WO2020116963A1 - 엔도텔린 수용체 a 활성 조절 항체 - Google Patents

엔도텔린 수용체 a 활성 조절 항체 Download PDF

Info

Publication number
WO2020116963A1
WO2020116963A1 PCT/KR2019/017110 KR2019017110W WO2020116963A1 WO 2020116963 A1 WO2020116963 A1 WO 2020116963A1 KR 2019017110 W KR2019017110 W KR 2019017110W WO 2020116963 A1 WO2020116963 A1 WO 2020116963A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
fragment
monoclonal antibody
amino acid
Prior art date
Application number
PCT/KR2019/017110
Other languages
English (en)
French (fr)
Inventor
정상택
유연규
주만석
나정현
김연재
안혜미
고병준
이원규
Original Assignee
주식회사 헤지호그
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020190159941A external-priority patent/KR102335799B1/ko
Application filed by 주식회사 헤지호그 filed Critical 주식회사 헤지호그
Priority to US17/311,537 priority Critical patent/US20220153831A1/en
Priority to CN201980090955.1A priority patent/CN113412280A/zh
Priority to EP19893847.4A priority patent/EP3892636A4/en
Priority to JP2021532324A priority patent/JP7315256B2/ja
Publication of WO2020116963A1 publication Critical patent/WO2020116963A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00—Drugs for disorders of the cardiovascular system
    • A61P9/12—Antihypertensives
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2869—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against hormone receptors
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention relates to an antibody that modulates the activity of ET A by effectively inhibiting binding between ET-1 (endothelin-1) and ET A by increasing the binding ability to ET A (endothelin receptor type A).
  • GPCR G-protein coupled receptor
  • ET A endothelin receptor type A
  • ET-1 endothelin-1
  • drugs such as endothelin receptor antagonist Bosentan have been used as a treatment for hypertension (Nature reviews drug discovery, 2011, Vol. 10, 47).
  • ET A is overexpressed in various cancers such as bladder cancer, lung cancer, ovarian cancer, kidney cancer, colon cancer, prostate cancer, breast cancer, uterine cancer, rhabdomyosarcoma, glioblastoma, and proliferation of cancer cells. It has been reported to decrease the survival rate of patients by directly participating in major cancer processes such as migration, penetration, metastasis, and angiogenesis (Nature review cancer, 2013, Vol. 13, 637).
  • Antibody drug despite the advantages such as high specificity, low side-effects, high serum half-life, the mechanism acting defect Apoptosis by the Fc region compared to the low-molecular-weight synthetic pharmaceuticals (ADCC, ADCP, CDC) and drugs that target the ET A existing are Bosentan , Zibotentan, Atrasentan, and other low-molecular weight compounds have not been reported.
  • Antibody drugs that have been approved for sale are very rare even when expanded to GPCRs.
  • Poteligeo Moteligeo (Mogamulizumab) from Kyowa Hakko Kirin, which targets CCR4, has been approved in Japan.
  • Aimovig (Erenumab), which targets the CGRP receptor developed by Amgen, was the first GPCR target antibody to receive US FDA approval. Therefore, there is a need to discover new antibodies that specifically bind to ET A and regulate its activity. In addition, in order to develop a new antibody drug for a GPCR target, it must first specifically bind to the extracellular domain (ECD) of the antigen, and the proportion of the extracellular portion of the total surface area of the GPCR is very limited to about 10%. Because of this, there is a limit to the existing strategies for discovering antibodies.
  • ECD extracellular domain
  • the present inventors made great efforts to discover new antibodies that specifically bind to ET A and inhibit the signal transduction process. As a result, the present inventors completed the present invention by finding an antibody that effectively inhibits ET-1 signaling in a cell line stably expressing ET A.
  • an object of the present invention is to provide an endothelin receptor type A (Endothelin receptor type A) or an extracellular domain thereof as an antigen and provides a monoclonal antibody or fragment thereof that specifically binds to it.
  • Endothelin receptor type A Endothelin receptor type A
  • Another object of the present invention is to provide a nucleic acid molecule encoding the monoclonal antibody or fragment thereof.
  • Another object of the present invention is to provide a vector containing the nucleic acid molecule.
  • Another object of the present invention is to provide a host cell comprising the vector.
  • Another object of the present invention is to provide a pharmaceutical composition for preventing or treating cancer or hypertension, including the monoclonal antibody, nucleic acid molecule or vector.
  • Another object of the present invention is to provide a method for treating cancer or hypertension, comprising administering a pharmaceutically effective amount of the monoclonal antibody, nucleic acid molecule, or vector to a subject.
  • Another object of the present invention is to provide a use of the monoclonal antibody or fragment thereof, nucleic acid molecule or vector for the manufacture of a pharmaceutical composition for the treatment of cancer or hypertension.
  • Another object of the present invention is to provide a method for quantifying endothelin receptor type A (Endothelin receptor type A) contained in a sample, comprising the step of processing the monoclonal antibody or fragment thereof.
  • Another object of the present invention is to provide a method for providing information for diagnosing a disease by overexpression of endothelin receptor type A.
  • Another object of the present invention is to provide an endothelin receptor type A (Endothelin receptor type A) quantification kit comprising the monoclonal antibody or a fragment thereof.
  • the present invention provides a monoclonal antibody or fragment thereof that specifically binds to an endothelin receptor type A (Endothelin receptor type A) or an extracellular domain thereof as an antigen.
  • Endothelin receptor type A Endothelin receptor type A
  • the Entothelin receptor A is responsible for the intracellular signaling process by the binding of the ligand ET-1 (endothelin-1), and has been spotlighted as a therapeutic agent for hypertension and a major anti-cancer target substance, but is a drug that targets ET A
  • ET-1 endothelin-1
  • antigen refers to any natural or synthetic immunogenic material, such as proteins, peptides or haptens.
  • the antigen can be ET A or a fragment thereof (eg, an extracellular domain).
  • epitope disclosed herein is a term in the art and refers to a local region of an antigen to which an antibody can specifically bind.
  • an epitope can be contiguous amino acids of a polypeptide (linear or contiguous epitope) or an epitope can be joined together from two or more non-contiguous regions of a polypeptide or polypeptides (stereoscopic, non-linear, discontinuous, Or non-contiguous epitope).
  • Epitopes formed from adjacent amino acids are not always, but typically retained upon exposure to denaturing solvents, but epitopes formed by tertiary folding are typically lost upon treatment with denaturing solvents.
  • Epitopes typically include at least 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or 20 amino acids in a unique spatial conformation.
  • Methods for determining how epitopes are bound by a given antibody i.e., epitope mapping
  • epitope mapping include, for example, immunoblotting and immunoprecipitation assays, wherein overlapping or contiguous peptides are used herein. (E.g., from ET A ) is tested for reactivity with a given antibody (e.g., anti-ET A antibody).
  • Methods for determining the spatial conformation of epitopes include those described in the art and those presented herein, such as x-ray crystallography, two-dimensional nuclear magnetic resonance and FIDX-MS (e.g., Epitope Mapping Protocols) in Methods in Molecular Biology, Vol. 66, GE Morris, Ed. (1996)).
  • the epitope to which the antibody binds is, for example, NMR spectroscopy, x-ray diffraction crystallography studies, ELISA analysis, hydrogen/deuterium exchange combined with mass spectrometry (e.g., liquid chromatography electrospray mass spectrometry). , Array-based oligopeptide scanning analysis and/or mutagenesis mapping (eg, site-directed mutagenesis mapping).
  • crystallization can be achieved using any of the methods known in the art (e.g., Giege R et al, (1994) Acta Crystallogr D Biol Crystallogr 50 (Pt 4): 339- 350; McPherson A (1990) Eur J Biochem 189: 1-23; Chayen E (1997) Structure 5: 1269-1274; McPherson A (1976) J Biol Chem 251: 6300-6303).
  • Antibodies Antigen crystals can be studied using well-known x-ray diffraction techniques, distributed by X-PLOR (Yale University, 1992, Molecular Simulations, Inc.; e.g.
  • epitopope mapping refers to the process of identifying molecular determinants for antibody-antigen recognition.
  • the term "binds to the same epitope" with respect to two or more antibodies means that the antibodies bind to the same segment of amino acid residues as determined by a given method.
  • Techniques for determining whether an antibody binds to the same epitope on ET A as an antibody provided herein include, for example, epitope mapping methods, such as x for antigen:antibody complex determinations that provide atomic resolution of the epitope. -Including linear analysis and hydrogen/deuterium exchange mass spectrometry (HDX-MS). Another method monitors the binding of an antibody to an antigenic fragment or mutated variant of an antigen, in which case loss of binding due to modification of amino acid residues within the antigen sequence is primarily considered as a sign of the epitope component.
  • a computer combinatorial method for epitope mapping can be used. These methods rely on the ability of the antibody of interest to affinity isolate a particular short peptide from a combinatorial phage display peptide library. Antibodies with identical VH and VL or identical CDR1, 2 and 3 sequences are expected to bind the same epitope.
  • an antibody that "competites with another antibody for binding to a target” refers to an antibody that inhibits (partially or completely) binding of the target to the rest of the antibody. Whether the two antibodies compete with each other for binding to the target, ie whether one antibody inhibits the binding of the other antibody to the target, and to what extent, can be determined using known competition experiments. In certain embodiments, the antibody competes for binding of the target with another antibody, and the binding of the target with the other antibody is at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, It is suppressed by 90% or 100%. The level of inhibition or competition may differ depending on whether the antibody is a “blocking antibody” (ie, a refrigerated antibody that is first incubated with the target).
  • Bispecific or “bifunctional” antibodies are artificial hybrid antibodies with two different heavy/light chain pairs and two different binding sites. Bispecific antibodies can be generated by several methods, including fusion of hybridomas or binding of Fab' fragments (e.g., Songsivilai & Lachmann, Clin. Exp. Immunol. 79:315-321 (1990) ; Kostelny et al, J. Immunol. 148, 1547-1553 (1992)).
  • a human monoclonal antibody refers to an antibody that exhibits single binding specificity and affinity for a particular epitope, or a combination of antibodies where all antibodies exhibit single binding specificity and affinity for a specific epitope.
  • the term “human monoclonal antibody” refers to an antibody or antibody composition that exhibits single binding specificity and has variable and selective constant regions derived from human dotted immunoglobulin sequences.
  • a human monoclonal antibody comprises a B cell obtained from a transgenic non-human animal having a genome comprising a human heavy chain transgene and a light chain transgen fused to immortalized cells, e.g., a transgenic mouse. It is produced by hybridomas.
  • “Recombinant human antibody” as provided herein includes any human antibody produced, expressed, produced or isolated by recombinant means, such as (a) an animal that is transgenic or transchromosomal to a human immunoglobulin gene (eg (E.g., mouse) or an antibody isolated from a hybridoma prepared therefrom, (b) an antibody isolated from a host cell transformed to express the antibody, e.g., an antibody isolated from a transfectoma, (c) a recombinant, combinatorial human antibody Antibodies isolated from libraries, and (d) antibodies prepared, expressed, produced, or isolated by any other means involving splicing of human immunoglobulin gene sequences and other DNA sequences.
  • recombinant means such as (a) an animal that is transgenic or transchromosomal to a human immunoglobulin gene (eg (E.g., mouse) or an antibody isolated from a hybridoma prepared therefrom, (b) an antibody isolated from a host cell transformed to express the
  • variable and constant regions which utilize specific human dotline immunoglobulin sequences encoded by dotline genes, but include subsequent rearrangements and mutations, for example, that occur during antibody maturation.
  • the variable region contains an antigen binding domain and rearranged to form antibodies specific to foreign antigens. It is encoded by various genes.
  • the variable region can be further modified by a number of single amino acid changes (somatic mutation or hypermutation) to increase the affinity of the antibody for foreign antigens.
  • the constant region will change in further response to the antigen (ie, isotype switch).
  • nucleic acid molecules encoding light and heavy chain immunoglobulin polypeptides in response to antigens may not have sequence identity with the parent nucleic acid molecule, but instead will be substantially identical or similar (i.e., at least 80 % Identity).
  • a “human” antibody refers to an antibody whose framework and CDR regions both have variable regions derived from human dotted immunoglobulin sequences.
  • the constant region is also derived from a human dotted line immunoglobulin sequence.
  • Antibodies disclosed herein can include amino acid residues that are not encoded by human dotted immunoglobulin sequences (e.g., introduced by random or site-specific mutagenesis in vitro or by somatic cell mutation in vivo). Mutation).
  • the “human antibody” disclosed herein does not include antibodies in which CDR sequences derived from the dotted lines of other mammalian species, such as mice, have been grafted onto human framework sequences.
  • the terms "human” antibody and "fully human” antibody are used as synonyms.
  • “Humanized” antibody refers to an antibody in which some, most, or all of the amino acids outside the CDR domains of non-human antibodies have been replaced with corresponding amino acids derived from human immunoglobulins. In one embodiment of the humanized form of the antibody, some, most or all of the amino acids outside of the CDR domains have been replaced with amino acids from human immunoglobulins, and some, most or all of the amino acids in one or more CDR regions remain the same. . Small additions, deletions, insertions, substitutions or modifications of amino acids can be tolerated as long as the antibody does not destroy its ability to bind to a particular antigen. "Humanized” antibodies retain antigen specificity similar to the parent antibody.
  • Chimeric antibody refers to an antibody in which the variable region is derived from one species and the constant region is derived from another species, such as an antibody in which the variable region is derived from a mouse antibody and the constant region is derived from a human antibody.
  • cross-react refers to the ability of the antibodies presented herein to bind ET A from different species.
  • an antibody that binds human ET A can also bind other species of ET A (eg, mouse ET A ).
  • Cross reactivity can be measured by detecting specific reactivity with purified antigens in binding assays (e.g., SPR, ELISA), or by detecting binding or other functional interactions to cells that physiologically express ET A. have.
  • Methods for determining cross reactivity include standard binding assays presented herein, e.g., BIACORE surface plasmon resonance (SPR) analysis using a BIACORE 2000 SPR instrument (Biacore AB, Uppsala, Sweden), or flow cytometry techniques.
  • SPR surface plasmon resonance
  • the antibody or fragment thereof of the present invention specifically recognizes and binds to the extracellular region of GPCR (eg, Entothelin Receptor A) as an antigen.
  • the extracellular region of GPCR is 1 N-term and 3 ECL (ECL1, ECL2 and ECL3), which can specifically bind to at least one extracellular site selected from the group consisting of the N-term, ECL1, ECL2 and ECL3 as an epitope, wherein the epitope is 1 or It may contain more amino acids.
  • the Entothelin receptor A comprises the amino acid sequence of SEQ ID NO:68.
  • the extracellular region is composed of the N-term region of SEQ ID NO: 69, ECL1 of SEQ ID NO: 70, ECL2 of SEQ ID NO: 71, and ECL3 of SEQ ID NO: 72 It is one or more sites selected from the group.
  • the term “antibody” may be any type of antibody of an immunoglobulin molecule (eg, IgG, IgE, IgM, IgD, IgA, or IgY), and any subtype of antibody (eg, human For IgG1, IgG2, IgG3, and IgG4; and for mice, IgG1, IgG2a, IgG2b, and IgG3).
  • Immunoglobulins eg, IgG1 can have a variety of allotypes (allotypes), and the term “antibody” herein includes commonly known isotypes and allotypes.
  • the term “antibody” in the present specification may be IgG1, IgG2, IgG3, or IgG4, or may be a hybrid type thereof (for example, hybrid of IgG2 and IgG4).
  • monoclonal antibody or “monoclonal antibody” as used herein refers to an antibody that exhibits single binding specificity and affinity for a specific epitope.
  • fragment refers to one or more fragments of an antibody that possess the ability to specifically bind antigen.
  • fragments may be, for example, about 8 to about 1500 amino acids long, suitably about 8 to about 745 amino acids long, about 8 to about 300 amino acids, about 8 to about 200 amino acids, or about 10 to about 50 amino acids long. It is a dog or 100 amino acids long. It has been found that the antigen-binding function of antibodies is performed by fragments of full-length antibodies.
  • binding fragments included in the term “antigen-binding fragment” of an antibody include (i) a Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CH1 domains; (ii) F(ab')2 fragment, a divalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting of the VH and CH1 domains; (iv) an Fv fragment consisting of the VL and VH domains of one arm of the antibody, and a disulfide-linked Fv (sdFv); (v) dAb fragments consisting of VH domains (Ward et al, (1989) Nature 341: 544-546) and (vi) two that can be selectively linked by isolated complementarity determining regions (CDR) or (vii) synthetic linkers It includes a combination of the above isolated CDR.
  • CDR complementarity determining regions
  • VL and VH two domains of the Fv fragment, VL and VH are encoded by separate genes, but using a recombinant method, the VL and VH regions are paired to form a monovalent molecule (short chain Fv (scFv)). It can be followed by a synthetic linker capable of chaining (Bird et al, (1988) Science 242:423-426; and Huston et al, (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883 Reference). Such single chain antibodies are also intended to be included in the term “antigen-binding fragment” of the antibody.
  • Antigen-binding fragments are obtained using conventional techniques known to those skilled in the art, and the fragments are screened for availability in the same way as intact antibodies.
  • Antigen-binding fragments can be produced by recombinant DNA technology, or by enzyme or chemical cleavage of intact immunoglobulins.
  • the VH domain, or one or more CDRs can be linked to a constant domain to form a heavy chain.
  • the VL domain, or one or more CDRs can be linked to a constant domain to form a light chain.
  • the full-length heavy chain and the full-length light chain combine to form a full-length antibody.
  • variable region typically refers to a portion of an antibody, typically a portion of a light or heavy chain, typically about amino-terminal 110 to 120 amino acids in a mature heavy chain and about 90 to 115 amino acids in a mature light chain, which are sequenced per antibody. It is broadly different and characterizes the binding and specificity of specific antibodies to specific antigens. The variability of the sequence is concentrated in a region called the complementarity determining region (CDR) (heavy chain: HCDR1, 2 and 3, light chain: LCDR1, 2 and 3), and the more highly conserved region in the variable domain is called the framework region (FR). Is called.
  • CDR complementarity determining region
  • variable region is a human variable region.
  • variable regions include rodent or murine CDRs and human framework regions (FR).
  • FR human framework regions
  • the variable region is a primate (eg, non-human primate) variable region.
  • the variable region comprises rodent or murine CDRs and primate (eg, non-human primate) framework regions (FR).
  • heavy chain as used herein, when used with an antibody, is based on the amino acid sequence of any different type, eg, constant domain, alpha( ⁇ ), delta( ⁇ ), epsilon ( ⁇ ), gamma ( ⁇ ) and Mu ( ⁇ ) can be referred to, and they generate IgA, IgD, IgE, IgG and IgM types of antibodies, including subclasses of IgG, eg IgGl, IgG2, IgG3 and IgG4, respectively.
  • light chain as used herein can refer to kappa ( ⁇ ) or lambda ( ⁇ ) based on the amino acid sequence of any different type, eg, constant domain when used with an antibody.
  • Light chain amino acid sequences are well known in the art.
  • the light chain is a human light chain.
  • VL and “VL domain” are used interchangeably and refer to the light chain variable region of an antibody.
  • VH and “VH domain” are used interchangeably and refer to the heavy chain variable region of an antibody.
  • constant region is an antibody portion, such as the carboxy-terminal portion of a light and/or heavy chain that is not directly involved in the binding of the antibody to the antigen, but can exhibit various effector functions, such as interaction with an Fc receptor.
  • the constant region of an immunoglobulin molecule generally has a more conserved amino acid sequence compared to an immunoglobulin variable domain.
  • Fc region fragment crystallizable region
  • Fc domain or Fc refers to an Fc receptor located on various cells of the immune system (eg, effector cells) or a first component of a classical complement system (Clq)
  • Clq classical complement system
  • the Fc region includes the constant region of the antibody except for the first constant region immunoglobulin domain (eg, CH1 or CL).
  • the Fc region comprises two identical protein fragments, derived from the second (CH2) and third (CH3) constant domains of the two heavy chains of the antibody;
  • the IgM and IgE Fc regions contain three heavy chain constant domains (CH domains 2-4) in each polypeptide chain.
  • the Fc region comprises the immunoglobulin domains C ⁇ 2 and C ⁇ 3 and the hinge between C ⁇ 1 and C ⁇ 2.
  • the boundary of the Fc region of the immunoglobulin heavy chain may be variable, but the human IgG heavy chain Fc region is generally defined as extending from the amino acid residue at position C226 or P230 (or the amino acid between these two amino acids) to the carboxy-terminal of the heavy chain. , Where the numbering follows the EU index presented in Kabat.
  • the CH2 domain of the human IgG Fc region extends from approximately amino acid 231 to approximately amino acid 340, and the CH3 domain is located on the C-terminal side of the Cm domain in the Fc region, i.e. extends from approximately amino acid 341 to approximately amino acid 447 of IgG.
  • the Fc region presented herein can be a native sequence Fc or a variant Fc (eg, a non-naturally occurring Fc) comprising any allotype variant.
  • the Fc may be an Fc-comprising protein polypeptide, such as a “binding protein comprising an Fc region”, also referred to as an “Fc fusion protein” (eg, antibody or immunoconjugate).
  • Native sequence Fc region or “Native sequence Fc” includes an amino acid sequence identical to the amino acid sequence of an Fc region found in nature.
  • the native sequence human Fc region may include a native sequence human IgG1 Fc region; Native sequence human IgG2 Fc region; Native sequence human IgG3 Fc region; And native sequence human IgG4 Fc regions, as well as naturally occurring variants thereof.
  • Native sequence Fc includes various allotypes of Fes (eg, Jefferis et al, (2009) mAbs 1:1; Vidarsson G. et al., Front Immunol. 5:520).
  • the constant region can be engineered to remove one or more effector functions, for example, by recombinant techniques.
  • Effective function refers to the interaction of an antibody Fc region with an Fc receptor or ligand, or a biochemical event resulting from it.
  • exemplary “effector functions” include Clq binding, complement dependent cytotoxicity (CDC), Fc receptor binding, Fc ⁇ R-mediated effector functions such as ADCC and antibody dependent cell-mediated phagocytosis (ADCP) and cell surface receptors (eg, B cell receptor; BCR). This effector function generally requires an Fc region that can be combined with a binding domain (eg, antibody variable domain).
  • the term “constant region without Fc function” includes a constant region with or without at least one effector function mediated by the Fc region.
  • the effector function of the antibody can be reduced or avoided by different approaches.
  • the effector function of the antibody is reduced using antibody fragments lacking the Fc region (e.g., Fab, F(ab')2, short chain Fv (scFv), or sdAb consisting of monomeric VH or VL domains) or Can be avoided.
  • the so-called non-glycosylated antibody may be generated by removing sugars bound to specific residues in the Fc region, whereby other valuable properties of the Fc region (e.g., extended half-life and heterodimerization) ) Can decrease the effector function of the antibody.
  • Non-glycosylated antibodies include, for example, deletion or alteration of residues to which sugar is attached, enzymatic sugar removal, production of antibodies in cells cultured in the presence of a glycosylation inhibitor, or cells that are unable to glycosylate proteins (eg For example, in bacterial host cells).
  • Another approach is to use Fc regions from IgG subclasses with reduced effector function, for example, IgG2 and IgG4 antibodies are characterized by having a lower level of Fc effector function than IgG1 and IgG3.
  • an antibody with or without reduced Fc effector function may include, for example, a chimeric Fc region comprising a CH2 domain from an IgG4 isotype IgG antibody and a CH3 domain from an IgG1 isotype IgG antibody, or a hinge region from IgG2.
  • Chimeric Fc region comprising a CH2 region from IgG4 (see, e.g., Lau C. et al, J. Immunol. 191:4769-4777 (2013)), or altered Fc effector function, e.g. reduced or absent Fc It can be produced by generating an Fc region having a mutation that brings a function.
  • Fc regions with mutations are known in the art (see, for example, Korean Patent Publication No. 10-2018-0113904).
  • “Hinge”, “hinge domain”, “hinge region” or “antibody hinge region” refers to the domain of the heavy chain constant region connecting the CH1 domain and the CH2 domain, and includes the upper, middle and lower portions of the hinge (Roux et. al, J. Immunol. 1998 161: 4083).
  • the hinge provides various levels of flexibility between the binding region and effector region of the antibody, and also provides a site for intermolecular disulfide binding between the two heavy chain constant regions.
  • the hinge presented herein ends at Gly237 starting at Glu216 for all IgG isotypes (Roux et al, 1998 J Immunol 161: 4083).
  • IgG1, IgG2, IgG3 and IgG4 hinges are known in the art (e.g., Kabat EA et al, (1991) Sequences of Proteins of Immunological Interest, 5th Edition, US Department of Health and Human Services, NIH Publication No. 91-3242; Vidarsson G. et al., Front Immunol. 5:520 (online publication 2014-10-20).
  • CH1 domain refers to the heavy chain constant region connecting the hinge and variable domains of the heavy chain constant domain.
  • the CH1 domain presented herein starts at A118 and ends at V215.
  • CH1 domain includes wild type CH1 domains as well as variants thereof that exist naturally (eg, allotypes).
  • the CH1 domain sequences of IgG1, IgG2, IgG3 and IgG4 are known in the art (e.g., Kabat EA et al, (1991) homology and Vidarsson G. et al., Front Immunol 5:520 (online publication 2014-10-20).
  • CH2 domain refers to the heavy chain constant region that connects the hinge with the CH3 domain of the heavy chain constant domain.
  • the CH2 domain presented herein starts at P238 and ends at K340.
  • CH2 domain includes wild type CH2 domains as well as variants thereof that exist naturally (eg, allotypes).
  • the CH2 domain sequences of IgG1, IgG2, IgG3 and IgG4 are known in the art (e.g., Kabat EA et al, (1991) homology and Vidarsson G. et al., Front Immunol 5:520 (online publication 2014-10-20).
  • Exemplary CH2 domains include CH2 domains with domains that modify the biological activity of the antibody, eg, half-life and/or reduced Fc effector function (see US Patent Publication No. 20120100140).
  • CH3 domain refers to the C-terminal heavy chain constant region towards the CH2 domain of the heavy chain constant domain.
  • the CH3 domain presented herein starts at G341 and ends at K447.
  • CH3 domain includes wild type CH3 domains as well as variants thereof that exist naturally (eg, allotypes).
  • the CH3 domain sequences of IgG1, IgG2, IgG3 and IgG4 are known in the art (e.g., Kabat EA et al, (1991) homology and Vidarsson G. et al., Front Immunol 5:520 (online publication 2014-10-20).
  • Exemplary CH3 domains include CH3 domains with domains that modify the biological activity of the antibody, eg, half-life (see US Patent Publication No. 20120100140).
  • Immunotype refers to an antibody type (eg, IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD and IgE antibody) encoded by the heavy chain constant region gene.
  • Allotype refers to variants that differ in several amino acids that occur naturally within a particular isotype group (eg, Jefferis et al, (2009) mAbs 1: 1).
  • the antibodies disclosed herein can have any allotype.
  • Allotypes of IgG1, IgG2, IgG3 and IgG4 are known in the art (e.g., Kabat EA et al, (1991) homologs; Vidarsson G. et al., Front Immunol. 5:520 (published online 2014- 10-20); and Lefranc MP, mAbs 1:4, 1-7 (2009)).
  • antibody that recognizes an antigen and “antibody that is specific for an antigen” are used herein interchangeably with the terms “an antibody that specifically binds an antigen”.
  • isolated antibody refers to the other antibody is substantially antibody free of having different antigenic specificities (e. G., The isolated antibody is specific for a different antigen than ET A ever specifically binding to ET A Substantially no antibody to bind). However, an isolated antibody that specifically binds to an epitope of the ET A has a cross-reactivity for other ET A proteins from different species.
  • Antibodies specifically bind cognate antigens with high affinity, typically reflected by a dissociation constant (K D ) of 10 -5 to 10 -11 M or less. Any KD above about 10 -4 M is generally considered to exhibit non-specific binding.
  • Antibodies "specifically binding" to the antigens presented herein refer to antibodies that bind antigens with high affinity and substantially identical antigens but do not bind with high affinity to unrelated antigens. For example, 10 -7 M or less, preferably 10 -8 M or less, even more preferably 10 -9 M or less, and most preferably 10 -8 M to 10 -10 M or less, as determined by immunoassay techniques using defined antigens It means to have K D.
  • the monoclonal antibody or fragment thereof comprises the CDR1 of SEQ ID NO:38 and the CDR2 of SEQ ID NO:39 in the heavy chain variable region, and the SEQ ID NO:40 sequence in the light chain variable region.
  • the CDR3 of the heavy chain variable region of the monoclonal antibody or fragment thereof is the amino acid sequence of SEQ ID NO:43.
  • the CDR3 of the heavy chain variable region of the monoclonal antibody or fragment thereof is 4th, 7th, 9th, 10th, 11th, 12th, 13th and 13th in SEQ ID NO:43. It contains a mutation at a position selected from the group consisting of the 14th amino acid.
  • the CDR3 of the heavy chain variable region is P (valine) in the fourth amino acid in SEQ ID NO: 43;
  • the 7th amino acid is L (leucine);
  • the 9th amino acid is V (valine);
  • the 10th amino acid is I (isoleucine) or H (histidine);
  • the 11th amino acid is F (phenylalanine) or Q (glutamine);
  • the 12th amino acid is E (glutamate);
  • the 13th amino acid is N (asparagine) or C (cysteine); Or the 14th amino acid contains a mutation substituted with L (leucine).
  • the CDR3 of the heavy chain variable region is SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49 It is an amino acid sequence selected from the group consisting of SEQ ID NO: SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54.
  • the light chain variable region comprises the amino acid sequence of SEQ ID NO:55.
  • the heavy chain variable region is SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 60, SEQ ID NO: 61, It contains an amino acid sequence selected from the group consisting of SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, and SEQ ID NO: 67.
  • the present invention provides a nucleic acid molecule encoding the monoclonal antibody or fragment thereof, a vector comprising the nucleic acid molecule or a host cell comprising the vector.
  • the nucleic acid molecule of the present invention may be isolated or recombined, and includes DNA and RNA in the form of single and double chains as well as corresponding complementary sequences.
  • An “isolated nucleic acid” is a nucleic acid isolated from a surrounding genetic sequence present in the genome of an isolated individual, in the case of a nucleic acid isolated from a naturally occurring source.
  • nucleic acids enzymatically or chemically synthesized from a template such as PCR products, cDNA molecules, or oligonucleotides
  • nucleic acids produced from such procedures can be understood as isolated nucleic acid molecules.
  • Isolated nucleic acid molecule refers to a nucleic acid molecule in the form of a separate fragment or as a component of a larger nucleic acid construct.
  • a nucleic acid is "operably linked" when placed in a functional relationship with another nucleic acid sequence.
  • the DNA of the entire sequence or secretion leader is operably linked to the DNA of the polypeptide when expressed as a preprotein, which is the form before the polypeptide is secreted
  • the promoter or enhancer is a polypeptide sequence When it affects the transcription of operably linked to the coding sequence, or the ribosome binding site is operably linked to the coding sequence when placed to facilitate translation.
  • operably linked means that the DNA sequences to be linked are contiguous, and in the case of a secretory leader, contiguous and in the same reading frame. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction enzyme sites. If such sites are not present, synthetic oligonucleotide adapters or linkers are used according to conventional methods.
  • vector refers to a carrier capable of inserting a nucleic acid sequence for introduction into a cell capable of replicating the nucleic acid sequence.
  • the nucleic acid sequence can be exogenous or heterologous.
  • examples of vectors include, but are not limited to, plasmids, cosmids, and viruses (eg, bacteriophage).
  • viruses eg, bacteriophage.
  • Those skilled in the art can construct vectors by standard recombinant techniques (Maniatis, et al., Molecular Cloning , A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, NY, 1988; and Ausubel et al., In: Current Protocols in Molecular Biology , John, Wiley & Sons, Inc, NY, 1994, etc.).
  • expression vector refers to a vector comprising a nucleic acid sequence encoding at least a portion of a gene product to be transcribed. In some cases, the RNA molecule is then translated into a protein, polypeptide, or peptide.
  • Expression vectors may contain various regulatory sequences. In addition to regulatory sequences that regulate transcription and translation, vectors and expression vectors may also contain nucleic acid sequences that provide other functions.
  • host cell refers to any transgenic organism that includes eukaryotes and prokaryotes, capable of replicating the vector or expressing a gene encoded by the vector.
  • the host cell can be transfected or transformed by the vector, which means the process by which exogenous nucleic acid molecules are delivered or introduced into the host cell.
  • the host cell of the present invention may preferably include bacterial cells, CHO cells, HeLa cells, HEK293 cells, BHK-21 cells, COS7 cells, COP5 cells, A549 cells, NIH3T3 cells, but is not limited thereto. no.
  • the present invention provides a composition comprising the antibody or fragment thereof, the nucleic acid molecule or the vector.
  • the composition of the present invention is a pharmaceutical composition for preventing or treating hypertension or cancer.
  • the pharmaceutical composition of the present invention includes (a) the monoclonal antibody or fragment thereof, the nucleic acid molecule or a vector comprising the nucleic acid molecule; And (b) a pharmaceutically acceptable carrier.
  • the present invention provides a method of treating cancer or hypertension, comprising administering to a subject a pharmaceutically effective amount of the monoclonal antibody or fragment, nucleic acid molecule or vector.
  • the present invention provides the use of the monoclonal antibody or fragment thereof, nucleic acid molecule or vector for the manufacture of a pharmaceutical composition for the treatment of cancer or hypertension.
  • administering refers to the physical introduction of a therapeutic agent or composition comprising a therapeutic agent into a subject, using any of a variety of methods and delivery systems known to those skilled in the art.
  • Preferred routes of administration for the antibodies presented herein include intravenous, intraperitoneal, intramuscular, subcutaneous, spinal or other parenteral routes of administration, such as by injection or infusion.
  • parenteral administration means other modes of administration than intestinal and topical administration, usually by injection, but is not limited to intravenous, intraperitoneal, intramuscular, intraarterial, intrathecal, lymphatic, Includes intralesional, intracranular, orbital, intracardiac, intradermal, tracheal, subcutaneous, sub-articular, intra-articular, subcutaneous, subarachnoid, intra-vertebral, epidural and intrasternal injections and injections, as well as in vivo electroporation. .
  • the antibodies presented herein can be administered via non-parenteral routes, such as topical, epithelial or mucosal routes of administration, for example by intranasal, oral, vaginal, rectal, sublingual or topical routes. Administration can also be performed over an extended period of time, eg, once, several times, and/or one or more times.
  • non-parenteral routes such as topical, epithelial or mucosal routes of administration, for example by intranasal, oral, vaginal, rectal, sublingual or topical routes.
  • Administration can also be performed over an extended period of time, eg, once, several times, and/or one or more times.
  • treat are reversal, alleviation, alleviation, inhibition or delay or prevention of the progression, development, severity or recurrence of symptoms, complications, conditions or biochemical indicators associated with a disease.
  • Treatment can be performed on a subject with or without a disease (eg, for prophylaxis).
  • the type of cancer to be prevented or treated by the present invention is not limited, leukemias and acute lymphocytic leukemia, acute nonlymphocytic leukemias, chronic lymphocytic leukemia, chronic Lymphomas, brain tumors, glioblastomas such as chronic myelogenous leukemia, Hodgkin's Disease, non-Hodgkin's lymphomas and multiple myeloma, etc.
  • Childhood solid tumors such as neuroblastoma, rhabdomyosarcoma, retinoblastoma, Wilms Tumor, bone tumors and soft-tissue sarcomas tumors, lung cancer, breast cancer, prostate cancer, urinary cancers, uterine cancers, oral cancers, pancreatic cancer, melanoma ( melanoma and other skin cancers, stomach cancer, colon cancer, ovarian cancer, brain tumors, liver cancer, laryngeal cancer, thyroid cancer It can be administered to treat a number of cancers, including common solid tumors in adults, such as thyroid cancer, esophageal cancer, and testicular cancer.
  • the subject to which the monoclonal antibody or fragment thereof, the nucleic acid molecule or the vector containing the nucleic acid molecule, or a pharmaceutical composition containing the same is administered includes any human or non-human animal. do.
  • non-human animal includes all vertebrates, eg mammals and non-mammals, such as non-human primates, sheep, dogs, cows, chickens, amphibians, reptiles, and the like.
  • the pharmaceutically acceptable carrier included in the pharmaceutical composition of the present invention is commonly used in formulation, lactose, dextrose, sucrose, sorbitol, mannitol, starch, acacia rubber, calcium phosphate, alginate, gelatin, Calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methyl cellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil, but is not limited thereto It does not work.
  • the pharmaceutical composition of the present invention may further include a lubricant, a wetting agent, a sweetener, a flavoring agent, an emulsifying agent, a suspending agent, a preservative, etc. in addition to the above components.
  • a lubricant e.g., a talc, a kaolin, a kaolin, a kaolin, a kaolin, a kaolin, kaolin, kaolin, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, a talct, a talct, a talct, a stevia, glycerin, a stevia, glycerin, glycerin, g
  • composition of the present invention may be administered orally or parenterally, preferably parenteral administration, for example, intravenous injection, topical injection and intraperitoneal injection.
  • Suitable dosages of the pharmaceutical compositions of the present invention vary by factors such as formulation method, mode of administration, patient's age, weight, sex, morbidity, food, time of administration, route of administration, rate of excretion, and response sensitivity, Usually, a skilled physician can easily determine and prescribe a dose effective for the desired treatment or prevention. According to a preferred embodiment of the invention, the daily dosage of the pharmaceutical composition of the invention is 0.0001-100 mg/kg.
  • the pharmaceutical composition of the present invention is prepared in a unit dose form by formulating using a pharmaceutically acceptable carrier and/or excipient according to a method that can be easily carried out by those skilled in the art to which the present invention pertains. Or it can be manufactured by incorporating into a multi-dose container.
  • the formulation may be in the form of a solution, suspension, or emulsion in an oil or aqueous medium, or may be in the form of ex, powder, granule, tablet, or capsule, and may further include a dispersant or stabilizer.
  • the pharmaceutical composition of the present invention may be used as a single therapy, but may also be used in combination with other conventional chemotherapy or radiation therapy, and when performing the combination therapy, cancer treatment can be more effective.
  • Chemotherapeutic agents that can be used with the compositions of the present invention are cisplatin, carboplatin, procarbazine, mechlorethamine, cyclophosphamide, Ipoh Ifosfamide, melphalan, chlorambucil, bisulfan, nitrosourea, dactinomycin, daunorubicin, doxorubicin , Bleomycin, plicomycin, mitomycin, etoposide, tamoxifen, taxol, transplatinum, 5-fluoro Uracil (5-fluorouracil), vincristine, vinblastin, and methotrexate.
  • Radiotherapy that can be used with the compositions of the present invention is X-ray irradiation and ⁇ -ray irradi
  • the present invention provides a method for quantifying endothelin receptor type A contained in a sample, comprising the step of treating the monoclonal antibody or fragment thereof.
  • the antibody or fragment thereof of the present invention specifically binds to Entothelin Receptor A, it is possible to accurately measure the amount of Entothelin Receptor A contained in the sample.
  • a method for providing information for diagnosing a disease caused by overexpression of Endothelin receptor type A comprising the following steps:
  • Entothelin receptor A acts as a vasoconstrictor by the binding of the ligand ET-1 (Nature reviews drug discovery, 2011, Vol. 10, 47); Major cancers such as bladder cancer, lung cancer, ovarian cancer, kidney cancer, colorectal cancer, prostate cancer, breast cancer, uterine cancer, rhabdomyosarcoma, glioblastoma, etc. Because it is directly involved in the process (Nature review cancer, 2013, Vol. 13, 637), by comparing the expression level of the endothelin receptor A with normal people, information for diagnosis of diseases caused by overexpression of the endothelin receptor A is provided. Can provide.
  • the disease caused by the overexpression of the Entothelin receptor A is cancer or hypertension.
  • the present invention provides an endothelin receptor type A quantification kit comprising the monoclonal antibody or fragment thereof.
  • the quantitative kit of the present invention can quantify the amount of Entothelin receptor A by analyzing the antigen against the antibody through an antigen-antibody-binding reaction, and the antigen-antibody-binding reaction is a conventional enzyme-linked immunosorbent assay (ELISA), RIA ( Radioimmnoassay, Sandwich assay, Western blot on polyacrylamide gel, immunoblot assay, and immunohistochemical staining method are preferably selected from the group consisting of, but not limited to Does not work.
  • ELISA enzyme-linked immunosorbent assay
  • RIA Radioimmnoassay
  • Sandwich assay Western blot on polyacrylamide gel
  • immunoblot assay and immunohistochemical staining method are preferably selected from the group consisting of, but not limited to Does not work.
  • a nitrocellulose membrane, a PVDF membrane, a well plate made of polyvinyl resin or polystyrene resin, and a slide glass made of glass are made. What is selected from the group can be used, but is not limited now.
  • the secondary antibody is preferably labeled with a conventional color developing agent that reacts with color development, HOR (Horseradish peroxidase), Alkaline phosphatase, Colloid gold, Poly L-lysine-fluorescein isothiocyanate (FITC) ), RITC (Rhodamine-B-isothiocyanate), such as a fluorescent material (Fluorescein) and any one selected from the group consisting of a dye (Dye) can be used. It is preferable to use the substrate that induces color development depending on the labeling agent that reacts with color development.
  • a conventional color developing agent that reacts with color development
  • HOR Haseradish peroxidase
  • Alkaline phosphatase Alkaline phosphatase
  • Colloid gold Poly L-lysine-fluorescein isothiocyanate (FITC)
  • FITC Poly L-lysine-fluorescein isothiocyanate
  • RITC
  • TMB (3,3',5,5'-tetramethyl bezidine), ABTS[2,2'-azino-bis(3-ethylbenzothiazoline It is preferable to use any one selected from the group consisting of -6-sulfonic acid) and OPD (ophenylenediamine), but is not limited thereto.
  • the present invention provides a monoclonal antibody or fragment thereof that specifically binds to the extracellular region of Entothelin receptor A as an antigen.
  • the present invention also provides a pharmaceutical composition for preventing or treating cancer or hypertension comprising the monoclonal antibody or fragment thereof, the nucleic acid molecule or the vector.
  • the monoclonal antibody of the present invention shows a function of inhibiting the signaling process of Entothelin receptor A, and by using this function, it can be usefully used as a therapeutic agent for hypertension or cancer involving Entothelin receptor A.
  • 5 is a graph showing the inhibitory ability of signaling induced by ET-1 of 10 nM to CHO-K1 cells expressing ET A at 200 nM excavated antibody concentration.
  • FIG. 6 is a graph showing the inhibitory ability of 10 nM of ET-1-induced signaling to HT-29 cells, a colon cancer cell line overexpressing ET A at a concentration of 200 nM excavated antibody.
  • FIG. 7 is a graph showing the inhibitory ability of signaling induced by 10 nM of ET-1 to HCT-116 cells, a colon cancer cell line overexpressed with ET A at excavating antibody concentrations of 25 nM and 200 nM.
  • Figure 9 is a graph showing the inhibitory effect of colon cancer cell proliferation of the excavated antibody on CT A overexpressing colorectal cancer cell line HCT-116.
  • FIG. 10 is a graph showing the effect of inhibiting the proliferation of colorectal cancer cells of five lead antibodies against ET A overexpressing colorectal cancer cell lines HT-29 and HCT-116.
  • Figure 11 is a graph showing the inhibitory effect of colon cancer growth of 5 Lead Antibodies against xenograft model produced from colon cancer cell line HT-29.
  • FIG 12 shows the results of the analysis of Size-Exclusion Chromatography (SEC)-HPLC of five Lead antibodies.
  • Figure 13 shows the results of the sugar chain structure analysis of the five lead antibodies.
  • Figure 14 shows the results of weight analysis of five Lead antibodies.
  • 16 is a result showing a decrease in the level of ERK, AKT, a product of the ET A signaling process according to the excavated antibody treatment.
  • a specific binding antibody (AG8, Patent Registration No. 10-2014383) sequence, it plays an important role in antigen-antibody binding in order to construct a library for discovering antibodies with improved binding power and efficacy to existing target antigens.
  • Affinity maturation library using degenerated NNK codon was prepared to randomly substitute 20 amino acids from 13 amino acid sequences of CDR3 sequence of antibody heavy chain among CDR (Complementarity-determining regions). .
  • Sequence number designation Sequence One AG8-CDR3H-NNK1-RV GGGTTCCCGGGCCCCA GACGTCCATACCGAAGCCATAAGTCCCCGAACCATAMNNATCTTTTGC ACAGTAATACACGGCCGTGTCCTC 2 AG8-CDR3H-NNK2-RV GGGTTCCCGGGCCCCA GACGTCCATACCGAAGCCATAAGTCCCCGAACCMNNCCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC 3 AG8-CDR3H-NNK3-RV GGGTTCCCGGGCCCCA GACGTCCATACCGAAGCCATAAGTCCCCGAMNNATACCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC 4 AG8-CDR3H-NNK4-RV GGGTTCCCGGGCCCCA GACGTCCATACCGAAGCCATAAGTCCCMNNACCATACCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC 5 AG8-CDR3H-NNK5-RV
  • Sequence number designation Sequence 14 #1NNK EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDRYGSGTYFFGMDVWGPGTLVTVSS 15 #2NNK EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSMRSEDTAVYYCAKDRYGSGTYQFGMDVWGPGTLVTVSS 16 #3NNK EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDRYGSGTIGFGMDVWGPGTLVTVSS 17 #4NNK EVQLVESGAEVRKPGASVK
  • Sequence number designation Sequence 28 AG8 EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDRYGSGTYGFGMDVWGPGTLVTVSSGGGSSGGGGSGGGGSGGGGSDIVMTQSPSAMSASVGDRVSITCRASQGINNYLAWFQQKPGKVPKRLMDVGSILQSGIPSRFRGRGSGTQFTLTISSLQAEDSGTYFCLQHNTYPLTFGPGTKVEIKR 29 EF12 EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDPYGSGTYGFGMDVWGPGTLVTVSSGGGSSGGGGSGGGGSGGSDIVMTQSPSAMSASVGDRVSITCRASQ
  • Sequence number designation Sequence 38 HCDR1 GYTFTSS 39 HCDR2 MNPKNGNT 40 LCDR1 QGINNY 41 LCDR2 VGS 42 LCDR3 LQHNTYPLT
  • Sequence number designation Sequence 43 AG8 AKDRYGSGTYGFGMDV 44 #1NNK AKDRYGSGTY F FGMDV 45 #2NNK AKDRYGSGTY Q FGMDV 46 #3NNK AKDRYGSGT I GFGMDV 47 #4NNK AKDRYGSGT H GFGMDV 48 #5NNK AKDRYGSGTYGF N MDV 49 #6NNK AKDRYGSGTYGF C MDV 50 #7NNK AKDRYGSGTYGFG L DV 51 EF12 AKD P YGSGTYGFGMDV 52 GG12 AKDRYGSG V YGFGMDV 53 FG12 AKDRYG L GTYGFGMDV 54 AB9 AKDRYGSGTYG E GMDV
  • VL Light chain variable region
  • Sequence number designation Sequence 56 AG8 EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYC AKDRYGSGTYGFGMDV WGPGTLVT 57 #1NNK EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYC AKDRYGSGTYFFGMDV WGPGTLVT 58 #2NNK EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSMRSEDTAVYYC AKDRYGSGTYQFGMDV WGPGTLVT 59 #3NNK EVQLVESGAEV
  • VH Heavy chain variable region
  • ET A expressing animal cell lines (ET A expressed CHO) to measure the signaling process by ET-1 of ET A by measuring the concentration of Ca 2+ in the cytoplasm using Fura-2-AM fluorescent dye (ThermoFisher, USA) -K1 stable cell line, GenScript, USA) treated with 5 ⁇ M of Fura-2-AM fluorescent dye and the purified antibody in FIG. 5 by concentration, and then induced a signal transduction process with 10 nM of ET-1 to fluorescence spectroscopy.
  • Fura-2-AM fluorescent dye ThermoFisher, USA
  • GenScript GenScript
  • the colon cancer cell lines HT-29 and HCT-116 were used by pre-sale from the Korea Cell Line Bank (Seoul, Korea), and confirming the inhibitory ability of ET A signaling in HT-29 colon cancer cells of excavated antibodies was confirmed as in Example 3.
  • the results were obtained as shown in FIG. 6 using the method, and the inhibition of ET A signaling in HCT-116 colorectal cancer cells was confirmed by treating the excavated antibodies with 25 nM and 200 nM, respectively, under the same conditions as in Example 3, and FIG. 7. The results were obtained, and the inhibitory ability of excavated antibodies to ET A was confirmed.
  • the excavated antibody was confirmed to exhibit an antagonistic effect (antagonistic effect) that inhibits the signaling process of ET A by ET-1 in HT-29 and HCT-116 colorectal cancer cell lines.
  • antagonistic effect antagonistic effect
  • FIGS. 5, 6, and 7, 4 types that commonly show the effects of inhibiting the signaling process according to ET A activity in common in human-derived ET A expressing cells and over-expressing cancer cells HT-29 and HCT-116.
  • Antibodies GG12, AB9, EF12 and FG12 were finally verified and discovered.
  • the extracellular sequences of other species of ET A were compared with the extracellular regions of human ET A.
  • the ET A of rats was analyzed to have an average amino acid identity in the N-terminal, extracellular loops 1, 2, and 3 regions of the extracellular region, on average, about 80% or more.
  • the mouse ET A sequence was cloned into an expression vector to express and purify the active mouse ETA under E. coli conditions, and the antibodies were discovered using ELISA technique.
  • the cross-linking capacity in human/rat ET A was tested, and the results are shown in FIG. 8. As shown in FIG. 8, it was confirmed that the discovered antibody has a binding ability in the active human ET A and a similar activity in the active rat ETA.
  • the excavated antibody has the effect of inhibiting the proliferation of colorectal cancer cells in the presence of ET-1 in the HCT-116 cell line, which is widely used along with the HT-29 cell line.
  • CyQUANT NF fluorescent dye (Invitrogen, USA) was used to confirm the proliferation of cells by measuring the amount of DNA in the cells.
  • the excavated antibody purified on the HCT-116 cell line was treated by concentration, incubated with a cell incubator at 37° C. for 1 hour, and then inoculated using a fluorescence spectrophotometer (TECAN, Switzerland) by inoculating and treating the CyQUANT NF fluorescent dye 72 hours later.
  • the antibody of the present invention shows an effect of inhibiting the increase in the proliferative power of ET A by ET-1 in the HCT-116 colorectal cancer cell line. Through the above results, it was confirmed that the antibody of the present invention has an activity that effectively inhibits the proliferation of colorectal cancer cells.
  • the same method as described above (Example 6) was used to confirm the inhibition of the proliferation of colon cancer cells of the 5 types, and the results shown in FIG. 10 were obtained.
  • the five lead antibodies of the present invention show the effect of effectively inhibiting the proliferation of HT-29 and HCT-116 colorectal cancer cell lines. Through the above results, it was confirmed that the five lead antibodies of the present invention have an activity of effectively inhibiting the proliferation of colorectal cancer cells.
  • a subcutaneous injection xenograft model of a colon cancer HT-29 cell line was injected into a flanks region, and 5 ⁇ g of Lead antibody of the present invention was injected to 25 ⁇ g to verify anticancer efficacy.
  • the experiment was conducted and the results as shown in FIG. 11 were derived.
  • five lead antibodies of the present invention show an effect of inhibiting the growth of colon cancer in a xenograft model of the HT-29 colorectal cancer cell line.
  • the five lead antibodies of the present invention have an activity of effectively inhibiting the proliferation of colorectal cancer cells in an animal model, and are effective as a therapeutic agent.
  • FIG. 12 it was confirmed that 5 types of excavated antibodies were separated through SEC-HPLC, and the aggregated percentage was 10% or less.
  • FIG. 13 as a result of analyzing the structure of the sugar chain, the structure of the discovered sugar chain did not show a significant difference from the human IgG standard.
  • FIG. 14 is an analysis of whether the size of the discovered antibody coincides with the theoretical value, and generally shows the same result as the sequence in 5 Da.
  • pH 4 ⁇ 8 sodium acetate, sodium citrate, potassium phosphate, Histidine, MES, Succinate, HEPES, Tris, Bicine, PBS as buffer solution
  • the concentration of the antibody was concentrated to 1 mg/mL, and 1000 X protein thermal shift TM dye (ThermoFisher scientific), a fluorescence capable of predicting the structural change of the protein in the concentrated excavated antibody, was diluted to a final concentration of 1X. I put it in.
  • ViiA7 ThermoFisher scientific
  • thermal stability analysis was performed according to the manual (Protein Thermal TM Studies, ThermoFisher scientific). The results of the thermal stability analysis according to the pH are shown in FIG. 15.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Public Health (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Engineering & Computer Science (AREA)
  • Endocrinology (AREA)
  • Neurology (AREA)
  • Biomedical Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Cardiology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)

Abstract

본 발명은 엔토텔린 수용체 A의 세포외 부위를 항원으로 인식하여 이에 특이적으로 결합하는 단일클론항체 또는 이의 단편에 관한 것이다. 본 발명에서 발굴한 단일클론항체는 엔토텔린 수용체 A와 관련된 고혈압이나 암에 대한 치료제로서 유용하게 활용될 수 있다.

Description

엔도텔린 수용체 A 활성 조절 항체
본 발명은 ETA(endothelin receptor type A)에 대한 결합력이 증대되어, ET-1(endothelin-1) 및 ETA 간 결합을 효과적으로 억제하여, ETA의 활성을 조절하는 항체에 관한 것이다.
GPCR(G-protein coupled receptor)은 7개의 막 투과부위를 갖는 다중 막 투과 단백질로서, 세포 밖의 신호를 세포 내로 전달함으로써 G-단백질 이형삼량체를 활성화하여 신호전달물질에 대한 반응뿐만 아니라 감각 등의 생리학상의 필수적인 역할을 수행한다. 또한 GPCR은 세포의 성장, 증식, 이동, 집단화, 사멸 등 주요 생물학적 현상을 가장 상위 단계에서 직접적으로 조절할 뿐 아니라, 암, 심혈관 질환등과 같은 질병과도 직접적으로 연관되어 있으므로 주요 약물 표적물질로 각광받고 있다.
ETA(endothelin receptor type A)는 정상인에서 주로 혈관평활근에 발현되어 리간드인 ET-1(endothelin-1)의 결합에 의한 세포내 신호전달과정을 통해 혈관수축작용을 일으키는 것으로 알려져 있다. 따라서 엔도텔린 수용체 길항제(endothelin receptor antagonist)인 보센탄(Bosentan)과 같은 약물들은 고혈압치료제로 사용되어져 왔다(Nature reviews drug discovery, 2011, Vol. 10, 47). 최근 많은 기초생물학 및 임상학적 연구들에 의해 ETA가 방광암, 폐암, 난소암, 신장암, 대장암, 전립선암, 유방암, 자궁암, 횡문근육종, 교모세포종 등의 다양한 암에서 과발현되어 암세포의 증식, 이동, 침투, 전이, 혈관신생성 등의 주요 암 진행과정에 직접적으로 관여하여 환자의 생존율을 낮추는 것으로 보고되어 주요 항암 표적물질로 각광받고 있다(Nature review cancer, 2013, Vol. 13, 637).
항체 약물은 저분자 합성 의약품에 비해 높은 특이성, 낮은 부작용, 높은 혈중 반감기, Fc 영역에 의한 결함세포 사멸 작용기작(ADCC, ADCP, CDC) 등의 장점에도 불구하고 기존에 ETA를 표적하는 약물들은 Bosentan, Zibotentan, Atrasentan 등의 저분자 화합물로서 아직 항체약물은 보고된 바 없으며, GPCR 전체로 확대하여도 판매 허가된 항체 약물은 매우 드물며, CCR4를 표적하는 Kyowa Hakko Kirin사의 Poteligeo(Mogamulizumab)이 일본에 승인받았으며 2018년 5월 Amgen에서 개발된 CGRP 수용체를 표적으로 하는 Aimovig(Erenumab)이 GPCR 표적항체로는 처음으로 US FDA 승인을 받았다. 따라서 ETA에 특이적으로 결합하고 이의 활성을 조절하는 신규 항체의 발굴의 필요성이 대두되었다. 또한 GPCR 표적의 신규 항체 약물을 개발하기 위해서는 우선 항원의 세포외 부위(extracellular domain, ECD)에 특이적으로 결합해야하는데, GPCR의 전체 표면적 중에서 세포외부위가 차지하는 비율은 약 10% 내외로 매우 제한적이기 때문에 기존에 사용해오던 항체 발굴전략으로는 한계가 있다.
상기한 배경기술로서 설명된 사항들은 본 발명의 배경에 대한 이해 증진을 위한 것일 뿐, 이 기술분야에서 통상의 지식을 가진 자에게 이미 알려진 종래기술에 해당함을 인정하는 것으로 받아들여져서는 안 될 것이다.
본 발명자들은 ETA에 특이적으로 결합하여 신호전달과정을 저해하는 신규항체를 발굴하고자 예의 노력을 하였다. 그 결과, 본 발명자들은 ETA가 안정 발현된 세포주에서의 ET-1 신호전달을 효율적으로 억제하는 항체를 발견함으로써 본 발명을 완성하였다.
따라서, 본 발명의 목적은 엔토텔린 수용체 A(Endothelin receptor type A) 또는 이의 세포외 부위(Extracellular domain)를 항원으로 인식하여 이에 특이적으로 결합하는 단일클론항체 또는 이의 단편을 제공하는데 있다.
본 발명의 또 다른 목적은 상기 단일클론항체 또는 이의 단편을 코딩하는 핵산분자를 제공하는데 있다.
본 발명의 또 다른 목적은 상기 핵산분자를 포함하는 벡터를 제공하는데 있다.
본 발명의 또 다른 목적은 상기 벡터를 포함하는 숙주세포를 제공하는데 있다.
본 발명의 또 다른 목적은 상기 단일클론항체, 핵산분자 또는 벡터를 포함하는 암 또는 고혈압의 예방 또는 치료용 약제학적 조성물을 제공하는데 있다.
본 발명의 또 다른 목적은 약제학적 유효량의 상기 단일클론항체, 핵산분자 또는 벡터를 대상(subject)에게 투여하는 단계를 포함하는 암 또는 고혈압의 치료방법을 제공하는데 있다.
본 발명의 또 다른 목적은 암 또는 고혈압의 치료용 약제학적 조성물의 제조를 위한 상기 단일클론항체 또는 이의 단편, 핵산분자 또는 벡터의 용도를 제공하는데 있다.
본 발명의 또 다른 목적은 상기 단일클론항체 또는 이의 단편을 처리하는 단계를 포함하는, 샘플 중에 포함된 엔토텔린 수용체 A(Endothelin receptor type A)의 정량 방법을 제공하는데 있다.
본 발명의 또 다른 목적은 엔토텔린 수용체 A(Endothelin receptor type A)의 과발현에 의한 질환의 진단을 위한 정보를 제공하는 방법을 제공하는데 있다.
본 발명의 또 다른 목적은 상기 단일클론항체 또는 이의 단편을 포함하는 엔토텔린 수용체 A(Endothelin receptor type A) 정량 키트를 제공하는데 있다.
본 발명의 다른 목적 및 이점은 하기의 발명의 상세한 설명, 청구범위 및 도면에 의해 보다 명확하게 된다.
본 발명의 일 양태에 따르면, 본 발명은 엔토텔린 수용체 A(Endothelin receptor type A) 또는 이의 세포외 부위(Extracellular domain)를 항원으로 인식하여 이에 특이적으로 결합하는 단일클론항체 또는 이의 단편을 제공한다.
상기 엔토텔린 수용체 A는 리간드인 ET-1(endothelin-1)의 결합에 의한 세포내 신호전달과정을 담당하며, 고혈압 치료제 및 주요 항암 표적물질로 각광을 받고 있으나, 기존에 ETA를 표적하는 약물들은 보센탄(Bosentan), 지보텐탄(Zibotentan), 아트라센탄(Atrasentan) 등의 저분자 화합물로서, 아직까지 엔토텔린 수용체 A의 세포외 부위를 항원으로 인식하는 단일클론항체 약물은 보고된 바 없다.
본 명세서에 개시된 용어 "항원"은 임의의 천연 또는 합성 면역원성 물질, 예컨대 단백질, 펩타이드 또는 합텐을 말한다. 항원은 ETA 또는 이의 단편(예를 들어, 세포외 부위(Extracellular domain))일 수 있다.
본 명세서에 개시된 "에피토프"는 당업계의 용어이며 항체가 특이적으로 결합할 수 있는 항원의 국소 영역을 말한다. 예를 들어, 에피토프는 폴리펩타이드의 인접 아미노산들일 수 있거나(선형 또는 인접 에피토프) 또는 에피토프는 폴리펩타이드 또는 폴리펩타이드들의 둘 이상의 비-인접 영역으로부터 함께 합쳐질 수 있다(입체구조적, 비-선형, 불연속, 또는 비-인접 에피토프). 인접 아미노산들로부터 형성된 에피토프는 항상은 아니지만 전형적으로 변성 용매에 노출시 유지되지만, 3차 폴딩에 의해 형성된 에피토프는 전형적으로 변성 용매로의 처리시 상실된다. 에피토프는 전형적으로 적어도 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 또는 20개 아미노산을 독특한 공간적 입체구조로 포함한다. 주어진 항체에 의해 에피토프가 결합되는 방식을 결정하기 위한 방법(즉, 에피토프 맵핑)은 당업계에 잘 공지되어 있고, 예를 들어 면역블롯팅 및 면역침전 분석을 포함하며, 본 명세서에서는 중첩 또는 인접 펩타이드(예를 들어, ETA로부터)가 주어진 항체(예를 들어, 항-ETA 항체)와의 반응성에 대해 시험된다. 에피토프의 공간적 입체구조를 결정하는 방법은 당업계의 기술 및 본 명세서에 제시된 것들, 예를 들어 x-선 결정학, 2-차원 핵자기공명 및 FIDX-MS를 포함한다(예를 들어, Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996) 참조).
특정 구체예에서, 항체가 결합하는 에피토프는, 예를 들어 NMR 분광학, x-선 회절 결정학 연구, ELISA 분석, 질량분석법과 결합된 수소/중수소 교환(예를 들어, 액체 크로마토그래피 전기분무 질량분석법), 어레이-기반 올리고펩타이드 스캐닝 분석 및/또는 돌연변이유발 맵핑(예를 들어, 부위-지정 돌연변이유발 맵핑)에 의해 결정될 수 있다. x-선 결정학의 경우, 당업계에 공지된 방법 중 어느 것을 사용하여 결정화가 달성될 수 있다(예를 들어, Giege R et al, (1994) Acta Crystallogr D Biol Crystallogr 50(Pt 4): 339-350; McPherson A (1990) Eur J Biochem 189: 1-23; Chayen E (1997) Structure 5: 1269-1274; McPherson A (1976) J Biol Chem 251: 6300-6303 참조). 항체:항원 결정은 잘 알려진 x-선 회절 기술을 사용하여 연구될 수 있고, X-PLOR(Yale University, 1992, Molecular Simulations, Inc.에 의해 배포; 예를 들어, Meth Enzymol (1985) volumes 114 & 115, eds Wyckoff HW et al; U.S. 2004/0014194 참조), 및 BUSTER(Bricogne G (1993) Acta Crystallogr D Biol Crystallogr 49(Pt 1): 37-60; Bricogne G (1997) Meth Enzymol 276 A: 361-423, ed Carter CW; Roversi P et al, (2000) Acta Crystallogr D Biol Crystallogr 56(Pt 10): 1316-1323)와 같은 컴퓨터 소프트웨어를 사용하여 확인할 수 있다. 돌연변이유발 맵핑 연구는 당업계에 공지된 임의의 방법을 사용하여 수행될 수 있다. 알라닌 스캐닝 돌연변이유발 기술을 포함하는 돌연변이유발 기술에 대한 내용은, 예를 들어 Champe M et al, (1995) J Biol Chem 270: 1388-1394 및 Cunningham BC & Wells JA (1989) Science 244: 1081-1085를 참조한다.
용어 "에피토프 맵핑"은 항체-항원 인식을 위한 분자 결정기를 확인하는 과정을 말한다.
둘 이상의 항체와 관련하여 용어 "동일한 에피토프에 결합한다"는 주어진 방법에 의해 결정되었을 때 항체들이 아미노산 잔기의 동일한 세그먼트에 결합한다는 것을 의미한다. 항체가 본 명세서에 제시된 항체와 "ETA 상의 동일한 에피토프"에 결합하는지의 여부를 결정하는 기술은, 예를 들어 에피토프 맵핑 방법, 예컨대 해당 에피토프의 원자분해능을 제공하는 항원:항체 복합체 결정에 대한 x-선 분석 및 수소/중수소 교환 질량분석법(HDX-MS)을 포함한다. 다른 방법은 항원 단편이나 항원의 돌연변이된 변이형에 대한 항체의 결합을 모니터하며, 이 경우 항원 서열 내에서 아미노산 잔기의 변형으로 인한 결합의 상실이 에피토프 성분의 징표로서 주로 고려된다. 또한, 에피토프 맵핑을 위한 컴퓨터 조합방식 방법이 사용될 수 있다. 이들 방법은 조합방식 파지 디스플레이 펩타이드 라이브러리로부터 특정한 짧은 펩타이드를 친화성 분리할 수 있는 관심 항체의 능력에 의존한다. 동일한 VH 및 VL 또는 동일한 CDR1, 2 및 3 서열을 가진 항체는 동일한 에피토프에 결합할 것으로 예상된다.
"표적과의 결합에 대해 다른 항체와 경쟁하는" 항체는 나머지 항체와 표적의 결합을 억제하는(부분적으로 또는 완전히) 항체를 말한다. 두 항체가 표적과의 결합에 대해 서로 경쟁하는지의 여부, 즉 하나의 항체가 나머지 항체와 표적의 결합을 억제하는지의 여부 및 그 정도는 공지된 경쟁 실험을 사용하여 결정될 수 있다. 특정 구체예에서, 항체는 다른 항체와 표적의 결합에 대해 경쟁하며, 다른 항체와 표적의 결합을 적어도 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% 또는 100%만큼 억제한다. 억제 또는 경쟁의 수준은 항체가 "차단 항체"(즉, 먼저 표적과 함께 인큐베이션되는 냉장 항체)인지에 따라 상이할 수 있다. 경쟁 분석은, 예를 들어 Ed Harlow and David Lane, Cold Spring Harb Protoc; 2006; doi: 10.1101/pdb. prot4277 또는 Ed Harlow and David Lane, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, USA 1999 "Using Antibodies"의 제11장에 개시된 대로 수행될 수 있다. 경쟁 항체는 동일한 에피토프, 중첩 에피토프 또는 인접 에피토프(예를 들어, 입체 장해에 의해 증명된 대로)에 결합한다.
다른 경쟁 결합 분석은 고체상 직접 또는 간접 방사성면역분석(RIA), 고체상 직접 또는 간접 효소면역분석(EIA), 샌드위치 경쟁 분석(Stahli et al, Methods in Enzymology 9:242(1983) 참조); 고체상 직접 바이오틴-아비딘 EIA(Kirkland et al, J. Immunol. 137:3614(1986) 참조); 고체상 직접 표지 분석, 고체상 직접 표지 샌드위치 분석(Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Press (1988) 참조); I-125 표지를 사용하는 고체상 직접 표지 RIA(Morel et al., Mol. Immunol. 25(1):7 (1988) 참조); 고체상 직접 바이오틴-아비딘 EIA (Cheung et al, Virology 176:546 (1990) 참조); 및 직접 표지 RIA(Moldenhauer et al, Scand. J. Immunol. 32:77 (1990) 참조)를 포함한다.
"이중특이적" 또는 "이중기능성" 항체는 두 상이한 중쇄/경쇄 쌍과 두 상이한 결합 부위를 가진 인공 하이브리드 항체이다. 이중특이적 항체는 하이브리도마들의 융합 또는 Fab' 단편들의 결합을 포함하는 여러 방법에 의해 생성될 수 있다(예를 들어, Songsivilai & Lachmann, Clin. Exp. Immunol. 79:315-321 (1990); Kostelny et al, J. Immunol. 148, 1547-1553 (1992) 참조).
본 명세서에 제시된 "단일클론항체"는 특정한 에피토프에 대해 단일 결합 특이성 및 친화성을 나타내는 항체 또는 모든 항체가 특정한 에피토프에 대해 단일 결합 특이성 및 친화성을 나타내는 항체들의 조합을 말한다. 따라서, 용어 "인간 단일클론항체"는 단일 결합 특이성을 나타내며, 인간 점라인 면역글로불린 서열로부터 유래된 가변 영역 및 선택적인 불변영역을 가진 항체 또는 항체 조성물을 말한다. 한 구체예에서, 인간 단일클론항체는 불멸화된 세포에 융합된 인간 중쇄 트랜스젠 및 경쇄 트랜스젠을 포함하는 게놈을 가진 트랜스제닉 비-사람 동물, 예를 들어 트랜스제닉 마우스로부터 얻어진 B 세포를 포함하는 하이브리도마에 의해 생성된다.
본 명세서에 제시된 "재조합 인간 항체"는 재조합 수단에 의해 제조, 발현, 생성 또는 분리된 모든 인간 항체를 포함하며, 예컨대 (a) 인간 면역글로불린 유전자에 대해 트랜스제닉 또는 트랜스크로모조말인 동물(예를 들어, 마우스) 또는 그로부터 제조된 하이브리도마로부터 분리된 항체, (b) 항체를 발현하도록 형질전환된 숙주 세포로부터, 예를 들어 트랜스펙토마로부터 분리된 항체, (c) 재조합, 조합방식 인간 항체 라이브러리로부터 분리된 항체, 및 (d) 인간 면역글로불린 유전자 서열과 다른 DNA 서열의 스플라이싱을 수반하는 임의의 다른 수단에 의해 제조, 발현, 생성 또는 분리된 항체가 있다. 이러한 재조합 인간 항체는 가변 및 불변 영역을 포함하며, 이들은 점라인 유전자에 의해 암호화된 특정한 인간 점라인 면역글로불린 서열을 이용하지만, 예를 들어 항체 성숙화 동안 일어나는, 후속 재배열 및 돌연변이를 포함한다. 당업계에 공지된 대로(예를 들어, Lonberg (2005) Nature Biotech. 23(9): 1117-1125 참조), 가변 영역은 항원 결합 도메인을 함유하고, 외래 항원에 특이적인 항체를 형성하도록 재배열한 다양한 유전자에 의해 암호화된다. 재배열에 더하여, 가변영역은 외래 항원에 대한 항체의 친화성을 증가시키기 위해 다수의 단일 아미노산 변화에 의해 더 변형될 수 있다(체세포 돌연변이 또는 초돌연변이). 불변영역은 항원에 대한 추가의 반응에서 변화할 것이다(즉, 이소타입 스위치). 따라서, 항원에 반응하여 경쇄 및 중쇄 면역글로불린 폴리펩타이드를 암호화하는 재배열되고 체세포 돌연변이된 핵산 분자는 모 핵산 분자와 서열 동일성을 가질 수는 없지만, 대신 실질적으로 동일하거나 유사할 것이다(즉, 적어도 80% 동일성을 가진다).
"인간" 항체(HuMAb)는 프레임워크와 CDR 영역이 둘 다 인간 점라인 면역글로불린 서열로부터 유래된 가변 영역을 가진 항체를 말한다. 또한, 항체가 불변영역을 함유하는 경우, 불변영역도 역시 인간 점라인 면역글로불린 서열로부터 유래된다. 본 명세서에 개시된 항체는 인간 점라인 면역글로불린 서열에 의해 암호화되지 않는 아미노산 잔기를 포함할 수 있다(예를 들어, 시험관내 무작위 또는 부위-특이적 돌연변이유발에 의해 또는 생체내 체세포 돌연변이에 의해 도입된 돌연변이). 그러나, 본 명세서에 개시된 "인간 항체"는 마우스와 같은 다른 포유류 종의 점라인으로부터 유래된 CDR 서열이 인간 프레임워크 서열 위에 그래프팅된 항체를 포함하지는 않는다. 용어 "인간" 항체 및 "완전 인간" 항체는 동의어로서 사용된다.
"인간화" 항체는 비-인간 항체의 CDR 도메인 바깥에 있는 아미노산의 일부, 대부분 또는 전부가 인간 면역글로불린으로부터 유래된 상응하는 아미노산으로 치환된 항체를 말한다. 항체의 인간화 형태의 한 구체예에서, CDR 도메인의 바깥에 있는 아미노산의 일부, 대부분 또는 전부가 인간 면역글로불린으로부터의 아미노산으로 치환되었고, 하나 이상의 CDR 영역 내의 아미노산의 일부, 대부분 또는 전부는 그대로 유지된다. 아미노산의 작은 추가, 결실, 삽입, 치환 또는 변형은 항체가 특정 항원에 결합하는 능력을 없애지 않는 한 허용될 수 있다. "인간화" 항체는 모 항체와 유사한 항원 특이성을 보유한다.
"키메라 항체"는 가변영역이 하나의 종으로부터 유래되고 불변영역이 다른 종으로부터 유래된 항체, 예컨대 가변 영역이 마우스 항체로부터 유래되고 불변 영역이 인간 항체로부터 유래된 항체를 말한다.
본 명세서에 개시된 용어 "교차 반응한다"는 본 명세서에 제시된 항체가 상이한 종으로부터의 ETA에 결합하는 능력을 말한다. 예를 들어, 인간 ETA에 결합하는 항체는 또한 ETA의 다른 종(예를 들어, 마우스 ETA)에도 결합할 수 있다. 교차 반응성은 결합 분석(예를 들어, SPR, ELISA)에서 정제된 항원과의 특이적 반응성을 검출함으로써, 또는 ETA를 생리적으로 발현하는 세포에 대한 결합 또는 다른 기능적 상호작용을 검출함으로써 측정될 수 있다. 교차 반응성을 결정하는 방법은 본 명세서에 제시된 표준 결합 분석, 예를 들어 BIACORE 2000 SPR 기기(Biacore AB, Uppsala, Sweden)를 사용한 BIACORE 표면 플라스몬 공명(SPR) 분석, 또는 유세포계수 기술을 포함한다.
본 발명의 항체 또는 이의 단편은 GPCR(예를 들어, 엔토텔린 수용체 A)의 세포외 부위를 항원으로 인식하여 이에 특이적으로 결합하는데, GPCR의 세포외 부위는 1개의 N-term과 3개의 ECL(ECL1, ECL2 및 ECL3)을 포함하는 바, 상기 N-term, ECL1, ECL2 및 ECL3로 구성된 군으로부터 선택되는 1 이상의 세포외 부위를 에피토프로 하여 특이적으로 결합할 수 있으며, 상기 에피토프는 1 또는 그 이상의 아미노산을 포함할 수 있다.
본 발명의 바람직한 구현예에 따르면, 상기 엔토텔린 수용체 A는 서열목록 제68서열의 아미노산 서열을 포함하는 것이다.
본 발명의 바람직한 구현예에 따르면, 상기 세포외 부위는 서열목록 제69서열의 N-term 부위, 서열목록 제70서열의 ECL1, 서열목록 제71서열의 ECL2 및 서열목록 제72서열의 ECL3로 구성된 군으로부터 선택되는 1 또는 그 이상의 부위인 것이다.
본 명세서에서, 용어 “항체”는 면역글로불린 분자 중 어느 유형의 항체(예를 들어, IgG, IgE, IgM, IgD, IgA, 또는 IgY)일 수 있으며, 어느 하위 유형의 항체(예를 들어, 인간에 있어서 IgG1, IgG2, IgG3, 및 IgG4; 및 마우스에 있어서 IgG1, IgG2a, IgG2b, 및 IgG3)일 수 있다. 면역글로불린(예를 들어, IgG1)은 다양한 알로타입(allotype)이 존재할 수 있으며, 본 명세서에서 용어 “항체”는 일반적으로 알려진 아이소타입(isotype) 및 알로타입(allotype)을 포함한다. 또한, 본 명세서에서 용어 “항체”는 IgG1, IgG2, IgG3, 또는 IgG4 이거나, 이의 하이브리드(hybrid) 유형일 수 있다(예를 들어, IgG2 및 IgG4의 하이브리드).
본 명세서에서 용어 “단일클론항체”또는 “monoclonal antibody”는 특정 에피토프에 대한 단일 결합 특이성(single binding specificity) 및 친화도(affinity)를 나타내는 항체를 의미한다.
본 명세서에서 용어 “단편”은 항원에 특이적으로 결합하는 능력을 보유한 항체의 하나 이상의 단편을 말한다. 이러한 "단편"은, 예를 들어 약 8 내지 약 1500개 아미노산 길이, 적합하게는 약 8 내지 약 745개 아미노산 길이, 약 8 내지 약 300개, 약 8 내지 약 200개 아미노산 또는 약 10 내지 약 50개 또는 100개 아미노산 길이이다. 항체의 항원-결합 기능은 전장 항체의 단편에 의해 수행되는 것으로 밝혀졌다. 항체, 예를 들어 본 명세서에 개시된 항-ETA의 "항원-결합 단편"이라는 용어에 포함된 결합 단편의 예들은 (i) Fab 단편, VL, VH, CL 및 CH1 도메인으로 구성된 1가 단편; (ii) F(ab')2 단편, 힌지 영역에서 이황화물 브릿지에 의해 연결된 2개의 Fab 단편을 포함하는 2가 단편; (iii) VH 및 CH1 도메인으로 구성된 Fd 단편; (iv) 항체의 하나의 팔의 VL 및 VH 도메인, 및 이황화물-연결된 Fv(sdFv)로 구성된 Fv 단편; (v) VH 도메인으로 구성된 dAb 단편(Ward et al, (1989) Nature 341: 544-546) 및 (vi) 분리된 상보성 결정 영역(CDR) 또는 (vii) 합성 링커에 의해 선택적으로 이어질 수 있는 둘 이상의 분리된 CDR의 조합을 포함한다. 또한, Fv 단편, VL 및 VH 중 2개 도메인은 별도의 유전자에 의해 코딩되지만, 재조합 방법을 사용하여, VL과 VH 영역이 쌍을 이루어 1가 분자(단쇄 Fv(scFv))를 형성한 단일 단백질 사슬을 이루도록 할 수 있는 합성 링커에 의해 이어질 수 있다(Bird et al, (1988) Science 242:423-426; 및 Huston et al, (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883 참조). 이러한 단쇄 항체도 역시 용어 항체의 "항원-결합 단편"에 포함되도록 의도된다. 이들 항체 단편은 당업자에게 공지된 종래의 기술을 사용하여 얻어지며, 단편은 무손상 항체와 동일한 방식으로 유용성에 대해 스크리닝된다. 항원-결합 단편은 재조합 DNA 기술, 또는 무손상 면역글로불린의 효소 또는 화학적 절단에 의해 생성될 수 있다.
VH 도메인, 또는 하나 또는 그 이상의 CDR은 중쇄(heavy chain)를 형성하기 위하여 불변 도메인에 연결될 수 있다. 또한, VL 도메인, 또는 하나 또는 그 이상의 CDR은 경쇄(light chain)를 형성하기 위하여 불변 도메인에 연결될 수 있다. 전장(full length) 중쇄 및 전장 경쇄가 결합하여 전장 항체를 구성한다.
본 명세서에서 용어 "가변영역" 또는 "가변 도메인"은 상호 교환하여 사용된다. 가변영역은 전형적으로 항체의 일부분, 일반적으로 경쇄 또는 중쇄의 일부분, 전형적으로 성숙한 중쇄에서 약 아미노-말단 110 내지 120개 아미노산 및 성숙한 경쇄에서 약 90 내지 115개 아미노산을 말하며, 이들은 항체들마다 서열이 광범위하게 상이하며 특정 항체의 특정 항원에 대한 결합 및 특이성을 특화한다. 서열의 가변성은 상보성 결정 영역(CDR)이라고 불리는 영역에 집중되며(중쇄: HCDR1, 2 및 3, 경쇄: LCDR1, 2 및 3), 가변 도메인에서 더 고도로 보존된 영역은 프레임워크 영역(FR)이라고 불린다.
경쇄 및 중쇄의 CDR은 항체와 항원의 상호작용 및 특이성을 주로 담당한다. 특정 구체예에서, 가변영역은 인간 가변영역이다. 특정 구체예에서, 가변영역은 설치류 또는 뮤린 CDR과 인간 프레임워크 영역(FR)을 포함한다. 특정 구체예에서, 가변영역은 영장류(예를 들어, 비-인간 영장류) 가변영역이다. 특정 구체예에서, 가변영역은 설치류 또는 뮤린 CDR과 영장류(예를 들어, 비-인간 영장류) 프레임워크 영역(FR)을 포함한다.
본 명세서에 용어 "중쇄"는 항체와 함께 사용되는 경우 임의의 상이한 타입, 예를 들어 불변도메인의 아미노산 서열에 기초하여 알파(α), 델타(δ), 엡실론(ε), 감마(γ) 및 뮤(μ)를 말할 수 있고, 이들은 각각 IgG의 서브클래스, 예를 들어 IgGl, IgG2, IgG3 및 IgG4를 포함하는 항체의 IgA, IgD, IgE, IgG 및 IgM 유형을 발생시킨다.
본 명세서에 제시된 용어 "경쇄"는 항체와 함께 사용되는 경우 임의의 상이한 타입, 예를 들어 불변도메인의 아미노산 서열에 기초하여 카파(κ) 또는 람다(λ)를 말할 수 있다. 경쇄 아미노산 서열은 당업계에 잘 공지되어 있다. 특정 구체예에서, 경쇄는 인간 경쇄이다.
용어 "VL" 및 "VL 도메인"은 상호 교환하여 사용되며 항체의 경쇄 가변영역을 말한다.
용어 "VH" 및 "VH 도메인"은 상호 교환하여 사용되며 항체의 중쇄 가변영역을 말한다.
본 명세서에서 용어 "불변영역" 또는 "불변 도메인"은 상호 교환이 가능하다. 불변영역은 항체 부분, 예를 들어 항체와 항원의 결합에는 직접 수반되지 않지만 Fc 수용체와의 상호작용과 같은 다양한 이펙터 기능을 나타낼 수 있는 경쇄 및/또는 중쇄의 카복시 말단 부분이다. 면역글로불린 분자의 불변영역은 일반적으로 면역글로불린 가변 도메인에 비해 더 보존된 아미노산 서열을 가진다.
"Fc 영역"(단편 결정화 가능한 영역), "Fc 도메인" 또는 "Fc"는 면역계의 다양한 세포(예를 들어, 이펙터 세포) 상에 위치된 Fc 수용체 또는 고전적 보체 시스템의 제1 성분(Clq)과의 결합을 포함하는, 면역글로불린과 숙주 조직 또는 인자의 결합을 매개하는 항체의 중쇄의 C-말단 영역을 말한다. 따라서, Fc 영역은 제1 불변영역 면역글로불린 도메인(예를 들어, CH1 또는 CL)을 제외한 항체의 불변영역을 포함한다. IgG, IgA 및 IgD 항체 이소타입에서, Fc 영역은 항체의 두 중쇄의 제2(CH2) 및 제3(CH3) 불변 도메인으로부터 유래된, 두 동일한 단백질 단편을 포함한다; IgM 및 IgE Fc 영역은 각 폴리펩타이드 사슬에서 3개의 중쇄 불변 도메인(CH 도메인 2-4)을 포함한다. IgG의 경우, Fc 영역은 면역글로불린 도메인 Cγ2 및 Cγ3 그리고 Cγ1과 Cγ2 사이의 힌지를 포함한다. 면역글로불린 중쇄의 Fc 영역의 경계는 가변적일 수 있지만, 인간 IgG 중쇄 Fc 영역은 일반적으로 위치 C226 또는 P230에 있는 아미노산 잔기(또는 이들 두 아미노산 사이의 아미노산)에서부터 중쇄의 카복시-말단까지 늘어나는 것으로 정의되며, 여기서 넘버링은 Kabat에 제시된 EU 인덱스를 따른다. 인간 IgG Fc 영역의 CH2 도메인은 대략 아미노산 231에서 대략 아미노산 340까지 연장되고, CH3 도메인은 Fc 영역에서 Cm 도메인의 C-말단 측에 위치되는데, 즉 IgG의 대략 아미노산 341에서부터 대략 아미노산 447까지 연장된다. 본 명세서에 제시된 Fc 영역은 임의의 알로타입 변이체를 포함하는 자생 서열 Fc 또는 변이체 Fc(예를 들어, 비-자연 발생 Fc)일 수 있다. 또한, Fc는 "Fc 융합 단백질"(예를 들어, 항체 또는 면역접합체)라고도 하는 "Fc 영역을 포함하는 결합 단백질"과 같은 Fc-포함 단백질 폴리펩타이드일 수 있다.
"자생 서열 Fc 영역" 또는 "자생 서열 Fc"는 자연에서 발견된 Fc 영역의 아미노산 서열과 동일한 아미노산 서열을 포함한다. 자생 서열 인간 Fc 영역은 자생 서열 인간 IgG1 Fc 영역; 자생 서열 인간 IgG2 Fc 영역; 자생 서열 인간 IgG3 Fc 영역; 및 자생 서열 인간 IgG4 Fc 영역뿐만 아니라 이들의 자연적으로 발생한 변이체를 포함한다. 자생 서열 Fc는 Fes의 다양한 알로타입을 포함한다(예를 들어, Jefferis et al, (2009) mAbs 1:1; Vidarsson G. et al., Front Immunol. 5:520).
불변영역은 하나 이상의 이펙터 기능을 제거하기 위해, 예를 들어 재조합 기술에 의해 조작될 수 있다. "이펙터 기능"은 항체 Fc 영역과 Fc 수용체 또는 리간드의 상호작용, 또는 그로부터의 결과인 생화학적 사건을 말한다. 예시적인 "이펙터 기능"은 Clq 결합, 보체 의존적 세포독성(CDC), Fc 수용체 결합, FcγR-매개 이펙터 기능, 예컨대 ADCC 및 항체 의존적 세포-매개 포식작용(ADCP) 및 세포 표면 수용체(예를 들어, B 세포 수용체; BCR)의 하향조절을 포함한다. 이러한 이펙터 기능은 일반적으로 결합 도메인(예를 들어, 항체 가변 도메인)과 조합될 수 있는 Fc 영역을 필요로 한다. 따라서, 용어 "Fc 기능이 없는 불변영역"은 Fc 영역에 의해 매개된 하나 이상의 이펙터 기능이 감소되거나 아예 없는 불변영역을 포함한다.
항체의 이펙터 기능은 상이한 접근법에 의해 감소되거나 또는 회피될 수 있다. 항체의 이펙터 기능은 Fc 영역을 결여한 항체 단편(예를 들어, Fab, F(ab')2, 단쇄 Fv(scFv), 또는 모노머 VH 또는 VL 도메인으로 구성된 sdAb와 같은)을 사용하여 감소되거나 또는 회피될 수 있다. 또는, Fc 영역에서 특정 잔기에 결합된 당을 제거하여 소위 말하는 비글리코실화된(aglycosylated) 항체가 생성될 수 있으며, 이로써 Fc 영역의 다른 가치있는 속성(예를 들어, 연장된 반감기 및 헤테로다이머화)은 유지한 채로 항체의 이펙터 기능을 감소시킬 수 있다. 비글리코실화된 항체는, 예를 들어 당이 부착된 잔기의 결실 또는 변경, 효소적 당 제거, 글리코실화 억제제의 존재하에 배양된 세포에서 항체의 생성, 또는 단백질을 글리코실화할 수 없는 세포(예를 들어, 박테리아 숙주 세포)에서 항체의 발현에 의해 생성될 수 있다. 다른 접근법은 감소된 이펙터 기능을 가진 IgG 서브클래스로부터 Fc 영역을 이용하는 것이며, 예를 들어 IgG2 및 IgG4 항체는 IgG1 및 IgG3보다 더 낮은 수준의 Fc 이펙터 기능의 갖는 것을 특징으로 한다. Fc 부분의 CH2 도메인에서 힌지 영역에 가장 가까이 있는 잔기가 항체의 이펙터 기능을 담당하며, 그것은 선천적 면역계의 이펙터 세포 상의 Clq(보체) 및 IgG-Fc 수용체(FcγR)에 대해 상당히 중첩된 결합 부위를 함유한다(Vidarsson G. et al., Front Immunol. 5:520, 2014). 따라서, Fc 이펙터 기능이 감소되거나 없는 항체는, 예를 들어 IgG4 이소타입의 IgG 항체로부터의 CH2 도메인과 IgG1 이소타입의 IgG 항체로부터의 CH3 도메인을 포함하는 키메라 Fc 영역, 또는 IgG2로부터의 힌지 영역과 IgG4로부터의 CH2 영역을 포함하는 키메라 Fc 영역(예를 들어, Lau C. et al, J. Immunol. 191 :4769-4777 (2013) 참조), 또는 변경된 Fc 이펙터 기능, 예를 들어 감소되거나 없는 Fc 기능을 가져오는 돌연변이를 가진 Fc 영역을 생성함으로써 제조될 수 있다. 돌연변이를 가진 이러한 Fc 영역은 당업계에 공지되어 있다(예를 들어, 대한민국 특허공개번호 제10-2018-0113904호 참조).
"힌지", "힌지 도메인", "힌지 영역" 또는 "항체 힌지 영역"은 CH1 도메인과 CH2 도메인을 연결하는 중쇄 불변 영역의 도메인을 말하며, 힌지의 상부, 중앙 및 하부 부분을 포함한다(Roux et al, J. Immunol. 1998 161: 4083). 힌지는 항체의 결합 영역과 이펙터 영역 사이에 다양한 수준의 가요성을 제공하며, 또한 두 중쇄 불변 영역 사이에 분자간 이황화물 결합을 위한 부위를 제공한다. 본 명세서에 제시된 힌지는 모든 IgG 이소타입에 대해 Glu216에서 시작해서 Gly237에서 끝난다(Roux et al, 1998 J Immunol 161: 4083). 야생형 IgG1, IgG2, IgG3 및 IgG4 힌지의 서열은 당업계에 공지되어 있다(예를 들어, Kabat EA et al, (1991) Sequences of Proteins of Immunological Interest, 5th Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242; Vidarsson G. et al., Front Immunol. 5:520(온라인 공개 2014-10-20) 참조).
용어 "CH1 도메인"은 중쇄 불변 도메인의 힌지와 가변 도메인을 연결하는 중쇄 불변영역을 말한다. 본 명세서에 제시된 CH1 도메인은 A118에서 시작해서 V215에서 끝난다. 용어 "CH1 도메인"은 야생형 CH1 도메인뿐만 아니라 자연적으로 존재하는 이의 변이체들을 포함한다(예를 들어, 알로타입). IgG1, IgG2, IgG3 및 IgG4의 CH1 도메인 서열(야생형 및 알로타입을 포함)은 당업계에 공지되어 있다(예를 들어, Kabat EA et al, (1991) 상동 및 Vidarsson G. et al., Front Immunol. 5:520(온라인 공개 2014-10-20) 참조).
용어 "CH2 도메인"은 중쇄 불변 도메인의 CH3 도메인과 힌지를 연결하는 중쇄 불변영역을 말한다. 본 명세서에 제시된 CH2 도메인은 P238에서 시작해서 K340에서 끝난다. 용어 "CH2 도메인"은 야생형 CH2 도메인뿐만 아니라 자연적으로 존재하는 이의 변이체들을 포함한다(예를 들어, 알로타입). IgG1, IgG2, IgG3 및 IgG4의 CH2 도메인 서열(야생형 및 알로타입을 포함)은 당업계에 공지되어 있다(예를 들어, Kabat EA et al, (1991) 상동 및 Vidarsson G. et al., Front Immunol. 5:520(온라인 공개 2014-10-20) 참조). 예시적인 CH2 도메인은 항체의 생물학적 활성, 예를 들어 반감기 및/또는 감소된 Fc 이펙터 기능을 변형하는 도메인을 가진 CH2 도메인을 포함한다(미국 특허공개번호 제20120100140호 참조).
용어 "CH3 도메인"은 중쇄 불변 도메인의 CH2 도메인을 향해서 C-말단인 중쇄 불변영역을 말한다. 본 명세서에 제시된 CH3 도메인은 G341에서 시작해서 K447에서 끝난다. 용어 "CH3 도메인"은 야생형 CH3 도메인뿐만 아니라 자연적으로 존재하는 이의 변이체들을 포함한다(예를 들어, 알로타입). IgG1, IgG2, IgG3 및 IgG4의 CH3 도메인 서열(야생형 및 알로타입을 포함)은 당업계에 공지되어 있다(예를 들어, Kabat EA et al, (1991) 상동 및 Vidarsson G. et al., Front Immunol. 5:520(온라인 공개 2014-10-20) 참조). 예시적인 CH3 도메인은 항체의 생물학적 활성, 예를 들어 반감기를 변형하는 도메인을 가진 CH3 도메인을 포함한다(미국 특허공개번호 제20120100140호 참조).
본 명세서에 제시된 "이소타입"은 중쇄 불변 영역 유전자에 의해 암호화되는 항체 유형(예를 들어, IgG1, IgG2, IgG3, IgG4, IgM, IgA1, IgA2, IgD 및 IgE 항체)을 말한다.
"알로타입"은 특정한 이소타입 그룹 내에서 자연적으로 발생하는, 몇 개의 아미노산에 차이가 있는 변이체들을 말한다(예를 들어, Jefferis et al, (2009) mAbs 1: 1). 본 명세서에 개시된 항체는 임의의 알로타입을 가질 수 있다. IgG1, IgG2, IgG3 및 IgG4의 알로타입은 당업계에 공지되어 있다(예를 들어, Kabat EA et al, (1991) 상동; Vidarsson G. et al., Front Immunol. 5:520(온라인 공개 2014-10-20); 및 Lefranc MP, mAbs 1:4, 1-7 (2009) 참조).
문구 "항원을 인식하는 항체" 및 "항원에 대해 특이적인 항체"는 용어 "항원에 특이적으로 결합하는 항체"와 상호 교환하여 본 명세서에서 사용된다.
본 명세서에 "분리된 항체"는 상이한 항원 특이성을 가진 다른 항체가 실질적으로 없는 항체를 말한다(예를 들어, ETA에 특이적으로 결합하는 분리된 항체는 ETA 이외의 다른 항원에 특이적으로 결합하는 항체가 실질적으로 없다). 그러나, ETA의 에피토프에 특이적으로 결합하는 분리된 항체는 상이한 종으로부터의 다른 ETA 단백질에 대해 교차 반응성을 가진다.
본 명세서에 개시된 용어 "특이적으로 결합한다", "특이적으로 인식한다", "특이적 결합", "선택적 결합" 및 "선택적으로 결합한다"는 항체와 관련하여 유사한 용어들이며, 항원(예를 들어, 에피토프 또는 면역 복합체)에 결합하는 분자(예를 들어, 항체)를 말하고, 이러한 결합은 당업자에 의해 이해되는 대로이다.
항체는 전형적으로 10-5 내지 10-11 M 이하의 해리 상수(KD)에 의해 반영된, 높은 친화성으로 동족 항원에 특이적으로 결합한다. 약 10-4 M을 초과하는 임의의 KD는 일반적으로 비특이적 결합을 나타내는 것으로 간주된다. 본 명세서에 제시된 항원에 "특이적으로 결합하는" 항체는 높은 친화성으로 항원 및 실질적으로 동일한 항원에 결합하지만 관련 없는 항원에는 높은 친화성으로 결합하지 않는 항체를 말하며, 높은 친화성이란, 예를 들어 정해진 항원을 사용하여 면역분석 기술에 의해 결정되었을 때 10-7 M 이하, 바람직하게 10-8 M 이하, 더욱더 바람직하게 10-9 M 이하 및 가장 바람직하게 10-8 M 내지 10-10 M 이하의 KD를 갖는 것을 의미한다.
본 발명의 바람직한 구현예에 따르면, 상기 단일클론항체 또는 이의 단편은 중쇄 가변영역에 서열목록 제38서열의 CDR1, 서열목록 제39서열의 CDR2를 포함하고, 경쇄 가변영역에 서열목록 제40서열의 CDR1, 서열목록 제41서열의 CDR2 및 서열목록 제42서열의 CDR3를 포함한다.
본 발명의 바람직한 구현예에 따르면, 상기 단일클론항체 또는 이의 단편의 중쇄 가변영역의 CDR3은 서열목록 제43서열의 아미노산 서열인 것이다.
본 발명의 바람직한 구현예에 따르면, 상기 단일클론항체 또는 이의 단편의 중쇄 가변영역의 CDR3은 서열목록 제43서열에서 4번째, 7번째, 9번째, 10번째, 11번째, 12번째, 13번째 및 14번째 아미노산으로 구성된 군으로부터 선택되는 위치에 돌연변이를 포함하는 것이다.
본 발명의 바람직한 구현예에 따르면, 상기 중쇄 가변영역의 CDR3은 서열목록 제43서열에서 4번째 아미노산이 P(발린)로; 7번째 아미노산이 L(류신)로; 9번째 아미노산이 V(발린)로; 10번째 아미노산이 I(이소류신) 또는 H(히스티딘)로; 11번째 아미노산이 F(페닐알라닌) 또는 Q(글루타민)로; 12번째 아미노산이 E(글루타메이트)로; 13번째 아미노산이 N(아스파라진) 또는 C(시스테인)로; 또는 14번째 아미노산이 L(류신)로 치환된 돌연변이를 포함하는 것이다.
본 발명의 바람직한 구현예에 따르면, 상기 중쇄 가변영역의 CDR3은 서열목록 제44서열, 서열목록 제45서열, 서열목록 제46서열, 서열목록 제47서열, 서열목록 제48서열, 서열목록 제49서열, 서열목록 제50서열, 서열목록 제51서열, 서열목록 제52서열, 서열목록 제53서열 및 서열목록 제54서열로 구성된 군으로부터 선택되는 아미노산 서열인 것이다.
본 발명의 바람직한 구현예에 따르면, 상기 경쇄 가변영역은 서열목록 제55서열의 아미노산 서열을 포함하는 것이다.
본 발명의 바람직한 구현예에 따르면, 상기 중쇄 가변영역은 서열목록 제56서열, 서열목록 제57서열, 서열목록 제58서열, 서열목록 제59서열, 서열목록 제60서열, 서열목록 제61서열, 서열목록 제62서열, 서열목록 제63서열, 서열목록 제64서열, 서열목록 제65서열, 서열목록 제66서열 및 서열목록 제67서열로 구성된 군으로부터 선택되는 아미노산 서열을 포함하는 것이다.
본 발명의 다른 양태에 따르면, 본 발명은 상기 단일클론항체 또는 이의 단편을 코딩하는 핵산분자, 상기 핵산분자를 포함하는 벡터 또는 상기 벡터를 포함하는 숙주세포를 제공한다.
본 발명의 핵산분자는 단리된 것이거나 재조합된 것일 수 있으며, 단일쇄 및 이중쇄 형태의 DNA 및 RNA뿐만 아니라 대응하는 상보성 서열이 포함된다. "단리된 핵산"은 천연 생성 원천에서 단리된 핵산의 경우, 핵산이 단리된 개체의 게놈에 존재하는 주변 유전 서열로부터 분리된 핵산이다. 주형으로부터 효소적으로 또는 화학적으로 합성된 핵산, 예컨대 PCR 산물, cDNA 분자, 또는 올리고뉴클레오타이드의 경우, 이러한 절차로부터 생성된 핵산이 단리된 핵산분자로 이해될 수 있다. 단리된 핵산분자는 별도 단편의 형태 또는 더 큰 핵산 구축물의 성분으로서의 핵산 분자를 나타낸다. 핵산은 다른 핵산 서열과 기능적 관계로 배치될 때 "작동가능하게 연결"된다. 예를 들면, 전서열 또는 분비 리더(leader)의 DNA는 폴리펩타이드가 분비되기 전의 형태인 전단백질(preprotein)로서 발현되는 경우 폴리펩타이드의 DNA에 작동가능하게 연결되고, 프로모터 또는 인핸서는 폴리펩타이드 서열의 전사에 영향을 주는 경우 코딩 서열에 작동가능하게 연결되며, 또는 리보솜 결합 부위는 번역을 촉진하도록 배치될 때 코딩 서열에 작동가능하게 연결된다. 일반적으로 "작동가능하게 연결된"은 연결될 DNA 서열들이 인접하여 위치함을 의미하며, 분비 리더의 경우 인접하여 동일한 리딩 프레임 내에 존재하는 것을 의미한다. 그러나 인핸서는 인접하여 위치할 필요는 없다. 연결은 편리한 제한 효소 부위에서 라이게이션에 의해 달성된다. 이러한 부위가 존재하지 않는 경우, 합성 올리고뉴클레오타이드 어댑터 또는 링커를 통상적인 방법에 따라 사용한다.
본 명세서에서 용어 "벡터"는 핵산 서열을 복제할 수 있는 세포로의 도입을 위해서 핵산 서열을 삽입할 수 있는 전달체를 의미한다. 핵산 서열은 외생 (exogenous) 또는 이종 (heterologous)일 수 있다. 벡터로서는 플라스미드, 코스미드 및 바이러스(예를 들면 박테리오파지)를 들 수 있으나, 이에 제한되지 않는다. 당업자는 표준적인 재조합 기술에 의해 벡터를 구축할 수 있다(Maniatis, et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 1988; 및 Ausubel et al., In: Current Protocols in Molecular Biology, John, Wiley & Sons, Inc, NY, 1994 등).
본 명세서에서 용어 "발현 벡터"는 전사되는 유전자 산물 중 적어도 일부분을 코딩하는 핵산 서열을 포함한 벡터를 의미한다. 일부의 경우에는 그 후 RNA 분자가 단백질, 폴리펩타이드, 또는 펩타이드로 번역된다. 발현 벡터에는 다양한 조절서열을 포함할 수 있다. 전사 및 번역을 조절하는 조절서열과 함께 벡터 및 발현 벡터에는 또 다른 기능도 제공하는 핵산 서열도 포함될 수 있다.
본 명세서에서 용어 "숙주세포"는 진핵생물 및 원핵생물을 포함하며, 상기 벡터를 복제할 수 있거나 벡터에 의해 코딩되는 유전자를 발현할 수 있는 임의의 형질 전환 가능한 생물을 의미한다. 숙주세포는 상기 벡터에 의해 형질감염(transfected) 또는 형질전환(transformed) 될 수 있으며, 이는 외생의 핵산분자가 숙주세포 내에 전달되거나 도입되는 과정을 의미한다.
본 발명의 숙주세포는 바람직하게는 세균(bacteria)세포, CHO 세포, HeLa 세포, HEK293 세포, BHK-21 세포, COS7 세포, COP5 세포, A549 세포, NIH3T3 세포 등을 들 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상기 항체 또는 이의 단편, 상기 핵산분자 또는 상기 벡터를 포함하는 조성물을 제공한다.
본 발명의 바람직한 구현예에 따르면, 본 발명의 조성물은 고혈압 또는 암의 예방 또는 치료용 약제학적 조성물이다.
본 발명의 약제학적 조성물은 (a) 상기 단일클론항체 또는 이의 단편, 상기 핵산분자 또는 상기 핵산분자를 포함하는 벡터; 및 (b) 약제학적으로 허용되는 담체를 포함할 수 있다.
본 발명의 또 다른 양태에 따르면, 본 발명은 약제학적 유효량의 상기 단일클론항체 또는 이의 단편, 핵산분자 또는 벡터를 대상(subject)에게 투여하는 단계를 포함하는 암 또는 고혈압의 치료방법을 제공한다.
본 발명의 또 다른 양태에 따르면, 본 발명은 암 또는 고혈압의 치료용 약제학적 조성물의 제조를 위한 상기 단일클론항체 또는 이의 단편, 핵산분자 또는 벡터의 용도를 제공한다.
본 명세서에서 "투여하는"은 당업자에게 공지된 다양한 방법 및 송달 시스템 중 어느 것을 사용하여, 대상에 치료제 또는 치료제를 포함하는 조성물을 물리적으로 도입하는 것을 말한다. 본 명세서에 제시된 항체를 위한 바람직한 투여 경로는 정맥내, 복강내, 근육내, 피하, 척추 또는 다른 비경구 투여 경로, 예를 들어 주사나 주입에 의한 경로를 포함한다. 본 명세서에 개시된 "비경구 투여"는 장 및 국소 투여 이외의 다른 투여 방식, 일반적으로 주사에 의한 것을 의미하며, 제한은 아니지만 정맥내, 복강내, 근육내, 동맥내, 척추강내, 림프내, 병소내, 낭내, 안와내, 심장내, 피내, 기관경유, 피하, 피부밑, 관절내, 낭하, 지주막하, 척추내, 경막외 및 흉골내 주사 및 주입, 뿐만 아니라 생체내 전기천공을 포함한다. 또는, 본 명세서에 제시된 항체는 비-비경구 경로, 예컨대 국소, 상피 또는 점막 투여 경로를 통해, 예를 들어 비내, 경구, 질, 직장, 설하 또는 국소 경로에 의해 투여될 수 있다. 투여는 또한, 예를 들어 1회, 여러 번, 및/또는 1회 이상의 연장된 기간에 걸쳐서 수행될 수 있다.
본 명세서 개시된 용어 "치료한다", "치료하는" 및 "치료"는 질환과 관련된 증상, 합병증, 상태 또는 생화학적 지표의 진행, 발생, 심각도 또는 재발의 역전, 경감, 완화, 저해 또는 지연이나 예방의 목적 하에 대상에 대해 수행된, 또는 대상에 활성제를 투여하는 임의의 종류의 개입이나 과정을 말한다. 치료는 질환을 가진 대상 또는 질환을 갖지 않은 대상(예를 들어, 예방을 위해)에 대해 수행될 수 있다.
본 발명이 예방 또는 치료하고자 하는 암의 종류는 제한되지 않으며, 백혈병(leukemias) 및 급성 림프구 백혈병(acute lymphocytic leukemia), 급성 비림프구 백혈병(acute nonlymphocytic leukemias), 만성 림프구 백혈병(chronic lymphocytic leukemia), 만성 골수 백혈병(chronic myelogenous leukemia), 호지킨 병(Hodgkin's Disease), 비호지킨 림프종(non-Hodgkin's lymphomas) 및 다발 골수종(multiple myeloma) 등과 같은 림프종(lymphomas), 뇌종양(brain tumors), 교모세포종(glioblastoma), 신경모세포종(neuroblastoma), 횡문근육종 (Rhabdomyosarcoma), 망막모세포종(retinoblastoma), 윌름즈종양(Wilms Tumor), 골종양(bone tumors) 및 연부조직육종(soft-tissue sarcomas) 등과 같은 소아 고형 종양(childhood solid tumors), 폐암(lung cancer), 유방암(breast cancer), 전립선암(prostate cancer), 요로암(urinary cancers), 자궁암(uterine cancers), 구강암(oral cancers), 췌장암(pancreatic cancer), 흑색종(melanoma) 및 기타 피부암(skin cancers), 위암(stomach cancer), 대장암(colon cancer), 난소암(ovarian cancer), 뇌종양(brain tumors), 간암(liver cancer), 후두암(laryngeal cancer), 갑상선암(thyroid cancer), 식도암(esophageal cancer) 및 고환암(testicular cancer) 등과 같은 성인들의 통상의 고형 종양(common solid tumors)들을 포함하여 다수의 암들을 치료하도록 투여될 수 있다.
본 명세서에서 상기 단일클론항체 또는 이의 단편, 상기 핵산분자 또는 상기 핵산분자를 포함하는 벡터나, 또는 이를 포함하는 약제학적 조성물을 투여하고자 하는 대상(subject)은 임의의 인간 또는 비-인간 동물을 포함한다. 용어 "비-인간 동물"은 모든 척추동물, 예를 들어 포유류 및 비-포유류, 예컨대 비-인간 영장류, 양, 개, 소, 닭, 양서류, 파충류 등을 포함한다.
본 발명의 약제학적 조성물에 포함되는 약제학적으로 허용되는 담체는 제제시에 통상적으로 이용되는 것으로서, 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산 칼슘, 알기네이트, 젤라틴, 규산 칼슘, 미세결정성 셀룰로스, 폴리비닐피롤리돈, 셀룰로스, 물, 시럽, 메틸 셀룰로스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘 및 미네랄 오일 등을 포함하나, 이에 한정되는 것은 아니다. 본 발명의 약제학적 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등을 추가로 포함할 수 있다. 적합한 약제학적으로 허용되는 담체 및 제제는 Remington's Pharmaceutical Sciences (19th ed., 1995)에 상세히 기재되어 있다.
본 발명의 약제학적 조성물은 경구 또는 비경구로 투여할 수 있고, 바람직하게는 비경구 투여이며, 예컨대, 정맥 내 주입, 국소 주입 및 복강 주입 등으로 투여할 수 있다.
본 발명의 약제학적 조성물의 적합한 투여량은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 다양하며, 보통으로 숙련된 의사는 소망하는 치료 또는 예방에 효과적인 투여량을 용이하게 결정 및 처방할 수 있다. 본 발명의 바람직한 구현예에 따르면, 본 발명의 약제학적 조성물의 1일 투여량은 0.0001-100 ㎎/㎏이다.
본 발명의 약제학적 조성물은 당해 발명이 속하는 기술분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있는 방법에 따라, 약제학적으로 허용되는 담체 및/또는 부형제를 이용하여 제제화 함으로써 단위 용량 형태로 제조되거나 또는 다용량 용기 내에 내입시켜 제조될 수 있다. 이때 제형은 오일 또는 수성 매질중의 용액, 현탁액 또는 유화액 형태이거나 엑스제, 분말제, 과립제, 정제 또는 캅셀제 형태일 수도 있으며, 분산제 또는 안정화제를 추가적으로 포함할 수 있다.
본 발명의 약제학적 조성물은 단독의 요법으로 이용될 수 있으나, 다른 통상적인 화학 요법 또는 방사 요법과 함께 이용될 수도 있으며, 이러한 병행 요법을 실시하는 경우에는 보다 효과적으로 암 치료를 할 수 있다. 본 발명의 조성물과 함께 이용될 수 있는 화학 요법제는 시스플라틴(cisplatin), 카르보플라틴(carboplatin), 프로카르바진(procarbazine), 메클로레타민(mechlorethamine), 시클로포스파미드(cyclophosphamide), 이포스파미드(ifosfamide), 멜팔란(melphalan), 클로라부실(chlorambucil), 비술판(bisulfan), 니트로소우레아(nitrosourea), 디악티노마이신(dactinomycin), 다우노루비신(daunorubicin), 독소루비신(doxorubicin), 블레오마이신(bleomycin), 플리코마이신(plicomycin), 미토마이신(mitomycin), 에토포시드(etoposide), 탁목시펜(tamoxifen), 택솔(taxol), 트랜스플라티눔(transplatinum), 5-플루오로우라실(5-fluorouracil), 빈크리스틴(vincristin), 빈블라스틴(vinblastin) 및 메토트렉세이트(methotrexate) 등을 포함한다. 본 발명의 조성물과 함께 이용될 수 있는 방사 요법은 X-선 조사 및 γ-선 조사 등이다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상기 단일클론항체 또는 이의 단편을 처리하는 단계를 포함하는, 샘플 중에 포함된 엔토텔린 수용체 A(Endothelin receptor type A)의 정량 방법을 제공한다.
본 발명의 항체 또는 이의 단편은 엔토텔린 수용체 A에 특이적으로 결합하기 때문에 이를 이용하면 샘플 중에 포함된 엔토텔린 수용체 A의 양을 정확하게 측정 가능하다.
본 발명의 또 다른 양태에 따르면, 하기의 단계를 포함하는 엔토텔린 수용체 A(Endothelin receptor type A)의 과발현에 의한 질환의 진단을 위한 정보를 제공하는 방법을 제공한다:
(a) 피검자로부터 체외로 분리된 샘플을 취득하는 단계;
(b) 상기 단일클론항체 또는 이의 단편을 상기 샘플에 처리하는 단계; 및
(c) 상기 피검자의 샘플 중에 포함된 엔토텔린 수용체 A의 발현양이 정상군 샘플 중에 포함된 엔토텔린 수용체 A의 발현양 보다 높은지 여부를 확인하는 단계.
엔토텔린 수용체 A는 리간드인 ET-1의 결합에 의해 혈관수축작용을 하며(Nature reviews drug discovery, 2011, Vol. 10, 47); 방광암, 폐암, 난소암, 신장암, 대장암, 전립선암, 유방암, 자궁암, 횡문근육종, 교모세포종 등의 다양한 암에서 과발현되어 암세포의 증식, 이동, 침투, 전이, 혈관신생성 등의 주요 암진행 과정에 직접적으로 관여(Nature review cancer, 2013, Vol. 13, 637)하기 때문에, 상기 엔토텔린 수용체 A의 발현량을 정상인과 비교함으로써, 엔토텔린 수용체 A의 과발현에 의한 질환의 진단을 위한 정보를 제공할 수 있다.
본 발명의 바람직한 구현예에 따르면, 상기 엔토텔린 수용체 A의 과발현에 의한 질환은 암 또는 고혈압이다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상기 단일클론항체 또는 이의 단편을 포함하는 엔토텔린 수용체 A(Endothelin receptor type A) 정량 키트를 제공한다.
본 발명의 정량 키트는 항원항체 결합반응을 통하여 상기 항체에 대한 항원을 분석함으로써 엔토텔린 수용체 A 양을 정량할 수 있으며, 상기 항원항체 결합반응은 통상의 ELISA(Enzyme-linked immunosorbent assay), RIA(Radioimmnoassay), 샌드위치 측정법(Sandwich assay), 폴리아크릴아미드 겔 상의 웨스턴 블롯(Western Blot), 면역블롯 분석(Immunoblot assay) 및 면역조직화학염색 방법(Immnohistochemical staining)으로 이루어지는 군에서 선택되는 것이 바람직하나 이에 제한되지 않는다.
항원-항체 결합 반응을 위한 고정체로는 니트로셀룰로오스 막, PVDF막, 폴리비닐(Polyvinyl) 수지 또는 폴리스티렌(Polystyrene) 수지로 합성된 웰 플레이트(Well plate) 및 유리로 된 슬라이드 글라스(Slide glass)로 이루어지는 군으로부터 선택되는 것이 사용될 수 있으나, 이제 제한되는 것은 아니다.
상기 2차 항체는 발색반응을 하는 통상의 발색제로 표지되는 것이 바람직하며, HRP(Horseradish peroxidase), 알칼리성 인산분해효소(Alkaline phosphatase), 콜로이드 골드(Coloid gold), FITC(Poly L-lysine-fluorescein isothiocyanate), RITC(Rhodamine-B-isothiocyanate) 등의 형광물질(Fluorescein) 및 색소(Dye)로 이루어지는 군으로부터 선택되는 어느 하나의 표지체가 사용될 수 있다. 발색을 유도하는 기질은 발색반응을 하는 표지체에 따라 사용하는 것이 바람직하며, TMB(3,3',5,5'-tetramethyl bezidine), ABTS[2,2'-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid)] 및 OPD(ophenylenediamine)로 이루어지는 군으로부터 선택되는 어느 하나를 사용하는 것이 바람직하나 이에 제한되는 것은 아니다.
본 발명의 특징 및 이점을 요약하면 다음과 같다:
(i) 본 발명은 엔토텔린 수용체 A의 세포외 부위를 항원으로 인식하여 이에 특이적으로 결합하는 단일클론항체 또는 이의 단편을 제공한다.
(ii) 또한, 본 발명은 상기 단일클론항체 또는 이의 단편, 상기 핵산분자 또는 상기 벡터를 포함하는 암 또는 고혈압의 예방 또는 치료용 약제학적 조성물을 제공한다.
(iii) 본 발명의 단일클론항체는 엔토텔린 수용체 A의 신호전달과정을 억제하는 기능을 보이며 이 기능을 이용하여 엔토텔린 수용체 A가 관여하는 고혈압이나 암에 대한 치료제로서 유용하게 활용될 수 있다.
도 1은 친화도 성숙 박테리오 파지 항체 라이브러리의 구축된 결과를 나타낸다.
도 2는 ETA에 선택적 결합하는 발굴 항체의 서열을 나타낸다.
도 3은 발현된 IgG의 구조를 나타낸다.
도 4는 동물세포에서 발현된 발굴 항체의 정제 결과를 나타낸다.
도 5는 200 nM의 발굴 항체 농도에서 ETA가 발현된 동물세포 CHO-K1 세포에 10 nM의 ET-1에 의해 유발된 신호전달의 저해능을 나타내는 그래프이다.
도 6은 200 nM의 발굴 항체 농도에서 ETA가 과발현된 대장암세포주인 HT-29 세포에 10 nM의 ET-1에 의해 유발된 신호전달의 저해능을 나타내는 그래프이다.
도 7은 25 nM, 200 nM의 발굴 항체 농도에서 ETA가 과발현된 대장암세포주인 HCT-116 세포에 10 nM의 ET-1에 의해 유발된 신호전달의 저해능을 나타내는 그래프이다.
도 8은 Lead 항체 5종에 대한 활성형 인간 ETA와 쥐 ETA간의 교차 결합능을 나타내는 그래프이다.
도 9는 ETA 과발현 대장암세포주인 HCT-116에 발굴 항체의 대장암 세포 증식 억제효과를 나타내는 그래프이다.
도 10은 ETA 과발현 대장암 세포주인 HT-29 및 HCT-116에 대한 Lead 항체 5종의 대장암 세포 증식 억제효과를 나타내는 그래프이다.
도 11은 대장암 세포주 HT-29로부터 제작된 이종이식 모델에 대한 Lead 항체 5종의 대장암 성장 억제효과를 나타내는 그래프이다.
도 12는 Lead 항체 5종의 Size-Exclusion Chromatography (SEC)-HPLC의 분석 결과를 나타낸다.
도 13은 Lead 항체 5종의 당쇄 구조 분석의 결과를 나타낸다.
도 14는 Lead 항체 5종의 무게 분석 결과를 나타낸다.
도 15는 Lead 항체 5종의 열 안정성 분석 결과를 나타낸다.
도 16은 발굴 항체 처리에 따른 ETA 신호전달 과정의 산물인 ERK, AKT의 수준 감소를 나타내는 결과이다.
이하, 실시 예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시 예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시 예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예
<실시예 1> ETA에 특이적 결합 항체 클론서열 (AG8)을 이용한 박테리오 파지 항체 라이브러리의 구축
발굴된 ETA 특이적 결합 항체 (AG8, 특허 등록번호 제10-2014383호) 서열을 기반으로 기존타겟 항원에 대한 결합력과 효능이 향상된 항체 발굴을 위한 라이브러리를 제작하고자 항원-항체 결합에서 중요한 역할을 하는 것으로 알려진 CDR (Complementarity-determining regions) 중 항체의 중쇄사슬 (Heavy chain)의 CDR3번째 서열구간의 13개의 아미노산 서열을 무작위적으로 전체 아미노산 20종이 치환되도록 degenerated NNK 코돈을 이용한 affinity maturation 라이브러리를 제작하였다. PCR 기법을 이용한 항체 라이브러리 제작을 위한 DNA primer의 설계와 DNA유전 서열 증폭 및 라이브러리 구축은 Manfred T Reetz & Jose´ Daniel Carballeira 논문 (Manfred T Reetz & Jose´ Daniel Carballeira, Iterative saturation mutagenesis (ISM) for rapid directed evolution of functional enzymes, Nature Protocols, 2(4), 891-903.)과 Frances H. Arnold & George Georgiou의 저서 (Directed Evolution Library Creation: Methods and Protocols, Humana press, 2010)를 참고로 하였다. 보다 자세하게는 기존 선행 특허 출원 AG8 유전 서열에서 항체의 구조를 이루는 중쇄 사슬 프레임워크와 CDR1과 CDR2 구간의 유전자 서열, 경쇄 사슬 (Light chain)의 프레임워크와 CDR1, CDR2, 및 CDR3서열은 보존하고 중쇄사슬의 CDR3 서열만 무작위적으로 20여종의 아미노산이 치환되도록 primer를 제작하고 유전자 증폭, 클로닝 기법 등을 이용하여 친화도 성숙 항체 라이브러리 플라스미드 DNA를 제작하였다. 이후, ETA 에 선택적 결합력을 보이는 항체를 파지디스플레이 기술을 이용하기 선별하기 위하여 대장균 ER2738에 제작된 친화도 성숙 항체 라이브러리의 플라스미드 DNA를 형질 전환하여 affinity maturation 박테리오 파지 항체 라이브러리를 구축하였고, 제작된 항체 라이브러리 중 무작위적으로 선택된 클론들의 유전서열 분석결과는 도 1에 나타내었다.
서열번호 명칭 Sequence
1 AG8-CDR3H-NNK1-RV GGGTTCCCGGGCCCCA GACGTCCATACCGAAGCCATAAGTCCCCGAACCATAMNNATCTTTTGC ACAGTAATACACGGCCGTGTCCTC
2 AG8-CDR3H-NNK2-RV GGGTTCCCGGGCCCCA GACGTCCATACCGAAGCCATAAGTCCCCGAACCMNNCCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC
3 AG8-CDR3H-NNK3-RV GGGTTCCCGGGCCCCA GACGTCCATACCGAAGCCATAAGTCCCCGAMNNATACCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC
4 AG8-CDR3H-NNK4-RV GGGTTCCCGGGCCCCA GACGTCCATACCGAAGCCATAAGTCCCMNNACCATACCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC
5 AG8-CDR3H-NNK5-RV GGGTTCCCGGGCCCCA GACGTCCATACCGAAGCCATAAGTMNNCGAACCATACCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC
6 AG8-CDR3H-NNK6-RV GGGTTCCCGGGCCCCA GACGTCCATACCGAAGCCATAMNNCCCCGAACCATACCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC
7 AG8-CDR3H-NNK7-RV GGGTTCCCGGGCCCCA GACGTCCATACCGAAGCCMNNAGTCCCCGAACCATACCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC
8 AG8-CDR3H-NNK8-RV GGGTTCCCGGGCCCCA GACGTCCATACCGAAMNNATAAGTCCCCGAACCATACCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC
9 AG8-CDR3H-NNK9-RV GGGTTCCCGGGCCCCA GACGTCCATACCMNNGCCATAAGTCCCCGAACCATACCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC
10 CDR3H-NNK10-RV GGGTTCCCGGGCCCCA GACGTCCATMNNGAAGCCATAAGTCCCCGAACCATACCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC
11 AG8-CDR3H-NNK11-RV GGGTTCCCGGGCCCCA GACGTCMNNACCGAAGCCATAAGTCCCCGAACCATACCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC
12 AG8-CDR3H-NNK12-RV GGGTTCCCGGGCCCCA GACMNNCATACCGAAGCCATAAGTCCCCGAACCATACCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC
13 AG8-CDR3H-NNK13-RV GGGTTCCCGGGCCCCA MNNGTCCATACCGAAGCCATAAGTCCCCGAACCATACCTATCTTTTGC ACAGTAATACACGGCCGTGTCCTC
라이브러리 제작에 사용된 Degenerated NNK 프라이머 서열(‘5 -> 3’)
서열번호 명칭 Sequence
14 #1NNK EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDRYGSGTYFFGMDVWGPGTLVTVSS
15 #2NNK EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSMRSEDTAVYYCAKDRYGSGTYQFGMDVWGPGTLVTVSS
16 #3NNK EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDRYGSGTIGFGMDVWGPGTLVTVSS
17 #4NNK EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDRYGSGTHGFGMDVWGPGTLVTVSS
18 #5NNK EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDRYGSGTYGFNMDVWGPGTLVTVSS
19 #6NNK EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDRYGSGTYGFCMDVWGPGTLVTVSS
20 #7NNK EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDRYGSGTYGFGLDVWGPGTLVTVSS
무작위적 선택에 따른 제작된 라이브러리의 서열분석(아미노산 서열)
서열번호 명칭 Sequence
21 #1NNK GAGGTGCAGCTGGTGGAGTCTGGGGCTGAGGTGAGGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCAGTTCTGATATCAACTGGATTCGACAGGCCACTGGACAAGGGCTTGAGTGGATGGGATACATGAACCCTAAAAATGGAAACACAGACTATGCACAGAAGTTCCAGGGCAGAATCTCCATGACCAGGGACAGCTCCATAAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCAAAAGATAGGTATGGTTCGGGGACTTATTTTTTCGGTATGGACGTCTGGGGCCCGGGAACCCTGGTCACCGTCTCCTCA
22 #2NNK GAGGTGCAGCTGGTGGAGTCTGGGGCTGAGGTGAGGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCAGTTCTGATATCAACTGGATTCGACAGGCCACTGGACAAGGGCTTGAGTGGATGGGATACATGAACCCTAAAAATGGAAACACAGACTATGCACAGAAGTTCCAGGGCAGAATCTCCATGACCAGGGACAGCTCCATAAGCACAGCCTACATGGAGCTGAGCAGCATGAGATCTGAGGACACGGCCGTGTATTACTGTGCAAAAGATAGGTATGGTTCGGGGACTTATCAGTTCGGTATGGACGTCTGGGGCCCGGGAACCCTGGTCACCGTCTCCTCA
23 #3NNK GAGGTGCAGCTGGTGGAGTCTGGGGCTGAGGTGAGGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCAGTTCTGATATCAACTGGATTCGACAGGCCACTGGACAAGGGCTTGAGTGGATGGGATACATGAACCCTAAAAATGGAAACACAGACTATGCACAGAAGTTCCAGGGCAGAATCTCCATGACCAGGGACAGCTCCATAAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCAAAAGATAGGTATGGTTCGGGGACTATTGGCTTCGGTATGGACGTCTGGGGCCCGGGAACCCTGGTCACCGTCTCCTCA
24 #4NNK GAGGTGCAGCTGGTGGAGTCTGGGGCTGAGGTGAGGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCAGTTCTGATATCAACTGGATTCGACAGGCCACTGGACAAGGGCTTGAGTGGATGGGATACATGAACCCTAAAAATGGAAACACAGACTATGCACAGAAGTTCCAGGGCAGAATCTCCATGACCAGGGACAGCTCCATAAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCAAAAGATAGGTATGGTTCGGGGACTCATGGCTTCGGTATGGACGTCTGGGGCCCGGGAACCCTGGTCACCGTCTCCTCA
25 #5NNK GAGGTGCAGCTGGTGGAGTCTGGGGCTGAGGTGAGGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCAGTTCTGATATCAACTGGATTCGACAGGCCACTGGACAAGGGCTTGAGTGGATGGGATACATGAACCCTAAAAATGGAAACACAGACTATGCACAGAAGTTCCAGGGCAGAATCTCCATGACCAGGGACAGCTCCATAAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCAAAAGATAGGTATGGTTCGGGGACTTATGGCTTCAATATGGACGTCTGGGGCCCGGGAACCCTGGTCACCGTCTCCTCA
26 #6NNK GAGGTGCAGCTGGTGGAGTCTGGGGCTGAGGTGAGGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCAGTTCTGATATCAACTGGATTCGACAGGCCACTGGACAAGGGCTTGAGTGGATGGGATACATGAACCCTAAAAATGGAAACACAGACTATGCACAGAAGTTCCAGGGCAGAATCTCCATGACCAGGGACAGCTCCATAAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCAAAAGATAGGTATGGTTCGGGGACTTATGGCTTCTGTATGGACGTCTGGGGCCCGGGAACCCTGGTCACCGTCTCCTCA
27 #7NNK GAGGTGCAGCTGGTGGAGTCTGGGGCTGAGGTGAGGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCAGTTCTGATATCAACTGGATTCGACAGGCCACTGGACAAGGGCTTGAGTGGATGGGATACATGAACCCTAAAAATGGAAACACAGACTATGCACAGAAGTTCCAGGGCAGAATCTCCATGACCAGGGACAGCTCCATAAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCAAAAGATAGGTATGGTTCGGGGACTTATGGCTTCGGTCTGGACGTCTGGGGCCCGGGAACCCTGGTCACCGTCTCCTCA
무작위적 선택에 따른 제작된 라이브러리의 서열분석(뉴클레오타이드 서열)
<실시예 2> 발굴된 ETA 특이적 항체의 full-length IgG 형태로 전환, 동물세포에서 발현 및 정제
제작된 항체 라이브러리를 이용하여 VCSM13 helper phage를 이용하여 라이브러리를 이용한 파지를 생성 후, 자성을 이용한 바이오패닝의 방법을 통하여 세포 외막에 선택적인 항체를 발굴하여 유전자 서열을 분석하였고, 결과는 도 2에 나타내었다. 발굴항체의 동물세포 발현, 정제 및 안정화를 위한 면역글로불린 (IgG) 형태로의 전환은 Mazor, Y의 논문 (Mazor, Y., Barnea, I., Keydar, I., & Benhar, I. (2007). Antibody internalization studied using a novel IgG binding toxin fusion. Journal of Immunological Methods, 321(1-2), 41-59.)을 참고하여 발현벡터를 준비하고 동물세포 내에서 발현 및 정제하였다. 이때 형성된 항체의 구조는 도 3에 나타내었다. 동물세포에서 발현하고 친화도 크로마토그래피를 이용하여 고순도로 정제한 단백질의 SDS-PAGE 결과는 도 4에 나타내었다.
서열번호 명칭 Sequence
28 AG8 EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDRYGSGTYGFGMDVWGPGTLVTVSSGGGSSGGGGSGGGGSGGGGSDIVMTQSPSAMSASVGDRVSITCRASQGINNYLAWFQQKPGKVPKRLMDVGSILQSGIPSRFRGRGSGTQFTLTISSLQAEDSGTYFCLQHNTYPLTFGPGTKVEIKR
29 EF12 EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDPYGSGTYGFGMDVWGPGTLVTVSSGGGSSGGGGSGGGGSGGGGSDIVMTQSPSAMSASVGDRVSITCRASQGINNYLAWFQQKPGKVPKRLMDVGSILQSGIPSRFRGRGSGTQFTLTISSLQAEDSGTYFCLQHNTYPLTFGPGTKVEIKR
30 GG12 EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDRYGSGVYGFGMDVWGPGTLVTVSSGGGSSGGGGSGGGGSGGGGSDIVMTQSPSAMSASVGDRVSITCRASQGINNYLAWFQQKPGKVPKRLMDVGSILQSGIPSRFRGRGSGTQFTLTISSLQAEDSGTYFCLQHNTYPLTFGPGTKVEIKR
31 FG12 EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDRYGLGTYGFGMDVWGPGTLVTVSSGGGSSGGGGSGGGGSGGGGSDIVMTQSPSAMSASVGDRVSITCRASQGINNYLAWFQQKPGKVPKRLMDVGSILQSGIPSRFRGRGSGTQFTLTISSLQAEDSGTYFCLQHNTYPLTFGPGTKVEIKR
32 AB9 EVQLVESGAEVRKPGASVKVSCKASGYTFTSSDINWIRQATGQGLEWMGYMNPKNGNTDYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYCAKDRYGSGTYGEGMDVWGPGTLVTVSSGGGSSGGGGSGGGGSGGGGSDIVMTQSPSAMSASVGDRVSITCRASQGINNYLAWFQQKPGKVPKRLMDVGSILQSGIPSRFRGRGSGTQFTLTISSLQAEDSGTYFCLQHNTYPLTFGPGTKVEIKR
ETA에 의한 세포신호전달 저해능을 보이는 5종의 항체 scFv 서열(아미노산 서열)
서열번호 명칭 Sequence
33 AG8 GAGGTGCAGCTGGTGGAGTCTGGGGCTGAGGTGAGGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCAGTTCTGATATCAACTGGATTCGACAGGCCACTGGACAAGGGCTTGAGTGGATGGGATACATGAACCCTAAAAATGGAAACACAGACTATGCACAGAAGTTCCAGGGCAGAATCTCCATGACCAGGGACAGCTCCATAAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCAAAAGATAGGTATGGTTCGGGGACTTATGGCTTCGGTATGGACGTCTGGGGCCCGGGAACCCTGGTCACCGTCTCCTCAGGTGGAGGGAGCTCTGGAGGTGGAGGTTCCGGTGGAGGTGGATCTGGTGGAGGTGGAAGTGACATCGTGATGACCCAGTCTCCATCTGCCATGTCTGCATCTGTCGGAGACAGAGTCTCCATCACTTGTCGGGCGAGTCAGGGCATTAACAATTATTTAGCCTGGTTTCAGCAGAAACCAGGGAAAGTCCCTAAGCGCCTGATGGATGTTGGATCCATTTTGCAAAGTGGCATCCCATCAAGATTCAGGGGCAGAGGCTCTGGGACACAATTCACTCTCACAATCAGCAGCCTGCAGGCAGAAGATTCAGGCACTTATTTCTGTCTTCAGCATAATACTTACCCCCTCACTTTCGGCCCTGGGACCAAGGTGGAGATCAAACGT
34 EF12 GAGGTGCAGCTGGTGGAGTCTGGGGCTGAGGTGAGGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCAGTTCTGATATCAACTGGATTCGACAGGCCACTGGACAAGGGCTTGAGTGGATGGGATACATGAACCCTAAAAATGGAAACACAGACTATGCACAGAAGTTCCAGGGCAGAATCTCCATGACCAGGGACAGCTCCATAAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCAAAAGATCCGTATGGTTCGGGGACTTATGGCTTCGGTATGGACGTCTGGGGCCCGGGAACCCTGGTCACCGTCTCCTCAGGTGGAGGGAGCTCTGGAGGTGGAGGTTCCGGTGGAGGTGGATCTGGTGGAGGTGGAAGTGACATCGTGATGACCCAGTCTCCATCTGCCATGTCTGCATCTGTCGGAGACAGAGTCTCCATCACTTGTCGGGCGAGTCAGGGCATTAACAATTATTTAGCCTGGTTTCAGCAGAAACCAGGGAAAGTCCCTAAGCGCCTGATGGATGTTGGATCCATTTTGCAAAGTGGCATCCCATCAAGATTCAGGGGCAGAGGCTCTGGGACACAATTCACTCTCACAATCAGCAGCCTGCAGGCAGAAGATTCAGGCACTTATTTCTGTCTTCAGCATAATACTTACCCCCTCACTTTCGGCCCTGGGACCAAGGTGGAGATCAAACGT
35 GG12 GAGGTGCAGCTGGTGGAGTCTGGGGCTGAGGTGAGGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCAGTTCTGATATCAACTGGATTCGACAGGCCACTGGACAAGGGCTTGAGTGGATGGGATACATGAACCCTAAAAATGGAAACACAGACTATGCACAGAAGTTCCAGGGCAGAATCTCCATGACCAGGGACAGCTCCATAAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCAAAAGATAGGTATGGTTCGGGGGTGTATGGCTTCGGTATGGACGTCTGGGGCCCGGGAACCCTGGTCACCGTCTCCTCAGGTGGAGGGAGCTCTGGAGGTGGAGGTTCCGGTGGAGGTGGATCTGGTGGAGGTGGAAGTGACATCGTGATGACCCAGTCTCCATCTGCCATGTCTGCATCTGTCGGAGACAGAGTCTCCATCACTTGTCGGGCGAGTCAGGGCATTAACAATTATTTAGCCTGGTTTCAGCAGAAACCAGGGAAAGTCCCTAAGCGCCTGATGGATGTTGGATCCATTTTGCAAAGTGGCATCCCATCAAGATTCAGGGGCAGAGGCTCTGGGACACAATTCACTCTCACAATCAGCAGCCTGCAGGCAGAAGATTCAGGCACTTATTTCTGTCTTCAGCATAATACTTACCCCCTCACTTTCGGCCCTGGGACCAAGGTGGAGATCAAACGT
36 FG12 GAGGTGCAGCTGGTGGAGTCTGGGGCTGAGGTGAGGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCAGTTCTGATATCAACTGGATACGACAGGCCACTGGACAAGGGCTTGAGTGGATGGGATACATGAACCCTAAAAATGGAAACACAGACTATGCACAGAAGTTCCAGGGCAGAATCTCCATGACCAGGGACAGCTCCATAAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCAAAAGATAGGTATGGTCTTGGGACTTATGGCTTCGGTATGGACGTCTGGGGCCCGGGAACCCTGGTCACCGTCTCCTCAGGTGGAGGGAGCTCTGGAGGTGGAGGTTCCGGTGGAGGTGGATCTGGTGGAGGTGGAAGTGACATCGTGATGACCCAGTCTCCATCTGCCATGTCTGCATCTGTCGGAGACAGAGTCTCCATCACTTGTCGGGCGAGTCAGGGCATTAACAATTATTTAGCCTGGTTTCAGCAGAAACCAGGGAAAGTCCCTAAGCGCCTGATGGATGTTGGATCCATTTTGCAAAGTGGCATCCCATCAAGATTCAGGGGCAGAGGCTCTGGGACACAATTCACTCTCACAATCAGCAGCCTGCAGGCAGAAGATTCAGGCACTTATTTCTGTCTTCAGCATAATACTTACCCCCTCACTTTCGGCCCTGGGACCAAGGTGGAGATCAAACGT
37 AB9 GAGGTGCAGCTGGTGGAGTCTGGGGCTGAGGTGAGGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGATACACCTTCACCAGTTCTGATATCAACTGGATTCGACAGGCCACTGGACAAGGGCTTGAGTGGATGGGATACATGAACCCTAAAAATGGAAACACAGACTATGCACAGAAGTTCCAGGGCAGAATCTCCATGACCAGGGACAGCTCCATAAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCAAAAGATAGGTATGGTTCGGGGACTTATGGCGAGGGTATGGACGTCTGGGGCCCGGGAACCCTGGTCACCGTCTCCTCAGGTGGAGGGAGCTCTGGAGGTGGAGGTTCCGGTGGAGGTGGATCTGGTGGAGGTGGAAGTGACATCGTGATGACCCAGTCTCCATCTGCCATGTCTGCATCTGTCGGAGACAGAGTCTCCATCACTTGTCGGGCGAGTCAGGGCATTAACAATTATTTAGCCTGGTTTCAGCAGAAACCAGGGAAAGTCCCTAAGCGCCTGATGGATGTTGGATCCATTTTGCAAAGTGGCATCCCATCAAGATTCAGGGGCAGAGGCTCTGGGACACAATTCACTCTCACAATCAGCAGCCTGCAGGCAGAAGATTCAGGCACTTATTTCTGTCTTCAGCATAATACTTACCCCCTCACTTTCGGCCCTGGGACCAAGGTGGAGATCAAACGT
ETA에 의한 세포신호전달 저해능을 보이는 5종의 항체 scFv 서열(뉴클레오타이드 서열)
서열번호 명칭 Sequence
38 HCDR1 GYTFTSS
39 HCDR2 MNPKNGNT
40 LCDR1 QGINNY
41 LCDR2 VGS
42 LCDR3 LQHNTYPLT
발굴된 항체의 중쇄사슬의 CDR1 및 CDR2 서열과 경쇄사슬의 CDR1, CDR2 및 CDR3 서열
서열번호 명칭 Sequence
43 AG8 AKDRYGSGTYGFGMDV
44 #1NNK AKDRYGSGTYFFGMDV
45 #2NNK AKDRYGSGTYQFGMDV
46 #3NNK AKDRYGSGTIGFGMDV
47 #4NNK AKDRYGSGTHGFGMDV
48 #5NNK AKDRYGSGTYGFNMDV
49 #6NNK AKDRYGSGTYGFCMDV
50 #7NNK AKDRYGSGTYGFGLDV
51 EF12 AKDPYGSGTYGFGMDV
52 GG12 AKDRYGSGVYGFGMDV
53 FG12 AKDRYGLGTYGFGMDV
54 AB9 AKDRYGSGTYGEGMDV
발굴된 항체의 중쇄사슬의 CDR3 서열(HCDR3)
서열번호 Sequence
55 DIVMTQSPSAMSASVGDRVSITCRAS QGINNY LAWFQQKPGKVPKRLMD VGS ILQSGIPSRFRGRGSGTQFTLTISSLQAEDSGTYFC LQHNTYPLT FGPGTKVEIKR
발굴된 항체의 경쇄 가변영역(VL) 서열
서열번호 명칭 Sequence
56 AG8 EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYC AKDRYGSGTYGFGMDV WGPGTLVT
57 #1NNK EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYC AKDRYGSGTYFFGMDV WGPGTLVT
58 #2NNK EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSMRSEDTAVYYC AKDRYGSGTYQFGMDV WGPGTLVT
59 #3NNK EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYC AKDRYGSGTIGFGMDV WGPGTLVT
60 #4NNK EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYC AKDRYGSGTHGFGMDV WGPGTLVT
61 #5NNK EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYC AKDRYGSGTYGFNMDV WGPGTLVT
62 #6NNK EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYC AKDRYGSGTYGFCMDV WGPGTLVT
63 #7NNK EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYC AKDRYGSGTYGFGLDV WGPGTLVT
64 EF12 EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYC AKDPYGSGTYGFGMDV WGPGTLVT
65 GG12 EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYC AKDRYGSGVYGFGMDV WGPGTLVT
66 FG12 EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYC AKDRYGLGTYGFGMDV WGPGTLVT
67 AB9 EVQLVESGAEVRKPGASVKVSCKAS GYTFTSS DINWIRQATGQGLEWMGY MNPKNGNT DYAQKFQGRISMTRDSSISTAYMELSSLRSEDTAVYYC AKDRYGSGTYGEGMDV WGPGTLVT
발굴된 항체의 중쇄 가변영역(VH) 서열
<실시예 3> 인간유래 ETA 발현 동물세포를 이용한 발굴된 ETA 특이적 항체의 신호전달과정 저해능 확인
Fura-2-AM 형광염료 (ThermoFisher, USA)를 이용해 세포질내 Ca2+농도 측정을 통한 ETA의 ET-1에 의한 신호전달과정 측정을 위해 105개의 ETA 발현 동물세포주 (ETA expressed CHO-K1 stable cell line, GenScript, USA)에 5 μM의 Fura-2-AM 형광염료와 도 5에서 정제된 항체를 농도별로 처리한 후, 10 nM의 ET-1으로 신호전달과정을 유발하여 형광분광 광도계 (Biotek, USA)를 이용해 excitation 파장 340 nm, 380 nm에 의한 510 nm emission 파장에서 형광의 비 (Emission by 340nm excitation/Emission by 380nm excitation)를 측정함으로써 세포질 내 Ca2+ 농도를 분석하고, 발굴항체가 도 5와 같이 세포내 ETA의 신호전달과정에서 저해능 효율을 도출하였다.
<실시예 4> 발굴된 ETA 특이적 항체의 대장암 세포에서의 ETA 신호전달 저해 확인 및 5종 Lead 항체 선정
대장암 세포주인 HT-29와 HCT-116을 한국세포주은행 (Seoul, Korea)에서 분양 받아 사용하였으며, 발굴항체의 HT-29 대장암 세포에서의 ETA 신호전달과정 저해능 확인은 실시예 3와 같은 방법을 사용하여 도 6과 같은 결과를 도출하였고, HCT-116 대장암 세포에서의 ETA 신호전달과정 저해능 확인은 실시예 3과 같은 조건에서 발굴 항체를 각각 25 nM, 200 nM로 처리하여 도 7과 같은 결과를 도출하였고, 발굴 항체들의 ETA의 신호전달과정 저해능을 확인하였다. 도 6과 도 7에서와 같이, 발굴된 항체는 HT-29와 HCT-116 대장암 세포주에서 ET-1에 의한 ETA의 신호전달과정을 저해하는 길항 효과 (antagonistic effect)를 보이는 것으로 확인하였다. 앞서 도 5, 6 및 7에서 나타난 결과와 같이 인간유래 ETA 발현세포와 과발현 암세포인 HT-29, HCT-116에서 공통적으로 ETA 활성에 따른 신호전달과정을 저해하는 효능을 공통적으로 보이는 4종의 항체 (GG12, AB9, EF12 및 FG12)를 최종적으로 검증 및 발굴 확보하였다.
<실시예 5> 5종 Lead 항체의 인간/쥐 ETA 간 교차 결합능 확인
Lead 항체 (AG8, AB9, EF12, FG12 및 GG12)의 의약품 개발을 위하여 적절한 동물모델을 선정하기 위해 다른 종의 ETA의 세포위부위 서열을 인간 ETA의 세포외부위와 비교 분석하였다. 분석결과 쥐의 ETA는 세포외부위인 N-말단, Extracellular loop 1, 2, 3 각각 영역의 아미노산 일치율은 평균적으로 약 80% 이상인 것으로 분석되었다. 분석된 결과를 바탕으로 앞선 특허 (등록번호 : 10-2014383)에 기술한 바와 같이 쥐 ETA 서열을 발현벡터로 클로닝하여 대장균 조건하에서 활성형 쥐 ETA를 발현 정제 하였으며 ELISA 기법을 이용하여 발굴 항체들의 인간/쥐 ETA에서의 교차 결합능을 실험하였고, 결과는 도 8에 나타내었다. 도 8에서 보는 것과 같이 발굴된 항체는 활성형 인간 ETA에서 가지는 결합능을 활성형 쥐 ETA에서도 매우 유사한 결합력을 가지는 것을 확인하였다.
<실시예 6> 발굴된 발굴된 Lead 항체 5종의 대장암세포에서의 증식 억제 효능 확인
대장암세포 연구에서 HT-29 세포주와 더불어 많이 사용되고 있는 HCT-116 세포주에서 ET-1이 존재하는 조건에서도 발굴항체의 대장암세포 증식력 억제 효능이 있는지 확인하였다. CyQUANT NF 형광 염료 (Invitrogen, USA)를 이용해 세포 내 DNA 양 측정을 통해서 세포의 증식도를 확인하였다. HCT-116 세포주에 정제된 발굴항체를 농도별로 처리하고 37℃ 세포 배양기에서 1시간동안 함께 배양시킨 후, 접종하고 72시간 후에 CyQUANT NF 형광 염료를 처리하여 형광분광광도계 (TECAN, Switzerland)를 이용해 여기파장 485nm에 의한 방출 형광의 비(Emission by 485nm excitation)를 측정함으로써 세포 내 DNA 양을 측정하여 발굴항체가 ETA 세포외부위에 결합하여 대장암세포의 증식력을 억제할 수 있는지 여부를 확인하여 도 9와 같은 결과를 도출하였다. 도 9에서 보는 바와 같이, 본원발명의 항체는 HCT-116 대장암 세포주에서 ET-1에 의한 ETA의 증식력 증가를 저해하는 효과를 보이고 있다. 상기 결과를 통해 본원발명의 항체는 대장암세포의 증식을 효과적으로 저해하는 활성이 있어 있음을 확인하였다. HT-29와 HCT-116 대장암 세포주에서 Lead 항체 5종의 대장암세포 증식 억제 확인은 위에 기술한 (실시예 6) 같은 방법을 사용하였고 도 10과 같은 결과를 도출하였다. 도 10에서 보는 바와 같이, 본원발명의 Lead 항체 5종은 HT-29와 HCT-116 대장암 세포주의 증식을 효과적으로 저해하는 효과를 보이고 있다. 상기 결과를 통해 본원발명의 Lead 항체 5종은 대장암세포의 증식을 효과적으로 저해하는 활성이 있음을 확인하였다.
<실시예 7> 발굴된 Lead 항체 5종의 대장암 동물 모델에서 항암 유효성 확인
BALB/c nude mouse를 이용하여 flanks region에 대장암 HT-29 세포주를 피하에 주사한(subcutaneous injection) 이종이식(xenograft) 모델을 만들고 본원발명의 Lead 항체 5종을 25 ㎍ 주사하여 항암 유효성 검증을 위한 실험을 진행하였고 도 11과 같은 결과를 도출하였다. 도 11에서 보는 바와 같이, 본원발명의 Lead 항체 5종은 HT-29 대장암 세포주의 이종이식(xenograft) 모델에서 대장암의 성장을 저해하는 효과를 나타내고 있다. 상기 결과를 통해 본원발명의 Lead 항체 5종은 대장암세포의 증식을 동물 모델에서도 효과적으로 저해하는 활성이 있어 치료제로서 효능이 있음을 확인하였다.
<실시예 8> 발굴된 Lead 항체 5종의 대장암 동물 모델에서 항암 유효성 확인
도 12에서 보는 바와 같이 5종의 발굴항체는 SEC-HPLC를 통해 분리한 결과 응집된 %가 10% 이하로 나타난 것을 확인하였다. 도 13에 보이는 바와 같이 당쇄의 구조를 분석한 결과 발굴된 항체의 당쇄 구조는 Human IgG standard와 크게 차이를 보이지 않았다. 도 14는 발굴된 항체의 크기가 이론값과 일치하는지 분석한 것으로 대체적으로 5 Da안에서 서열과 동일한 결과를 보였다. 열안정성을 확인하기 위하여, 5종의 발굴항체를 pH 4 ~ 8의 완충용액 (완충용액으로 sodium acetate, sodium citrate, potassium phosphate, Histidine, MES, Succinate, HEPES, Tris, Bicine, PBS를 사용함)으로 완충용액 치환 (buffer exchange)를 수행하였다. 완충용액 치환 후, 항체의 농도는 1 mg/mL로 농축하였고, 농축된 발굴항체에 단백질의 구조변화를 예측할 수 있는 형광인 1000 X protein thermal shiftTM dye (ThermoFisher scientific)을 최종 농도 1X로 희석되게 넣어주었다. ViiA7 (ThermoFisher scientific)를 이용하여, 매뉴얼 (Protein ThermalTM Studies, ThermoFisher scientific)에 따라 열안정성 분석을 수행하였다. pH에 따른 열안정성 분석 결과는 도 15에 나타내었다.
<실시예 9> 발굴된 Lead 항체 5종의 대장암세포에서의 ETA 신호전달 저해 기전 확인
발굴항체의 HCT-116 대장암 세포에서의 ETA 신호전달과정 저해능 확인은 ETA 신호전달과정의 최종 활성 산물인 ERK와 AKT 단백질의 인산화를 면역 블로팅 (Immuniblot assay) 방법을 사용하여 도16과 같은 결과를 도출하였다. 도 16에서 보는 바와 같이, 본원발명의 항체는 HCT-116 대장암 세포주에서 ET-1에 의한 ETA 신호전달과정의 최종 활성 산물인 ERK와 AKT 단백질의 인산화를 저해하는 antagonism 효과를 나타내고 있다. 이를 통해 발굴항체는 ETA의 신호전달과정을 효과적으로 억제하는 활성이 있음을 확인하였다.
이상으로 본 발명의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적인 기술은 단지 바람직한 구현 예일 뿐이며, 이에 본 발명의 범위가 제한되는 것이 아닌 점은 명백하다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항과 그의 등가물에 의하여 정의된다고 할 것이다.

Claims (18)

  1. 엔토텔린 수용체 A(Endothelin receptor type A) 또는 이의 세포외 부위를 항원으로 인식하여 이에 특이적으로 결합하는 단일클론항체 또는 이의 단편으로서,
    상기 단일클론항체 또는 이의 단편은 중쇄 가변영역에 서열목록 제38서열의 CDR1, 서열목록 제39서열의 CDR2를 포함하고, 경쇄 가변영역에 서열목록 제40서열의 CDR1, 서열목록 제41서열의 CDR2 및 서열목록 제42서열의 CDR3를 포함하며,
    상기 단일클론항체 또는 이의 단편의 중쇄 가변영역의 CDR3은 서열목록 제43서열이거나 서열목록 제43서열에서 4번째, 7번째, 9번째, 10번째, 11번째, 12번째, 13번째 및 14번째 아미노산으로 구성된 군으로부터 선택되는 위치에 돌연변이를 포함하는 서열인 것을 특징으로 하는 단일클론항체 또는 이의 단편.
  2. 제 1 항에 있어서, 상기 중쇄 가변영역의 CDR3은 서열목록 제43서열에서 4번째 아미노산이 P(발린)로; 7번째 아미노산이 L(류신)로; 9번째 아미노산이 V(발린)로; 10번째 아미노산이 I(이소류신) 또는 H(히스티딘)로; 11번째 아미노산이 F(페닐알라닌) 또는 Q(글루타민)로; 12번째 아미노산이 E(글루타메이트)로; 13번째 아미노산이 N(아스파라진) 또는 C(시스테인)로; 또는 14번째 아미노산이 L(류신)로 치환된 돌연변이를 포함하는 것을 특징으로 하는 단일클론항체 또는 이의 단편.
  3. 제 2 항에 있어서, 상기 중쇄 가변영역의 CDR3은 서열목록 제44서열, 서열목록 제45서열, 서열목록 제46서열, 서열목록 제47서열, 서열목록 제48서열, 서열목록 제49서열, 서열목록 제50서열, 서열목록 제51서열, 서열목록 제52서열, 서열목록 제53서열 및 서열목록 제54서열로 구성된 군으로부터 선택되는 아미노산 서열인 것을 특징으로 하는 단일클론항체 또는 이의 단편.
  4. 제 1 항에 있어서, 상기 경쇄 가변영역은 서열목록 제55서열의 아미노산 서열을 포함하는 것을 특징으로 하는 단일클론항체 또는 이의 단편.
  5. 제 1 항에 있어서, 상기 중쇄 가변영역은 서열목록 제56서열, 서열목록 제57서열, 서열목록 제58서열, 서열목록 제59서열, 서열목록 제60서열, 서열목록 제61서열, 서열목록 제62서열, 서열목록 제63서열, 서열목록 제64서열, 서열목록 제65서열, 서열목록 제66서열 및 서열목록 제67서열로 구성된 군으로부터 선택되는 아미노산 서열을 포함하는 것을 특징으로 하는 단일클론항체 또는 이의 단편.
  6. 제 1 항에 있어서, 상기 엔토텔린 수용체 A는 서열목록 제68서열의 아미노산 서열을 포함하는 것을 특징으로 하는 단일클론항체 또는 이의 단편.
  7. 제 1 항에 있어서, 상기 세포외 부위는 서열목록 제69서열의 N-term 부위, 서열목록 제70서열의 ECL1, 서열목록 제71서열의 ECL2 및 서열목록 제72서열의 ECL3로 구성된 군으로부터 선택되는 1 또는 그 이상의 부위인 것을 특징으로 하는 단일클론항체 또는 이의 단편.
  8. 제 1 항의 단일클론항체 또는 이의 단편을 코딩하는 핵산분자.
  9. 제 8 항의 핵산분자를 포함하는 벡터.
  10. 제 9 항의 벡터를 포함하는 숙주세포.
  11. 제 1 항의 단일클론항체 또는 이의 단편, 제 8 항의 핵산분자 또는 제 9 항의 벡터를 포함하는 암의 예방 또는 치료용 약제학적 조성물.
  12. 제 1 항의 단일클론항체 또는 이의 단편, 제 8 항의 핵산분자 또는 제 9 항의 벡터를 포함하는 고혈압의 예방 또는 치료용 약제학적 조성물.
  13. 약제학적 유효량의 제 1 항의 단일클론항체 또는 이의 단편, 제 8 항의 핵산분자 또는 제 9 항의 벡터를 대상(subject)에게 투여하는 단계를 포함하는 암 또는 고혈압의 치료방법.
  14. 암 또는 고혈압의 치료용 약제학적 조성물의 제조를 위한 제 1 항의 단일클론항체 또는 이의 단편, 제 8 항의 핵산분자 또는 제 9 항의 벡터의 용도.
  15. 제 1 항의 단일클론항체 또는 이의 단편을 처리하는 단계를 포함하는, 샘플 중에 포함된 엔토텔린 수용체 A(Endothelin receptor type A)의 정량 방법.
  16. 하기의 단계를 포함하는 엔토텔린 수용체 A(Endothelin receptor type A)의 과발현에 의한 질환의 진단을 위한 정보를 제공하는 방법:
    (a) 피검자로부터 체외로 분리된 샘플을 취득하는 단계;
    (b) 제 1 항의 단일클론항체 또는 이의 단편을 상기 샘플에 처리하는 단계; 및
    (c) 상기 피검자의 샘플 중에 포함된 엔토텔린 수용체 A의 발현양이 정상군 샘플 중에 포함된 엔토텔린 수용체 A의 발현양 보다 높은지 여부를 확인하는 단계.
  17. 제 16 항에 있어서, 상기 엔토텔린 수용체 A의 과발현에 의한 질환은 암 또는 고혈압인 것을 특징으로 하는 방법.
  18. 제 1 항의 단일클론항체 또는 이의 단편을 포함하는 엔토텔린 수용체 A(Endothelin receptor type A) 정량 키트.
PCT/KR2019/017110 2018-12-05 2019-12-05 엔도텔린 수용체 a 활성 조절 항체 WO2020116963A1 (ko)

Priority Applications (4)

Application Number Priority Date Filing Date Title
US17/311,537 US20220153831A1 (en) 2018-12-05 2019-12-05 Endothelin receptor type a activity regulating antibody
CN201980090955.1A CN113412280A (zh) 2018-12-05 2019-12-05 活性调节抗体
EP19893847.4A EP3892636A4 (en) 2018-12-05 2019-12-05 ENDOTHELIN RECEPTOR TYPE A ACTIVITY REGULATING ANTIBODIES
JP2021532324A JP7315256B2 (ja) 2018-12-05 2019-12-05 エンドセリン受容体ａ活性調節抗体

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR10-2018-0155319 2018-12-05
KR20180155319 2018-12-05
KR10-2019-0159941 2019-12-04
KR1020190159941A KR102335799B1 (ko) 2018-12-05 2019-12-04 엔도텔린 수용체 a 활성 조절 항체

Publications (1)

Publication Number Publication Date
WO2020116963A1 true WO2020116963A1 (ko) 2020-06-11

Family

ID=70973634

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2019/017110 WO2020116963A1 (ko) 2018-12-05 2019-12-05 엔도텔린 수용체 a 활성 조절 항체

Country Status (3)

Country Link
US (1) US20220153831A1 (ko)
JP (1) JP7315256B2 (ko)
WO (1) WO2020116963A1 (ko)

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN115724994A (zh) * 2022-08-17 2023-03-03 无锡佰翱得生物科学有限公司 一种内皮素受体a融合突变体蛋白及其应用
EP3978527A4 (en) * 2019-05-29 2023-06-14 Hedgehog, Inc. ANTIBODIES WITH INCREASED BINDING AFFINITY FOR ENDOTHELLIN RECEPTOR A

Citations (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040014194A1 (en) 2002-03-27 2004-01-22 Schering Corporation Beta-secretase crystals and methods for preparing and using the same
US20120100140A1 (en) 2009-01-23 2012-04-26 Biogen Idec Ma Inc. Stabilized fc polypeptides with reduced effector function and methods of use
US9644038B2 (en) * 2011-12-21 2017-05-09 The Regents Of The University Of California Apolipoprotein nanodiscs with telodendrimer
US20180256714A1 (en) * 2014-12-05 2018-09-13 Gmax Biopharm Llc. Human endothelin receptor antibody and use thereof
KR20180113904A (ko) 2018-01-10 2018-10-17 국민대학교산학협력단 혈중 반감기 연장을 위한 항체 Fc 변이체들
KR20180136327A (ko) * 2017-06-14 2018-12-24 국민대학교산학협력단 G 단백질 연결 수용체의 활성 조절 인간 항체

Patent Citations (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20040014194A1 (en) 2002-03-27 2004-01-22 Schering Corporation Beta-secretase crystals and methods for preparing and using the same
US20120100140A1 (en) 2009-01-23 2012-04-26 Biogen Idec Ma Inc. Stabilized fc polypeptides with reduced effector function and methods of use
US9644038B2 (en) * 2011-12-21 2017-05-09 The Regents Of The University Of California Apolipoprotein nanodiscs with telodendrimer
US20180256714A1 (en) * 2014-12-05 2018-09-13 Gmax Biopharm Llc. Human endothelin receptor antibody and use thereof
KR20180136327A (ko) * 2017-06-14 2018-12-24 국민대학교산학협력단 G 단백질 연결 수용체의 활성 조절 인간 항체
KR102014383B1 (ko) 2017-06-14 2019-08-26 국민대학교 산학협력단 G 단백질 연결 수용체의 활성 조절 인간 항체
KR20180113904A (ko) 2018-01-10 2018-10-17 국민대학교산학협력단 혈중 반감기 연장을 위한 항체 Fc 변이체들

Non-Patent Citations (40)

* Cited by examiner, † Cited by third party
Title
"Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996
1 May 2018 (2018-05-01), retrieved from NCBI Database accession no. XP_008967127 .1 *
AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1994, JOHN, WILEY & SONS
BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426
BRICOGNE G, ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 49, 1993, pages 37 - 60
BRICOGNE G, METH ENZYMOL, 1997, pages 361 - 423
CHAMPE M ET AL., J BIOL CHEM, vol. 270, 1995, pages 1388 - 1394
CHAYEN E, STRUCTURE, vol. 5, 1997, pages 1269 - 1274
CHEUNG ET AL., VIROLOGY, vol. 176, no. 546, 1990
CUNNINGHAM BCWELLS JA, SCIENCE, vol. 244, 1989, pages 1081 - 1085
ED HARLOWDAVID LANE: "Cold Spring Harb Protoc", 2006
ED HARLOWDAVID LANE: "Using Antibodies", 1999, COLD SPRING HARBOR LABORATORY PRESS
FRANCES H. ARNOLDGEORGE GEORGIOU: "Directed Evolution Library Creation: Methods and Protocols", 2010, HUMANA PRESS
GIEGE R ET AL., ACTA CRYSTALLOGR D BIOL CRYSTALLOGR 50, 1994, pages 339 - 350
HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883
JEFFERIS ET AL., MABS, vol. 1, no. 4, 2009, pages 1 - 7
JO, M.: "Engineering therapeutic antibodies targeting G-protein-coupled receptors", EXPERIMENTAL & MOLECULAR MEDICINE, vol. 48, no. 2, 2016, pages e207, XP055546956 *
JU, M. S.: "P0230. Isolation of human anti-GPCR antibodies using nanodisc proteins", 2017 KSBB SPRING MEETING AND INTERNATIONAL SYMPOSIUM, 5 April 2017 (2017-04-05), pages 1 - 2, XP055817063 *
KABAT EA ET AL.: "Sequences of Proteins of Immunological Interest", 1991, DEPARTMENT OF HEALTH AND HUMAN SERVICES
KIRKLAND ET AL., J. IMMUNOL., vol. 137, 1986, pages 3614
KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553
LAU C. ET AL., J. IMMUNOL., vol. 191, 2013, pages 4769 - 4777
LEE, K.: "Purification and characterization of recombinant human endothelin receptor type A", PROTEIN EXPRESSION AND PURIFICATION, vol. 84, 2012, pages 14 - 18, XP028493235, DOI: 10.1016/j.pep.2012.04.011 *
LONBERG, NATURE BIOTECH., vol. 23, no. 9, 2005, pages 1117 - 1125
MANFRED T REETZJOSE' DANIEL CARBALLEIRA: "Iterative saturation mutagenesis (ISM) for rapid directed evolution of functional enzymes", NATURE PROTOCOLS, vol. 2, no. 4, pages 891 - 903, XP001538725, DOI: 10.1038/nprot.2007.72
MANIATIS ET AL.: "Molecular Cloning", 1988, COLD SPRING HARBOR PRESS
MAZOR, Y.BARNEA, I.KEYDAR, I.BENHAR, I.: "Antibody internalization studied using a novel IgG binding toxin fusion", JOURNAL OF IMMUNOLOGICAL METHODS, vol. 321, no. 1-2, 2007, pages 41 - 59, XP005936349
MCPHERSON A, EUR JBIOCHEM, vol. 189, 1990, pages 1 - 23
MCPHERSON A, JBIOL CHEM, vol. 251, 1976, pages 6300 - 6303
MOLDENHAUER ET AL., SCAND. J. IMMUNOL, vol. 32, 1990, pages 77
MOREL ET AL., MOL. IMMUNOL, vol. 25, no. 1, 1988, pages 7
ROUX ET AL., J IMMUNOL, vol. 161, 1998, pages 4083
ROUX ET AL., J. IMMUNOL., vol. 161, 1998, pages 4083
ROVERSI P ET AL., ACTA CRYSTALLOGR D BIOL CRYSTALLOGR, vol. 56, 2000, pages 1316 - 1323
SONGSIVILAILACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321
STAHLI ET AL., METHODS IN ENZYMOLOGY, vol. 9, 1983, pages 242
VIDARSSON G. ET AL., FRONT IMMUNOL, vol. 5, 20 October 2014 (2014-10-20), pages 520
VIDARSSON G. ET AL., FRONT IMMUNOL, vol. 5, no. 520, 2014
VIDARSSON G. ET AL., FRONT IMMUNOL., vol. 5, 20 October 2014 (2014-10-20), pages 520
WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546

Cited By (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP3978527A4 (en) * 2019-05-29 2023-06-14 Hedgehog, Inc. ANTIBODIES WITH INCREASED BINDING AFFINITY FOR ENDOTHELLIN RECEPTOR A
CN115724994A (zh) * 2022-08-17 2023-03-03 无锡佰翱得生物科学有限公司 一种内皮素受体a融合突变体蛋白及其应用

Also Published As

Publication number Publication date
US20220153831A1 (en) 2022-05-19
JP7315256B2 (ja) 2023-07-26
JP2022511876A (ja) 2022-02-01

Similar Documents

Publication Publication Date Title
CN109311985B (zh) 抗pd-l1抗体
US20190270826A1 (en) Anti-il1rap antibodies, bispecific antigen binding molecules that bind il1rap and cd3, and uses thereof
WO2020111913A1 (en) Anti-4-1bb antibody and use thereof
US11407828B2 (en) Anti-CLauDiN 18 antibodies and methods of use thereof
WO2019098682A1 (ko) 항-her2 항체 또는 그의 항원 결합 단편, 및 이를 포함하는 키메라 항원 수용체
CN111629754A (zh) 不引起显著红血细胞凝集的抗cd47抗体
KR102335799B1 (ko) 엔도텔린 수용체 a 활성 조절 항체
US20180142032A1 (en) Anti-lamp1 antibodies and antibody drug conjugates, and uses thereof
WO2021091359A1 (ko) 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체
KR20210042091A (ko) 항-l1cam 항체 및 이의 용도
WO2020116963A1 (ko) 엔도텔린 수용체 a 활성 조절 항체
JP2024513239A (ja) Ｒｏｒ１に結合する抗原結合タンパク質
JP2024012682A (ja) 抗ｌ１ｃａｍ抗体及びその使用
WO2024032777A1 (zh) 抗cd73抗体或其抗原片段及其应用
JP2011523849A (ja) インターロイキン−２１受容体結合性タンパク質
WO2020242200A1 (ko) 엔도텔린 수용체 a 결합력이 향상된 항체
US20220315663A1 (en) TRISPECIFIC ANTIBODY TARGETING CD79b, CD20, AND CD3
US20210403582A1 (en) Binding molecule specific for lif and use thereof
TW201833140A (zh) 抗fgfr抗體及使用方法
KR20230145542A (ko) Tgf-베타-rii 결합 단백질
WO2023101438A1 (ko) Smo 인간 항체
WO2022098173A1 (ko) 코로나바이러스 스파이크 단백질에 특이적인 항체 및 이의 용도
WO2020032614A1 (ko) Epb41l5 단백질의 에피토프 및 단일클론항체
KR20200138013A (ko) 엔도텔린 수용체 a 결합력이 향상된 항체
TW202328190A (zh) 抗acvr2a抗體及其用途

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 19893847

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2021532324

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2019893847

Country of ref document: EP

Effective date: 20210705