenia Diseases 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- DFVFTMTWCUHJBL-BQBZGAKWSA-N statine Chemical compound CC(C)C[C@H](N)[C@@H](O)CC(O)=O DFVFTMTWCUHJBL-BQBZGAKWSA-N 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000002636 symptomatic treatment Methods 0.000 description 1
- 230000007470 synaptic degeneration Effects 0.000 description 1
- 230000005062 synaptic transmission Effects 0.000 description 1
- 208000011580 syndromic disease Diseases 0.000 description 1
- 229960001685 tacrine Drugs 0.000 description 1
- YLJREFDVOIBQDA-UHFFFAOYSA-N tacrine Chemical compound C1=CC=C2C(N)=C(CCCC3)C3=NC2=C1 YLJREFDVOIBQDA-UHFFFAOYSA-N 0.000 description 1
- UUBIWGRMBVAUIK-UHFFFAOYSA-N tetracyclo[5.5.2.04,13.010,14]tetradeca-1(13),4,6,10(14),11-pentaene Chemical compound C1CC2=CC=C3CCC4=CC=C1C2=C43 UUBIWGRMBVAUIK-UHFFFAOYSA-N 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- MSRILKIQRXUYCT-UHFFFAOYSA-M valproate semisodium Chemical compound [Na+].CCCC(C(O)=O)CCC.CCCC(C([O-])=O)CCC MSRILKIQRXUYCT-UHFFFAOYSA-M 0.000 description 1
- 229960000604 valproic acid Drugs 0.000 description 1
- 235000021419 vinegar Nutrition 0.000 description 1
- 239000000052 vinegar Substances 0.000 description 1
- 230000008673 vomiting Effects 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/55—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/21—Esters, e.g. nitroglycerine, selenocyanates
- A61K31/215—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids
- A61K31/22—Esters, e.g. nitroglycerine, selenocyanates of carboxylic acids of acyclic acids, e.g. pravastatin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
Landscapes
- Health & Medical Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Medicinal Chemistry (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Life Sciences & Earth Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Epidemiology (AREA)
- Engineering & Computer Science (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- General Chemical & Material Sciences (AREA)
- Biomedical Technology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Neurology (AREA)
- Neurosurgery (AREA)
- Psychiatry (AREA)
- Hospice & Palliative Care (AREA)
- Emergency Medicine (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Pyrane Compounds (AREA)
- Acyclic And Carbocyclic Compounds In Medicinal Compositions (AREA)
- Nitrogen Condensed Heterocyclic Rings (AREA)
- Pyrrole Compounds (AREA)
- Indole Compounds (AREA)
Applications Claiming Priority (3)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US36928502P | 2002-04-02 | 2002-04-02 | |
| US369285P | 2002-04-02 | ||
| PCT/EP2003/003324 WO2003082298A1 (en) | 2002-04-02 | 2003-03-28 | Statin therapy for enhancing cognitive maintenance |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| DE60306503D1 DE60306503D1 (de) | 2006-08-10 |
| DE60306503T2 true DE60306503T2 (de) | 2007-06-21 |
Family
ID=28675573
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| DE60306503T Expired - Lifetime DE60306503T2 (de) | 2002-04-02 | 2003-03-28 | Statin-therapie zur verbesserung der aufrechterhaltung der kognitiven funktion |
Country Status (21)
| Country | Link |
|---|---|
| EP (1) | EP1492539B1 (https=) |
| JP (1) | JP2005525391A (https=) |
| KR (1) | KR100986194B1 (https=) |
| CN (1) | CN100528164C (https=) |
| AT (1) | ATE331523T1 (https=) |
| AU (1) | AU2003226753B2 (https=) |
| BR (1) | BR0308293A (https=) |
| CA (1) | CA2480275C (https=) |
| CY (1) | CY1105545T1 (https=) |
| DE (1) | DE60306503T2 (https=) |
| DK (1) | DK1492539T3 (https=) |
| EA (1) | EA013069B1 (https=) |
| ES (1) | ES2268393T3 (https=) |
| IL (2) | IL164317A0 (https=) |
| MX (1) | MXPA04009535A (https=) |
| NO (1) | NO20044698L (https=) |
| NZ (1) | NZ536111A (https=) |
| PL (1) | PL211160B1 (https=) |
| PT (1) | PT1492539E (https=) |
| UA (1) | UA79605C2 (https=) |
| WO (1) | WO2003082298A1 (https=) |
Families Citing this family (7)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2004071431A2 (en) * | 2003-02-05 | 2004-08-26 | Myriad Genetics, Inc. | Method and composition for treating neurodegenerative disorders |
| MXPA06011969A (es) * | 2004-04-14 | 2006-12-15 | Warner Lambert Co | Combinacion terapeutica para tratamiento de la enfermedad de alzheimer. |
| WO2005123068A2 (en) * | 2004-06-08 | 2005-12-29 | Axonyx, Inc. | Methods of dealying alzheimer’s disease progression using a beta-amyloid precursor protein inhibitor and a hmg coa reductase inhibitor |
| GB0607946D0 (en) * | 2006-04-21 | 2006-05-31 | Minster Res The Ltd | Mono and combination therapy |
| AU2007299726A1 (en) * | 2006-09-22 | 2008-03-27 | Braincells, Inc. | Combination comprising an HMG-COA reductase inhibitor and a second neurogenic agent for treating a nervous system disorder and increasing neurogenesis |
| TWI432195B (zh) | 2007-10-03 | 2014-04-01 | Kowa Co | 神經細胞死亡抑制劑 |
| WO2015089349A1 (en) * | 2013-12-13 | 2015-06-18 | Tabaczynski David A | Inhibition of isoprenoid biosynthetic pathways to treat neuroinflammatory disorders |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| TW506836B (en) * | 1996-06-14 | 2002-10-21 | Janssen Pharmaceutica Nv | Fast-dissolving galanthamine hydrobromide tablet |
-
2003
- 2003-03-28 IL IL16431703A patent/IL164317A0/xx unknown
- 2003-03-28 EA EA200401295A patent/EA013069B1/ru not_active IP Right Cessation
- 2003-03-28 CN CNB038073854A patent/CN100528164C/zh not_active Expired - Fee Related
- 2003-03-28 MX MXPA04009535A patent/MXPA04009535A/es active IP Right Grant
- 2003-03-28 PT PT03745196T patent/PT1492539E/pt unknown
- 2003-03-28 AU AU2003226753A patent/AU2003226753B2/en not_active Ceased
- 2003-03-28 DK DK03745196T patent/DK1492539T3/da active
- 2003-03-28 DE DE60306503T patent/DE60306503T2/de not_active Expired - Lifetime
- 2003-03-28 AT AT03745196T patent/ATE331523T1/de active
- 2003-03-28 PL PL371551A patent/PL211160B1/pl unknown
- 2003-03-28 CA CA2480275A patent/CA2480275C/en not_active Expired - Fee Related
- 2003-03-28 ES ES03745196T patent/ES2268393T3/es not_active Expired - Lifetime
- 2003-03-28 UA UA20040806803A patent/UA79605C2/uk unknown
- 2003-03-28 WO PCT/EP2003/003324 patent/WO2003082298A1/en not_active Ceased
- 2003-03-28 JP JP2003579835A patent/JP2005525391A/ja active Pending
- 2003-03-28 KR KR1020047013127A patent/KR100986194B1/ko not_active Expired - Fee Related
- 2003-03-28 BR BR0308293-8A patent/BR0308293A/pt not_active IP Right Cessation
- 2003-03-28 NZ NZ536111A patent/NZ536111A/xx not_active IP Right Cessation
- 2003-03-28 EP EP03745196A patent/EP1492539B1/en not_active Expired - Lifetime
-
2004
- 2004-09-28 IL IL164317A patent/IL164317A/en not_active IP Right Cessation
- 2004-10-29 NO NO20044698A patent/NO20044698L/no not_active Application Discontinuation
-
2006
- 2006-09-27 CY CY20061101397T patent/CY1105545T1/el unknown
Also Published As
| Publication number | Publication date |
|---|---|
| NO20044698L (no) | 2004-10-29 |
| IL164317A (en) | 2010-04-29 |
| EA013069B1 (ru) | 2010-02-26 |
| PL371551A1 (en) | 2005-06-27 |
| EP1492539A1 (en) | 2005-01-05 |
| AU2003226753A1 (en) | 2003-10-13 |
| CN100528164C (zh) | 2009-08-19 |
| AU2003226753B2 (en) | 2007-06-28 |
| IL164317A0 (en) | 2005-12-18 |
| JP2005525391A (ja) | 2005-08-25 |
| CA2480275A1 (en) | 2003-10-09 |
| EA200401295A1 (ru) | 2005-02-24 |
| WO2003082298A1 (en) | 2003-10-09 |
| CA2480275C (en) | 2011-08-16 |
| NZ536111A (en) | 2006-03-31 |
| EP1492539B1 (en) | 2006-06-28 |
| CN1642555A (zh) | 2005-07-20 |
| KR100986194B1 (ko) | 2010-10-07 |
| DE60306503D1 (de) | 2006-08-10 |
| CY1105545T1 (el) | 2010-07-28 |
| BR0308293A (pt) | 2004-12-28 |
| UA79605C2 (en) | 2007-07-10 |
| KR20040096608A (ko) | 2004-11-16 |
| PL211160B1 (pl) | 2012-04-30 |
| PT1492539E (pt) | 2006-11-30 |
| DK1492539T3 (da) | 2006-10-30 |
| ES2268393T3 (es) | 2007-03-16 |
| ATE331523T1 (de) | 2006-07-15 |
| MXPA04009535A (es) | 2005-01-25 |
| HK1079688A1 (zh) | 2006-04-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| DE69828881T2 (de) | Zusammensetzung zur linderung von störungen der stimmungslage bei gesunden individuen | |
| DE3855113T2 (de) | Verwendung von Buspiron zur Herstellung eines pharmazeutischen Präparats zur Behandlung der Alkoholsucht | |
| DE60009697T2 (de) | Verwendung von 1-[4-(5-cyanoindol-3yl)butyl]-4-(2-carbamoylbenzofuran-5-yl)piperazin und dessen physiologisch akzeptablen salzen zur behandlung von bipolaren krankheiten und manie | |
| DE3005208A1 (de) | Verwendung von acylcarnitin in arzneimitteln zur behandlung von stoerungen im gehirn-metabolismus | |
| DE60218193T2 (de) | Verwendung von 2-oxo-1-pyrrolidin-derivaten zur herstellung eines arzneimittels zur behandlung von dyskinesia | |
| DE19858789A1 (de) | Kombination von Cerivastatin und Fibraten | |
| DE69926804T2 (de) | Vorrichtungen zur behandlung und diagnose des restless leg syndroms | |
| DE60306503T2 (de) | Statin-therapie zur verbesserung der aufrechterhaltung der kognitiven funktion | |
| DE3820218C2 (https=) | ||
| EP0618797B1 (de) | Bilobalid enthaltende pharmazeutische zubereitungen zur behandlung von spannungs- und angstzuständen | |
| DE60125062T2 (de) | Quetiapin zur Behandlung der Dyskinesie in nicht-psychotischen Patienten | |
| EP1001756A1 (de) | Synergistisch wirkende zusammensetzungen zur selektiven bekämpfung von tumorgewebe | |
| DE69821970T2 (de) | Verwendung von CITICOLINE ZUR BEHANDLUNG VON MULTIPLER SKLEROSE | |
| DE10163667A1 (de) | Verwendung von Desoxypeganin zur Behandlung der klinischen Depression | |
| DE2352618A1 (de) | Arzneimittel zur behandlung des parkinsonismus | |
| DE3116859A1 (de) | Therapeutische zubereitungen fuer die behandlung einer tardiven dyskinesie | |
| DE60109799T2 (de) | Verwendung von quetiapin für aufmerksamkeitsmangel-hyperaktivitätsstörungen oder verhaltensstörungen | |
| AT402691B (de) | Verwendung von galanthamin zum herstellen von arzneimitteln zur behandlung von trisomie 21 oder verwandter trisomie-syndrome | |
| DE2161588A1 (de) | Mittel zur behandlung von hyperlipoproteinaemien und verfahren zu seiner herstellung | |
| DE2831728C2 (de) | Arzneimittel zur Behandlung von Kopfschmerzen | |
| US20050222122A1 (en) | Statin therapy for enhancing cognitive maintenance | |
| DE1617508A1 (de) | Neue Wirkstoffzusammensetzungen | |
| HK1079688B (en) | Statin product for enhancing cognitive maintenance | |
| DE10311921A1 (de) | Verwendung von Weihrauch zur Behandlung von zerebraler Ischämie | |
| DE10354893A1 (de) | Verwendung von Desoxypeganin zur Behandlung schizophrener Psychosen |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 8364 | No opposition during term of opposition |