WO2022098173A1 - 코로나바이러스 스파이크 단백질에 특이적인 항체 및 이의 용도 - Google Patents

코로나바이러스 스파이크 단백질에 특이적인 항체 및 이의 용도 Download PDF

Info

Publication number
WO2022098173A1
WO2022098173A1 PCT/KR2021/016073 KR2021016073W WO2022098173A1 WO 2022098173 A1 WO2022098173 A1 WO 2022098173A1 KR 2021016073 W KR2021016073 W KR 2021016073W WO 2022098173 A1 WO2022098173 A1 WO 2022098173A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
chain variable
heavy chain
variable region
Prior art date
Application number
PCT/KR2021/016073
Other languages
English (en)
French (fr)
Inventor
김동식
이수아
장신아
강지훈
조기준
박수빈
한영우
남혜미
오미영
이지붕
류지혜
김문경
이지원
Original Assignee
주식회사 녹십자
재단법인 목암생명과학연구소
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 녹십자, 재단법인 목암생명과학연구소 filed Critical 주식회사 녹십자
Priority to JP2023524972A priority Critical patent/JP2023547167A/ja
Priority to US18/035,235 priority patent/US20230417748A1/en
Priority to CN202180074379.9A priority patent/CN117098773A/zh
Priority to EP21889638.9A priority patent/EP4242224A1/en
Publication of WO2022098173A1 publication Critical patent/WO2022098173A1/ko

Links

Images

Classifications

    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56983—Viruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6839—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting material from viruses
    • A61K47/6841—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting material from viruses the antibody targeting a RNA virus
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
    • C07K16/1002—Coronaviridae
    • C07K16/1003—Severe acute respiratory syndrome coronavirus 2 [SARS‐CoV‐2 or Covid-19]
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/10—Processes for the isolation, preparation or purification of DNA or RNA
    • C12N15/1034—Isolating an individual clone by screening libraries
    • C12N15/1037—Screening libraries presented on the surface of microorganisms, e.g. phage display, E. coli display
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
    • G01N2333/08—RNA viruses
    • G01N2333/165—Coronaviridae, e.g. avian infectious bronchitis virus
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2469/00—Immunoassays for the detection of microorganisms
    • G01N2469/10—Detection of antigens from microorganism in sample from host

Definitions

  • the present invention relates to antibodies specific for the coronavirus spike (S) protein and uses thereof.
  • Coronavirus was first discovered in chickens in 1937, followed by animals such as dogs, pigs, and birds, and then in humans in 1965.
  • animals such as dogs, pigs, and birds, and then in humans in 1965.
  • corona phenomenon which is a phenomenon that glows white around the moon.
  • Coronaviruses are known to mainly cause pneumonia and enteritis in humans and animals, and are also known to occasionally cause nervous system infections and hepatitis.
  • Coronavirus belongs to the coronaviridae and is a positive sense RNA virus with a spherical outer membrane, about 100-120 nm in size.
  • Coronavirus consists of a total of five structural proteins, including the outermost spike protein (S), hemagglutinin-esterase (HE) protein, transmembrane (M) protein, small membrane (E) protein, and nucleocapsid (N) protein.
  • S outermost spike protein
  • HE hemagglutinin-esterase
  • M transmembrane
  • E small membrane
  • N nucleocapsid
  • the spike protein acts as a ligand that binds to the cell receptor and induces fusion between the host cell and the virus, and is known as the most mutable protein.
  • coronavirus has been recognized as a pathogen that rarely infects humans and mainly infects animals such as dogs, pigs, and cattle. It is one of several viruses that cause respiratory symptoms even when infecting humans, and only causes a simple cold or intestinal disease such as diarrhea, which is not very dangerous for children.
  • SARS Severe Acute Respiratory Syndrome
  • MERS Middle East Respiratory Syndrome
  • COVID-19 coronavirus disease 2019
  • COVID-19 is an infectious disease caused by SARS-coronavirus-2, a disease that was first identified in Wuhan, the capital of Hubei province, China at the end of 2019, and has spread worldwide, resulting in a progressive pandemic. As of May 7, 2020, more than 3.75 million cases were reported in 187 countries, with 263,000 deaths and 1.24 million recoveries. Common symptoms are fever, cough, fatigue, shortness of breath and loss of smell and taste. In most cases, symptoms are mild, but some progress to viral pneumonia, multi-organ failure, and a cytokine storm. The time from onset of symptoms to onset is usually about 5 days, but can be between 2 and 14 days.
  • the virus is spread from person to person primarily during close contact and sometimes through droplets that occur when coughing, sneezing, and talking. It is most contagious during the first 3 days after onset of symptoms and can be spread before symptoms appear or even late in the disease.
  • a standard method for diagnosing it is using real-time reverse transcription polymerase chain reaction (rRT-PCR) from a nasopharyngeal swab.
  • SARS-coronavirus-2 is known as a variant coronavirus belonging to the genus Beta coronavirus and is believed to have originated from bats, the primary carrier host for various coronaviruses (Antiviral Res., 101:45-56). , the exact route of infection has not yet been fully elucidated.
  • One object of the present invention is to provide an antibody or antigen-binding fragment thereof that specifically binds to the coronavirus spike protein.
  • Another object of the present invention is to provide a polynucleotide encoding the antibody or antigen-binding fragment, an expression vector comprising the polynucleotide, and a transformant comprising the expression vector.
  • Another object of the present invention is to provide a method for preparing the antibody or the binding fragment.
  • Another object of the present invention is to provide a composition for diagnosing coronavirus infection comprising the antibody or the binding fragment, and a kit comprising the same.
  • Another object of the present invention is to provide an information providing method for diagnosing a coronavirus infection, comprising the step of detecting a coronavirus present in a biological sample using the antibody or the binding fragment.
  • Another object of the present invention is to provide a pharmaceutical composition for preventing or treating coronavirus comprising the antibody or the binding fragment.
  • Another object of the present invention is to provide a method for treating coronavirus using the antibody or the binding fragment.
  • the antibody of the present invention can be usefully used for detecting and diagnosing coronavirus, as well as having a neutralizing ability of coronavirus and can be usefully used for prevention and treatment of coronavirus-infected diseases.
  • Figure 1 shows that the antigen is purified and the size and purity of the product are confirmed by SDS PAGE.
  • Figure 2 shows the size and purity of the product through SDS PAGE after expression and purification of the anti SARS-CoV-2 antibody obtained through library screening. Specifically, the overall size of the antibody ( ⁇ 150kDa) was confirmed through Non-reduced PAGE, and the size of the heavy chain ( ⁇ 50kDa) and light chain ( ⁇ 25kDa) of the antibody was confirmed through Reduced PAGE.
  • Figure 3 is the result of performing a sandwich ELISA to select antigen-specific anti-COVID-19 antibody, through which the antibody showing specific binding to the antigen was selected.
  • 4 shows the results of an experiment on whether the selected Anti-SARS-CoV2 antibody also binds to the S(S1S2) protein of SARS-CoV and MERS-CoV, which are other betacoronaviruses.
  • 5 is a result of confirming the results of IgG expression and purification of humanized clones by SDS-PAGE. Specifically, the overall size of the antibody ( ⁇ 150kDa) was confirmed through Non-reduced PAGE, and the size of the heavy chain ( ⁇ 50kDa) and light chain ( ⁇ 25kDa) of the antibody was confirmed through Reduced PAGE.
  • Figure 6 is a result of performing a sandwich ELISA to screen antigen-specific anti-COVID-19 humanized antibody. Specifically, it is the result of confirming that all of the humanized clones maintain the same binding force as before.
  • Figure 8a is a result of the kinetics among the binding properties of the antibody to the anti-SARS-CoV-2 antigen.
  • the humanized antibody M4-4 had a dissociation constant value that was 10 times higher than that of the existing antibody M4.
  • Figure 8b is a result of evaluating the binding ability of the antibody to the Alpha, Beta, Gamma mutations among the binding properties of the antibody to the anti-SARA-CoV-2 antigen. Specifically, it was confirmed that M4-4 had a very strong binding force to all mutations.
  • Figure 9a is the result of observing the expression of ACE2 in ACE2-HEK293 cells by flow cytometry.
  • 9B shows the results of measuring the SARS-Cov-2 pseudovirus neutralizing ability of the candidate antibody using SARS-CoV-2 pseudovirus and ACE2-HEK293 cells.
  • 10a is a result of observation of Spike protein expression in HT1080-S cells by flow cytometry.
  • Figure 10b is the result of measuring the ADCC efficacy of the candidate antibody using ADCC Effector cells and HT1080-S cells.
  • Figure 10c is the result of measuring the ADCP efficacy of the candidate antibody using Fc ⁇ RIIa-H Effector cells and HT1080-S cells.
  • FIG. 11 shows the neutralizing activity of anti-SARS-CoV-2 antibodies against authentic, wild type antigens, alpha, beta, and gamma mutant antigens. Specifically, the M4-4 antibody was observed to have a neutralizing effect equal to or greater than that of the comparative antibody in all cases.
  • M4-4 binds to a wide epitope capable of 100% competition with REGN10987, S309, and ACE2 receptors.
  • One aspect of the present invention provides an antibody or antigen-binding fragment thereof that specifically binds to the coronavirus spike (S) protein.
  • coronavirus refers to a positive-sense single-stranded RNA virus (ssRNA) belonging to the Coronaviridae family and having a spherical outer membrane, with a size of about 80-220 nm.
  • Coronaviruses are the outermost spike (S) protein, hemagglutinin-esterase (HE) protein, membrane (M) protein, envelope (E) protein and nucleocapsid ( It is known to contain five structural proteins such as nucleocapsid, NP) protein (Lai and Homes, 2001. Fields Virology).
  • the coronavirus may be SARS-CoV, SARS-CoV-2 or MERS-CoV, specifically SARS-CoV-2, but is not limited thereto.
  • the coronavirus spike (S) protein may be a spike 1 (spike1, S1) protein in which some domains of the spike (S) protein of SARS-CoV-2 are truncated, but the antibody or antigen-binding fragment thereof of the present invention Coronaviruses capable of specifically binding are included without limitation.
  • SARS-CoV-2 SARS-coronavirus-2
  • COVID-19 Coronavirus Infectious Disease-19
  • SARS-CoV-2 is a positive single-stranded RNA virus.
  • SARS-CoV-2 is a taxonomic strain of SARS-CoV, has zoonotic origins, and is considered to have close genetic similarity to bat coronavirus.
  • the SARS-CoV-2 is mainly spread through close contact between people and/or through droplets generated during coughing or sneezing, and mainly the receptor angiotensin converting enzyme 2 that has the spike (S) protein of the virus shell on the surface of human cells. It is known to enter human cells by binding to (angiotensin converting enzyme 2, ACE2).
  • SARS-CoV-2 is RNA-dependent RNA polymerase, spike (S), membrane (M), envelope (E) and nucleocapsid (NP) proteins and/or genes encoding these proteins may include Among SARS-CoV-2 structural proteins, the spike (S) protein exists on the surface of virus particles and is involved in host cell invasion, and is divided into S1 and S2. The S1 protein interacts with the receptor of the host cell, and the receptor-binding domain (RBD) present in the S1 protein is known as a key site for binding to the ACE2 receptor present on the host cell surface. The S2 protein is involved in fusion with the host cell membrane.
  • the antibody or fragment thereof provided in the present invention may specifically bind to the spike 1 (S1) protein, which is a cleaved form of a part of the spike (S) protein of SARS-CoV-2.
  • the antibody that specifically binds to the coronavirus spike protein may be a mouse antibody, a chimeric antibody, or a humanized antibody.
  • the antigenic determinant region (epitope, epitope) recognized by the antibody or fragment thereof provided in the present invention may be a part of the binding domain (CD) present in the spike 1 (S1) protein of SARS-CoV-2.
  • the term "antibody” refers to a protein molecule serving as a ligand that specifically recognizes an antigen, including immunoglobulin molecules having immunological reactivity with a specific antigen, polyclonal antibody, monoclonal antibody, Includes both whole antibodies and antibody fragments.
  • the term also includes chimeric antibodies (eg, humanized murine antibodies) and bivalent or bispecific molecules (eg, bispecific antibodies), diabodies, triabodies and tetrabodies.
  • the term further includes single-chain antibodies having a binding function for neonatal Fc receptor (FcRn), scaps, derivatives of antibody constant regions, and artificial antibodies based on protein scaffolds.
  • the whole antibody has a structure having two full-length light chains (LC) and two full-length heavy chains (HC), and each light chain is connected to the heavy chain by a disulfide bond.
  • the whole antibody includes IgA, IgD, IgE, IgM and IgG, and IgG is a subtype, including IgG1, IgG2, IgG3 and IgG4.
  • the antibody provided by the present invention may be an IgG antibody.
  • fragment binding fragment of a polypeptide
  • antibody fragment refers to any fragment of an antibody of the invention that retains the antigen-binding activity of the antibody.
  • Exemplary antibody fragments include, but are not limited to, single chain antibodies, Fd, Fab, Fab', F(ab')2, dsFv or scFv.
  • the Fd refers to the heavy chain portion included in the Fab fragment.
  • the Fab has a structure having a light chain and a heavy chain variable region (variable region), a light chain constant region (framework region, FR), and a heavy chain first constant region (CH1 domain), and has one antigen-binding site.
  • Fab' differs from Fab in that it has a hinge region comprising one or more cysteine residues at the C-terminus of the heavy chain CH1 domain.
  • the F(ab')2 antibody is produced by forming a disulfide bond with a cysteine residue in the hinge region of Fab'.
  • Fv (variable fragment) refers to a minimal antibody fragment having only a heavy chain variable region and a light chain variable region.
  • dsFv double disulfide Fv
  • scFv single chain Fv
  • the heavy chain variable region and the light chain variable region are covalently linked through a peptide linker.
  • Such antibody fragments can be obtained using proteolytic enzymes (for example, Fab can be obtained by restriction digestion of the entire antibody with papain, and F(ab')2 fragments can be obtained by digestion with pepsin), For example, it can be produced through genetic recombination technology.
  • proteolytic enzymes for example, Fab can be obtained by restriction digestion of the entire antibody with papain, and F(ab')2 fragments can be obtained by digestion with pepsin
  • epitopic determinant is also referred to as “epitope”, and refers to a region or region of an antigen to which an antibody or antibody fragment specifically binds to an antigen.
  • the antibody or antigen-binding fragment thereof may be one that competitively binds to an epitope derived from a coronavirus spike to which casirivimab (REGN10933), imdevimab (REGN10987), and/or S309 binds.
  • casirivimab casirivimab
  • REGN10987 imdevimab
  • S309 binds to an epitope derived from a coronavirus spike to which casirivimab (REGN10933), imdevimab (REGN10987), and/or S309 binds.
  • the present invention is not limited thereto.
  • the antibody provided in the present invention may be a monoclonal antibody.
  • the term "monoclonal antibody” refers to an antibody molecule of a single molecular composition obtained from substantially the same antibody population, and such monoclonal antibody exhibits a single binding specificity and affinity for a specific epitope.
  • immunoglobulins typically have heavy and light chains, each heavy and light chain comprising a constant region and a variable region (these regions are also known as domains).
  • the variable regions of the light and heavy chains comprise three variable regions and four framework regions called complementarity-determining regions (hereinafter referred to as "CDRs").
  • the CDRs mainly serve to bind to an epitope of an antigen.
  • the CDRs of each chain are called sequentially CDR1, CDR2, CDR3, typically starting from the N-terminus, and are also identified by the chain in which the specific CDR is located.
  • an immunoglobulin has a heavy chain and a light chain, each heavy and light chain comprising a constant region and a variable region.
  • the variable regions of the light and heavy chains include three complementarity-determining regions (hereinafter referred to as "CDRs") and four framework regions (hereinafter referred to as "FRs”) called complementarity determining regions.
  • CDRs complementarity-determining regions
  • FRs framework regions
  • the CDRs of each chain mainly play a role in binding to an epitope of an antigen, and are typically named CDR1, CDR2, and CDR3 sequentially, starting from the N-terminus.
  • the FR of each chain may be sequentially named FR1, FR2, FR3, FR4 starting from the N-terminus.
  • variable region of the heavy chain may be named 'V H ', the variable region of the light chain as 'V L ', and the CDRs of the heavy chain are 'V H -CDR1', 'V H -CDR2', 'V', respectively.
  • the CDRs of the light chain are respectively 'V L -CDR1', 'V L -CDR2', 'V L -CDR3'
  • the FRs of the heavy chain are 'V H -FR1', 'V H -FR2, respectively ', 'V H -FR3', 'V H -FR4'
  • the FR of the light chain is named 'V L -FR1', 'V L -FR2', 'V L -FR3', 'V L -FR4' can be
  • the antibody or binding fragment thereof that specifically binds to the coronavirus spike protein of the present invention comprises any one of SEQ ID NOs: 5 to 45, SEQ ID NOs: 87 to 91, SEQ ID NOs: 97 to 115 any one or more heavy chain variable regions selected from the group; and SEQ ID NOs: 46 to 86, SEQ ID NOs: 92 to 96, and SEQ ID NOs: 116 to 131 may include any one or more light chain variable regions selected from the group comprising any one of the sequences.
  • the antibody or antigen-binding fragment thereof may have a cross-reactivity with two or more types of coronaviruses.
  • the coronavirus may be SARS-CoV, SARS-CoV-2 or MERS-CoV, but is not limited thereto as long as it has a cross-reactivity.
  • the antibody or antigen-binding fragment thereof having a cross-reactivity to the two or more coronaviruses is SEQ ID NO: 6 to 12, SEQ ID NO: 14 to 22, SEQ ID NO: 24, 25, 32, 37, 45, SEQ ID NO: 87 to 91 , and any one or more heavy chain variable regions selected from the group comprising any one of SEQ ID NOs: 97 to 99; And any one or more light chain variable regions selected from the group comprising any one of SEQ ID NOs: 47 to 53, SEQ ID NOs: 55 to 63, SEQ ID NOs: 65, 66, 73, 78, 86, and SEQ ID NOs: 92 to 96 It may include, but is not limited to.
  • human antibody refers to a molecule derived from human immunoglobulin, wherein the entire amino acid sequence constituting the antibody, including the complementarity determining region and structural region, is composed of the amino acid sequence of human immunoglobulin.
  • Human antibodies are commonly used for the treatment of human diseases, which may have three or more potential advantages. First, it interacts better with the human immune system, for example in complement-dependent cytotoxicity (CDC) or antibody-dependent cell-mediated cytotoxicity (ADCC). Thus, it is possible to more efficiently destroy the target cells. Second, it has the advantage that the human immune system does not recognize the antibody as foreign.
  • the human antibodies according to the present invention have a preventive or therapeutic effect on coronavirus, particularly SARS-CoV-2, and thus can be usefully used in the treatment of SARS-CoV-2.
  • the human monoclonal antibody of the present invention may include a constant region derived from IgG, IgA, IgD, IgE, IgM, a combination thereof, or a hybrid thereof.
  • dimer or multimers may be formed from two or more constant regions selected from the group consisting of constant regions of IgG, IgA, IgD, IgE and IgM.
  • hybrid means that sequences corresponding to the constant regions of immunoglobulin heavy chains of two or more different origins exist in the constant regions of single-chain immunoglobulin heavy chains, for example, IgG, IgA, IgD, IgE And hybridization of domains consisting of 1 to 4 domains selected from the group consisting of CH1, CH2, CH3 and CH4 of IgM is possible.
  • binding to an antibody or antigen fragment thereof may have the same or different origins of the variable region and the constant region, and may have the same or different origins of the CDR, variable regions and constant regions excluding them.
  • the antibody or antigen fragment binding thereof of the present invention is a heavy chain CDR1 of SEQ ID NO: 139; heavy chain CDR2 of SEQ ID NO: 140; and a heavy chain variable region comprising a heavy chain CDR3 of SEQ ID NO: 141 and a light chain CDR1 of SEQ ID NO: 142 or 148; light chain CDR2 of SEQ ID NO: 143 or 146; and a light chain variable region comprising the light chain CDR3 of SEQ ID NO: 144 or 147, but is not limited thereto.
  • antibody or antigen fragment binding thereof is a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 103; and a light chain variable region consisting of the amino acid sequence of SEQ ID NO: 119, but is not limited thereto.
  • an antibody comprising a heavy chain variable region consisting of the amino acid sequence of SEQ ID NO: 103 and a light chain variable region consisting of the amino acid sequence of SEQ ID NO: 119 was named "M4-4" or "MG1141A”.
  • the antibody of the present invention is a heavy chain FR (Framework region) 1 of SEQ ID NO: 148, 152 or 155; heavy chain FR2 of SEQ ID NO: 149 or 156; heavy chain FR3 of SEQ ID NO: 150, 153 or 157; and a heavy chain variable region comprising a heavy chain FR4 of SEQ ID NO: 151, 154 or 158 and a light chain FR1 of SEQ ID NO: 159, 163 or 166; light chain FR2 of SEQ ID NO: 160 or 167; light chain FR3 of SEQ ID NO: 161, 164 or 168; and a light chain variable region comprising a light chain FR4 of SEQ ID NO: 162, 165 or 169, but is not limited thereto.
  • FR Framework region 1 of SEQ ID NO: 148, 152 or 155
  • heavy chain FR2 of SEQ ID NO: 149 or 156 heavy chain FR3 of SEQ ID NO: 150, 153 or 157
  • the present invention provides a method for preparing the novel antibody or antigen-binding fragment thereof.
  • novel antibody or antigen-binding fragment thereof of the present invention can be easily prepared by known antibody production techniques. For example, this can be done by preparing hybridomas using B lymphocytes obtained from immunized animals (Koeher and Milstein, 1976, Nature, 256:495), or by using phage display technology.
  • the present invention is not limited thereto.
  • An antibody library using phage display technology is a method of expressing an antibody on the surface of a phage by directly obtaining an antibody gene from B lymphocytes without producing a hybridoma.
  • phage display technology many existing difficulties related to the generation of monoclonal antibodies by B-cell immortalization can be overcome.
  • the phage display technology comprises the steps of 1) inserting an oligonucleotide of a random sequence into a gene region corresponding to the N-terminus of the coat protein pIII (or pIV) of the phage; 2) expressing a fusion protein of a portion of a native envelope protein and a polypeptide encoded by the random sequence oligonucleotide; 3) treating a receptor material capable of binding to the polypeptide encoded by the oligonucleotide; 4) eluting the peptide-phage particles bound to the receptor using a low pH or binding competitive molecule; 5) amplifying the eluted phage in a host cell by panning; 6) repeating the method to obtain the desired amount; and 7) determining the sequence of the active peptide from the DNA sequence of the phage clones selected by panning.
  • the present invention provides a polynucleotide encoding the novel antibody, an expression vector comprising the polynucleotide, and a transformant comprising the expression vector.
  • Another aspect of the present invention provides an expression vector comprising the antibody or antigen-binding fragment thereof provided in the present invention and a host cell into which the vector is introduced.
  • the antibody is the same as described above.
  • the expression vector comprising the polynucleotide encoding the antibody provided in the present invention is not particularly limited thereto, but mammalian cells (eg, human, monkey, rabbit, rat, hamster, mouse cell, etc.), plant cell, yeast It may be a vector capable of replicating and/or expressing the polynucleotide in a eukaryotic or prokaryotic cell, including a cell, insect cell or bacterial cell (eg, E. coli, etc.), specifically, in a host cell, the nucleotide is It may be a vector that is operably linked to an appropriate promoter for expression and contains at least one selectable marker.
  • the polynucleotide may be introduced into a phage, a plasmid, a cosmid, a mini-chromosome, a virus, or a retroviral vector.
  • the expression vector comprising the polynucleotide encoding the antibody may be an expression vector comprising a polynucleotide encoding a heavy chain or a light chain of the antibody, respectively, or an expression vector comprising both a polynucleotide encoding a heavy chain or a light chain.
  • the transformant introduced with the expression vector provided in the present invention is not particularly limited thereto, but bacterial cells such as Escherichia coli, Streptomyces, Salmonella typhimurium, etc. transformed by introducing the expression vector; yeast cells; Fungal cells such as Pichia pastoris; insect cells such as Drosophila and Spodoptera Sf9 cells; CHO (chinese hamster ovary cells), SP2/0 (mouse myeloma), human lymphoblastoid, COS, NSO (mouse myeloma), 293T, Bow melanoma cells, HT-1080, BHK ( animal cells such as baby hamster kidney cells, HEK (human embryonic kidney cells), and PERC.6 (human retinal cells); or plant cells.
  • yeast cells Fungal cells such as Pichia pastoris
  • insect cells such as Drosophila and Spodoptera Sf9 cells
  • CHO chinese hamster ovary cells
  • SP2/0 mouse my
  • introduction refers to a method of delivering a vector including a polynucleotide encoding the antibody to a host cell.
  • introduction may include calcium phosphate-DNA co-precipitation, DEAE-dextran-mediated transfection, polybrene-mediated transfection, electroshock method, microinjection method, liposome fusion method, lipofectamine and protoplast fusion method, etc. It can be carried out by several methods known in the art.
  • transduction means the delivery of a target object into a cell using virus particles by means of infection.
  • the vector can be introduced into the host cell by gene bombardment or the like. In the present invention, introduction may be used in combination with transformation.
  • Another aspect of the present invention provides a composition for diagnosing coronavirus infection, comprising the antibody or antigen-binding fragment thereof provided in the present invention.
  • Another aspect of the present invention provides a kit for diagnosing coronavirus infection, comprising the antibody or antigen-binding fragment thereof provided in the present invention.
  • Another aspect of the present invention is an antibody or antigen-binding fragment thereof provided in the present invention; or a composition for diagnosing infection comprising the same; Or, by using a kit comprising the composition, it provides a method for diagnosing a coronavirus infection or an information providing method for diagnosis, comprising the step of detecting a coronavirus present in a biological sample isolated from an individual suspected of having a coronavirus infection.
  • diagnosis refers to determining the susceptibility of an individual to a specific disease or disorder, determining whether the individual currently has a specific disease or disorder, or providing information on the efficacy of treatment This includes monitoring the condition of an object for harm.
  • the diagnosis may be to confirm whether or not a coronavirus-infected disease occurs.
  • coronavirus infection disease refers to a disease caused by an infection in which a coronavirus enters the body of a host organism.
  • the coronavirus may be SARS-CoV-2 (SARS-coronavirus-2).
  • the coronavirus-infected disease may be COVID-19.
  • composition for diagnosing coronavirus infection of the present invention may include an antibody or antigen-binding fragment thereof other than the antibody or antigen-binding fragment thereof of the present invention.
  • substances necessary for the antigen-binding reaction of the antibody or antigen-binding fragment thereof of the present invention for example, reagents may be further included.
  • substances necessary for detecting this binding, substances for stabilizing the antibody or antigen-binding fragment thereof of the present invention, etc. may be further included.
  • the antibody or antigen-binding fragment thereof included in the diagnostic composition of the present invention may be labeled for detection.
  • the various methods available for molecular labeling are well known to those skilled in the art and are contemplated within the scope of the present invention.
  • label types examples include enzymes, radioactive isotopes, colloidal metals, fluorescent compounds, chemiluminescent compounds and bioluminescent compounds.
  • markers include fluorescent substances (eg, fluorescein, rhodamine, Texas red, etc.), enzymes (eg, horseradish peroxidase, beta-galactosidase, alkaline phosphatase), radioactive isotopes (eg, 32P or 125I), biotin, digoxigenin, colloidal metals, chemiluminescent or bioluminescent compounds (eg, dioxetane, luminol or acridinium). Labeling methods such as covalent bonding of enzymes or biotinyl groups, iodination, phosphorylation, and biotinylation are also well known.
  • the kit of the present invention may further include reagents and instruments necessary for detecting the binding of the antibody or antigen-binding fragment thereof to the antigen of the present invention.
  • kit container of the present invention may contain a solid carrier.
  • Antibodies of the invention may be attached to a solid carrier, which may be porous or non-porous, planar or non-planar.
  • the kit comprises a solid carrier; a sample pad receiving a sample to be analyzed and having a buffer input unit and a sample input unit; a conjugate pad comprising an antibody that specifically binds to the coronavirus contained in the sample introduced from the sample pad; a signal detection pad including a signal detection unit for detecting whether the coronavirus is present in the sample and a control unit for checking whether the sample has moved to the absorbent pad regardless of the presence or absence of an analyte; and an absorbent pad that absorbs the sample on which the signal detection reaction has been completed, but is not limited thereto.
  • the kit of the present invention may be in the form of an enzyme-linked immunosorbent assay (ELISA) kit.
  • ELISA enzyme-linked immunosorbent assay
  • the term "ELISA" of the present invention is also referred to as an enzyme immunoassay method, and is a method of quantifying using absorbance through the reaction of an enzyme with a substrate by binding an enzyme to an antibody to form an antigen-antibody complex.
  • the ELISA is a direct ELISA using a labeled antibody recognizing an antigen attached to a solid support, an indirect ELISA using a labeled secondary antibody recognizing a capture antibody in a complex of an antibody recognizing an antigen attached to a solid support, and a solid support.
  • Direct sandwich ELISA using another labeled antibody that recognizes an antigen in a complex of an attached antibody and antigen reacts with another antibody that recognizes an antigen in a complex of an antibody attached to a solid support and an antigen and indirect sandwich ELISA using labeled secondary antibodies.
  • the antibody or fragment thereof of the present invention may be used to detect the presence of coronavirus in the biological sample by contacting the biological sample and confirming the reaction.
  • the biological sample may be any one selected from the group consisting of sputum, saliva, blood, sweat, lung cells, lung tissue mucus, respiratory tissue, and saliva, but is not limited thereto and can be prepared by a conventional method known to those skilled in the art. It is possible.
  • the information providing method for the diagnosis of coronavirus infection of the present invention comprises the steps of (a) contacting the antibody or antigen-binding fragment thereof provided in the present invention with a biological sample; and (b) detecting the complex of the antibody or antigen-binding fragment thereof of the present invention and the coronavirus spike protein formed by the contact.
  • the complex of the antibody or fragment thereof and the coronavirus spike protein in step (b) may be a binding domain (CD) site conjugate of the SARS-CoV-2 spike protein.
  • the term “antigen-antibody complex” refers to a combination of a corresponding protein antigen in a sample and an antibody that recognizes it.
  • the detection of the antigen-antibody complex can be detected using methods known in the art, for example, spectroscopic, photochemical, biochemical, immunochemical, electrical, optical, chemical and other methods, specifically colormetric method, electrochemical method, fluorimetric method, luminometry, particle counting method, visual assessment and scintillation counting method It can be detected by any method selected from the group consisting of, western blotting, ELISA, radioimmunoassay, radioimmunodiffusion, ouchterlony immunodiffusion method, rocket Immunoelectrophoresis, tissue immunostaining, immunoprecipitation assay, complete fixation assay, fluorescence-activated cell sorting (FACS), protein chip, etc. can be used. It is not limited thereto.
  • Another aspect of the present invention provides a pharmaceutical composition for preventing or treating coronavirus infection comprising the antibody or binding fragment thereof.
  • the coronavirus may be SARS-CoV-2.
  • the composition may be for prevention or treatment of COVID-19.
  • COVID-19 refers to a disease caused by infection with SARS-CoV-2. Since the antibody of the present invention exhibits neutralizing ability and infection inhibition ability for SARS-CoV-2, it can be used for prevention or treatment of COVID-19.
  • prevention may mean any action that suppresses or delays the onset of coronavirus infection by administration of the composition
  • treatment refers to symptoms caused by coronavirus infection by administration of the composition can mean any action that is improved or is changed for the better.
  • the pharmaceutical composition may further include a pharmaceutically acceptable carrier.
  • the term "pharmaceutically acceptable carrier” refers to a carrier or diluent that does not stimulate the organism and does not inhibit the biological activity and properties of the administered compound.
  • acceptable pharmaceutical carriers for compositions formulated as liquid solutions are sterile and biocompatible, and include saline, sterile water, Ringer's solution, buffered saline, albumin injection, dextrose solution, maltodextrin solution, glycerol, ethanol and One or more of these components may be mixed and used, and other conventional additives such as antioxidants, buffers, and bacteriostats may be added as needed.
  • diluents such as an aqueous solution, suspension, emulsion, etc., pills, capsules, granules or tablets.
  • the pharmaceutical composition may be in various oral or parenteral formulations.
  • formulation it is prepared using commonly used diluents or excipients such as fillers, extenders, binders, wetting agents, disintegrants, and surfactants.
  • Solid preparations for oral administration include tablets, pills, powders, granules, capsules, etc., and such solid preparations include at least one excipient in one or more compounds, for example, starch, calcium carbonate, sucrose or lactose ( lactose), gelatin, etc.
  • lubricants such as magnesium stearate and talc are also used.
  • Liquid preparations for oral administration include suspensions, internal solutions, emulsions, syrups, etc.
  • Formulations for parenteral administration include sterile aqueous solutions, non-aqueous solutions, suspensions, emulsions, freeze-dried preparations, and suppositories.
  • Non-aqueous solvents and suspensions may include propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable esters such as ethyl oleate.
  • witepsol, macrogol, tween 61, cacao butter, laurin, glycerogelatin, and the like can be used.
  • the pharmaceutical composition is selected from the group consisting of tablets, pills, powders, granules, capsules, suspensions, internal solutions, emulsions, syrups, sterile aqueous solutions, non-aqueous solutions, suspensions, emulsions, freeze-dried preparations and suppositories It may have any one formulation.
  • composition of the present invention is administered in a pharmaceutically effective amount.
  • the term "pharmaceutically effective amount” means an amount sufficient to treat a disease with a reasonable benefit/risk ratio applicable to medical treatment, and the effective dose level is dependent on the type and severity of the subject, age, sex, and cancer. It may be determined according to the type, drug activity, drug sensitivity, administration time, administration route and excretion rate, treatment period, factors including concurrent drugs, and other factors well known in the medical field.
  • the composition of the present invention may be administered as an individual therapeutic agent or in combination with other therapeutic agents, and may be administered sequentially or simultaneously with conventional therapeutic agents. and may be administered single or multiple. In consideration of all of the above factors, it is important to administer an amount that can obtain the maximum effect with a minimum amount without side effects, and can be easily determined by those skilled in the art.
  • Another aspect of the present invention provides a method for preventing or treating a coronavirus infection using the antibody.
  • the coronavirus may be SARS-CoV-2.
  • the method may include administering the antibody to a subject suspected of being infected with SARS-CoV-2.
  • the method may be a method comprising administering a pharmaceutical composition further comprising an antibody and a pharmaceutically acceptable carrier to a subject infected with or infected with a coronavirus, wherein the pharmaceutically acceptable carrier is as described above. same as bar
  • the subject includes mammals, birds, etc. including cattle, pigs, sheep, chickens, dogs, humans, and the like, and includes, without limitation, individuals whose coronavirus infection is treated by administration of the composition of the present invention.
  • the antibody may be administered single or multiple in a pharmaceutically effective amount.
  • the antibody may be administered in the form of a liquid, powder, aerosol, capsule, enteric-coated tablet or capsule or suppository.
  • Routes of administration include, but are not limited to, intraperitoneal administration, intravenous administration, intramuscular administration, subcutaneous administration, endothelial administration, oral administration, topical administration, intranasal administration, intrapulmonary administration, rectal administration, and the like.
  • the method may also be used for preventing or treating a coronavirus infectious disease, specifically, preventing or treating an infectious disease of SARS-CoV-2.
  • a coronavirus infectious disease specifically, preventing or treating an infectious disease of SARS-CoV-2.
  • it may be used for the prevention or treatment of COVID-19, but is not limited thereto.
  • Another aspect of the present invention is the use of the antibody for the manufacture of a medicament for the prevention or treatment of a coronavirus infection.
  • the drug may be used for the prevention or treatment of SARS-CoV-2 infectious disease, for example, COVID-19, but is not limited thereto.
  • the antibody and the prevention or treatment of SARS-CoV-2 infection are the same as described above.
  • Genes encoding the outer domain (spike-ECD) and RBD (RBD-his) of the SARS-CoV-2 spike glycoprotein were synthesized and cloned into the pCIW mammalian expression vector with a C-terminal 6x histidine tag.
  • Genes encoding RBD-Fc and human ACE2-Fc were cloned into the pCIW vector.
  • the pCIW mammalian vector was transformed into Expi293F TM cells (Cat. No. A1435101). All steps for the analysis of expression were performed according to the manufacturer's instructions. After 5-6 days of cell culture, cells were harvested by centrifugation, and the supernatant was passed through a 0.22 ⁇ m filter to remove cell debris.
  • Ni-NTA resin was added to the supernatant for His-tag purification of the recombinant protein.
  • MabSelect Xtra Cat. no. 17-5269-02, GE Healthcare
  • PBS phosphate-buffered saline
  • Zeba Spin Desalting Columns Protein concentration was quantified using a Nanodrop 2000C spectrophotometer (Thermo Scientific) (Fig. 1).
  • a human B cell-derived library, a mouse immune library, and a human domain antibody synthesis library were constructed and screened.
  • a commonly used single clone ELISA method was used.
  • the monoclonal ELISA screening method is a method to check whether the antibody is specific to the spike protein by mixing the spike protein with the antibody expressed from a single clone. 5 (clones M1-M5), 3 (clones 5E9, 6D9, 6H10) spike protein-specific clones were obtained from the human domain antibody synthesis library.
  • the heavy chain and light chain sequences of the antibody obtained through sequence analysis were confirmed (FIG. 3, Table 1, Table 2, Table 3).
  • the clones obtained from the human domain antibody synthesis library included only heavy chain sequence information because the synthetic library itself is a library consisting only of heavy chain sequences.
  • the anti-SARS-CoV-2 scFv was converted to human IgG1 format by subcloning into pCIW.
  • Expi293F TM cells were prepared in 30 mL Expi293 TM expression medium at a concentration of 2.5 ⁇ 10 6 cells/mL (37° C., 8% CO 2 , 125 rpm, viability ⁇ 95%). These cells were transfected with a DNA mixture consisting of 30 ⁇ g of DNA (pCLW-anti-SARS-CoV-2 heavy chain: 15 ⁇ g, pcIw-anti-SARS-CoV-2 light chain: 15 ⁇ g), OptiProTM SEM medium and ExpiFectamineTM 293 reagent. converted.
  • the desalting column was centrifuged at 1000 g for 2 min to filter the preservation solution. After adding PBS buffer to the volume of the column, centrifugation was performed at 1000 g for 2 min, and column washing was repeated 3 times. After adding the sample, centrifugation was performed for 1000 g and 2 min, and the concentration was measured again using a 280 nm wavelength.
  • Antigens are Recombinant SARS (1-1190) (Beta Lifescience, BLIT-0210), SARS-CoV-2 (2019-nCoV) Spike Protein (S1+S2 ECD, His tag) (Sino Biological., 40589-V08B1), MERS -CoV Spike Protein (ECD, aa 1-1297, His Tag) (Sino Biological., 40069-V08B) was used.
  • the antigen was removed from the ELISA plate and washed 3 times with PBS + tween20 0.05%. Each well coated with the antigen was blocked with 200 ⁇ l of PBS + BSA 5% at room temperature for 1 hour. After 1 hour, wash 3 times with PBS + tween 20 0.05%. 35 antibody concentrations were measured by dilution to 300 nM. 50 ⁇ l of the diluted antibody was put into each well and allowed to bind at room temperature for 1 hour. It was again washed 3 times with PBS + tween 20 0.05%. 50 ⁇ l of Anti-human Fc-HRP (3000: 1) was put into each well and incubated at room temperature for 1 hour.
  • Humanization was performed on M4 and M5 clones among mouse immune clones.
  • the framework region sequences of the M4 and M5 antibodies were identified as mouse germline sequences IGHV5-6 and IGKV6-32, respectively.
  • M4 and M5 clones have the same HCDR sequence and different LCDR sequences.
  • CDR-grafting a general method, CDR-grafting, was used. Igblast search was performed to search for human frameworks with the highest homology to M4 and M5. As a result of the search, it was confirmed that the homology was the highest with IGHV3-21 and IGKV1-39, and the CDRs of M4 and M5 were grafted with human antibody skeletons IGHV3-21 and IGKV1-39, respectively.
  • a variant was designed by introducing additional mutations after identifying core residues that play an important role in determining antibody structure stability and canonical structure of CDRs (Table 5).
  • the gene sequences of the M4 and M5 antibodies of which the design was completed were synthesized and used as inserts (SEQ ID NOs: 132 to 138).
  • the synthesized gene was cloned by the infusion cloning method, and the culture and purification of the chimeric antibody were performed as previously described (FIG. 5).
  • ELISA was performed to confirm that each humanized antibody specifically binds to the SARS-CoV2 spike protein.
  • Spike protein was coated on an ELISA plate at 3 ⁇ g/ml and 100 ⁇ l per well at 4°C overnight. The next day, the spike protein of the ELISA plate was removed and blocked with 200 ⁇ l of PBS + BSA 2% in each well at 37° C. for 1 hour. Washed 3 times with PBS + tween 20 0.05%. M4, M5, and each humanized antibody was diluted 11 times with PBS from the initial concentration (100 nM) to a final concentration of 0.5 pM. 100 ⁇ l of the diluted antibody solution was placed in each well and bound at 37° C. for 1 hour.
  • both M4-4 and M5-4 were confirmed to have a binding force greater than or equal to the WT RBD level for the mutant.
  • REGN10933 and REGN10987 used as comparative antibodies when treated alone, it was confirmed that the binding force to Y453F and N439K mutant was reduced by 50% or more, respectively (FIG. 7).
  • Anti-SARS-CoV-2 spike protein antibodies showed different binding properties to the spike protein and its variants, alpha (UK), beta (South Africa) and gamma (Brazil), antigen-antibody binding properties were checked. .
  • the kinetics were determined using a Biacore T-200 biosensor (Cytiva). The antibody was diluted with HBS-EP buffer to a concentration of 10 ⁇ g/mL and immobilized on the SA chip at a flow rate of 10 ⁇ L/min until Rmax reached 200Ru.
  • the RBM-targeting neutralizing antibody REGN10933 showed similar binding affinity to the alpha variant as in the original RBD, but it was confirmed that the binding of REGN10933 was significantly reduced in the beta and gamma variants. In contrast, M4 and M4-4 exhibited similar binding affinities for pre-existing RBDs and all variants (Fig. 8b).
  • the antibody of the present invention maintains the ability to bind to the newly generated SARS-CoV-2 mutant, and has binding ability to neutralize various mutant viruses.
  • Pseudoviruses carrying the full-length spike protein of SARS-CoV-2 and variants carrying the firefly luciferase reporter gene were produced in Lenti-X 293T cells (Takara). That is, 10 ⁇ g of psPAX2 (Addgene), 10 ⁇ g of pLVX-Luciferase, and 10 ⁇ g of SARS-CoV-2 S (codon-optimized) expression plasmid were injected with polyethylenimine (mass ratio 1:2) into Lenti-X 293T cells.
  • the ACE2-HEK293 stable cell line was maintained in DMEM medium containing 10% fetal bovine serum and an antibiotic-antifungal cocktail.
  • 96-well flat-bottom plates were coated with 10 ⁇ g/mL collagen I and incubated at 37 °C in an atmosphere containing 5% CO 2 for 4 h.
  • ACE2-HEK293 cells were suspended in DMEM and aliquoted in a collagen-coated 96-well flat bottom plate at 1 ⁇ 10 5 cells/well and cultured for 24 hours.
  • Antibodies were serially diluted 3-fold from 10 ⁇ g/mL (66.67 nM) with DMEM containing 2% FBS and antibiotic-antifungal cocktail.
  • Antibody dilutions were mixed 1:1 with pseudovirus and incubated at 37 °C in an atmosphere containing 5% CO 2 for 1 h.
  • the supernatant was removed from ACE2-HEK293 cells and replaced with 50 ⁇ L of antibody-pseudovirus mixture. Then, the cells were incubated for 1 h at 37 °C in an atmosphere containing 5% CO 2 . 50 ⁇ L of infection medium was added to the cells, and the cells were further incubated at 37 °C in an atmosphere containing 5% CO 2 for 48 h.
  • Cells were lysed with 5X reporter lysis buffer (Promega) and relative luciferase activity was determined using a luciferase assay system and a luminometer.
  • Relative luciferase units were converted to percent neutralization and plotted as a nonlinear regression curve fitted to Prism Software (GraphPad, Prism 8.0). As a result, it was confirmed that the M4 and M5 chimeric antibodies and the humanized candidate antibodies M4-4,5,7,8 and M5-4,5,7,8 showed a neutralizing ability similar to that of REGN10933 (Fig. 9a, b).
  • pcDNA3.1-spike cDNA of SARS-CoV-2 was transfected into a cell line expressing the SARS-CoV-2 S protein. was selected with 1.5 mg/mL Geneticin. Expression of SARS-CoV-2 S protein was confirmed by flow cytometry (FACS LSR Fortessa, BD Biosciences) using the anti-SARS-CoV-2 antibody REGN10933 (FIG. 10a).
  • ADCC and ADCP effects were assayed to determine whether anti-SARS-CoV-2 antibody exhibits Fc-mediated antibody-dependent phagocytosis.
  • HT1080-S cells were used as target cells and Jurkat-NFAT-Luc/Fc ⁇ RIIIa were used as effector cells.
  • HT1080-S cells were cultured in an appropriate medium for 18 hours, and ADCC assay buffer was added thereto. Thereafter, the antibody was diluted and added, followed by reaction for 15 minutes. After adding effector cells and culturing for 18 hours, Bio-Glo luciferase assay reagent was added and luminescence was measured according to the manufacturer's instructions.
  • the humanized SARS-CoV-2 antibody, M4-4 can neutralize WT and selected spike mutant SARS-CoV-2 pseudovirus particles, and it was confirmed that the neutralization efficacy was similar to that of the Regeneron cocktail ( FIG. 11 ).
  • Epitope binning was performed in three steps using the BLI system (Octet Qke). Step 1 involves antigen immobilization; Step 2 involved primary antibody binding and Step 3 involved secondary antibody binding. A baseline signal was confirmed by setting a reference step of 60 seconds between each step.
  • step 1 20 ⁇ g/mL purified recombinant SARS-CoV-2 spike protein or RBD His was immobilized on a pre-hydrated antipenta-His biosensor at 1000 rpm for 200 seconds.
  • step 2 37.5 ⁇ g/mL of different primary binding Abs were bound for 300 seconds.
  • one type of secondary antibody (18.75 ⁇ g/mL) was bound for 150 seconds to confirm the degree of self-binding and competition. The degree of competition was defined as a percentage.
  • M4-4 can bind to a wider epitope than REGN10933, REGN10987, and S309.
  • BioLuminate in Schrodinger Suite was used for scFv homology modeling of M4-4 using the structures of anti-PD1 (PDB code: 6JJP) and anti-SIRP ⁇ antibody (PDB code: 6 NMR) as templates for heavy and light chains, respectively.
  • Docking the scFv structure of M4-4 to RBD (PDB code: 6M0J) was performed using PIPER in BioLuminate56.
  • the distance between Lys440 and Thr500 of the RBD and CDR loops was limited to between 2 ⁇ and 10 ⁇ based on the results of epitope binning.
  • BioLuminate proposed 30 best complexes with 70,000 possible protein-protein configurations.
  • the final complex for M4-4 was selected according to cluster size and conformance with epitope binning results, followed by energy minimization.
  • the predicted binding site of M4-4 to RBD was found to be a position capable of interfering with the binding of REGN10933, REGN10987, S309 and ACE2 receptors.
  • the epitope of M4-4 FOG. 13

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Molecular Biology (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Microbiology (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Epidemiology (AREA)
  • Physics & Mathematics (AREA)
  • Urology & Nephrology (AREA)
  • Zoology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Hematology (AREA)
  • Communicable Diseases (AREA)
  • Oncology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Pulmonology (AREA)
  • Mycology (AREA)
  • Plant Pathology (AREA)
  • Food Science & Technology (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)

Abstract

본 발명은 코로나바이러스 스파이크(spike, S) 단백질에 특이적인 항체 및 이의 용도에 관한 것이다.

Description

코로나바이러스 스파이크 단백질에 특이적인 항체 및 이의 용도
본 발명은 코로나바이러스 스파이크(spike, S) 단백질에 특이적인 항체 및 이의 용도에 관한 것이다.
코로나 바이러스(coronavirus)는 1937년 닭에서 처음 발견된 뒤 개, 돼지, 조류 등의 동물을 거쳐 1965년에는 사람에게서도 발견되었다. 개기일식 때 태양의 광구가 달에 가려졌을 때 그 둘레에서 하얗게 빛나는 현상인 코로나 현상과 생김새가 비슷하여 이러한 이름이 붙여졌다.
코로나바이러스는 사람과 동물에서 주로 폐렴과 장염을 유발하는 것으로 알려져 있으며, 간혹 신경계 감염과 간염을 유발하는 것으로도 알려져 있다. 코로나바이러스는 코로나바이러스과(Coronaviridae)에 속하며 구형의 외막을 가지는, 약 100-120 nm 크기의 positive sense RNA 바이러스이다. 코로나바이러스는 가장 외각에 있는 spike 단백질 (S), hemagglutinin-esterase (HE) 단백질, transmembrane (M) 단백질, small membrane (E) 단백질 및 nucleocapsid (N) 단백질 등 총 5개의 구조 단백질로 이루어져 있다. 이 중 spike 단백질은 세포 수용체와 결합하는 리간드 역할을 하며, 숙주세포와 바이러스간의 융합을 유도하는 단백질로 가장 변이가 심한 단백질로 알려져 있다.
지금까지 코로나바이러스는 사람에게는 거의 감염되지 않고 주로 개, 돼지, 소 등의 동물에 감염되는 병원균으로 인식되어 왔다. 사람에게 감염될 때에도 호흡기 증상을 유발하는 여러 바이러스 가운데 하나로서 단순한 감기를 유발하거나 어린이에게 위험성이 그리 높지 않은 설사 등의 장 질환을 일으키는 경우가 있을 뿐이었다. 그러나 세계적으로 수백 명이 넘는 사망자와 수천여 명의 환자를 발생시킨 중증 급성 호흡기 증후군(사스; SARS)의 원인균, 중동 호흡기 증후군(메르스;MERS), 및 코로나바이러스 감염증(coronavirus disease 2019; COVID-19)의 원인균이 신종(변종) 코로나바이러스인 것으로 알려지면서 점차적으로 주목 받기 시작하였다.
COVID-19는 2019년 말 중국 후베이 지방의 수도인 우한에서 처음 확인되어 전세계로 확산되어 진행성 팬데믹을 초래한 질환으로, 사스-코로나바이러스-2에 의해 유발되는 감염성 질환이다. 2020년 5월 7일을 기준으로 3.75백만 케이스 이상이 187개국에서 보고되었고, 사망자는 263천명에 이르며, 1.24백만명이 회복되었다. 보편적인 증상은 발열(fever), 기침(cough), 피로(fatigue), 호흡곤란(shortness of breath) 및 후각 및 미각의 상실이다. 대부분의 경우 증상이 경미하나 몇몇은 바이러스성 폐렴(viral pneumonia), 다중기관부전(multi-organ failure) 및 사이토카인 폭풍(cyrokine storm)으로 진행한다. 증상의 발현으로부터 발병까지의 시간은 일반적으로 약 5일이지만 2 내지 14일 사이일 수 있다. 바이러스는 주로 밀접 접촉하는 동안, 때로는 기침, 재채기 및 대화 시 발생하는 비말을 통해 사람 간에 전파된다. 증상 발현 후 처음 3일 동안 가장 전염성이 높으며, 증상이 나타나기 전이나 질환의 말기에라도 전파될 수 있다. 이를 진단하는 표준 방법은 비인두 면봉검사(nasopharyngeal swab)로부터의 실시간 역전사 PCR(real-time reverse transcription polymerase chain reaction; rRT-PCR)을 이용한다.
사스-코로나바이러스-2는 베타 코로나바이러스(Beta coronavirus) 속에 속하는 변종 코로나바이러스로 알려져 있으며, 다양한 코로나바이러스의 1차적인 보유 숙주인 박쥐로부터 유래한 것으로 여겨지며(Antiviral Res., 101:45-56), 그 정확한 감염 경로에 대해서는 아직 완전히 밝혀지지 않았다.
한편, 현재까지 개발된 항바이러스제들은 심한 부작용을 나타내고 있으므로, 그 응용에 있어서 많은 주의가 필요하다. 이러한 치료제는 효과적이지 못하며 부작용 또한 나타나고 있는 실정이다. 또한, 아직까지 사스-코로나바이러스-2의 발생을 예방하고 치료하기 위한 감염 억제 효과가 뛰어나고 독성이 적은 우수한 새로운 코로나바이러스 치료제가 없어, 개발의 필요성이 증가하고 있다.
본 발명자들은 신규한 사스-코로나바이러스-2 치료제를 개발하기 위해 노력한 결과, SARS-CoV-2 S 단백질의 Receptor Binding Domain (RBD)에 특이적인 신규 항체가 코로나바이러스, 그 중에서도 SARS-CoV-2에 대한 치료 효과가 있음을 확인함으로써, 본 발명을 완성하였다.
본 발명의 하나의 목적은 코로나바이러스 스파이크 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 제공하는 것이다.
본 발명의 다른 하나의 목적은 상기 항체 또는 상기 항원 결합 단편을 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 발현 벡터 및 상기 발현 벡터를 포함하는 형질전환체를 제공하는 것이다.
본 발명의 또 다른 하나의 목적은 상기 항체 또는 상기 결합 단편을 제조하는 방법을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 항체 또는 상기 결합 단편을 포함하는 코로나바이러스 감염 진단용 조성물, 이를 포함하는 키트를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 항체 또는 상기 결합 단편을 이용하여, 생물학적 시료에 존재하는 코로나바이러스를 검출하는 단계를 포함하는, 코로나바이러스 감염 진단을 위한 정보제공방법을 제공하는 것이다.
본 발명의 또 다른 하나의 목적은 상기 항체 또는 상기 결합 단편을 포함하는 코로나바이러스의 예방 또는 치료용 약학적 조성물을 제공하는 것이다.
본 발명의 또 다른 하나의 목적은 상기 항체 또는 상기 결합 단편을 이용하여 코로나바이러스를 치료하는 방법을 제공하는 것이다.
본 발명의 항체는 코로나바이러스 검출 및 진단에 유용하게 사용할 수 있을 뿐만 아니라, 코로나바이러스의 중화능을 가지는 바 코로나바이러스 감염질환의 예방 및 치료에도 유용하게 사용될 수 있다.
도 1은 항원을 정제하고 그 산물의 크기 및 순도를 SDS PAGE를 통해 확인한 것이다.
도 2는 Library 스크리닝을 통해 확보한 anti SARS-CoV-2 antibody 발현 및 정제 후 SDS PAGE를 통해 산물의 크기 및 순도를 확인한 것이다. 구체적으로, Non-reduced PAGE를 통해 항체 전체 크기(~150kDa)를 확인하였고, Reduced PAGE를 통해 항체의 중쇄(~50kDa), 경쇄 (~25kDa) 크기를 확인하였다.
도 3은 항원 특이적인 항 COVID-19 항체를 선별하기 위해 sandwich ELISA를 수행한 결과이며, 이를 통해 항원에 특이적 결합을 보이는 항체를 선별하였다.
도 4는 선별된 Anti-SARS-CoV2 항체가 다른 Betacoronavirus인 SARS-CoV, MERS-CoV의 S(S1S2) protein에도 binding을 하는지 실험한 결과를 나타낸 것이다. 도 5는 Humanized 클론의 IgG 발현 및 정제 결과를 SDS-PAGE로 확인한 결과이다. 구체적으로, Non-reduced PAGE를 통해 항체 전체 크기(~150kDa)를 확인하였고, Reduced PAGE를 통해 항체의 중쇄(~50kDa), 경쇄 (~25kDa) 크기를 확인하였다.
도 6는 항원 특이적인 항 COVID-19 humanized 항체를 선별하기 위해 sandwich ELISA를 수행한 결과이다. 구체적으로, humanized 클론 모두 기존과 동일한 결합력을 유지함을 확인한 결과이다.
도 7은 SARS-CoV-2 돌연변이 항원에 대한 humanized 항체의 결합력을 비교한 결과이다. 구체적으로, M4-4, M5-4 두 클론 모두 돌연변이 항원에 대해 wild type 수준 이상의 결합력을 유지함을 확인하였다.
도 8a는 항-SARS-CoV-2 항원에 대한 항체의 결합특성 중 동역학에 대한 결과이다. 구체적으로, humanized 항체인 M4-4는 기존 항체인 M4 대비 10배 이상 높은 해리 상수 값이 측정되었다.
도 8b는 항-SARA-CoV-2 항원에 대한 항체의 결합특성 중 Alpha, Beta, Gamma 돌연변이에 대한 결합력을 평가한 결과이다. 구체적으로, M4-4는 모든 돌연변이에 강한 매우 강한 결합력을 가짐이 확인되었다.
도 9a는 ACE2-HEK293 세포의 ACE2 발현을 유세포 분석기로 관찰한 결과이다.
도 9b는 후보 항체의 SARS-Cov-2 pseudovirus 중화능을 SARS-CoV-2 pseudovirus와 ACE2-HEK293 세포를 이용하여 측정한 결과이다.
도 10a는 HT1080-S 세포의 Spike protein 발현을 유세포 분석기로 관찰한 결과이다.
도 10b는 후보 항체의 ADCC 효능을 ADCC Effector cell과 HT1080-S 세포를 이용하여 측정한 결과이다.
도 10c는 후보 항체의 ADCP 효능을 FcγRIIa-H Effector cell과 HT1080-S 세포를 이용하여 측정한 결과이다.
도 11은 authentic, wild type 항원, alpha, beta, gamma 돌연변이 항원에 대한 항-SARS-CoV-2 항체의 중화 활성을 나타낸 것이다. 구체적으로, M4-4 항체는 모든 경우에서 비교 항체 대비 동등 이상의 중화효능이 관찰되었다.
도 12는 M4-4 항체의 에피토프 비닝 결과이다. 구체적으로, M4-4는 REGN10987, S309, ACE2 수용체와 100% 경쟁할 수 있는 넓은 에피토프에 결합함을 유추할 수 있는 결과이다.
도 13은 M4-4 항체의 에피토프를 simulation docking으로 예측한 결과이다. 구체적으로, 에피토프 예측 데이터와 일치함을 확인하였다.
이를 구체적으로 설명하면 다음과 같다. 한편, 본 출원에서 개시된 각각의 설명 및 실시 형태는 각각의 다른 설명 및 실시 형태에도 적용될 수 있다. 즉, 본 출원에서 개시된 다양한 요소들의 모든 조합이 본 출원의 범주에 속한다. 또한, 하기 기술된 구체적인 서술에 의하여 본 출원의 범주가 제한된다고 볼 수 없다. 또한, 본 명세서 전체에 걸쳐 다수의 논문 및 특허 문헌이 참조되고 그 인용이 표시되어 있다. 인용된 논문 및 특허 문헌의 개시 내용은 그 전체로서 본 명세서에 참조로 삽입되어 본 발명이 속하는 기술 분야의 수준 및 본 발명의 내용이 보다 명확하게 설명된다.
본 발명의 하나의 양태는 코로나바이러스 스파이크(S) 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 제공한다.
본 발명에서, 용어 "코로나바이러스"는 코로나바이러스과(Coronaviridae)에 속하며 구형의 외막을 가지는, 약 80-220 nm 크기의 양성 단일가닥 RNA 바이러스(positive-sense single-stranded RNA virus, ssRNA)를 지칭한다. 코로나바이러스는 가장 외각에 있는 스파이크(S) 단백질, 헤마글루티닌-에스터라제(hemagglutinin-esterase, HE) 단백질, 멤브레인(membrane, M) 단백질, 엔벨로프(envelope, E) 단백질 및 뉴클레오캡시드(nucleocapsid, NP) 단백질 등 5개의 구조 단백질을 포함하는 것으로 알려져 있다(Lai and Homes, 2001. Fields Virology).
일 구현예로, 상기 코로나바이러스는 SARS-CoV, SARS-CoV-2 또는 MERS-CoV일 수 있고, 구체적으로 SARS-CoV-2일 수 있으나, 이에 제한되지 않는다. 상기 코로나바이러스 스파이크(S) 단백질은 SARS-CoV-2의 스파이크(S) 단백질의 일부 도메인이 절단된 형태인 스파이크1(spike1, S1)단백질일 수 있으나, 본 발명의 항체 또는 이의 항원 결합 단편이 특이적으로 결합할 수 있는 코로나바이러스는 제한 없이 포함된다.
본 발명의 용어, "SARS-CoV-2(사스-코로나바이러스-2)"는 호흡기 질환인 코로나바이러스감염증-19(COVID-19)를 야기하는 바이러스이다.
SARS-CoV-2는 양성 단일가닥 RNA 바이러스이다. SARS-CoV-2는 분류학적으로 SARS-CoV의 계통(strain)으로, 동물원성 감염증의 기원(zoonotic origins)을 가지며, 박쥐 코로나바이러스와 근접한 유전적 유사성을 갖는 것으로 간주된다. 상기 SARS-CoV-2는 주로 사람들 간의 긴밀한 접촉을 통해 및/또는 기침이나 재채기시 발생하는 비말을 통해 전파되며, 주로 바이러스 외각의 스파이크(S) 단백질이 인간세포 표면에 존재하는 수용체 안지오텐신 전환 효소 2(angiotensin converting enzyme 2, ACE2)에 결합하여 인간세포에 진입하는 것으로 알려져 있다.
SARS-CoV-2는 RNA 의존적 RNA 중합효소 (RNA-dependent RNA polymerase), 스파이크(S), 멤브레인(M), 엔벨로프(E) 및 뉴클레오캡시드(NP) 단백질 및/또는 상기 단백질을 코딩하는 유전자를 포함할 수 있다. SARS-CoV-2 구조 단백질 중 스파이크(S) 단백질은 바이러스 입자 표면에 존재하여 숙주세포 침입에 관여하고, S1과 S2로 나누어진다. S1 단백질은 숙주세포의 수용체와 상호작용하는데, S1 단백질 내 존재하는 수용체 결합 도메인(receptor-binding domain, RBD)는 숙주세포 표면에 존재하는 ACE2 수용체와 결합하는 핵심 부위로 알려져 있다. S2 단백질은 숙주세포 세포막과의 융합에 관여한다. 상기 구조에 대한 내용은 Cascella, M., Rajnik, M., Cuomo, A., Dulebohn, S. C., & Di Napoli, R. (2020). Features, Evaluation and Treatment Coronavirus (COVID-19). In StatPearls. Treasure Island (FL)에 상세히 기재되어 있다.
구체적으로, 본 발명에서 제공하는 항체 또는 이의 단편은 SARS-CoV-2의 스파이크(S) 단백질의 일부 도메인이 절단된 형태인 스파이크1(S1)단백질에 특이적으로 결합하는 것일 수 있다. 구체적으로, 상기 코로나바이러스 스파이크 단백질에 특이적으로 결합하는 항체는 마우스 항체, 키메라 항체 또는 인간화 항체일 수 있다.
그 예로, 본 발명에서 제공하는 항체 또는 이의 단편이 인식하는 항원결정부위(에피토프, epitope)는 SARS-CoV-2의 스파이크1(S1) 단백질에 존재하는 결합 도메인(CD)의 일부일 수 있다.
본 발명에서, 용어 "항체"는 면역학적으로 특정 항원과 반응성을 갖는 면역글로불린 분자를 포함하는, 항원을 특이적으로 인식하는 리간드 역할을 하는 단백질 분자를 의미하며, 다클론 항체, 단일클론 항체, 전체(whole) 항체 및 항체 단편을 모두 포함한다. 또한, 상기 용어는 키메라성 항체(예를 들면, 인간화 뮤린 항체) 및 이가(bivalent) 또는 이중특이성 분자(예를 들어, 이중특이성 항체), 디아바디, 트리아바디 및 테트라바디를 포함한다. 상기 용어는 추가로 FcRn(neonatal Fc receptor)에 대한 결합 기능을 보유한 단쇄 항체, 스캡, 항체 불변 영역의 유도체 및 단백질 스캐폴드에 기초한 인공 항체를 포함한다. 전체 항체는 2개의 전체 길이의 경쇄(light chain, LC) 및 2개의 전체 길이의 중쇄(heavy chain, HC)를 가지는 구조이며, 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다. 상기 전체 항체는 IgA, IgD, IgE, IgM 및 IgG를 포함하며, IgG는 아형(subtype)으로, IgG1, IgG2, IgG3 및 IgG4를 포함한다. 일 구현예로, 본 발명에서 제공하는 항체는 IgG 항체일 수 있다.
상기 용어 "단편", "폴리펩타이드의 결합 단편" 및 "항체 단편"은 항체의 항원-결합 활성을 보유하는 본 발명의 항체의 임의의 단편을 지칭하는 것으로 호환적으로 사용된다. 예시적인 항체 단편은 단일 쇄 항체, Fd, Fab, Fab', F(ab')2, dsFv 또는 scFv를 포함하나 이에 한정되지 않는다. 상기 Fd는 Fab 단편에 포함되어 있는 중쇄 부분을 의미한다. 상기 Fab는 경쇄 및 중쇄의 가변 영역(variable region)과 경쇄의 불변 영역(framework region, FR) 및 중쇄의 첫 번째 불변 영역(CH1 도메인)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C 말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 디설파이드 결합을 이루면서 생성된다. Fv(variable fragment)는 중쇄 가변 부위 및 경쇄 가변 부위만을 가지고 있는 최소의 항체 조각을 의미한다. 이중디설파이드 Fv(dsFv)는 디설파이드 결합으로 중쇄 가변 부위와 경쇄 가변 부위가 연결되어 있고, 단쇄 Fv(scFv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변 영역과 경쇄의 가변 영역이 공유 결합으로 연결되어 있다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻을 수 있고(예를 들어, 전체 항체를 파파인으로 제한 절단하며 Fab를 얻을 수 있고 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다), 그 예로 유전자 재조합 기술을 통하여 제작할 수 있다.
본 발명에서, 용어 "항원결정부위"는 "에피토프(epitope)"라고도 하며, 항체 또는 항체 단편이 항원에 특이적으로 결합하는 항원의 영역 또는 구역을 지칭한다.
또한, 상기 항체 또는 이의 항원 결합 단편은 카시리비맙(casirivimab, REGN10933), 임데비맙(imdevimab, REGN10987), 및/또는 S309가 결합하는 코로나바이러스 스파이크로부터 유래된 에피토프에 경쟁적으로 결합하는 하는 것일 수 있으나, 이에 제한되지 않는다.
일 구현예로, 본 발명에서 제공하는 항체는 단일클론항체일 수 있다.
본 발명에서 용어, "단일클론항체"는 실질적으로 동일한 항체 집단에서 수득한 단일 분자 조성의 항체 분자를 지칭하고, 이러한 단일클론항체는 특정 에피토프에 대해 단일 결합 특이성 및 친화도를 나타낸다.
전형적으로, 면역글로불린은 중쇄 및 경쇄를 가지며 각각의 중쇄 및 경쇄는 불변 영역 및 가변 영역(상기 부위는 도메인으로 또한 알려져 있음)을 포함한다. 경쇄 및 중쇄의 가변 영역은, 상보성 결정 영역(complementarity-determining region, 이하 "CDR"이라 함)이라 불리우는 3개의 다변가능한 영역 및 4개의 구조 영역(framework region)을 포함한다. 상기 CDR은 주로 항원의 에피토프(epitope)에 결합하는 역할을 한다. 각각의 사슬의 CDR은 전형적으로 N-말단으로부터 시작하여 순차적으로 CDR1, CDR2, CDR3로 불리우고, 또한 특정 CDR이 위치하고 있는 사슬에 의해서 식별된다.
일반적으로, 면역글로불린은 중쇄(heavy chain) 및 경쇄(light chain)를 가지며 각각의 중쇄 및 경쇄는 불변 영역(constant region) 및 가변 영역(variable region)을 포함한다. 경쇄 및 중쇄의 가변 영역은, 상보성 결정 영역으로 불리는 3개의 다변가능한 영역(complementarity-determining region, 이하 "CDR"로 명명) 및 4개의 구조 영역(framework region, 이하 "FR"로 명명)을 포함한다. 각 사슬의 CDR은 주로 항원의 에피토프(epitope)에 결합하는 역할을 하며, 전형적으로 N-말단으로부터 시작하여 순차적으로 CDR1, CDR2, CDR3로 명명된다. 또한, 각 사슬의 FR은 N-말단으로부터 시작하여 순차적으로 FR1, FR2, FR3, FR4로 명명될 수 있다.
본 발명에서, 중쇄의 가변영역은 'VH', 경쇄의 가변영역은 'VL'로 명명될 수 있으며, 중쇄의 CDR은 각각 'VH-CDR1', ' VH-CDR2', ' VH-CDR3'으로, 경쇄의 CDR은 각각 'VL-CDR1', 'VL-CDR2', 'VL-CDR3'으로, 중쇄의 FR은 각각 'VH-FR1', 'VH-FR2', 'VH-FR3', 'VH-FR4'로, 경쇄의 FR은 'VL-FR1', 'VL-FR2', 'VL-FR3', 'VL-FR4'로 명명될 수 있다.
일 구현예로, 본 발명의 코로나바이러스 스파이크 단백질에 특이적으로 결합하는 항체 또는 이의 결합 단편은, 서열번호 5 내지 45, 서열번호 87 내지 91, 서열번호 97 내지 115 중 어느 하나의 서열을 포함하는 군으로부터 선택되는 어느 하나 이상의 중쇄 가변영역; 및 서열번호 46 내지 86, 서열번호 92 내지 96, 및 서열번호 116 내지 131 중 어느 하나의 서열을 포함하는 군으로부터 선택되는 어느 하나 이상의 경쇄 가변영역을 포함하는 것일 수 있다. 구체적으로, 서열번호 5의 중쇄 가변영역 및 서열번호 46의 경쇄 가변영역; 서열번호 6의 중쇄 가변영역 및 서열번호 47의 경쇄 가변영역; 서열번호 7의 중쇄 가변영역 및 서열번호 48의 경쇄 가변영역; 서열번호 8의 중쇄 가변영역 및 서열번호 49의 경쇄 가변영역; 서열번호 9의 중쇄 가변영역 및 서열번호 50의 경쇄 가변영역; 서열번호 10의 중쇄 가변영역 및 서열번호 51의 경쇄 가변영역; 서열번호 11의 중쇄 가변영역 및 서열번호 52의 경쇄 가변영역; 서열번호 12의 중쇄 가변영역 및 서열번호 53의 경쇄 가변영역; 서열번호 13의 중쇄 가변영역 및 서열번호 54의 경쇄 가변영역; 서열번호 14의 중쇄 가변영역 및 서열번호 55의 경쇄 가변영역; 서열번호 15의 중쇄 가변영역 및 서열번호 56의 경쇄 가변영역; 서열번호 16의 중쇄 가변영역 및 서열번호 57의 경쇄 가변영역; 서열번호 17의 중쇄 가변영역 및 서열번호 58의 경쇄 가변영역; 서열번호 18의 중쇄 가변영역 및 서열번호 59의 경쇄 가변영역; 서열번호 19의 중쇄 가변영역 및 서열번호 60의 경쇄 가변영역; 서열번호 20의 중쇄 가변영역 및 서열번호 61의 경쇄 가변영역; 서열번호 21의 중쇄 가변영역 및 서열번호 62의 경쇄 가변영역; 서열번호 22의 중쇄 가변영역 및 서열번호 63의 경쇄 가변영역; 서열번호 23의 중쇄 가변영역 및 서열번호 64의 경쇄 가변영역; 서열번호 24의 중쇄 가변영역 및 서열번호 65의 경쇄 가변영역; 서열번호 25의 중쇄 가변영역 및 서열번호 66의 경쇄 가변영역; 서열번호 26의 중쇄 가변영역 및 서열번호 67의 경쇄 가변영역; 서열번호 27의 중쇄 가변영역 및 서열번호 68의 경쇄 가변영역; 서열번호 28의 중쇄 가변영역 및 서열번호 69의 경쇄 가변영역; 서열번호 29의 중쇄 가변영역 및 서열번호 70의 경쇄 가변영역; 서열번호 30의 중쇄 가변영역 및 서열번호 71의 경쇄 가변영역; 서열번호 31의 중쇄 가변영역 및 서열번호 72의 경쇄 가변영역; 서열번호 32의 중쇄 가변영역 및 서열번호 73의 경쇄 가변영역; 서열번호 33의 중쇄 가변영역 및 서열번호 74의 경쇄 가변영역; 서열번호 34의 중쇄 가변영역 및 서열번호 75의 경쇄 가변영역; 서열번호 35의 중쇄 가변영역 및 서열번호 76의 경쇄 가변영역; 서열번호 36의 중쇄 가변영역 및 서열번호 77의 경쇄 가변영역; 서열번호 37의 중쇄 가변영역 및 서열번호 78의 경쇄 가변영역; 서열번호 38의 중쇄 가변영역 및 서열번호 79의 경쇄 가변영역; 서열번호 39의 중쇄 가변영역 및 서열번호 80의 경쇄 가변영역; 서열번호 40의 중쇄 가변영역 및 서열번호 81의 경쇄 가변영역; 서열번호 41의 중쇄 가변영역 및 서열번호 82의 경쇄 가변영역; 서열번호 42의 중쇄 가변영역 및 서열번호 83의 경쇄 가변영역; 서열번호 43의 중쇄 가변영역 및 서열번호 84의 경쇄 가변영역; 서열번호 44의 중쇄 가변영역 및 서열번호 85의 경쇄 가변영역; 서열번호 45의 중쇄 가변영역 및 서열번호 86의 경쇄 가변영역; 서열번호 87의 중쇄 가변영역 및 서열번호 92의 경쇄 가변영역; 서열번호 88의 중쇄 가변영역 및 서열번호 93의 경쇄 가변영역; 서열번호 89의 중쇄 가변영역 및 서열번호 94의 경쇄 가변영역; 서열번호 90의 중쇄 가변영역 및 서열번호 95의 경쇄 가변영역; 서열번호 91의 중쇄 가변영역 및 서열번호 96의 경쇄 가변영역; 서열번호 100의 중쇄 가변영역 및 서열번호 116의 경쇄 가변영역; 서열번호 101의 중쇄 가변영역 및 서열번호 117의 경쇄 가변영역; 서열번호 102의 중쇄 가변영역 및 서열번호 118의 경쇄 가변영역; 서열번호 103의 중쇄 가변영역 및 서열번호 119의 경쇄 가변영역; 서열번호 104의 중쇄 가변영역 및 서열번호 120의 경쇄 가변영역; 서열번호 105의 중쇄 가변영역 및 서열번호 121의 경쇄 가변영역; 서열번호 106의 중쇄 가변영역 및 서열번호 122의 경쇄 가변영역; 서열번호 107의 중쇄 가변영역 및 서열번호 123의 경쇄 가변영역; 서열번호 108의 중쇄 가변영역 및 서열번호 124의 경쇄 가변영역; 서열번호 109의 중쇄 가변영역 및 서열번호 125의 경쇄 가변영역; 서열번호 110의 중쇄 가변영역 및 서열번호 126의 경쇄 가변영역; 서열번호 111의 중쇄 가변영역 및 서열번호 127의 경쇄 가변영역; 서열번호 112의 중쇄 가변영역 및 서열번호 128의 경쇄 가변영역; 서열번호 113의 중쇄 가변영역 및 서열번호 129의 경쇄 가변영역; 서열번호 114의 중쇄 가변영역 및 서열번호 130의 경쇄 가변영역; 서열번호 115의 중쇄 가변영역 및 서열번호 131의 경쇄 가변영역 중 어느 하나를 포함할 수 있으나, 이에 제한되지 않는다.
본 발명의 목적상 상기 항체 또는 이의 항원 결합 단편은 2종 이상의 코로나바이러스에 교차반응을 가지는 것일 수 있다. 상기 코로나바이러스는 SARS-CoV, SARS-CoV-2 또는 MERS-CoV일 수 있으나, 교차반응을 갖는 것이라면 이에 제한되지 않는다.
일 예로, 상기 2종 이상의 코로나바이러스에 교차반응을 가지는 항체 또는 이의 항원 결합 단편은 서열번호 6 내지 12, 서열번호 14 내지 22, 서열번호 24, 25, 32, 37, 45, 서열번호 87 내지 91, 및 서열번호 97 내지 99 중 어느 하나의 서열을 포함하는 군으로부터 선택되는 어느 하나 이상의 중쇄 가변영역; 및 서열번호 47 내지 53, 서열번호 55 내지 63, 서열번호 65, 66, 73, 78, 86, 및 서열번호 92 내지 96중 어느 하나의 서열을 포함하는 군으로부터 선택되는 어느 하나 이상의 경쇄 가변영역을 포함하는 것일 수 있으나, 이에 제한되지 않는다.
구체적으로, 서열번호 6의 중쇄 가변영역 및 서열번호 47의 경쇄 가변영역; 서열번호 7의 중쇄 가변영역 및 서열번호 48의 경쇄 가변영역; 서열번호 8의 중쇄 가변영역 및 서열번호 49의 경쇄 가변영역; 서열번호 9의 중쇄 가변영역 및 서열번호 50의 경쇄 가변영역; 서열번호 10의 중쇄 가변영역 및 서열번호 51의 경쇄 가변영역; 서열번호 11의 중쇄 가변영역 및 서열번호 52의 경쇄 가변영역; 서열번호 12의 중쇄 가변영역 및 서열번호 53의 경쇄 가변영역; 서열번호 14의 중쇄 가변영역 및 서열번호 55의 경쇄 가변영역; 서열번호 15의 중쇄 가변영역 및 서열번호 56의 경쇄 가변영역; 서열번호 16의 중쇄 가변영역 및 서열번호 57의 경쇄 가변영역; 서열번호 17의 중쇄 가변영역 및 서열번호 58의 경쇄 가변영역; 서열번호 18의 중쇄 가변영역 및 서열번호 59의 경쇄 가변영역; 서열번호 19의 중쇄 가변영역 및 서열번호 60의 경쇄 가변영역; 서열번호 20의 중쇄 가변영역 및 서열번호 61의 경쇄 가변영역; 서열번호 21의 중쇄 가변영역 및 서열번호 62의 경쇄 가변영역; 서열번호 22의 중쇄 가변영역 및 서열번호 63의 경쇄 가변영역; 서열번호 24의 중쇄 가변영역 및 서열번호 65의 경쇄 가변영역; 서열번호 25의 중쇄 가변영역 및 서열번호 66의 경쇄 가변영역; 서열번호 32의 중쇄 가변영역 및 서열번호 73의 경쇄 가변영역; 서열번호 37의 중쇄 가변영역 및 서열번호 78의 경쇄 가변영역; 서열번호 45의 중쇄 가변영역 및 서열번호 86의 경쇄 가변영역; 서열번호 87의 중쇄 가변영역 및 서열번호 92의 경쇄 가변영역; 서열번호 88의 중쇄 가변영역 및 서열번호 93의 경쇄 가변영역; 서열번호 89의 중쇄 가변영역 및 서열번호 94의 경쇄 가변영역; 서열번호 90의 중쇄 가변영역 및 서열번호 95의 경쇄 가변영역; 서열번호 91의 중쇄 가변영역 및 서열번호 96의 경쇄 가변영역 중 어느 하나를 포함할 수 있으나, 이에 제한되지 않는다.
본 발명에서 용어, "인간 항체"는 인간 면역글로불린으로부터 유래하는 분자로서, 상보성 결정영역, 구조 영역을 포함한 항체를 구성하는 모든 아미노산 서열 전체가 인간 면역글로불린의 아미노산 서열로 구성되어 있는 것을 의미한다. 인간 항체는 통상적으로 인간의 질병의 치료에 사용되는데, 이는 3가지 이상의 잠재적인 장점을 가질 수 있다. 먼저, 이는 인간 면역 체계와 보다 양호하게 상호작용하여, 예를 들어 보체-의존성 세포독성(complement-dependent cytotoxicity, CDC) 또는 항체-의존성 세포성 세포독성(antibody-dependent cell-mediated cytotoxicity, ADCC)에 의하여 목적 세포를 보다 효율적으로 파괴시킬 수 있다. 둘째로, 인간 면역 체계가 상기 항체를 외래의 것으로 인식하지 않는 이점이 있다. 셋째로, 더 적은 양, 보다 적은 빈도의 약물을 투여하였을 때에도 인간 순환계 내 반감기가 천연 발생 항체와 유사하다는 이점이 있다. 따라서 본 발명에 따른 인간 항체들은 코로나바이러스, 그 중에서도 SARS-CoV-2에 대한 예방 또는 치료 효과를 가져 SARS-CoV-2를 치료에 있어 유용하게 사용될 수 있다.
본 발명의 인간 단일클론항체가 불변 영역을 포함하는 경우, IgG, IgA, IgD, IgE, IgM 유래 또는 이들의 조합(combination) 또는 이들의 혼성(hybrid)에 의한 불변 영역을 포함할 수 있다.
본 발명에서 용어, "조합(combination)"이란 이량체 또는 다량체를 형성할 때, 동일 기원 단쇄 면역글로불린 불변 영역을 암호화하는 폴리펩타이드가 상이한 기원의 단쇄 폴리펩타이드와 결합을 형성하는 것을 의미한다. 그 예로, IgG, IgA, IgD, IgE 및 IgM의 불변 영역으로 이루어진 그룹으로부터 선택된 2개 이상의 불변 영역으로부터 이량체 또는 다량체를 형성할 수 있다.
본 발명에서 용어, "하이브리드(hybrid)"란 단쇄 면역 글로불린 중쇄 불변 영역 내에 2개 이상의 상이한 기원의 면역글로불린 중쇄 불변 영역에 해당하는 서열이 존재함을 의미하며, 그 예로 IgG, IgA, IgD, IgE 및 IgM의 CH1, CH2, CH3 및 CH4로 이루어진 그룹으로부터 선택되는 1개 내지 4개 도메인으로 이루어진 도메인의 하이브리드가 가능하다.
또한, 본 발명에서 항체 또는 이의 항원 단편 결합은 가변영역 및 불변영역의 유래가 동일하거나 상이할 수 있으며, CDR, 이를 제외한 가변영역 및 불변영역의 유래가 동일 또는 상이할 수 있다.
일 예로, 본 발명의 항체 또는 이의 항원 단편 결합은 서열번호 139의 중쇄 CDR1; 서열번호 140의 중쇄 CDR2; 및 서열번호 141의 중쇄 CDR3을 포함하는 중쇄 가변영역 및 서열번호 142 또는 148의 경쇄 CDR1; 서열번호 143 또는 146의 경쇄 CDR2; 및 서열번호 144 또는 147의 경쇄 CDR3을 포함하는 경쇄 가변영역을 포함할 수 있으나, 이에 제한되지 않는다.
구체적으로, 서열번호 139의 중쇄 CDR1; 서열번호 140의 중쇄 CDR2; 및 서열번호 141의 중쇄 CDR3을 포함하는 중쇄 가변영역 및 서열번호 142의 경쇄 CDR1; 서열번호 143의 경쇄 CDR2; 및 서열번호 144의 경쇄 CDR3을 포함하는 경쇄 가변영역을 포함하거나, 서열번호 139의 중쇄 CDR1; 서열번호 140의 중쇄 CDR2; 및 서열번호 141의 중쇄 CDR3을 포함하는 중쇄 가변영역 및 서열번호 145의 경쇄 CDR1; 서열번호 146의 경쇄 CDR2; 및 서열번호 147의 경쇄 CDR3을 포함하는 경쇄 가변영역을 포함할 수 있으나, 이에 제한되지 않는다.
또한, 본 발명에서 항체 또는 이의 항원 단편 결합은 서열번호 103의 아미노산 서열로 이루어진 중쇄 가변영역; 및 서열번호 119의 아미노산 서열로 이루어진 경쇄 가변영역을 포함할 수 있으나, 이에 제한되지 않는다.
본 발명의 일 실시예에서는, 서열번호 103의 아미노산 서열로 이루어진 중쇄 가변영역 및 서열번호 119의 아미노산 서열로 이루어진 경쇄 가변영역을 포함하는 항체를 "M4-4" 또는 "MG1141A"로 명명하였다.
또한, 본 발명의 항체는 서열번호 148, 152 또는 155의 중쇄 FR(Framework region)1; 서열번호 149 또는 156의 중쇄 FR2; 서열번호 150, 153 또는 157의 중쇄 FR3; 및 서열번호 151, 154 또는 158의 중쇄 FR4를 포함하는 중쇄 가변영역 및 서열번호 159, 163 또는 166의 경쇄 FR1; 서열번호 160 또는 167의 경쇄 FR2; 서열번호 161, 164 또는 168의 경쇄 FR3; 및 서열번호 162, 165 또는 169의 경쇄 FR4를 포함하는 경쇄 가변영역을 포함할 수 있으나, 이에 제한되지 않는다.
구체적으로, 서열번호 148의 중쇄 FR(Framework region)1; 서열번호 149의 중쇄 FR2; 서열번호 150의 중쇄 FR3; 및 서열번호 151의 중쇄 FR4를 포함하는 중쇄 가변영역 및 서열번호 159의 경쇄 FR1; 서열번호 160의 경쇄 FR2; 서열번호 161의 경쇄 FR3; 및 서열번호 162의 경쇄 FR4를 포함하는 경쇄 가변영역을 포함하는 것이거나, 서열번호 152의 중쇄 FR(Framework region)1; 서열번호 149의 중쇄 FR2; 서열번호 153의 중쇄 FR3; 및 서열번호 154의 중쇄 FR4를 포함하는 중쇄 가변영역 및 서열번호 163의 경쇄 FR1; 서열번호 160의 경쇄 FR2; 서열번호 164의 경쇄 FR3; 및 서열번호 165의 경쇄 FR4를 포함하는 경쇄 가변영역을 포함하는 것이거나, 서열번호 155의 중쇄 FR(Framework region)1; 서열번호 156의 중쇄 FR2; 서열번호 157의 중쇄 FR3; 및 서열번호 158의 중쇄 FR4를 포함하는 중쇄 가변영역 및 서열번호 166의 경쇄 FR1; 서열번호 167의 경쇄 FR2; 서열번호 168의 경쇄 FR3; 및 서열번호 169의 경쇄 FR4를 포함하는 경쇄 가변영역을 포함하는 것일 수 있으나, 이에 제한되지 않는다.
본 발명은 다른 양태로서, 상기 신규 항체 또는 이의 항원 결합 단편을 제조하는 방법을 제공한다.
본 발명의 신규 항체 또는 이의 항원 결합 단편은 공지의 항체 제조기술로 용이하게 제조될 수 있다. 예를 들어, 면역된 동물로부터 얻은 B 림프구를 사용하여 하이브리도마를 제조함으로써 수행될 수 있거나(Koeher and Milstein, 1976, Nature, 256:495), 파지 디스플레이(phage display) 기술을 이용함으로써 수행될 수 있으나, 이에 제한되는 것은 아니다.
파지 디스플레이 기술을 이용한 항체 라이브러리는 하이브리도마를 제작하지 않고 바로 B 림프구로부터 항체 유전자를 얻어 파지(phage) 표면에 항체를 발현시키는 방법이다. 파지 디스플레이 기술을 이용하면 B-세포 불멸화(immortalization)에 의해 단일클론항체를 생성하는데 관련된 기존의 많은 어려움이 극복될 수 있다. 일반적으로 파지 디스플레이 기술은 1) 파지의 외피 단백질(coat protein) pⅢ(또는 pⅣ) N-말단에 해당하는 유전자 부위에 무작위 서열의 올리고뉴클레오티드(oligonucleotide)를 삽입하는 단계; 2) 천연형의 외피 단백질 일부와 상기 무작위 서열의 올리고뉴클레오티드에 의해 코딩되는 폴리펩티드의 융합 단백질을 발현시키는 단계; 3) 상기 올리고뉴클레오티드에 의해 코딩된 폴리펩티드와 결합할 수 있는 수용체 물질을 처리하는 단계; 4) 수용체에 결합된 펩티드-파지 입자들을 낮은 pH나 결합 경쟁력 있는 분자를 이용하여 용출시키는 단계; 5) 패닝(panning)에 의하여 용출된 파지를 숙주 세포 내에서 증폭시키는 단계; 6) 원하는 양을 얻기 위해 상기 방법을 반복하는 단계; 및 7) 패닝에 의해 선별된 파지 클론들의 DNA 서열로부터 활성이 있는 펩티드의 서열을 결정하는 단계로 구성될 수 있다.
본 발명은 또 다른 양태로서, 상기 신규 항체를 코딩하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 발현 벡터 및 상기 발현 벡터를 포함하는 형질전환체를 제공한다.
본 발명의 다른 하나의 양태는 본 발명에서 제공하는 항체 또는 이의 항원 결합 단편을 포함하는 발현 벡터 및 상기 벡터가 도입된 숙주세포를 제공한다.
상기 항체에 대해서는 상기에서 설명한 바와 같다.
본 발명에서 제공하는 상기 항체를 코딩하는 폴리뉴클레오티드를 포함하는 발현 벡터는 특별히 이에 제한되지 않으나, 포유류 세포(예를 들어, 사람, 원숭이, 토끼, 래트, 햄스터, 마우스 세포 등), 식물 세포, 효모 세포, 곤충 세포 또는 박테리아 세포(예를 들어, 대장균 등)를 포함하는 진핵 또는 원핵세포에서 상기 폴리뉴클레오티드를 복제 및/또는 발현할 수 있는 벡터가 될 수 있고, 구체적으로는 숙주세포에서 상기 뉴클레오티드가 발현될 수 있도록 적절한 프로모터에 작동가능하도록 연결되며, 적어도 하나의 선별 마커를 포함하는 벡터가 될 수 있다. 그 예로 파지, 플라스미드, 코스미드, 미니-염색체, 바이러스 또는 레트로바이러스벡터 등에 상기 폴리뉴클레오티드가 도입된 형태가 될 수 있다.
상기 항체를 코딩하는 폴리뉴클레오티드를 포함하는 발현 벡터는 상기 항체의 중쇄 또는 경쇄를 코딩하는 폴리뉴클레오티드를 각각 포함하는 발현 벡터 또는 중쇄 또는 경쇄를 코딩하는 폴리뉴클레오티드를 모두 포함하는 발현 벡터일 수 있다.
본 발명에서 제공하는 상기 발현 벡터가 도입된 형질전환체는 특별히 이에 제한되지 않으나, 상기 발현벡터가 도입되어 형질전환된 대장균, 스트렙토미세스, 살모넬라 티피뮤리움 등의 박테리아 세포; 효모 세포; 피치아 파스토리스 등의 균류세포; 드로조필라, 스포도프테라 Sf9 세포 등의 곤충 세포; CHO(중국 햄스터 난소 세포, chinese hamster ovary cells), SP2/0(마우스 골수종), 인간 림프아구(human lymphoblastoid), COS, NSO(마우스 골수종), 293T, 보우 멜라노마 세포, HT-1080, BHK(베이비 햄스터 신장세포, baby hamster kidney cells), HEK(인간 배아신장 세포, human embryonic kidney cells), PERC.6(인간망막세포) 등의 동물 세포; 또는 식물 세포가 될 수 있다.
본 발명에서 용어, "도입"은 상기 항체를 코딩하는 폴리뉴클레오티드를 포함하는 벡터를 숙주세포에 전달하는 방법을 의미한다. 이와 같은 도입은 칼슘 포스페이트-DNA 공침전법, DEAE-덱스트란-매개 트랜스펙션법, 폴리브렌-매개 형질감염법, 전기충격법, 미세주사법, 리포좀 융합법, 리포펙타민 및 원형질체 융합법 등의 당 분야에 공지된 여러 방법에 의해 수행될 수 있다. 또한, 형질도입은 감염(infection)을 수단으로 하여 바이러스 입자를 사용하여 목적물을 세포 내로 전달시키는 것을 의미한다. 아울러, 유전자 밤바드먼트 등에 의해 벡터를 숙주세포 내로 도입할 수 있다. 본 발명에서 도입은 형질전환과 혼용되어 사용될 수 있다.
본 발명의 다른 하나의 양태는 본 발명에서 제공하는 항체 또는 이의 항원 결합 단편을 포함하는, 코로나바이러스 감염 진단용 조성물을 제공한다.
본 발명의 다른 하나의 양태는 본 발명에서 제공하는 항체 또는 이의 항원 결합 단편을 포함하는, 코로나바이러스 감염 진단용 키트를 제공한다.
본 발명의 다른 하나의 양태는 본 발명에서 제공하는 항체 또는 이의 항원 결합 단편; 또는 이를 포함하는 감염 진단용 조성물; 또는 상기 조성물을 포함하는 키트를 이용하여, 코로나바이러스 감염 의심 개체로부터 분리된 생물학적 시료에 존재하는 코로나바이러스를 검출하는 단계를 포함하는, 코로나바이러스 감염 진단방법 또는 진단을 위한 정보제공방법을 제공한다.
본 발명에서 용어, "진단"은 특정 질병 또는 질환에 대한 개체의 감수성(susceptibility)을 판정하는 것, 개체가 특정 질병 또는 질환을 현재 가지고 있는지 여부를 판정하는 것 또는 치료 효능에 대한 정보를 제공하기 위해 개체의 상태를 모니터링 하는 것을 포함한다.
본 발명의 목적상, 상기 진단은 코로나바이러스 감염 질환의 발병 여부를 확인하는 것일 수 있다. 상기 "코로나바이러스 감염 질환"은 코로나바이러스가 숙주가 되는 생물체의 체내에 침입하는 감염에 의해 발병되는 질환을 의미한다. 구체적으로, 상기 코로나바이러스는 SARS-CoV-2(사스-코로나바이러스-2) 일 수 있다. 그 예로, 상기 코로나바이러스 감염 질환은 COVID-19일 수 있다.
본 발명의 코로나바이러스 감염 진단용 조성물은 본 발명의 항체 또는 이의 항원 결합 단편 이외의 다른 항체 또는 이의 항원 결합 단편을 포함할 수 있다. 또한, 이 밖에 본 발명의 항체 또는 이의 항원 결합 단편과 항원의 결합 반응에 필요한 물질, 예를 들어 시약이 더 포함될 수 있다. 또한, 이 결합을 검출하는데 필요한 물질, 본 발명의 항체 또는 이의 항원 결합 단편의 안정화를 위한 물질 등이 더 포함될 수 있다.
일 예로, 본 발명의 진단용 조성물에 포함되는 항체 또는 이의 항원 결합 단편은 검출을 위해 표지 된 것일 수 있다. 분자 표식에 사용 가능한 다양한 방법들이 당업자에게 잘 알려져 있고, 본 발명의 범주 내에서 고려된다.
본 발명에서 사용될 수 있는 표식 종류의 예로는 효소, 방사성 동위원소, 콜로이드금속, 형광 화합물, 화학발광 화합물 및 생발광 화합물이 있다. 통상적으로 사용되는 표식들은 형광물질(가령, 플루레신, 로다민, 텍사스 레드 등), 효소(가령, 고추냉이 퍼옥시다아제, 베타-갈락토시다아제, 알칼리포스파타 아제), 방사성 동위원소(가령, 32P 또는 125I), 바이오틴, 디곡시게닌, 콜로이드 금속, 화학발광 또는 생발광 화합물(가령, 디옥세탄, 루미놀 또는 아크리디늄)을 포함한다. 효소 또는 바이오티닐기의 공유 결합법, 요오드화법, 인산화법, 바이오틴화법 등과 같은 표식 방법들 역시 잘 알려져 있다.
본 발명의 키트는, 본 발명의 항체 또는 이의 항원 결합 단편과 항원의 결합을 검출하는데 필요한 시약, 기구 등이 더 포함될 수 있다.
일 예로, 본 발명의 키트 용기에는 고체 담체가 포함될 수 있다. 본 발명의 항체는 고체 담체에 부착될 수 있고, 이와 같은 고체 담체는 다공성 또는 비다공성, 평면 또는 비평면일 수 있다.
일 예로, 상기 키트는 고체 담체; 분석하고자 하는 검체를 수용하고 버퍼 투입부 및 검체 투입부를 구비하는 검체 패드; 상기 검체 패드에서 유입된 검체에 함유되어 있는 코로나바이러스와 특이적으로 결합하는 항체를 포함하는 컨쥬게이트 패드; 상기 검체에 코로나바이러스가 존재하는지 여부를 검출하는 신호검출부와 분석 물질의 존재 유무와 관계없이 검체가 흡수 패드로 이동하였는지 여부를 확인하는 대조부를 포함하는 신호 검출 패드; 및 신호 검출 반응이 종료된 검체를 흡수하는 흡수 패드를 포함하는 것일 수 있으나, 이에 제한되지 않는다.
일 예로, 본 발명의 키트는 ELISA(Enzyme-linked immunosorbent assay) 키트 형태일 수 있다. 본 발명의 용어 "ELISA"는 효소면역측정방법이라고도 하며, 항체에 효소를 결합시켜 항원-항체 복합체를 형성함으로써 이의 효소와 기질의 반응을 통해 흡광도를 이용하여 정량하는 방법이다. 상기 ELISA는 고체 지지체에 부착된 항원을 인지하는 표지 된 항체를 이용하는 직접적 ELISA, 고체 지지체에 부착된 항원을 인지하는 항체의 복합체에서 포획 항체를 인지하는 표지 된 이차 항체를 이용하는 간접적 ELISA, 고체 지지체에 부착된 항체와 항원의 복합체에서 항원을 인지하는 표지된 또 다른 항체를 이용하는 직접적 샌드위치 ELISA, 고체 지지체에 부착된 항체와 항원의 복합체에서 항원을 인지하는 또 다른 항체와 반응시킨 후 이 항체를 인지하는 표지 된 2차 항체를 이용하는 간접적 샌드위치 ELISA 등을 포함한다.
본 발명의 항체 또는 이의 단편은 생물학적 시료와 접촉시켜, 반응을 확인하여 생물학적 시료 내 코로나바이러스 존재 여부를 검출하는 데 사용될 수 있다.
상기 생물학적 시료는 대상의 가래, 침, 혈액, 땀, 폐 세포, 폐 조직의 점액, 호흡기 조직 및 타액으로 이루어진 군으로부터 선택된 어느 하나일 수 있으나, 이에 한정되지 않으며 당업자에게 알려진 통상적인 방법으로 준비가 가능하다.
일 예로, 본 발명의 코로나바이러스 감염 진단을 위한 정보제공방법은 (a) 본 발명에서 제공하는 항체 또는 이의 항원 결합 단편을 생물학적 시료와 접촉시키는 단계; 및 (b) 상기 접촉으로 형성된, 본 발명의 항체 또는 이의 항원 결합 단편과 코로나바이러스 스파이크 단백질의 복합체를 검출하는 단계를 포함할 수 있다. 구체적으로, 상기 (b) 단계에서 항체 또는 이의 단편과 코로나바이러스 스파이크 단백질의 복합체는, SARS-CoV-2 스파이크 단백질의 결합 도메인(CD) 부위 결합체 일 수 있다.
본 발명에서 사용된 용어 "항원-항체 복합체"는 시료 중의 해당 단백질 항원과 이를 인지하는 항체의 결합물을 의미한다. 상기 항원-항체 복합체의 검출은 당업계에 공지된 바와 같은 방법, 예를 들어 분광학적, 광화학적, 생물화학적, 면역화학적, 전기적, 흡광적, 화학적 및 기타 방법을 이용하여 검출할 수 있으며, 구체적으로 비색법(colormetric method), 전기화학법(electrochemical method), 형광법(fluorimetric method), 발광법(luminometry), 입자계수법(particle counting method), 육안측정법(visual assessment) 및 섬광계수법(scintillation counting method)으로 이루어진 군에서 선택되는 임의의 방법으로 검출할 수 있으며, 웨스턴블랏(western blotting), ELISA, 방사선면역분석법(radioimmunoassay), 방사면역 확산법(radioimmunodiffusion), 오우크레로니(ouchterlony) 면역 확산법, 로케트(rocket) 면역전기영동, 조직면역 염색, 면역침전 분석법(immunoprecipitation assay), 보체 고정 분석법(complete fixation assay), 유세포 분석법(fluorescence-activated cell sorting, FACS), 단백질 칩(protein chip) 등의 방법을 사용할 수 있으나 이에 제한되지 않는다.
본 발명의 다른 하나의 양태는 상기 항체 또는 이의 결합 단편을 포함하는 코로나바이러스 감염의 예방 또는 치료용 약학적 조성물을 제공한다. 구체적으로, 상기 코로나바이러스는 SARS-CoV-2 일 수 있다. 일 예로, 상기 조성물은 COVID-19의 예방 또는 치료를 위한 것일 수 있다.
본 발명에서 용어, "COVID-19"는 SARS-CoV-2에 감염되어 발생하는 질환을 말한다. 본 발명의 항체는 SARS-CoV-2에 대한 중화능 및 감염 억제능을 나타내므로, 이를 COVID-19의 예방 또는 치료에 사용할 수 있다.
본 발명에서 용어, "예방"이란 상기 조성물의 투여에 의해 코로나바이러스 감염의 발병을 억제하거나 지연시키는 모든 행위를 의미할 수 있으며, 상기 "치료"란 상기 조성물의 투여에 의해 코로나바이러스 감염에 의한 증세가 호전되거나 이롭게 변경되는 모든 행위를 의미할 수 있다. 상기 약학적 조성물은 약학적으로 허용가능한 담체를 추가로 포함할 수 있다.
본 발명에서 용어, "약학적으로 허용가능한 담체"란 생물체를 자극하지 않고 투여 화합물의 생물학적 활성 및 특성을 저해하지 않는 담체 또는 희석제를 말한다. 액상 용액으로 제제화되는 조성물에 있어서 허용되는 약학적 담체로는, 멸균 및 생체에 적합한 것으로서, 식염수, 멸균수, 링거액, 완충 식염수, 알부민 주사용액, 덱스트로즈 용액, 말토 덱스트린 용액, 글리세롤, 에탄올 및 이들 성분 중 1 성분 이상을 혼합하여 사용할 수 있으며, 필요에 따라 항산화제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다. 또한, 희석제, 분산제, 계면활성제, 결합제 및 윤활제를 부가적으로 첨가하여 수용액, 현탁액, 유탁액 등과 같은 주사용 제형, 환약, 캡슐, 과립 또는 정제로 제제화할 수 있다.
상기 약학적 조성물은 경구 또는 비경구의 여러 가지 제형일 수 있다. 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다. 경구투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 하나 이상의 화합물에 적어도 하나 이상의 부형제 예를 들면, 전분, 탄산칼슘, 수크로오스(sucrose) 또는 락토오스(lactose), 젤라틴 등을 섞어 조제된다. 또한 단순한 부형제 이외에 스테아린산 마그네슘, 탈크 등과 같은 윤활제들도 사용된다. 경구투여를 위한 액상제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제, 좌제가 포함된다. 비수성용제, 현탁용제로는 프로필렌글리콜(propylene glycol), 폴리에틸렌 글리콜, 올리 브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테로 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세로젤라틴 등이 사용될 수 있다.
상기 약학적 조성물은 정제, 환제, 산제, 과립제, 캡슐제, 현탁제, 내용액 제, 유제, 시럽제, 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제 및 좌제으로 이루어진 군으로부터 선택되는 어느 하나의 제형을 가질 수 있다.
상기 본 발명의 조성물은 약제학적으로 유효한 양으로 투여한다.
본 발명에서 용어, "약제학적으로 유효한 양"은 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분한 양을 의미하며, 유효 용량 수준은 개체 종류 및 중증도, 연령, 성별, 암의 종류, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출 비율, 치료기간, 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다. 본 발명의 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있다. 그리고 단일 또는 다중 투여될 수 있다. 상기 요소를 모두 고려하여 부작용없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여하는 것이 중요하며, 당업자에 의해 용이하게 결정될 수 있다.
본 발명의 또 하나의 양태는 상기 항체를 이용하여 코로나바이러스 감염을 예방 또는 치료하는 방법을 제공한다.
구체적으로, 상기 코로나바이러스는 SARS-CoV-2 일 수 있다.
일 예로, 상기 방법은 상기 항체를 SARS-CoV-2 감염 의심 개체에 투여하는 단계를 포함하는 것일 수 있다.
상기 방법은 항체 및 약학적으로 허용 가능한 담체를 추가로 포함하는 약학적 조성물을 코로나바이러스가 감염되거나 감염된 개체에 투여하는 단계를 포함하는 방법일 수 있으며, 상기 약학적으로 허용 가능한 담체는 상기에서 설명한 바와 동일하다.
상기 개체는 소, 돼지, 양, 닭, 개, 인간 등을 포함하는 포유동물, 조류 등을 포함하며, 본 발명의 상기 조성물의 투여에 의해 코로나바이러스 감염이 치료되는 개체를 제한없이 포함한다. 이때, 상기 항체는 약학적으로 유효한 양으로 단일 또는 다중 투여될 수 있다. 이때, 항체는 액제, 산제, 에어로졸, 캡슐제, 장용피 정제 또는 캡슐제 또는 좌제의 형태로 투여할 수 있다. 투여 경로는 복강 내 투여, 정맥 내 투여, 근육 내 투여, 피하 내 투여, 내피 투여, 경구 투여, 국소 투여, 비 내 투여, 폐 내 투여, 직장 내 투여 등을 포함하지만, 이에 제한되지는 않는다.
상기 방법은 또한 코로나바이러스 감염질환의 예방 또는 치료, 구체적으로는 SARS-CoV-2의 감염질환 예방 또는 치료에 사용될 수 있다. 그 예로, COVID-19의 예방 또는 치료에 사용될 수 있으나, 이에 제한되지는 않는다.
본 발명의 또 하나의 양태는 상기 항체를 코로나바이러스 감염의 예방 또는 치료를 위한 의약품의 제조에 사용하기 위한 용도이다. 상기 의약품은 SARS-CoV-2 감염질환, 예를 들어 COVID-19의 예방 또는 치료에 사용될 수 있으나, 이에 제한되지는 않는다. 상기 항체 및 SARS-CoV-2 감염의 예방 또는 치료에 대해서는 앞서 설명한 바와 같다.
이하, 하기 실시예에 의하여 본 발명을 더욱 상세하게 설명하고자 한다. 단, 하기 실시예는 본 발명을 예시하기 위한 것일 뿐 본 발명의 범위가 이들만으로 한정되는 것은 아니다.
실험예 1. 재조합 단백질 발현 및 정제
SARS-CoV-2 스파이크 당단백질의 외부 도메인(spike-ECD) 및 RBD(RBD-his)를 인코딩하는 유전자를 합성하고 C-말단 6x 히스티딘 태그가 있는 pCIW 포유류 발현 벡터에 클로닝하였다. RBD-Fc 및 인간 ACE2-Fc를 코딩하는 유전자를 pCIW 벡터에 클로닝하였다. pCIW 포유동물 벡터를 Expi293FTM 세포(카탈로그 번호 A1435101)에 형질전환시켰다. 발현의 분석을 위한 모든 단계는 제조사의 지침에 따라 수행되었다. 세포배양 5-6일 후, 원심분리에 의해 세포를 수확하고, 상청액을 0.22μm 필터에 통과시켜 세포 파편을 제거하였다. 재조합 단백질의 His-tag 정제를 위해 Ni-NTA 수지를 상등액에 첨가하였다. MabSelect Xtra(Cat. no. 17-5269-02, GE Healthcare)를 Fc 융합 단백질의 protein-A 정제용 수지로 사용하였다. 모든 정제과정은 제조사의 지침에 따라 수행되었다. 용출된 단백질의 완충액은 Zeba Spin Desalting Columns를 사용하여 PBS(phosphate-buffered saline)로 교체하였다. 단백질 농도는 Nanodrop 2000C 분광광도계(Thermo Scientific)를 사용하여 정량화하였다(도 1).
실험예2. SARS-CoV2 spike 단백질에 대한 항체 생산
SARS-CoV2 spkie 단백질에 대한 항체를 생산하기 위해 일반적인 항체 생산 기술들을 사용하였다. 구체적으로 인간 B 세포 유래 라이브러리, 마우스 면역 라이브러리, 인간 도메인 항체 합성 라이브러리를 구축 및 스크리닝하였다. 스크리닝은 통상적으로 이용되는 단일 클론 ELISA 방법을 이용하였다. 단일 클론 ELISA 스크리닝 방법은 spike 단백질에 단일 클론에서 발현된 항체를 섞어 해당 항체가 spike 단백질에 특이적인지 확인하는 방법으로 스크리닝 결과 인간 B 세포 유래 라이브러리에서 41개 (클론 1~41), 마우스 면역 라이브러리에서 5개(클론 M1~M5), 인간 도메인 항체 합성 라이브러리에서 3개(클론 5E9, 6D9, 6H10)의 spike 단백질에 특이적인 클론을 확보하였다. 서열 분석을 통해 확보된 항체의 중쇄, 경쇄 서열을 확인하였다(도 3, 표 1, 표 2, 표 3). 다만, 인간 도메인 항체 합성 라이브러리에서 확보한 클론은 합성 라이브러리 자체가 중쇄 서열로만 이루어진 라이브러리이기 때문에 중쇄 서열 정보만을 포함하였다.
클론 가변영역 아미노산서열 서열번호
1 중쇄 EVQLVQSGAEVQKPGSSVKVSCKASGGTFSSYPISWVRQAPGQGLEWMGKIIPILGIPNYAQRFQGRVTITADKSTGTAYLDLSSLSSEDTAVYYCARAGGYSGYGAHYYMDVWGKGTLVTVSS 5
경쇄 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGSVFGGGTKLTVLG 46
2 중쇄 EVQLVESGGGLIQPGGSLRLSCAASGFTFSNFAMSWVRQAPGKGLEWVSGISGSGGSTSYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVFYCAKDLYGGPGSSTFDYWGQGTLVTVSS 6
경쇄 DIVMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLPLTFGPGTKVDIKR 47
3 중쇄 QVQLVQSGGGLIQPGGSLRLSCAASGFTFSNFAMSWVRQAPGKGLEWVSGISGSGGSTSYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVFYCAKDLYGGPGSSTFDYWGQGTLVTVSS 7
경쇄 AIWMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGNGSGTDFTLTISSLQPEDFAIYYCQQSYSTPLTFGGGTKVEIKR 48
4 중쇄 EDQLVESGGGLIQPGGSLRLSCAASGFTFSNFAMSWVRQAPGKGLEWVSGISGSGGSTSYADSVKGRFTISRDNSKNTLYLQMNSLRVEDTAVFYCAKDLYGGPGSSTFDYWGQGTLVTVSS 8
경쇄 DIVMTQTPSSLSASVGDRVTITCQASQDISIYLNWYQQKPGKAPKLLIYDASILETGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQYFSYPITFGGGTKVEIKR 49
5 중쇄 EDQLVESGGGLIQPGGSLRLSCAASGFTFSNFAMSWVRQAPGKGLEWVSGISGSGGSTSYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVFYCAKDLYGGPGSSTFDYWGQGTLVTVSS 9
경쇄 DIQMTQSPSSLSASVGDRVTITCQASEDITDYLNWYQQKPGKAPKLLIYDASILETGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQQYDGLPLFGPGTKVDIKR 50
6 중쇄 QLQLQESGGGWVQPGRSLRLTCATSGFTFDDYAMHWVRQAPGKGLEWVSGITWNSDSIGYADSVKGRFTISRDDAKNSLYLQMDNLRPEDTALYYCVKDSAYRILPYWYFDLWGRGTTVTVSS 10
경쇄 DIQMTQSPSSLSASVGDRVTITCRASQSISNYLNWYQQIPGKAPKLLMYAATRLHSGVPSRFSGSGSGTDFTLTIYSLQPEDFATYYCQQSFGSPYTFGQGTKLEIKR 51
7 중쇄 EVQLVESGGDLVQPGGSLRISCAASGFAVSNNYMSWVRQAPGKGLEWVSVIHTDGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGFGELLGSDAFDIWGQGTMVTVSS 11
경쇄 AIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPHTFGPGTKVDIKR 52
8 중쇄 QVQLVQSGGGLVQPGGSLRLSCVASGFTFRTFEMNWVRQAPGKGLEWVSYISPSGSSIYNADSVKGRFTISRDNARNSLYLQMNSLRAEDTAVYYCAREGGSYYGGSAFDIWGQGTMVTVSS 12
경쇄 SYELTQPSSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGWVFGGGTKLTVLG 53
9 중쇄 EVQLVESGGGVVQPGRSLRLSCVASGFTFRTFEMNWVRQAPGKGLEWVSYISPSGSSIYNADSVKGRFTISRDNARNSLYLQMNSLRAEDTAVYYCAREGGSYYGGSAFDIWGQGTTVTVSS 13
경쇄 SYELTQPPSASGTPGQRVTISCSGSSSNIERNIVNWYQQVPGTAPKLLIYTNSHRPSGVPDRFSGSKSGSAASLAISGLQSEDEADYYCAAWDDTLNGWVFGGGTKLTVLG 54
10 중쇄 EVQLVQSGGGSVQPGGSLRLSCAASGFTFRTFEMNWVRQAPGKGLEWVSYISPSGSSIYNADSVKGRFTISRDNARNSLYLQMNSLRAEDTAVYYCAREGGSYYGGSAFDIWGQGTMVTVSS 14
경쇄 QSVPTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGRWVFGGGTKLTVLG 55
11 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDHWGQGTLVTVSS 15
경쇄 QSALTQPRSVSGSPGQSVTISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVSKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGSYTWVFGGGTKLTVLG 56
12 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYAMSWVRQAPGKGLEWVSAISGNGGSTSYAASVQGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 16
경쇄 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLG 57
13 중쇄 QVQLVESGGGVVQPGRSLRLSCAASGFTFRGYAMHWVRQAPGKGLEWVAVISEDGSDEYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 17
경쇄 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTELTVLG 58
14 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 18
경쇄 SYELTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGYVFGTGTKVTVLG 59
15 중쇄 QVQLVESGGTLVQPGGSLRLSCAASGFTFSGYAMNWVRQAPGKGLEWVSSVSGRGDTTHYADSVKGRFTISRDNRENKLYLQMHSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 19
경쇄 QAGLTQPPSVSGAPGQRVTMSCTGTTSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGYVFGTGTKVTVLG 60
16 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFTFRTYAMSWVRQAPGKGLEWVSAISSSDDTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 20
경쇄 SYELTQPLSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGWVFGGGTKLTVLG 61
17 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFSSSYYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 21
경쇄 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGWVFGGGTKLTVLG 62
18 중쇄 EVQLVQSGGGLVQPGGSLRLSCAASGFTFRTYAMSWVRQAPGKGLEWVSAISSSDDTTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 22
경쇄 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQDEDEADYYCQSYDSSLSEYVFGTGTKVTVLG 63
19 중쇄 EVQLLESGGGLVQPGGSLRLSCAASGFTFSTYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 23
경쇄 QSVLTQPPSVSGAPGQRVTISCTGSSSNFGAGYDVHWYQQLPGTAPKLLIYGNDNRPSGVPDRFSGSKSGTSASLAITGLQDEDEADYYCQSYDSSLSEYVFGTGTQLTDLG 64
20 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFTFRTYAMSWVRQAPGKGLEWVSAISSSDDTTYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTTVTVSS 24
경쇄 QSALIQPRSVSGSPGQSVTISCTGTSSNVGVYNYVSWYQQHPGKAPKLIIYDVTKRPSGVPDRFSGSKSGNTGSLTISGLQAEDEADYYSCSYAGSYTWVFGPGTKVTVLS 65
21 중쇄 QVQLLESGGGLVQPGGSLRLSCAASGFTFSTYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 25
경쇄 QTVVTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGSGVFGGGTKLTVLG 66
22 중쇄 EVQLVESGGGLAQSGGSLRLSCEASGFTFSTYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 26
경쇄 SYELTQPPSASGTPGQRVTISCSGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDYNLSGYVSGTGTKVTVLG 67
23 중쇄 QVQLVESGGGLVQPGGSLRLSCAASGFTFSTYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 27
경쇄 TYELSQPPSVSGAPGQRVTISCTGSSSNIGADYDVHWYQQLPGTAPKLLIYGNNNRPSGVPDRFSGSKSGTSGSLAITGLRSEDEADYYCAAWDDSLSGYVFGTGTKVTVLG 68
24 중쇄 EVQLVESGGAMVQPGGSLRLSCAASGFTFSTYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 28
경쇄 QPVLTQPPSVSGAPGQRVTITCTGSGSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGAPDRVSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLRTYVFGTGTKVTVLG 69
25 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISKDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 29
경쇄 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGRVFGGGTKLTVLG 70
26 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 30
경쇄 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSNLSGYVFGTGTKVTVLG 71
27 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 31
경쇄 SYELMQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLRAYVFGTGTKVTDLG 72
28 중쇄 QVQLVQSGGGLVQPGGSLRLSCAASGFTFSTYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 32
경쇄 DVVMTQSPSSLSASVGDRVTITCRASQGITNDLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYDTPPYTFGQGTKLEIKR 73
29 중쇄 QVQLVESGGGLVQPGGSLRLSCAASGFTFSTYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 33
경쇄 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGSTVFGGGTELTVLG 74
30 중쇄 EVQLVETGGGLVQPGGSLRLSCAASGFTFSTYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 34
경쇄 SYELTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDNSLSGVFGGGTKLTVLG 75
31 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYWMSWVRQAPGKGLEWVANIKQEGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 35
경쇄 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQVPGTAPKLLIYGNINRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGSYVFGTGTKVTVLG 76
32 중쇄 QVQLVQSGGGVVQPGGSLRLSCAASGFTFSGYGMNWVRQAPGKGLEWVADIEKDGGERNYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAREGGYYYGSGSYYKPKVVFDYWGQGTLVTVSS 36
경쇄 QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQHLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDGSLSGWVFGGGTKLTVLG 77
33 중쇄 EVQLVESGGGLIQPGGSLRLSCAASGFTFSSFWMSWVRQAPGKGLEWVANIKQDGSEKYSVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARHGIYCSGDNCYYFAPTLSSHAFDIWGQGTMVTVSS 37
경쇄 AIQLTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPLTFGGGTKVEIKR 78
34 중쇄 QVQLVQSGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGSSWNSGTIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAIIPGDGYNYPGASDFDYWGQGTLVTVSS 38
경쇄 QPVLTQPPSASGTPGQRVIISCSGSSSNIGSHTVNWYQQLPGTAPKLLIYNNNQRPSGVPDRFSGSKSGTSASLAISGLQSADEADYSCAAWDDSLNGYVFGTGTKVTVLG 79
35 중쇄 EVQLLESGGGLVQPGRSLKLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGSSWNSGTIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAIIPGDGYNYPGASDFDYWGQGTLVTVSS 39
경쇄 QSALTQPASVSGSPGQSITISCTGTSSDVGGYNYVSWYQQHPGKAPKLMIYDVGQRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSYTSSSSYVFGTGTKVTVLG 80
36 중쇄 QVTLKESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGSSWNSGTIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAIIPGDGYNYPGASDFDYWGQGTLVTVSS 40
경쇄 SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHVVFGGGTQLIILG 81
37 중쇄 QVQLVESGGGLVQPGGSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSGSSWNSGTIGYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCAIIPGDGYNYPGASDFDYWGQGTTVTVSS 41
경쇄 RPVLTQPPSASGTPGQRATISCSGSSSNIGSNTVNWYRQLPGTAPKLLIHSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCATWDDSLDGWVFGGGTKLTVLG 82
38 중쇄 QVQLVQSGAEVKKPGASVRVSCKASGYTFSSYYTHWVRQAPGQGLEWMGIINPSGGSTIYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARLPRDGVHASDIWGQGTTVTVSS 42
경쇄 QTVVTQEPSVSAAPEQKVTISCSGSSSNIGNNYVSWYQQLPGTAPKLLIYDNNKRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGTWDSSLSAYVFGTGTKVTVLG 83
39 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYYMGWVRQAPGKGLEWVSLISGSGGSTYYDDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKPPYSFDSMSESDYWGQGTLVTVSS 43
경쇄 QSVLTQPPSVSAAPGQKVTISCSGSGSNVENNYVSWYQQLPGTAPKLLIYENNNRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGVWDDSLNHVIFGGGTKLTVLG 84
40 중쇄 QVQLQDSGPGLVKPSETLSLTCTVSGGSISSYDWSWIRQPPGKGLEWIGDIYNSGSTKYNPSLKSRVTISVDTSKNQLSLKLSSVTAADTAVYYCARRGLGNYDILTGYFENAFDIWGQGTTVTVSS 44
경쇄 EIVLTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPRTFGQGTRLEIKR 85
41 중쇄 ETQLVESGGGLVQPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSYISSSTSTIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARTRLTQLAMIGRGGNAFDIWGQGTMVTVSS 45
경쇄 SYELTQPPSVSVAPGKTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSVVFGGGTKLTVLG 86
클론 가변영역 아미노산서열 서열번호
M1 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFTFSTYYMGWVRQAPGKGLEWVSLISGSGGSTYYDDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKPPYSFDSMSESDYWGQGTLVTVS 87
경쇄 QSVLTQPPSVSAAPGQKVTISCSGSGSNVENNYVSWYQQLPGTAPKLLIYENNNRPSGIPDRFSGSKSGTSATLGITGLQTGDEADYYCGVWDDSLNHVIFGGGTKLTVLG 92
M2 중쇄 QAYLQQSGAELVRSGASVKLSCTASGFNIKDYYMHWVKQRPEQGLEWIGWIDPENGDTEYAPKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCNEDGNYDYWGQGTTLTVSS 88
경쇄 DVVVTQSPASLAVSLGQRATISCKASQSVDYAGDSYMNWYQQKPGQPPKLLIYAASNLESGIPARFSGSGSGTDFTLNIHPVEEEDAATYYCQQSNEDPWTFGGGTKLEIKR 93
M3 중쇄 EVQLLESGGGLVKPGGSLKLSCAASGFTFSSYDMSWVRQTPEKRLDWVASISSSGGTYYPDSVKGRFTISRDIARNILYLQMNSLRSEDTAMYYCVRGDYWGQGTTLTVSS 89
경쇄 DIVMTQSHKFMSASVGDRVNITCKASQDVGTAVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDFTLTISNVQSEDLADYFCQQYTRYSNTFGGGTKLEIKR 94
M4 중쇄 DVMLVESGGDLVKPGGSLKLSCAASGFTFSSRGMSWVRQTPDKRLEWVATISFGDIYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAIYYCVRPNDGYFDYWGQGTTLTVSA 90
경쇄 DIVMTQSHKFMSTSVGDRVSITCKASQDVSTDVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDYTLTINSVQAEDLALYYCQQHYSTPWTFGGGTKLEIKR 95
M5 중쇄 EVKLVESGGDLVKPGGSLKLSCAASGFTFSSRGMSWVRQTPDKRLEWVATISFGDIYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAIYYCARPNDGYFDYWGQGTTLTVSS 91
경쇄 DVVMTQTPKFLLVSAGDRVTITCKASQSVSNDVAWYQQKPGQSPKLLIYYASNRYTGVPDRFTGSGYGTDFTLTINSVQAEDLAVYYCQQSYSAPYTFGGGTKLEMK 96
클론 가변영역 아미노산서열 서열번호
5E9 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFTFTTYDMGWVRQAPGKGPEWVSLISSGGSNTWYDDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK EKYPYSDCDY WGQGTLVTVSS 97
6D9 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFTFTDYDMGWVRQAPGKGPEWVSLISGDSGNTWYDDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK YRGTTKDY WGQGTLVTVSS 98
6H10 중쇄 EVQLVESGGGLVQPGGSLRLSCAASGFTFTNYYMGWVRQAPGKGPEWVSLISYDGSSTWYDDSVKGRFAISRDNSKNTLYLQMNTLRAEDTAVYYCAK PDY WGQGTLVTVSS 99
실험예 3. 항체의 발현 및 정제
항-SARS-CoV-2 scFv는 pCIW로 서브클로닝하여 인간 IgG1 형식으로 전환되었다. Expi293FTM 세포는 30 mL Expi293TM 발현 배지에서 2.5 Х 106 cells/mL 농도로 준비했다(37℃, 8% CO2, 125 rpm, 생존율 ≥ 95%). 이들 세포는 30㎍의 DNA(pCLW-항-SARS-CoV-2 중쇄: 15㎍, pcIw-항-SARS-CoV-2 경쇄: 15㎍), OptiProTM SEM 배지 및 ExpiFectamineTM 293 시약으로 구성된 DNA 혼합물로 형질전환시켰다. 발현된 supernatant에 PBS로 세척된 protein A resin 0.1 mL 넣어준 후 4℃에서 하룻밤 인큐베이션 하였다. 정제용 column에 옮긴 후 IgG binding buffer로 resin의 20배 이상 세척하였다. Elution buffer를 이용하여 결합된 IgG를 용출시켰다. 280 nm wavelength를 이용하여 농도를 측정한 후 취합하였다(도 2).
Desalting column 을 1000 g, 2 min간 원심분리를 하여 보존액을 걸러냈다. PBS buffer를 column의 용량에 맞게 넣어준 후 1000 g, 2 min간 원심분리를 하여 column washing을 3회 반복 하였다. 시료를 넣은 후 1000 g, 2 min 간 원심분리하고 280 nm wavelength를 이용하여 농도를 재측정하였다.
실험예 4. ELISA를 통한 IgG Cross-reactivity 확인
IgG1 형태로 전환에 성공한 클론 29종에 대한 cross-reactivity 측정을 위한 ELISA를 진행하였다. ELISA plate에 항원 3 μg/ml, 50 ㎕를 4℃에서 overnight coating 시켰다. 항원은 Recombinant SARS (1-1190) (Beta Lifescience, BLIT-0210), SARS-CoV-2 (2019-nCoV) Spike Protein (S1+S2 ECD, His tag) (Sino Biological., 40589-V08B1), MERS-CoV Spike Protein (ECD, aa 1-1297, His Tag) (Sino Biological., 40069-V08B)를 사용하였다. 다음날, ELISA plate의 항원를 제거하고 PBS + tween20 0.05%로 3회 washing 하였다. 항원이 코팅 된 각 well에 PBS +BSA 5% 200 ㎕로 상온에서 1시간 blocking 시켜주었다. 1시간 뒤, PBS + tween 20 0.05%로 3회 washing 해준다. 35종 항체 농도는 300 nM로 희석하여 측정하였다. 희석한 항체 50 ㎕를 각 well에 넣고 상온에서 1시간 binding 시켜주었다. 다시 PBS + tween 20 0.05%로 3회 washing 하였다. Anti-human Fc-HRP (3000: 1) 50 ㎕를 각 well에 넣고 상온에서 1시간 incubating 하였다. PBS + tween 20 0.05%로 3회 washing 하였다. TMB solution 50 ㎕를 각 well에 넣어주고 1-15분 incubating 시켰다. stop solution 50 ㎕를 각 well에 넣어 반응을 중단하였다. ELISA reader기로 발색 정도를 측정하였다.
선별된 IgG의 SARS-CoV-2, SARS-CoV, MERS-CoV에 대한 cross-reactivity 실험 결과 두 개 이상의 코로나바이러스에 cross-reactivity를 가지는 클론을 확인하였다(표 4, 도 4).
Clone SARS-CoV-S1S2 SARS-CoV2-S1S2 MERS-CoV-S1S2
2 2.446 2.4908 2.027 2.027 0.0732 0.0721
3 2.4794 2.5186 1.9015 1.8947 0.07 0.0765
4 2.4746 2.5391 1.9973 1.9937 0.0769 0.0719
5 2.481 2.5269 1.9471 1.9842 0.0773 0.0743
6 0.0838 0.081 0.2018 0.1948 0.0816 0.0842
7 0.7374 0.7917 2.2017 2.2618 0.0759 0.0758
8 1.5787 1.6213 2.2563 2.3055 0.0811 0.0743
10 1.4732 1.6543 2.2592 2.322 0.0824 0.0718
11 1.6712 1.7502 2.189 2.243 0.0896 0.0937
12 1.5002 1.5042 2.2436 2.2271 0.0851 0.0862
13 1.5442 1.5971 2.1301 2.2009 0.0763 0.0754
14 1.7089 1.6739 2.3198 2.2674 0.0795 0.0801
15 1.6942 1.6906 2.2577 2.2371 0.0945 0.0899
16 1.6185 1.6898 2.2151 2.2353 0.072 0.0721
17 1.5754 1.6017 2.1343 2.2118 0.0837 0.087
18 1.6126 1.5299 2.1413 2.2009 0.0814 0.0772
20 1.2254 1.2087 2.375 2.3156 0.1114 0.0909
21 1.7254 1.7082 2.3127 2.2976 0.0822 0.0809
28 0.8419 0.8235 2.2509 2.2324 0.0759 0.0736
33 1.589 1.6232 2.081 2.128 0.1097 0.1014
41 1.8776 1.9265 2.2973 2.3247 0.0892 0.0893
5E9 0.2944 0.2779 0.8921 0.9043 0.4069 0.3855
6D9 0.3894 0.3859 0.9972 0.9911 0.4242 0.3948
6H10 0.4795 0.4939 2.0931 2.0575 0.5794 0.5073
M1 0.2098 0.1506 0.9114 0.8545 0.3014 0.2892
M2 0.2735 0.2355 1.2127 1.1994 0.5101 0.53
M3 2.6159 2.6175 2.2611 2.285 0.0799 0.0732
M4 0.1178 0.1186 1.953 1.9824 0.0779 0.0751
M5 0.0773 0.0777 1.9465 1.9842 0.0837 0.0814
huCCM1 ab 0.0689 0.0709 0.1381 0.1178 0.0698 0.0716
구체적으로, ELISA를 통한 cross-reactivity test를 통해 2,3,4,5,7,8,10,11,12,13,14,15,16,17,18,20,21,28,33,41,M3 (21종) 항체는 SARS-CoV1에도 binding (cut-off O.D. 0.5 이상)하는 것을 확인하였다. 또한, 6H10, M3 항체 (2종)는 MERS-CoV에도 binding (cut-off O.D. 0.5 이상)하는 것을 확인하였다. 이 결과를 통해 anti-SARS-CoV2 항체 중 SARS-CoV 또는 MERS-CoV2에도 cross-reactivity를 보이는 클론을 선별할 수 있었다(도 4).
실험예 5. M4와 M5에 대한 키메라 항체(chimeric antibodies)의 제조
마우스 면역 클론 중 M4, M5 클론에 대하여 Humanization을 진행하였다. M4, M5 항체의 framework region 서열은 mouse germline 서열 IGHV5-6 과 IGKV6-32 서열로 각각 identification 되었다. M4, M5 클론은 HCDR 서열은 동일하고, LCDR 은 다르다. Humanization 을 위하여 일반적인 방법인 CDR-grafting 을 이용하였다. M4, M5 와 가장 높은 상동성을 가지는 인간 framework 을 검색하기 위하여 Igblast search 를 진행하였다. 검색 결과 IGHV3-21 과 IGKV1-39와 가장 상동성이 높음을 확인하였고, M4, M5 의 CDR을 인간 항체 뼈대 IGHV3-21 과 IGKV1-39 각각 grafting 시켰다. Grafting 이 후 framework의 변화로 안정성 및 affinity 감소를 최소화 하고자 항체 구조의 안정성과 CDR 의 canonical structure 를 결정하는 중요 역할을 하는 core residue 를 확인 후 추가 돌연변이를 도입하여 variant 를 디자인 하였다 (표 5).
디자인 완료한 M4, M5 항체의 유전자 서열을 합성하여 insert로 사용하였다(서열번호 132번 내지 138번). 합성한 유전자는 infusion cloning 방법으로 클로닝 되었으며 키메라 항체의 배양 및 정제는 이전에 기술된 바와 같이 수행하였다(도 5).
클론 가변영역 아미노산 서열 서열번호
M4-1 중쇄
(H original)		 DVMLVESGGDLVKPGGSLKLSCAASGFTFSSRGMSWVRQTPDKRLEWVATISFGDIYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAIYYCVRPNDGYFDYWGQGTTLTVSA 100
경쇄
(hM4-k2)		 DIVMTQSPATLSVSPGERATLSCKASQDVSTDVAWYQQKPGQAPRLLIYWASTRHTGVPDRFSGSGSGTDFTLTISSLQSEDFAVYYCQQHYSTPWTFGGGTKVEIKR 116
M4-2 중쇄
(H original)		 DVMLVESGGDLVKPGGSLKLSCAASGFTFSSRGMSWVRQTPDKRLEWVATISFGDIYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAIYYCVRPNDGYFDYWGQGTTLTVSA 101
경쇄
(hM4-k3)		 DIVMTQSPATLSVSPGDRVSISCRASQDVSTDVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDYTLTISSLQPEDFAVYYCQQHYSTPWTFGGGTKVEIKR 117
M4-3 중쇄
(H1)		 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSRGMSWVRQAPGKGLEWVSTISFGDIYTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARPNDGYFDYWGQGTLVTVSS 102
경쇄
(4k original)		 DIVMTQSHKFMSTSVGDRVSITCKASQDVSTDVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDYTLTINSVQAEDLALYYCQQHYSTPWTFGGGTKLEIKR 118
M4-4 중쇄
(H1)		 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSRGMSWVRQAPGKGLEWVSTISFGDIYTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARPNDGYFDYWGQGTLVTVSS 103
경쇄
(hM4-k2)		 DIVMTQSPATLSVSPGERATLSCKASQDVSTDVAWYQQKPGQAPRLLIYWASTRHTGVPDRFSGSGSGTDFTLTISSLQSEDFAVYYCQQHYSTPWTFGGGTKVEIKR 119
M4-5 중쇄
(H1)		 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSRGMSWVRQAPGKGLEWVSTISFGDIYTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARPNDGYFDYWGQGTLVTVSS 104
경쇄
(hM4-k3)		 DIVMTQSPATLSVSPGDRVSISCRASQDVSTDVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDYTLTISSLQPEDFAVYYCQQHYSTPWTFGGGTKVEIKR 120
M4-6 중쇄
(H2)		 EVQLVESGGGLVKPGGSLKLSCAASGFTFSSRGMSWVRQAPGKGLEWVATISFGDIYTYYPDSVKGRFTISRDNAKNSLYLQMNSLKAEDTAIYYCARPNDGYFDYWGQGTLVTVSS 105
경쇄
(4k original)		 DIVMTQSHKFMSTSVGDRVSITCKASQDVSTDVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDYTLTINSVQAEDLALYYCQQHYSTPWTFGGGTKLEIKR 121
M4-7 중쇄
(H2)		 EVQLVESGGGLVKPGGSLKLSCAASGFTFSSRGMSWVRQAPGKGLEWVATISFGDIYTYYPDSVKGRFTISRDNAKNSLYLQMNSLKAEDTAIYYCARPNDGYFDYWGQGTLVTVSS 106
경쇄
(hM4-k2)		 DIVMTQSPATLSVSPGERATLSCKASQDVSTDVAWYQQKPGQAPRLLIYWASTRHTGVPDRFSGSGSGTDFTLTISSLQSEDFAVYYCQQHYSTPWTFGGGTKVEIKR 122
M4-8 중쇄
(H2)		 EVQLVESGGGLVKPGGSLKLSCAASGFTFSSRGMSWVRQAPGKGLEWVATISFGDIYTYYPDSVKGRFTISRDNAKNSLYLQMNSLKAEDTAIYYCARPNDGYFDYWGQGTLVTVSS 107
경쇄
(hM4-k3)		 DIVMTQSPATLSVSPGDRVSISCRASQDVSTDVAWYQQKPGQSPKLLIYWASTRHTGVPDRFTGSGSGTDYTLTISSLQPEDFAVYYCQQHYSTPWTFGGGTKVEIKR 123
M5-1 중쇄
(H original)		 EVKLVESGGDLVKPGGSLKLSCAASGFTFSSRGMSWVRQTPDKRLEWVATISFGDIYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAIYYCARPNDGYFDYWGQGTTLTVSS 108
경쇄
(hM5-k1)		 DIQMTQSPSSLSASVGDRVTITCKASQSVSNDVAWYQQKPGKAPKLLIYYASNRYTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSAPYTFGGGTKVEIKR 124
M5-2 중쇄
(H original)		 EVKLVESGGDLVKPGGSLKLSCAASGFTFSSRGMSWVRQTPDKRLEWVATISFGDIYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDTAIYYCARPNDGYFDYWGQGTTLTVSS 109
경쇄
(hM5-k2)		 DVVMTQSPATLSVSPGERATLSCKASQSVSNDVAWYQQKPGQAPRLLIYYASNRYTGVPDRFTGSGSGTDFTLTISSLQSEDFAVYYCQQSYSAPYTFGGGTKVEIKR 125
M5-3 중쇄
(H1)		 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSRGMSWVRQAPGKGLEWVSTISFGDIYTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARPNDGYFDYWGQGTLVTVSS 110
경쇄
(5k original)		 DVVMTQTPKFLLVSAGDRVTITCKASQSVSNDVAWYQQKPGQSPKLLIYYASNRYTGVPDRFTGSGYGTDFTLTINSVQAEDLAVYYCQQSYSAPYTFGGGTKLEMK 126
M5-4 중쇄
(H1)		 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSRGMSWVRQAPGKGLEWVSTISFGDIYTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARPNDGYFDYWGQGTLVTVSS 111
경쇄
(hM5-k1)		 DIQMTQSPSSLSASVGDRVTITCKASQSVSNDVAWYQQKPGKAPKLLIYYASNRYTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSAPYTFGGGTKVEIKR 127
M5-5 중쇄
(H1)		 EVQLVESGGGLVKPGGSLRLSCAASGFTFSSRGMSWVRQAPGKGLEWVSTISFGDIYTYYPDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARPNDGYFDYWGQGTLVTVSS 112
경쇄
(hM5-k2)		 DVVMTQSPATLSVSPGERATLSCKASQSVSNDVAWYQQKPGQAPRLLIYYASNRYTGVPDRFTGSGSGTDFTLTISSLQSEDFAVYYCQQSYSAPYTFGGGTKVEIKR 128
M5-6 중쇄
(H2)		 EVQLVESGGGLVKPGGSLKLSCAASGFTFSSRGMSWVRQAPGKGLEWVATISFGDIYTYYPDSVKGRFTISRDNAKNSLYLQMNSLKAEDTAIYYCARPNDGYFDYWGQGTLVTVSS 113
경쇄
(5k original)		 DVVMTQTPKFLLVSAGDRVTITCKASQSVSNDVAWYQQKPGQSPKLLIYYASNRYTGVPDRFTGSGYGTDFTLTINSVQAEDLAVYYCQQSYSAPYTFGGGTKLEMK 129
M5-7 중쇄
(H2)		 EVQLVESGGGLVKPGGSLKLSCAASGFTFSSRGMSWVRQAPGKGLEWVATISFGDIYTYYPDSVKGRFTISRDNAKNSLYLQMNSLKAEDTAIYYCARPNDGYFDYWGQGTLVTVSS 114
경쇄
(hM5-k1)		 DIQMTQSPSSLSASVGDRVTITCKASQSVSNDVAWYQQKPGKAPKLLIYYASNRYTGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSAPYTFGGGTKVEIKR 130
M5-8 중쇄
(H2)		 EVQLVESGGGLVKPGGSLKLSCAASGFTFSSRGMSWVRQAPGKGLEWVATISFGDIYTYYPDSVKGRFTISRDNAKNSLYLQMNSLKAEDTAIYYCARPNDGYFDYWGQGTLVTVSS 115
경쇄
(hM5-k2)		 DVVMTQSPATLSVSPGERATLSCKASQSVSNDVAWYQQKPGQAPRLLIYYASNRYTGVPDRFTGSGSGTDFTLTISSLQSEDFAVYYCQQSYSAPYTFGGGTKVEIKR 131
실험예 6. Humanized 항체의 Spike protein에 대한 결합력 평가
각각의 humanized 항체가 SARS-CoV2 spike protein에 특이적으로 결합하는지 확인하기 위하여 ELISA를 진행하였다. ELISA plate에 spike protein을 3 μg/ml, 각 well 당 100㎕씩 4℃에 하룻밤 코팅하였다. 다음날, ELISA plate의 spike protein을 제거하고 각 well에 PBS + BSA 2% 200 ㎕로 37℃에서 1시간 blocking 하였다. PBS + tween 20 0.05%로 3회 세척하였다. M4, M5 및 각각의 humanized 항체를 초기 농도(100nM)로부터 PBS로 3배씩 11번 희석하여 최종농도를 0.5pM로 설정한다. 희석한 항체 용액을 100 ㎕를 각 well에 넣고, 37℃에서 1시간 바인딩시켰다. 다시 PBS + tween 20 0.05%로 3회 세척하였다. HRP conjugated anti-Human IgG-Fc antibody (5000:1) 50㎕를 각 well에 넣고 37℃에서 1시간 인큐베이팅 시켰다. PBS + tween 20 0.05%로 4회 세척하였다. TMB solution 50㎕를 각 well에 넣어주고 5분 인큐베이팅 시켰다. Stop solution 50㎕를 각 well에 넣어 반응을 중단하였다. Spike 단백질에 대한 Humanized 클론의 결합력을 평가한 결과 humanization 을 진행한 후에도 모두 기존 M4, M5 수준의 결합력을 유지함을 확인하였다(도 6).
실험예 7. RBD 및 spike protein mutant에 대한 항체의 결합력 평가
M4의 humanized 항체 M4-4와 M5의 humaizaed 항체 M5-4가 RBD, spike protein의 WT뿐만아니라 다양한 mutant에도 결합하는지 확인하기 위해 ELISA를 진행하였다. Mutant는 하기 표 6에 나타낸 9종을 사용하였다.
Mutant 회사 명, 제품번호 Mutant 회사 명, 제품번호
RBD-V367F Sino biologics, 40592-V08H1 RBD-N501Y Sino biologics, 40592-V08H82
RBD-N439K Sino biologics, 40592-V08H14 RBD-A520S Sino biologics, 40592-V08H20
RBD-S477N Sino biologics, 40592-V08H46 RBD-A522S Sino biologics, 40592-V08H21
RBD-T478I Sino biologics, 40592-V08H30 Spike-D614G Sino biologics, 40589-V08B4
RBD-P479S Sino biologics, 40592-V08H57
ELISA plate에 RBD WT 및 mutant들을 각각 3 μg/ml (0.1μM) 100㎕를 4℃에 하룻밤 코팅하였다. Spike protein의 경우 WT 및 mutant를 각각 14ug/ml (0.1 μM) 100㎕를 4℃에 하룻밤 코팅하였다. 다음날, ELISA plate의 WT 및 mutant 를 제거하고 각 well에 PBS + BSA 2% 200 ㎕로 37℃에서 1시간 blocking 하였다. PBS + tween 20 0.05%로 3회 세척하였다. 기존 항체 (S309, REGN 10933+10987 combination)과 M4, M5 및 각각의 humanized 항체를 1nM씩, 100 ㎕를 각 well에 넣고 37℃에서 1시간 바인딩시켰다. 다시 PBS + tween 20 0.05%로 3회 세척하였다. HRP conjugated anti-Human IgG-Fc antibody (5000:1) 50㎕를 각 well에 넣고 37℃에서 1시간 인큐베이팅 시켰다. PBS + tween 20 0.05%로 4회 세척하였다. TMB solution 50㎕를 각 well에 넣어주고 5분 인큐베이팅 시켰다. Stop solution 50㎕를 각 well에 넣어 반응을 중단하였다. Mutant에 대한 M4-4 와 M5-4의 결합력을 평가한 결과, M4-4, M5-4 모두 mutant에 대해 WT RBD 수준 이상의 결합력이 확인되었다. 비교 항체로 사용된 REGN10933와 REGN10987의 경우, 단독으로 처리하였을 때, 각각 Y453F, N439K mutant에 대한 결합력이 50% 이상 감소됨을 확인하였다(도 7).
실험예 8. S 단백질 및 그 변이체에 대한 항체의 결합특성
항-SARS-CoV-2 spike 단백질 항체들이 spike 단백질 및 그 변이체, 알파(영국), 베타(남아프리카) 및 감마(브라질)에 대해 서로 다른 결합특성을 보이는지 확인하기 위하여 항원-항체 결합특성을 확인하였다. 항-S 단백질 항체의 결합 특성 중 동역학은 Biacore T-200 바이오센서(Cytiva)를 사용하여 결정되었다. 항체를 HBS-EP 완충액으로 희석하여 10μg/mL의 농도를 구성하고 SA칩에서 Rmax가 200Ru에 도달할 때까지 10μL/min의 유속으로 고정화하였다. HBS-EP 완충액에 0.3125-20 nM 농도로 희석된 S 단백질을 30 μL/min의 유속으로 결합을 위해 3분 동안, 해리를 위해 30분 동안 항체가 고정화된 SA 칩에 흘려주었다. 다음으로, 10mM 글리신-HCl(pH 1.5)을 30초 동안 반응시켜 항체에 결합된 S 단백질을 세척하였다. Biacore 평가 소프트웨어를 사용하여 항체의 센서그램을 분석하였다. 항원-항체 결합 동역학 측정결과 mouse 항체인 M4 대비 humanized 항체인 M4-4에서 10배 이상 향상된 해리상수 값을 관찰하였다. 이는 비교 항체 REGN10933, REGN10987 대비 약 10배 수준으로 확인되었다(도 8a).
다음으로 알파(영국), 베타(남아프리카) 및 감마(브라질) 변이체의 RBD에 대한 항체의 결합능력을 평가하였다. 이 실험에서는 M4, M4-4, 그리고 비교 항체 (REGN10933, REGN10987 및 REGN mix(REGN10933 + 10987, 1:1 혼합) 항체를 사용하였다. REGN mix는 RBM에 대한 에피토프가 다른 두 항체가 혼합물로 사용될 때 변이체에 대한 작용에서 시너지 효과가 있는지 비교하는데 사용되었다.
RBM-표적 중화 항체인 REGN10933은 원래 RBD 에서와 같이 알파 변이체에 대해 유사한 결합 친화도를 나타냈으나, 베타 및 감마 변이체에서는 REGN10933의 결합이 상당히 감소되었음을 확인하였다. 이와 대조적으로, M4 및 M4-4는 기존 RBD 및 모든 변이체에 대해 유사한 결합 친화도를 나타냈다(도 8b).
이는, 본 발명의 항체가 새로 생성된 SARS-CoV-2 변이체에 결합하는 능력을 유지하고, 다양한 변이 바이러스에 대해서도 결합력을 갖고 중화할 수 있음을 시사하는 것이다.
실험예 9. Pseudovirus 생산
SARS-CoV-2의 전체 길이 스파이크 단백질을 보유하는 슈도바이러스 및 반딧불이 루시퍼라제 리포터 유전자를 보유하는 변이체가 Lenti-X 293T 세포(Takara)에서 생산되었다. 즉, 10 μg의 psPAX2(Addgene), 10 μg의 pLVX-Luciferase 및 10 μg의 SARS-CoV-2 S(코돈 최적화) 발현 플라스미드를 폴리에틸렌이민(질량비 1: 2) Lenti-X 293T 세포에. 형질전환시키고 72시간 후에 상청액을 600xg에서 15분 동안 원심분리한 다음 0.45μm 필터를 통해 여과하고 추가 사용을 위해 -70°C에서 보관하였다. 슈도바이러스 역가는 상대적인 루시페라제 단위를 측정하여 결정하였다.
실험예 10. SARS-CoV-2 pseudovirus를 이용한 중화 분석
ACE2-HEK293 안정 세포주는 10% 소태아 혈청, 항생제-항진균제 칵테일이 포함된 DMEM배지에서 유지되었다. 96-well의 평평한 바닥 플레이트를 10 μg/mL 콜라겐 I으로 코팅하고 5% CO2를 포함하는 대기에서 37°C에서 4시간 동안 인큐베이션하였다. ACE2-HEK293 세포를 DMEM에 현탁하고 1 Х 105 cells/well로 콜라겐 코팅된 96 well 평평한 바닥 플레이트에 분주하여 24시간 동안 배양하였다. 항체는 2% FBS 및 항생제-항진균제 칵테일을 포함하는 DMEM으로 10μg/mL(66.67nM)에서부터 3배 연속희석하였다. 항체 희석액을 슈도바이러스와 1:1로 혼합하고 1시간 동안 5% CO2를 포함하는 대기에서 37°C에서 배양하였다. ACE2-HEK293 세포에서 상층액을 제거하고 50 μL의 항체-슈도바이러스 혼합물로 교체하였다. 이후, 세포를 5% CO2를 포함하는 대기에서 37°C에서 1시간 동안 인큐베이션하였다. 50 μL의 감염 배지를 세포에 첨가하고, 세포를 48시간 동안 5% CO2를 함유하는 대기에서 37°C에서 추가로 인큐베이션하였다. 세포를 5X 리포터 용해 완충액(Promega)으로 용해시키고 루시퍼라제 분석 시스템 및 발광계를 사용하여 상대적 루시퍼라제 활성을 결정하였다. 상대적 루시퍼라제 단위를 중화 퍼센트로 변환하고 Prism Software(GraphPad, Prism 8.0)에 맞는 비선형 회귀 곡선으로 플로팅하였다. 그 결과, M4, M5 chimeric 항체 및 인간화를 거친 후보 항체 M4-4,5,7,8 및 M5-4,5,7,8가 REGN10933와 유사한 수준의 중화능을 보이는 것을 확인하였다 (도 9a,b).
실험예 11. SARS-CoV-2의 스파이크 단백질을 발현하는 세포주의 생성
SARS-CoV-2의 스파이크 단백질(HT1080-S)을 발현하는 안정한 세포주를 생성하기 위해, SARS-CoV-2의 pcDNA3.1-스파이크 cDNA를형질주입하였으며 SARS-CoV-2 S 단백질을 발현하는 세포주는 1.5 mg/mL 제네티신으로 선별하였다. SARS-CoV-2 S 단백질의 발현은 항-SARS-CoV-2 항체인 REGN10933을 사용하여 유세포분석기(FACS LSR Fortessa, BD Biosciences)로 확인하였다(도 10a).
실험예 12. Fc 매개 효과의 측정
항-SARS-CoV-2 항체가 Fc 매개 항체 의존성 포식작용을 보이는지 확인하기 위해 ADCC 및 ADCP 효과를 척정하였다. ADCC 분석의 경우, HT1080-S 세포가 target cell로 사용되고 Jurkat-NFAT-Luc/FcγRIIIa가 effector cell로 사용되었다. HT1080-S 세포를 적절한 배지에 18시간 배양하고 ADCC assay 완충용액을 첨가하였다. 그 후, 항체를 희석하여 청가하고 15분간 반응시켰다. Effector cell을 추가하여 18시간 배양한 후, Bio-Glo luciferase assay 시약을 첨가하고 제조사의 지시에 따라 발광성을 측정하였다. 측정된 luminescence 값을 Prism software (Graphpad)를 사용하여 nonlinear regression curve를 그리고 EC50 값을 얻었다. ADCP 분석 역시 이전 기술 내용과 동일하게 측정하였다. 측정 결과, M4, M5 chimeric 항체 및 인간화를 거친 후보 항체 M4-4,5,7,8 및 M5-4,5,7,8가 Reference 항체 (REGN10987, REGN mix)와 유사한 수준의 ADCC 효능을 보이는 것을 확인하였다(도 10b). ADCC 효과뿐만 아니라, M4-4는 단일 Regeneron 항체 또는 Regeneron 항체 칵테일에 필적하는 ADCP 활성을 유도함을 추가적으로 확인하였다(도 10c). 종합하면, 도 10의 데이터는 M4-4가 최대 치료 효능을 매개하기 위해 Fc 매개 항체 효과 기능인 ADCC 및 ADCP를 유도할 가능성이 있음을 보여주었다 (도 10b,c).
실험예 13. SARS-CoV-2 spike 단백질 변이체에 대한 중화능 측정
SARS-CoV-2 스파이크 변이체, 알파(영국), 베타(남아프리카) 및 감마(브라질)에 대한 M4-4의 중화 효능을 평가하기 위해 각 SARS-CoV-2 spike variant를 발현하는 렌티바이러스 시스템을 사용하여 pseudovirus neutralization assays을 수행하였다. M4 및 M4-4는 REGN10987 또는 Regeneron 칵테일(mix)에 필적하는 중화 효능으로 3개의 변이형 바이러스를 중화할 수 있음을 확인하였다. REGN10933은 고농도의 세포에서 베타 또는 감마 변이형 슈도바이러스 감염의 100% 중화를 매개하지 못했다 (도 11).
종합하면, 인간화 SARS-CoV-2 항체인 M4-4는 WT 및 선택된 스파이크 돌연변이 SARS-CoV-2 슈도바이러스 입자를 중화시킬 수 있으며, 중화 효능은 Regeneron 칵테일과 유사함을 확인하였다 (도 11).
실험예 14. 에피토프(epitope) 비닝(binning)
에피토프 비닝은 BLI 시스템(Octet Qke)을 사용하여 3단계로 수행되었다. 단계 1은 항원 고정화를 수반하고; 2단계는 1차 항체 결합을 포함하고, 단계 3은 2차 항체 결합을 포함하였다. 각 단계 사이에 60초의 기준 단계를 설정하여 기준선 신호를 확인하였다. 1단계에서 20μg/mL 정제된 재조합 SARS-CoV-2 스파이크 단백질 또는 RBD His를 1000rpm에서 200초 동안 미리 수화된 안티펜타-His 바이오센서에 고정화하였다. 2단계에서 37.5μg/mL의 서로 다른 1차 결합 Ab가 300초 동안 결합되었다. 3단계에서는 2차 항체 1종(18.75μg/mL)을 150초 동안 결합하여 자가 결합 및 경쟁 정도를 확인하였다. 경쟁의 정도는 백분율로 정의하였다. 고정된 항원에 2차 항체만 결합한 경우를 100%로 정의하였다. 33% 미만의 결합 수준은 완전한 경쟁으로 정의되었으며, 33%와 66% 사이의 수준은 중간 경쟁으로 정의되었으며, 66% 이상의 수준은 비경쟁으로 정의하였다. 비닝 결과 M4-4는 REG10987과 S309의 에프토프와 100% 경쟁하며 부분적으로 REGN10933의 에피토프와도 경쟁함을 확인하였다. 반면, REGN10987과 S309는 REGN10933과 비경쟁 에피토프를 가지는 것으로 관찰되었다(도 12).
이는 M4-4가 REGN10933, REGN10987, S309 대비 더 넓은 영역의 에피토프에 결합할 수 있음을 시사하는 것이다.
더불어, ACE2 수용체의 경쟁적 결합을 확인하기 위해 유사한 실험을 수행하였다. 차이점은 재조합 인간 ACE2 수용체와 재조합 SARS-CoV-2 스파이크 단백질 RBD의 결합 친화도가 mAb와 RBD 사이의 친화도에 비해 약 10-100이라는 것이다. 이에, ACE2 수용체는 2차 항체 결합과 관련된 단계 3에만 사용하였다. M4-4는 ACE2 수용체와도 100% 경쟁하는 것으로 관찰하였다. 이를 통해 M4-4가 ACE2 수용체에 대한 항원의 결합을 100% 방해할 수 있음이 확인되었다 (도 12).
실험예 15. Simulation docking
Schrodinger Suite 내의 BioLuminate는 각각 중쇄 및 경쇄에 대한 템플릿으로 항-PD1(PDB 코드: 6JJP) 및 항-SIRPα 항체(PDB 코드: 6 NMR)의 구조를 사용하여 M4-4의 scFv 상동성 모델링에 사용하였다. M4-4의 scFv 구조를 RBD(PDB 코드: 6M0J)에 도킹하는 것은 BioLuminate56에서 PIPER를 사용하여 수행하였다. RBD 및 CDR 루프의 Lys440과 Thr500 사이의 거리는 에피토프 비닝(binning) 결과를 기반으로 2Å에서 10Å 사이로 제한하였다. BioLuminate는 70,000개의 가능한 단백질-단백질 구성을 가진 30개의 최상의 복합체를 제안하였다. M4-4에 대한 최종 복합체는 클러스터 크기 및 에피토프 비닝 결과와의 일치에 따라 선택하였으며, 이후 에너지 최소화를 수행하였다. Simulation docking 결과로 예측된 RBD에 대한 M4-4의 결합부위는 REGN10933, REGN10987, S309 그리고 ACE2 수용체의 결합을 모두 방해할 수 있는 위치로 나타났다. 이는 비닝 결과와 연결되는 결과로 M4-4의 에피토프를 예측해볼 수 있었다 (도 13).
이상의 설명으로부터, 본 발명이 속하는 기술 분야의 당업자는 본 발명이 그 기술적 사상이나 필수적 특징을 변경하지 않고서 다른 구체적인 형태로 실시될 수 있다는 것을 이해할 수 있을 것이다. 이와 관련하여, 이상에서 기술한 실시 예들은 모든 면에서 예시적인 것이며 한정적인 것이 아닌 것으로서 이해해야만 한다. 본 발명의 범위는 상기 상세한 설명보다는 후술하는 특허 청구범위의 의미 및 범위 그리고 그 등가 개념으로부터 도출되는 모든 변경 또는 변형된 형태가 본 발명의 범위에 포함되는 것으로 해석되어야 한다.

Claims (17)

  1. 코로나바이러스 스파이크 단백질에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편.
  2. 제1항에 있어서,
    상기 항체 또는 이의 항원 결합 단편은 서열번호 5 내지 45, 서열번호 87 내지 91, 서열번호 97 내지 115 중 어느 하나의 서열을 포함하는 군으로부터 선택되는 어느 하나 이상의 중쇄 가변영역; 및 서열번호 46 내지 86, 서열번호 92 내지 96, 및 서열번호 116 내지 131 중 어느 하나의 서열을 포함하는 군으로부터 선택되는 어느 하나 이상의 경쇄 가변영역을 포함하는 것인, 항체 또는 이의 항원 결합 단편.
  3. 제1항에 있어서,
    상기 항체 또는 이의 항원 결합 단편은 서열번호 87 내지 91, 및 서열번호 100 내지 115 중 어느 하나의 서열을 포함하는 군으로부터 선택되는 어느 하나 이상의 중쇄 가변영역; 및 서열번호 92 내지 96 및 서열번호 116 내지 131 중 어느 하나의 서열을 포함하는 군으로부터 선택되는 어느 하나 이상의 경쇄 가변영역을 포함하는 것인, 항체 또는 이의 항원 결합 단편.
  4. 제1항에 있어서,
    상기 코로나바이러스는 SARS-CoV, SARS-CoV-2 또는 MERS-CoV인, 항체 또는 이의 항원 결합 단편.
  5. 제1항에 있어서,
    상기 항체 또는 이의 항원 결합 단편은 2종 이상의 코로나바이러스에 교차반응을 가지는 것인, 항체 또는 이의 항원 결합 단편.
  6. 제5항에 있어서,
    상기 2종 이상의 코로나바이러스에 교차반응을 가지는 항체 또는 이의 항원 결합 단편은 서열번호 6 내지 12, 서열번호 14 내지 22, 서열번호 24, 25, 32, 37, 45, 서열번호 87 내지 91, 및 서열번호 97 내지 99 중 어느 하나의 서열을 포함하는 군으로부터 선택되는 어느 하나 이상의 중쇄 가변영역; 및 서열번호 47 내지 53, 서열번호 55 내지 63, 서열번호 65, 66, 73, 78, 86, 및 서열번호 92 내지 96, 중 어느 하나의 서열을 포함하는 군으로부터 선택되는 어느 하나 이상의 경쇄 가변영역을 포함하는 것인, 항체 또는 이의 항원 결합 단편.
  7. 제1항에 있어서,
    상기 항체 또는 이의 항원 결합 단편은
    서열번호 139의 중쇄 CDR1; 서열번호 140의 중쇄 CDR2; 및 서열번호 141의 중쇄 CDR3을 포함하는 중쇄 가변영역 및
    서열번호 142 또는 145의 경쇄 CDR1; 서열번호 143 또는 146의 경쇄 CDR2; 및 서열번호 144 또는 147의 경쇄 CDR3을 포함하는 경쇄 가변영역을 포함하는 것인, 항체 또는 이의 항원 결합 단편.
  8. 제1항에 있어서,
    상기 중쇄 가변영역은 서열번호 103의 아미노산 서열로 이루어지고;
    상기 경쇄 가변영역은 서열번호 119의 아미노산 서열로 이루어진 것인, 항체 또는 이의 항원 결합 단편.
  9. 제1항 내지 제8항 중 어느 한 항의 항체 또는 이의 항원 결합 단편을 코딩하는 폴리뉴클레오티드.
  10. 제9항의 폴리뉴클레오티드를 포함하는 발현 벡터.
  11. 제10항의 발현 벡터가 도입된 형질전환체.
  12. 제1항 내지 제8항 중 어느 한 항의 항체 또는 이의 항원 결합 단편을 포함하는, 코로나바이러스 감염증의 예방 또는 치료용 약학 조성물.
  13. 제1항 내지 제8항 중 어느 한 항의 항체 또는 이의 항원 결합 단편을 인간을 제외한 개체에 투여하는 단계를 포함하는, 코로나바이러스 감염증의 예방 또는 치료 방법.
  14. 제1항 내지 제8항 중 어느 한 항의 항체 또는 이의 항원 결합 단편에 약물이 결합된, 항체-약물 결합체.
  15. 제1항 내지 제8항 중 어느 한 항의 항체 또는 이의 항원 결합 단편을 포함하는, 코로나바이러스 감염 진단용 조성물.
  16. 제15항의 조성물을 포함하는, 코로나바이러스 감염 진단용 키트.
  17. 제1항 내지 제8항 중 어느 한 항의 항체 또는 이의 항원 결합 단편; 또는 이를 포함하는 감염 진단용 조성물; 또는 상기 조성물을 포함하는 키트를 이용하여, 코로나바이러스 감염 의심 개체로부터 분리된 생물학적 시료에 존재하는 코로나바이러스를 검출하는 단계를 포함하는, 코로나바이러스 감염 진단을 위한 정보제공방법.
PCT/KR2021/016073 2020-11-06 2021-11-05 코로나바이러스 스파이크 단백질에 특이적인 항체 및 이의 용도 WO2022098173A1 (ko)

Priority Applications (4)

Application Number Priority Date Filing Date Title
JP2023524972A JP2023547167A (ja) 2020-11-06 2021-11-05 コロナウイルススパイクタンパク質に特異的な抗体及びその用途
US18/035,235 US20230417748A1 (en) 2020-11-06 2021-11-05 Coronavirus Spike Protein-Specific Antibody and Use Thereof
CN202180074379.9A CN117098773A (zh) 2020-11-06 2021-11-05 特异于冠状病毒刺突蛋白的抗体及其用途
EP21889638.9A EP4242224A1 (en) 2020-11-06 2021-11-05 Antibody specific to coronavirus spike protein and use thereof

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR20200148064 2020-11-06
KR10-2020-0148064 2020-11-06
KR20210042796 2021-04-01
KR10-2021-0042796 2021-04-01

Publications (1)

Publication Number Publication Date
WO2022098173A1 true WO2022098173A1 (ko) 2022-05-12

Family

ID=81457320

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/016073 WO2022098173A1 (ko) 2020-11-06 2021-11-05 코로나바이러스 스파이크 단백질에 특이적인 항체 및 이의 용도

Country Status (5)

Country Link
US (1) US20230417748A1 (ko)
EP (1) EP4242224A1 (ko)
JP (1) JP2023547167A (ko)
KR (1) KR20220061903A (ko)
WO (1) WO2022098173A1 (ko)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101895228B1 (ko) * 2017-08-23 2018-10-30 대한민국 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 대한 단일클론항체 및 이의 용도
CN111366734A (zh) * 2020-03-20 2020-07-03 广州市康润生物科技有限公司 双指标筛选新冠病毒及预判重型肺炎的方法
CN111592594A (zh) * 2020-03-13 2020-08-28 北京大学 一种抗新型冠状病毒的单克隆抗体及其应用
US10787501B1 (en) * 2020-04-02 2020-09-29 Regeneron Pharmaceuticals, Inc. Anti-SARS-CoV-2-spike glycoprotein antibodies and antigen-binding fragments
CN111727199A (zh) * 2018-01-31 2020-09-29 赛特瑞恩股份有限公司 针对中东呼吸综合征-冠状病毒具有中和活性的结合分子

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101895228B1 (ko) * 2017-08-23 2018-10-30 대한민국 중동호흡기증후군 코로나바이러스의 스파이크 단백질에 대한 단일클론항체 및 이의 용도
CN111727199A (zh) * 2018-01-31 2020-09-29 赛特瑞恩股份有限公司 针对中东呼吸综合征-冠状病毒具有中和活性的结合分子
CN111592594A (zh) * 2020-03-13 2020-08-28 北京大学 一种抗新型冠状病毒的单克隆抗体及其应用
CN111366734A (zh) * 2020-03-20 2020-07-03 广州市康润生物科技有限公司 双指标筛选新冠病毒及预判重型肺炎的方法
US10787501B1 (en) * 2020-04-02 2020-09-29 Regeneron Pharmaceuticals, Inc. Anti-SARS-CoV-2-spike glycoprotein antibodies and antigen-binding fragments

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
ANTIVIRAL RES., vol. 101, pages 45 - 56
KOEHERMILSTEIN, NATURE, vol. 256, 1976, pages 495

Also Published As

Publication number Publication date
KR20220061903A (ko) 2022-05-13
EP4242224A1 (en) 2023-09-13
JP2023547167A (ja) 2023-11-09
US20230417748A1 (en) 2023-12-28

Similar Documents

Publication Publication Date Title
WO2020111913A1 (en) Anti-4-1bb antibody and use thereof
WO2022050709A1 (ko) 사스-코로나바이러스-2 표면의 스파이크 단백질에 결합하는 사스-코로나바이러스 감염증의 진단용 결합 분자
JP2022106950A (ja) モノクローナル抗ＩＬ－１ＲＡｃＰ抗体
WO2019098682A1 (ko) 항-her2 항체 또는 그의 항원 결합 단편, 및 이를 포함하는 키메라 항원 수용체
AU2019229076A1 (en) Anti-TIGIT antibodies and uses thereof
WO2017164678A2 (ko) 중증열성혈소판감소증후군 바이러스의 외막 당단백질에 결합하는 항체 및 이의 용도
WO2014077648A1 (ko) 인간 및 마우스 ｌ１ｃａｍ 단백질에 특이적으로 결합하는 항체 및 이의 용도
WO2016085289A1 (ko) B형 간염 바이러스의 pres1에 특이적으로 결합하는 항체 및 이의 용도
WO2020116963A1 (ko) 엔도텔린 수용체 a 활성 조절 항체
WO2022098173A1 (ko) 코로나바이러스 스파이크 단백질에 특이적인 항체 및 이의 용도
WO2020004934A1 (ko) 항-bcma 항체 및 그 용도
WO2022216014A1 (ko) 항-cntn4 항체 및 그의 용도
WO2016084993A1 (ko) 신규 EGFRvIII 항체 및 이를 포함하는 조성물
WO2022154288A1 (ko) 단백질 키나아제 a의 촉매 서브 유닛 알파에 특이적으로 결합하는 단일클론항체 및 이를 활용한 암 진단 용도
WO2022131889A1 (ko) Taci 단백질의 용도
WO2014021693A2 (ko) Tm4sf5 단백질에 특이적으로 결합하는 신규한 단일클론항체 및 이의 용도
WO2017179862A1 (ko) 안정성이 개선된 ｈｅｒ２에 특이적으로 결합하는 항체
WO2020159229A1 (ko) Ccsp-2에 특이적으로 결합하는 단일클론항체 및 이의 용도
WO2019151632A1 (ko) 중동호흡기증후군 코로나바이러스에 중화활성을 갖는 결합 분자
WO2020141869A1 (ko) Icam-1에 특이적으로 결합하는 항체 및 그의 용도
WO2022265264A1 (ko) B형 간염바이러스 pres1항원의 간세포 수용체 결합부위에 특이적으로 결합하는 인간 항체 및 이의 용도
WO2023038477A1 (ko) 코로나바이러스 뉴클레오캡시드 단백질에 특이적인 항체 및 이의 용도
WO2017142294A1 (ko) EGFRvIII에 대한 항체 및 이의 용도
WO2023234748A1 (ko) 항-tigit 항체 및 이의 용도
WO2022092644A1 (ko) Wars 중화항체 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21889638

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2023524972

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 202180074379.9

Country of ref document: CN

WWE Wipo information: entry into national phase

Ref document number: 18035235

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021889638

Country of ref document: EP

Effective date: 20230606