WO2020032614A1 - Epb41l5 단백질의 에피토프 및 단일클론항체 - Google Patents
Epb41l5 단백질의 에피토프 및 단일클론항체 Download PDFInfo
- Publication number
- WO2020032614A1 WO2020032614A1 PCT/KR2019/009960 KR2019009960W WO2020032614A1 WO 2020032614 A1 WO2020032614 A1 WO 2020032614A1 KR 2019009960 W KR2019009960 W KR 2019009960W WO 2020032614 A1 WO2020032614 A1 WO 2020032614A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- epb41l5
- cancer
- cells
- monoclonal antibody
- antibody
- Prior art date
Links
- 102100023053 Band 4.1-like protein 5 Human genes 0.000 claims abstract description 239
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 92
- 201000011510 cancer Diseases 0.000 claims abstract description 85
- 230000014509 gene expression Effects 0.000 claims abstract description 77
- 239000012634 fragment Substances 0.000 claims abstract description 58
- 108050002666 Band 4.1-like protein 5 Proteins 0.000 claims description 234
- 210000004027 cell Anatomy 0.000 claims description 220
- 102000046299 Transforming Growth Factor beta1 Human genes 0.000 claims description 62
- 101800002279 Transforming growth factor beta-1 Proteins 0.000 claims description 62
- 238000000034 method Methods 0.000 claims description 47
- 108090000623 proteins and genes Proteins 0.000 claims description 43
- 206010027476 Metastases Diseases 0.000 claims description 40
- 230000009401 metastasis Effects 0.000 claims description 40
- 150000007523 nucleic acids Chemical class 0.000 claims description 40
- 102000039446 nucleic acids Human genes 0.000 claims description 34
- 108020004707 nucleic acids Proteins 0.000 claims description 34
- 102000004169 proteins and genes Human genes 0.000 claims description 34
- 101150112533 EPB41L5 gene Proteins 0.000 claims description 27
- 239000013598 vector Substances 0.000 claims description 27
- 239000000203 mixture Substances 0.000 claims description 26
- 238000011282 treatment Methods 0.000 claims description 24
- 125000000539 amino acid group Chemical group 0.000 claims description 20
- 229960005486 vaccine Drugs 0.000 claims description 20
- 239000008194 pharmaceutical composition Substances 0.000 claims description 19
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 16
- 210000000130 stem cell Anatomy 0.000 claims description 13
- 230000002401 inhibitory effect Effects 0.000 claims description 12
- 238000000338 in vitro Methods 0.000 claims description 11
- 239000003112 inhibitor Substances 0.000 claims description 11
- 230000002265 prevention Effects 0.000 claims description 11
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 9
- 230000002018 overexpression Effects 0.000 claims description 9
- 201000010099 disease Diseases 0.000 claims description 8
- 230000001225 therapeutic effect Effects 0.000 claims description 8
- 239000004480 active ingredient Substances 0.000 claims description 7
- 108091034117 Oligonucleotide Proteins 0.000 claims description 6
- 108020004459 Small interfering RNA Proteins 0.000 claims description 5
- 108091093037 Peptide nucleic acid Proteins 0.000 claims description 4
- 230000003993 interaction Effects 0.000 claims description 4
- 239000002773 nucleotide Substances 0.000 claims description 4
- 125000003729 nucleotide group Chemical group 0.000 claims description 4
- 108091027967 Small hairpin RNA Proteins 0.000 claims description 3
- 239000002679 microRNA Substances 0.000 claims description 3
- 238000011002 quantification Methods 0.000 claims description 3
- 239000004055 small Interfering RNA Substances 0.000 claims description 3
- 102000053642 Catalytic RNA Human genes 0.000 claims description 2
- 108090000994 Catalytic RNA Proteins 0.000 claims description 2
- 108091027757 Deoxyribozyme Proteins 0.000 claims description 2
- 239000000074 antisense oligonucleotide Substances 0.000 claims description 2
- 238000012230 antisense oligonucleotides Methods 0.000 claims description 2
- 108091092562 ribozyme Proteins 0.000 claims description 2
- 208000037819 metastatic cancer Diseases 0.000 claims 1
- 208000011575 metastatic malignant neoplasm Diseases 0.000 claims 1
- 108091070501 miRNA Proteins 0.000 claims 1
- 239000002924 silencing RNA Substances 0.000 claims 1
- 239000000427 antigen Substances 0.000 abstract description 26
- 102000036639 antigens Human genes 0.000 abstract description 26
- 108091007433 antigens Proteins 0.000 abstract description 26
- 108090001012 Transforming Growth Factor beta Proteins 0.000 abstract description 22
- 102000004887 Transforming Growth Factor beta Human genes 0.000 abstract description 22
- 230000004083 survival effect Effects 0.000 abstract description 15
- 230000000694 effects Effects 0.000 abstract description 12
- 101001049973 Homo sapiens Band 4.1-like protein 5 Proteins 0.000 abstract description 9
- 101710143111 Mothers against decapentaplegic homolog 3 Proteins 0.000 abstract description 9
- 239000003814 drug Substances 0.000 abstract description 8
- 229940124597 therapeutic agent Drugs 0.000 abstract description 7
- 102000049939 Smad3 Human genes 0.000 abstract 1
- 238000011835 investigation Methods 0.000 abstract 1
- 230000009456 molecular mechanism Effects 0.000 abstract 1
- 208000005718 Stomach Neoplasms Diseases 0.000 description 77
- 206010017758 gastric cancer Diseases 0.000 description 77
- 201000011549 stomach cancer Diseases 0.000 description 77
- 235000018102 proteins Nutrition 0.000 description 27
- 238000009739 binding Methods 0.000 description 22
- 235000001014 amino acid Nutrition 0.000 description 20
- 229940024606 amino acid Drugs 0.000 description 20
- 238000004458 analytical method Methods 0.000 description 19
- 230000027455 binding Effects 0.000 description 19
- 238000001262 western blot Methods 0.000 description 19
- 150000001413 amino acids Chemical class 0.000 description 18
- 230000005012 migration Effects 0.000 description 15
- 108090000765 processed proteins & peptides Proteins 0.000 description 14
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 13
- 238000013508 migration Methods 0.000 description 13
- 108050007957 Cadherin Proteins 0.000 description 11
- 102000000905 Cadherin Human genes 0.000 description 11
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 11
- 238000001764 infiltration Methods 0.000 description 11
- 230000008595 infiltration Effects 0.000 description 11
- 102000004196 processed proteins & peptides Human genes 0.000 description 11
- 206010006187 Breast cancer Diseases 0.000 description 10
- 208000026310 Breast neoplasm Diseases 0.000 description 10
- 230000011664 signaling Effects 0.000 description 10
- 108010022233 Plasminogen Activator Inhibitor 1 Proteins 0.000 description 9
- 238000003125 immunofluorescent labeling Methods 0.000 description 9
- 239000000523 sample Substances 0.000 description 9
- 102100028906 Catenin delta-1 Human genes 0.000 description 8
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 8
- 102100025748 Mothers against decapentaplegic homolog 3 Human genes 0.000 description 8
- 101710143112 Mothers against decapentaplegic homolog 4 Proteins 0.000 description 8
- 102100025725 Mothers against decapentaplegic homolog 4 Human genes 0.000 description 8
- 102100039418 Plasminogen activator inhibitor 1 Human genes 0.000 description 8
- 238000003556 assay Methods 0.000 description 8
- 239000013604 expression vector Substances 0.000 description 8
- 210000004408 hybridoma Anatomy 0.000 description 8
- 201000005202 lung cancer Diseases 0.000 description 8
- 208000020816 lung neoplasm Diseases 0.000 description 8
- 210000003462 vein Anatomy 0.000 description 8
- IVRXNBXKWIJUQB-UHFFFAOYSA-N LY-2157299 Chemical compound CC1=CC=CC(C=2C(=C3CCCN3N=2)C=2C3=CC(=CC=C3N=CC=2)C(N)=O)=N1 IVRXNBXKWIJUQB-UHFFFAOYSA-N 0.000 description 7
- 241000699670 Mus sp. Species 0.000 description 7
- 101150047834 SNAI2 gene Proteins 0.000 description 7
- 230000012292 cell migration Effects 0.000 description 7
- 108010031971 delta catenin Proteins 0.000 description 7
- -1 epitopes Proteins 0.000 description 7
- 230000006870 function Effects 0.000 description 7
- 230000012010 growth Effects 0.000 description 7
- 238000011580 nude mouse model Methods 0.000 description 7
- 229920001184 polypeptide Polymers 0.000 description 7
- 230000001105 regulatory effect Effects 0.000 description 7
- 241000699666 Mus <mouse, genus> Species 0.000 description 6
- 230000007705 epithelial mesenchymal transition Effects 0.000 description 6
- 229950000456 galunisertib Drugs 0.000 description 6
- 210000004072 lung Anatomy 0.000 description 6
- 239000012528 membrane Substances 0.000 description 6
- 239000013612 plasmid Substances 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 5
- 108060003951 Immunoglobulin Proteins 0.000 description 5
- 241000581650 Ivesia Species 0.000 description 5
- 125000003412 L-alanyl group Chemical group [H]N([H])[C@@](C([H])([H])[H])(C(=O)[*])[H] 0.000 description 5
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 230000001419 dependent effect Effects 0.000 description 5
- 238000002474 experimental method Methods 0.000 description 5
- 102000018358 immunoglobulin Human genes 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 108020004999 messenger RNA Proteins 0.000 description 5
- 230000035772 mutation Effects 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 239000003981 vehicle Substances 0.000 description 5
- 239000004475 Arginine Substances 0.000 description 4
- 238000002965 ELISA Methods 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 4
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 4
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 239000004472 Lysine Substances 0.000 description 4
- 102100025751 Mothers against decapentaplegic homolog 2 Human genes 0.000 description 4
- 101710143123 Mothers against decapentaplegic homolog 2 Proteins 0.000 description 4
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 4
- 108091005735 TGF-beta receptors Proteins 0.000 description 4
- 102000016715 Transforming Growth Factor beta Receptors Human genes 0.000 description 4
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 4
- 102000004243 Tubulin Human genes 0.000 description 4
- 108090000704 Tubulin Proteins 0.000 description 4
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 4
- 230000009824 affinity maturation Effects 0.000 description 4
- 235000004279 alanine Nutrition 0.000 description 4
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 4
- 238000002869 basic local alignment search tool Methods 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 230000005907 cancer growth Effects 0.000 description 4
- 239000003937 drug carrier Substances 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 230000005764 inhibitory process Effects 0.000 description 4
- 230000009545 invasion Effects 0.000 description 4
- 238000010208 microarray analysis Methods 0.000 description 4
- 239000013610 patient sample Substances 0.000 description 4
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 4
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 238000003753 real-time PCR Methods 0.000 description 4
- 238000001890 transfection Methods 0.000 description 4
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 4
- 108010085238 Actins Proteins 0.000 description 3
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 3
- 101000785626 Homo sapiens Zinc finger E-box-binding homeobox 1 Proteins 0.000 description 3
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- 208000007433 Lymphatic Metastasis Diseases 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- 239000012980 RPMI-1640 medium Substances 0.000 description 3
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 3
- 102100026457 Zinc finger E-box-binding homeobox 1 Human genes 0.000 description 3
- 230000000844 anti-bacterial effect Effects 0.000 description 3
- 102000025171 antigen binding proteins Human genes 0.000 description 3
- 108091000831 antigen binding proteins Proteins 0.000 description 3
- 230000003115 biocidal effect Effects 0.000 description 3
- 239000000090 biomarker Substances 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 239000002299 complementary DNA Substances 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 230000034994 death Effects 0.000 description 3
- 231100000517 death Toxicity 0.000 description 3
- 230000002950 deficient Effects 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 238000003197 gene knockdown Methods 0.000 description 3
- 229940022353 herceptin Drugs 0.000 description 3
- 230000003053 immunization Effects 0.000 description 3
- 238000001802 infusion Methods 0.000 description 3
- 239000006166 lysate Substances 0.000 description 3
- 238000013507 mapping Methods 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 238000010837 poor prognosis Methods 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 230000002829 reductive effect Effects 0.000 description 3
- 230000007727 signaling mechanism Effects 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- 238000013518 transcription Methods 0.000 description 3
- 230000035897 transcription Effects 0.000 description 3
- 229960000575 trastuzumab Drugs 0.000 description 3
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 102100022900 Actin, cytoplasmic 1 Human genes 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 208000003174 Brain Neoplasms Diseases 0.000 description 2
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 101000814373 Homo sapiens Protein wntless homolog Proteins 0.000 description 2
- 101000864098 Homo sapiens Small muscular protein Proteins 0.000 description 2
- 101000651178 Homo sapiens Striated muscle preferentially expressed protein kinase Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 125000000570 L-alpha-aspartyl group Chemical group [H]OC(=O)C([H])([H])[C@]([H])(N([H])[H])C(*)=O 0.000 description 2
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 2
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- 125000003440 L-leucyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C(C([H])([H])[H])([H])C([H])([H])[H] 0.000 description 2
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- 125000002842 L-seryl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])O[H] 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 206010063916 Metastatic gastric cancer Diseases 0.000 description 2
- 108700011259 MicroRNAs Proteins 0.000 description 2
- 241000699660 Mus musculus Species 0.000 description 2
- 238000005481 NMR spectroscopy Methods 0.000 description 2
- 239000000020 Nitrocellulose Substances 0.000 description 2
- 102000018546 Paxillin Human genes 0.000 description 2
- ACNHBCIZLNNLRS-UHFFFAOYSA-N Paxilline 1 Natural products N1C2=CC=CC=C2C2=C1C1(C)C3(C)CCC4OC(C(C)(O)C)C(=O)C=C4C3(O)CCC1C2 ACNHBCIZLNNLRS-UHFFFAOYSA-N 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 102100039471 Protein wntless homolog Human genes 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 102100029873 Small muscular protein Human genes 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 102100027659 Striated muscle preferentially expressed protein kinase Human genes 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- 108700031954 Tgfb1i1/Leupaxin/TGFB1I1 Proteins 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- FJWGYAHXMCUOOM-QHOUIDNNSA-N [(2s,3r,4s,5r,6r)-2-[(2r,3r,4s,5r,6s)-4,5-dinitrooxy-2-(nitrooxymethyl)-6-[(2r,3r,4s,5r,6s)-4,5,6-trinitrooxy-2-(nitrooxymethyl)oxan-3-yl]oxyoxan-3-yl]oxy-3,5-dinitrooxy-6-(nitrooxymethyl)oxan-4-yl] nitrate Chemical compound O([C@@H]1O[C@@H]([C@H]([C@H](O[N+]([O-])=O)[C@H]1O[N+]([O-])=O)O[C@H]1[C@@H]([C@@H](O[N+]([O-])=O)[C@H](O[N+]([O-])=O)[C@@H](CO[N+]([O-])=O)O1)O[N+]([O-])=O)CO[N+](=O)[O-])[C@@H]1[C@@H](CO[N+]([O-])=O)O[C@@H](O[N+]([O-])=O)[C@H](O[N+]([O-])=O)[C@H]1O[N+]([O-])=O FJWGYAHXMCUOOM-QHOUIDNNSA-N 0.000 description 2
- 239000002246 antineoplastic agent Substances 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 230000021164 cell adhesion Effects 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 230000003833 cell viability Effects 0.000 description 2
- 230000005754 cellular signaling Effects 0.000 description 2
- 239000001913 cellulose Substances 0.000 description 2
- 229920002678 cellulose Polymers 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000002975 chemoattractant Substances 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 239000000284 extract Substances 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 238000009650 gentamicin protection assay Methods 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 229930195712 glutamate Natural products 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 2
- 102000051446 human EPB41L5 Human genes 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 238000003119 immunoblot Methods 0.000 description 2
- 238000010166 immunofluorescence Methods 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 229960000310 isoleucine Drugs 0.000 description 2
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 2
- 208000032839 leukemia Diseases 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 238000004519 manufacturing process Methods 0.000 description 2
- 230000002503 metabolic effect Effects 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 238000010232 migration assay Methods 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 229920001220 nitrocellulos Polymers 0.000 description 2
- 229940079938 nitrocellulose Drugs 0.000 description 2
- 235000015097 nutrients Nutrition 0.000 description 2
- 238000012634 optical imaging Methods 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- ACNHBCIZLNNLRS-UBGQALKQSA-N paxilline Chemical compound N1C2=CC=CC=C2C2=C1[C@]1(C)[C@@]3(C)CC[C@@H]4O[C@H](C(C)(O)C)C(=O)C=C4[C@]3(O)CC[C@H]1C2 ACNHBCIZLNNLRS-UBGQALKQSA-N 0.000 description 2
- 229920002401 polyacrylamide Polymers 0.000 description 2
- 239000011148 porous material Substances 0.000 description 2
- 238000004393 prognosis Methods 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 2
- 230000005855 radiation Effects 0.000 description 2
- 238000001959 radiotherapy Methods 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 230000003362 replicative effect Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 238000007619 statistical method Methods 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 210000001519 tissue Anatomy 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- 230000004614 tumor growth Effects 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical group COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 1
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 1
- DMNGYLXTYNBBSV-UHFFFAOYSA-N 5,5-difluoropyrimidine-2,4-dione Chemical compound FC1(F)C=NC(=O)NC1=O DMNGYLXTYNBBSV-UHFFFAOYSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 1
- 239000012103 Alexa Fluor 488 Substances 0.000 description 1
- 239000012099 Alexa Fluor family Substances 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 102100024003 Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 Human genes 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- DXVMJJNAOVECBA-WHFBIAKZSA-N Asn-Gly-Asn Chemical compound NC(=O)C[C@H](N)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O DXVMJJNAOVECBA-WHFBIAKZSA-N 0.000 description 1
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 1
- 102100023054 Band 4.1-like protein 4A Human genes 0.000 description 1
- 108060000903 Beta-catenin Proteins 0.000 description 1
- 102000015735 Beta-catenin Human genes 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 101100257134 Caenorhabditis elegans sma-4 gene Proteins 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 108050004754 Catenin delta-1 Proteins 0.000 description 1
- 102000016289 Cell Adhesion Molecules Human genes 0.000 description 1
- 108010067225 Cell Adhesion Molecules Proteins 0.000 description 1
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 1
- 108091026890 Coding region Proteins 0.000 description 1
- 206010010071 Coma Diseases 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical group [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 102000016621 Focal Adhesion Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108010067715 Focal Adhesion Protein-Tyrosine Kinases Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- LPIKVBWNNVFHCQ-GUBZILKMSA-N Gln-Ser-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O LPIKVBWNNVFHCQ-GUBZILKMSA-N 0.000 description 1
- XCLCVBYNGXEVDU-WHFBIAKZSA-N Gly-Asn-Ser Chemical compound NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O XCLCVBYNGXEVDU-WHFBIAKZSA-N 0.000 description 1
- MHXKHKWHPNETGG-QWRGUYRKSA-N Gly-Lys-Leu Chemical compound [H]NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O MHXKHKWHPNETGG-QWRGUYRKSA-N 0.000 description 1
- GBYYQVBXFVDJPJ-WLTAIBSBSA-N Gly-Tyr-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)CN)O GBYYQVBXFVDJPJ-WLTAIBSBSA-N 0.000 description 1
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- 208000017604 Hodgkin disease Diseases 0.000 description 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000975752 Homo sapiens Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 Proteins 0.000 description 1
- 101001049968 Homo sapiens Band 4.1-like protein 4A Proteins 0.000 description 1
- 101001098868 Homo sapiens Proprotein convertase subtilisin/kexin type 9 Proteins 0.000 description 1
- 101001133654 Homo sapiens Protein PALS1 Proteins 0.000 description 1
- 101001059454 Homo sapiens Serine/threonine-protein kinase MARK2 Proteins 0.000 description 1
- 101000851007 Homo sapiens Vascular endothelial growth factor receptor 2 Proteins 0.000 description 1
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 1
- NSPNUMNLZNOPAQ-SJWGOKEGSA-N Ile-Tyr-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N2CCC[C@@H]2C(=O)O)N NSPNUMNLZNOPAQ-SJWGOKEGSA-N 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 1
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 1
- 102100034343 Integrase Human genes 0.000 description 1
- 238000010824 Kaplan-Meier survival analysis Methods 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- 125000003338 L-glutaminyl group Chemical group O=C([*])[C@](N([H])[H])([H])C([H])([H])C([H])([H])C(=O)N([H])[H] 0.000 description 1
- 125000001176 L-lysyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C([H])([H])C([H])([H])C(N([H])[H])([H])[H] 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 125000000769 L-threonyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])[C@](O[H])(C([H])([H])[H])[H] 0.000 description 1
- 125000003798 L-tyrosyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C([H])([H])C1=C([H])C([H])=C(O[H])C([H])=C1[H] 0.000 description 1
- 125000003580 L-valyl group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(C([H])([H])[H])(C([H])([H])[H])[H] 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 206010023825 Laryngeal cancer Diseases 0.000 description 1
- 241000713666 Lentivirus Species 0.000 description 1
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 1
- 240000007472 Leucaena leucocephala Species 0.000 description 1
- 239000012098 Lipofectamine RNAiMAX Substances 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- GILLQRYAWOMHED-DCAQKATOSA-N Lys-Val-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](C(C)C)NC(=O)[C@@H](N)CCCCN GILLQRYAWOMHED-DCAQKATOSA-N 0.000 description 1
- 102100031803 MYCBP-associated protein Human genes 0.000 description 1
- 101150106769 MYCBPAP gene Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- 208000003445 Mouth Neoplasms Diseases 0.000 description 1
- 208000034578 Multiple myelomas Diseases 0.000 description 1
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 1
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 1
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 229930012538 Paclitaxel Natural products 0.000 description 1
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- GNRMAQSIROFNMI-IXOXFDKPSA-N Phe-Thr-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(O)=O GNRMAQSIROFNMI-IXOXFDKPSA-N 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- ZUZINZIJHJFJRN-UBHSHLNASA-N Pro-Phe-Ala Chemical compound C([C@@H](C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1NCCC1)C1=CC=CC=C1 ZUZINZIJHJFJRN-UBHSHLNASA-N 0.000 description 1
- VBZXFFYOBDLLFE-HSHDSVGOSA-N Pro-Trp-Thr Chemical compound N([C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H]([C@H](O)C)C(O)=O)C(=O)[C@@H]1CCCN1 VBZXFFYOBDLLFE-HSHDSVGOSA-N 0.000 description 1
- 102100038955 Proprotein convertase subtilisin/kexin type 9 Human genes 0.000 description 1
- 206010060862 Prostate cancer Diseases 0.000 description 1
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 102100031952 Protein 4.1 Human genes 0.000 description 1
- 101710196266 Protein 4.1 Proteins 0.000 description 1
- 102100034054 Protein PALS1 Human genes 0.000 description 1
- 238000002123 RNA extraction Methods 0.000 description 1
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 1
- 238000011529 RT qPCR Methods 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 101100221606 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) COS7 gene Proteins 0.000 description 1
- 101100331535 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) DIB1 gene Proteins 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- FMDHKPRACUXATF-ACZMJKKPSA-N Ser-Gln-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O FMDHKPRACUXATF-ACZMJKKPSA-N 0.000 description 1
- 102100028904 Serine/threonine-protein kinase MARK2 Human genes 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- TWLMXDWFVNEFFK-FJXKBIBVSA-N Thr-Arg-Gly Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O TWLMXDWFVNEFFK-FJXKBIBVSA-N 0.000 description 1
- YUPVPKZBKCLFLT-QTKMDUPCSA-N Thr-His-Val Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](C(C)C)C(=O)O)N)O YUPVPKZBKCLFLT-QTKMDUPCSA-N 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 101710120037 Toxin CcdB Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- HQYVQDRYODWONX-DCAQKATOSA-N Val-His-Ser Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)N[C@@H](CO)C(=O)O)N HQYVQDRYODWONX-DCAQKATOSA-N 0.000 description 1
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 1
- 208000036142 Viral infection Diseases 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- 238000002441 X-ray diffraction Methods 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 210000000683 abdominal cavity Anatomy 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- ZTOJFFHGPLIVKC-CLFAGFIQSA-N abts Chemical compound S/1C2=CC(S(O)(=O)=O)=CC=C2N(CC)C\1=N\N=C1/SC2=CC(S(O)(=O)=O)=CC=C2N1CC ZTOJFFHGPLIVKC-CLFAGFIQSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 101150063416 add gene Proteins 0.000 description 1
- 239000000853 adhesive Substances 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 239000003674 animal food additive Substances 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- 108010068265 aspartyltyrosine Proteins 0.000 description 1
- 229940031567 attenuated vaccine Drugs 0.000 description 1
- OHDRQQURAXLVGJ-HLVWOLMTSA-N azane;(2e)-3-ethyl-2-[(e)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S/1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C\1=N/N=C1/SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-HLVWOLMTSA-N 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 239000000378 calcium silicate Substances 0.000 description 1
- 229910052918 calcium silicate Inorganic materials 0.000 description 1
- 235000012241 calcium silicate Nutrition 0.000 description 1
- OYACROKNLOSFPA-UHFFFAOYSA-N calcium;dioxido(oxo)silane Chemical compound [Ca+2].[O-][Si]([O-])=O OYACROKNLOSFPA-UHFFFAOYSA-N 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 190000008236 carboplatin Chemical compound 0.000 description 1
- 230000004956 cell adhesive effect Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000004715 cellular signal transduction Effects 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 230000007012 clinical effect Effects 0.000 description 1
- 238000002648 combination therapy Methods 0.000 description 1
- 230000009137 competitive binding Effects 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 238000011254 conventional chemotherapy Methods 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 230000000875 corresponding effect Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 210000004292 cytoskeleton Anatomy 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 229910052805 deuterium Inorganic materials 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 238000002050 diffraction method Methods 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 235000013861 fat-free Nutrition 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000002073 fluorescence micrograph Methods 0.000 description 1
- 238000012757 fluorescence staining Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 235000013305 food Nutrition 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 230000005251 gamma ray Effects 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 125000003712 glycosamine group Chemical group 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 230000009036 growth inhibition Effects 0.000 description 1
- 108060003552 hemocyanin Proteins 0.000 description 1
- 239000003906 humectant Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 229960001101 ifosfamide Drugs 0.000 description 1
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 210000001822 immobilized cell Anatomy 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 238000010185 immunofluorescence analysis Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 230000006698 induction Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 206010023841 laryngeal neoplasm Diseases 0.000 description 1
- 108010057821 leucylproline Proteins 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 238000001325 log-rank test Methods 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 108010082117 matrigel Proteins 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 238000003358 metastasis assay Methods 0.000 description 1
- 230000001394 metastastic effect Effects 0.000 description 1
- 206010061289 metastatic neoplasm Diseases 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 238000002493 microarray Methods 0.000 description 1
- 239000013081 microcrystal Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- 230000004660 morphological change Effects 0.000 description 1
- 210000003097 mucus Anatomy 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 201000008026 nephroblastoma Diseases 0.000 description 1
- OSTGTTZJOCZWJG-UHFFFAOYSA-N nitrosourea Chemical compound NC(=O)N=NO OSTGTTZJOCZWJG-UHFFFAOYSA-N 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 238000004806 packaging method and process Methods 0.000 description 1
- 229960001592 paclitaxel Drugs 0.000 description 1
- 201000002528 pancreatic cancer Diseases 0.000 description 1
- 208000008443 pancreatic carcinoma Diseases 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 230000026731 phosphorylation Effects 0.000 description 1
- 238000006366 phosphorylation reaction Methods 0.000 description 1
- 230000001766 physiological effect Effects 0.000 description 1
- INAAIJLSXJJHOZ-UHFFFAOYSA-N pibenzimol Chemical compound C1CN(C)CCN1C1=CC=C(N=C(N2)C=3C=C4NC(=NC4=CC=3)C=3C=CC(O)=CC=3)C2=C1 INAAIJLSXJJHOZ-UHFFFAOYSA-N 0.000 description 1
- 229920000515 polycarbonate Polymers 0.000 description 1
- 239000004417 polycarbonate Substances 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920005990 polystyrene resin Polymers 0.000 description 1
- 229920000915 polyvinyl chloride Polymers 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- 230000002062 proliferating effect Effects 0.000 description 1
- 108010029020 prolylglycine Proteins 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 238000002731 protein assay Methods 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 230000014493 regulation of gene expression Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000012679 serum free medium Substances 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 230000008054 signal transmission Effects 0.000 description 1
- 238000011125 single therapy Methods 0.000 description 1
- 235000020183 skimmed milk Nutrition 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- UNFWWIHTNXNPBV-WXKVUWSESA-N spectinomycin Chemical compound O([C@@H]1[C@@H](NC)[C@@H](O)[C@H]([C@@H]([C@H]1O1)O)NC)[C@]2(O)[C@H]1O[C@H](C)CC2=O UNFWWIHTNXNPBV-WXKVUWSESA-N 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 108091008023 transcriptional regulators Proteins 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 230000002485 urinary effect Effects 0.000 description 1
- JXLYSJRDGCGARV-CFWMRBGOSA-N vinblastine Chemical compound C([C@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-CFWMRBGOSA-N 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 238000002424 x-ray crystallography Methods 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3046—Stomach, Intestines
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57484—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
- G01N33/57496—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites involving intracellular compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
- C12N15/113—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
- C12N15/1138—Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against receptors or cell surface proteins
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2310/00—Structure or type of the nucleic acid
- C12N2310/10—Type of nucleic acid
- C12N2310/14—Type of nucleic acid interfering N.A.
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2320/00—Applications; Uses
- C12N2320/30—Special therapeutic applications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/46—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
Definitions
- the present invention relates to epitopes of EPB41L5 (Erythrocyte Membrane Protein Band 4.1 Like 5) protein and monoclonal antibodies specifically binding thereto.
- EPB41L5 Epitope Membrane Protein Band 4.1 Like 5
- Cancer is a very fatal disease that can threaten the life of the individual by causing the cells that make up the tissues to abnormally multiply and form tumors, thereby preventing the organs from performing normal functions.
- stomach cancer is one of the leading causes of death.
- metastatic gastric cancer is known to be a malignant disease with a 5-year survival rate of less than 30% worldwide.
- Researches on new biomarkers have been conducted for the treatment of metastatic gastric cancer, but the specific pathogenesis is not known.
- Targeted therapeutic agents developed to date include HER2 targeted therapeutic agents and VEGFR2 targeted therapeutic agents, and in particular, HER2 has been found to be associated with poor prognosis of breast cancer, ovarian cancer or gastric cancer by Genetech / Roche.
- Humanized monoclonal antibodies (Herceptin or Trastuzumab) that bind to the extracellular domain have been developed.
- Herceptin / Trastuzumab is also a blockbuster drug currently sold worldwide, with sales of $ 950 million in the US alone in the first half of 2011, but other overexpressing HER2 / neu except breast cancer. Not only does it show no clinical effect, but patients with long-term administration of Herceptin / Trastuzumab are known to be resistant.
- One object of the present invention is to provide an epitope of 1 to 6 mer selected from amino acid residues 619 to 624 of EPB41L5 protein represented by the amino acid sequence of SEQ ID NO: 1.
- Another object of the present invention is to provide a monoclonal antibody or fragment thereof that recognizes and specifically binds EPB41L5 protein represented by SEQ ID NO: 1 as an antigen.
- Still another object of the present invention is a nucleic acid molecule encoding the monoclonal antibody or fragment thereof; And it provides a vector comprising the same.
- Still another object of the present invention is an epitope of 1 to 6 mer selected from the 619th to 624th amino acid residues of EPB41L5 protein represented by SEQ ID NO: 1; Nucleic acid molecules encoding them; Or to provide a vaccine composition for the prevention or treatment of cancer comprising a vector comprising the same as an active ingredient.
- Another object of the present invention is the monoclonal antibody or fragment thereof; Nucleic acid molecules encoding the same; Or to provide a pharmaceutical composition for the prevention, improvement or treatment of cancer comprising the vector containing the nucleic acid molecule as an active ingredient.
- Another object of the present invention is to provide a method for providing information for diagnosis of a disease caused by overexpression of EPB41L5.
- EPB41L5 Extracellular Tumor Cellular Protein Band 4.1 Like 5
- EPB41L5 Extracellular Membrane Protein Band 4.1 Like 5
- Efforts have been made to discover targeted therapeutic biomarkers, thereby completing the present invention by identifying epitopes of EPB41L5 protein that inhibit cancer growth and metastasis through TGF ⁇ -EPB41L5 signaling.
- the present invention provides an epitope of 1 to 6 mer selected from amino acid residues 619 to 624 of the EPB41L5 protein represented by SEQ ID NO: 1.
- the EPB41L5 protein in the present invention may be represented by SEQ ID NO: 1, GenBank No. Sequence information can be found in NM_020909.
- the EPB41L5 (Erythrocyte membrane protein band 4.1 like 5) protein belongs to the NBL4 subgroup of the superfamily of superfamily Erythrocyte Membrane Protein Band 4.1 having a FREM domain at the N-terminus and a nonhomologous sequence at the C-terminus.
- epitope refers to a localized site of an antigen to which an antibody or fragment thereof can specifically bind.
- Epitopes generally consist of surface groups of molecules such as amino acids or sugar side chains and generally have specific three-dimensional structural and specific charge characteristics. Conformational and non-stereotropic epitopes are distinguished in that binding to the conformational epitope is lost in the presence of denaturing solvents but not for non-stereotropic epitopes.
- Epitopes are amino acid residues that are directly involved in binding (also referred to as immunodominant components of the epitope) and other amino acid residues that are not directly involved in binding, such as amino acid residues that are effectively blocked by specific antigen binding peptides (ie, amino acid residues Present in the footprint of a specific antigen binding peptide).
- the epitope may include any one or more amino acids selected from amino acid residues at positions 619, 620, 621, 622, 623, and 624 of the EPB41L5 protein.
- the epitope may be composed of the 619th to 624th amino acid sequence of EPB41L5 protein, preferably may be composed of the amino acid sequence represented by SEQ ID NO: 2, but is not limited thereto.
- the epitope comprising the amino acid at the position may be used in a form combined with a carrier when used as a vaccine or a composition to maintain its structure.
- the carrier according to the present invention is not particularly limited as long as it is biocompatible and can achieve the desired effect in the present invention, but preferably may be selected from peptides, serum albumin, immunoglobulins, hemocyanin, polysaccharides and the like.
- the invention provides a monoclonal antibody or fragment thereof that recognizes and specifically binds EPB41L5 protein represented by SEQ ID NO: 1 as an antigen.
- the antibody or fragment thereof of the invention can bind to 1 to 6 mer epitopes selected from the 619th to 624th amino acid residues of EPB41L5.
- Epithelial-mesodermal metastasis is one of the major causes of gastric cancer cells, and many researchers have known that TGF ⁇ signaling mediates epithelial-mesodermal metastasis.
- TGF ⁇ ligand binds to TGF ⁇ receptor I by the serine / threonine kinase TGF ⁇ receptor II
- Smad2 / 3 is activated by phosphorylation by activation of the TGF ⁇ receptor dimer, it binds to coma Sma4 and moves into the nucleus.
- TGF- ⁇ 1 expression is high in mucus, serum, and tissue of gastric cancer patients, and some studies have reported that high TGF- ⁇ 1 expression is associated with low survival in gastric cancer patients.
- EPB41L5 gene and the protein encoded by the oligonucleotide microarray and Kaplan-Meier survival analysis when the expression level of the EPB41L5 gene and the protein encoded by the oligonucleotide microarray and Kaplan-Meier survival analysis is high, the survival rate of cancer patients is low, and KATOIII, MKN28, SNU1, SNU719 four gastric cancer cell lines It was confirmed that EPB41L5 mRNA and protein expression were increased by TGF- ⁇ 1, and that EPB41L5 expression increased by TGF- ⁇ 1 was regulated by Smad-dependent TGF ⁇ signaling mechanism.
- EPB41L5 protein, which is increased by TGF ⁇ signaling can interact with p120-catenin, a cell-adhesive agent, to affect cancer metastasis.
- the monoclonal antibody or fragment thereof according to the present invention specifically binds to the epitope of the amino acid sequence to be bound when the EPB41L5 / p120-catenin complex is formed, by effectively inhibiting the formation of the EPB41L5 / p120-catenin complex It can effectively inhibit cancer development, metastasis and growth.
- the monoclonal antibody or fragment thereof specifically binds to EPB41L5 represented by SEQ ID NO: 1, and blocks the interaction between EPB41L5 and p120-catenin, represented by SEQ ID NO: 1 If it is prepared using the EPB41L5 protein as an antigen is not particularly limited, but most preferably, the amino acid sequence of SEQ ID NO: 2 may be used as an antigen, but is not limited thereto.
- epitope refers to a localized site of an antigen to which an antibody or fragment thereof can specifically bind.
- contiguous amino acids in an antigen polypeptide may be epitopes, and two or more sites that are discontinuous by tertiary structural folding in the polypeptide may be epitopes together.
- Epitopes contain at least two, at least three, at least four, at least five, at least six, at least seven, and at least eight consecutive or discontinuous amino acids in the unique three-dimensional structure of an antigen. At least 9, at least 10, at least 11, at least 12, at least 13, at least 13, at least 14 or at least 15 may be included.
- EPB41L5 The antibody or fragment thereof of the present invention recognizes EPB41L5 as an antigen and specifically binds to it.
- EPB41L5 may specifically bind 1 to 6 mer selected from the 619th to 624th amino acid residues as epitopes.
- Epitopes may comprise one or more amino acids.
- Methods of determining the epitope to which a given antibody binds include various methods such as immunoblotting and immunoprecipitation tests through reactivity tests for the antibody. Determination of the three-dimensional spatial structure of the epitope can be performed using various methods such as x-ray crystallography, 2-dimensional nuclear magnetic resonance, and HDX-MS. (Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, GE Morris, Ed. (1996)).
- the epitope to which the antibody or fragment thereof of the present invention can bind is NMR spectroscopy, X-ray diffraction crystallography, ELISA analysis, HDX-MS (hydrogen / deuterium exchange coupled with mass spectrometry), array Can be determined via array-based oligo-peptide scanning assays, and / or mutagenesis mapping (Giege R et al., (1994) Acta Crystallogr D Biol Crystallogr 50 (Pt 4). ): 339-350; McPherson A (1990) Eur J Biochem 189: 1-23; Chayen NE (1997) Structure 5: 1269-1274; McPherson A (1976) J Biol Chem 251: 6300-6303).
- the term “antibody” may be any type of antibody (eg, IgG, IgE, IgM, IgD, IgA, or IgY) of an immunoglobulin molecule, and any subtype of antibody (eg, human IgG1, IgG2, IgG3, and IgG4 for mice; and IgG1, IgG2a, IgG2b, and IgG3) for mice.
- Immunoglobulins eg IgG1 may have various allotypes, and the term “antibody” herein includes generally known isotypes and allotypes.
- the term “antibody” herein may be IgG1, IgG2, IgG3, or IgG4, or a hybrid type thereof (eg, a hybrid of IgG2 and IgG4).
- the term “monoclonal antibody” or “monoclonal antibody” refers to an antibody that exhibits single binding specificity and affinity for a specific epitope.
- the monoclonal antibodies of the invention can be produced by the hybridoma method first described, for example, in Kohler et al., Nature 256, 495 (1975), or by recombinant DNA methods. Monoclonal antibodies are also described, for example, in Clackson et al., Nature 352, 624-628 (1991) and in Marks et al., J. Mol. Biol. 222, 581-597 (1991), can be isolated from phage antibody libraries.
- Monoclonal antibodies can be obtained from any suitable source, wherein the monoclonal antibodies in the present invention are prepared from cells obtained from mice immunized with cells expressing EPB41L5 antigen or with antigen of interest in the form of nucleic acid encoding EPB41L5 antigen. Available from Bridoma. Monoclonal antibodies can also be obtained from hybridomas derived from antibody-expressing cells, such as immunized human or non-human mammals such as rats, dogs, primates and the like.
- the monoclonal antibody is used to mean a fragment thereof, and the fragment preferably means an antigen binding fragment.
- fragments can be prepared using various methods known in the art. Fab and F (ab ') 2 fragments, for example, through proteolytic cleavage of immunoglobulin molecules using enzymes such as papain (production of Fab fragments) or pepsin (F (ab') 2). Can be prepared.
- fragment herein may be Fab, Fab ', F (ab') 2, Fv, single chain Fv (scFV), or sdAb comprising the VH or VL domain of a monomer, for which fragments are known in the art Well known.
- the antibody is a chimeric antibody, humanized antibody, bivalent, bispecific molecule, minibody, domain antibody, bispecific antibody, antibody mimetic, diabody ( diabody, triabody, tetrabody, or fragments thereof, but is not limited thereto.
- the "chimeric antibody” is an antibody obtained by recombining a variable region of a mouse antibody and a constant region of a human antibody, and is an antibody having a greatly improved immune response compared to a mouse antibody.
- the "humanized antibody” refers to an antibody in which the protein sequence of an antibody derived from a non-human species is modified to be similar to antibody variants naturally produced in humans.
- the humanized antibody may be prepared by recombining a mouse-derived CDR with a human antibody-derived FR to produce a humanized variable region, which may be recombined with a constant region of a preferred human antibody to prepare a humanized antibody.
- the monoclonal antibodies or fragments thereof of the invention inhibit the physiological effects associated with the growth and metastasis of cancer mediated by the EPB41L5 gene or proteins encoded by it.
- the increase in TGF- ⁇ 1 was confirmed in cancer, and the expression level of EPB41L5 protein is increased by TGF- ⁇ 1, and the expression level of EPB41L5 protein is regulated by Smad-dependent TGF ⁇ signaling mechanism. That is, the expression level of EPB41L5 protein increased by TGF- ⁇ 1 affects the mobility and invasion of cancer through the epithelial-mesodermal metastasis process.
- EPB41L5 may be treated by treating a monoclonal antibody or fragment thereof comprising the antigen-binding protein described above. It is possible to effectively inhibit cellular signal transduction and the like mediated by proteins.
- inhibit growth means any measurable decrease in cell growth when contacted with a monoclonal antibody or fragment thereof as compared to the growth of the same cell that is not in contact with the monoclonal antibody or fragment thereof. For example, about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100% growth inhibition of cell cultures). The reduction of can be caused by various mechanisms.
- the monoclonal antibody or fragment thereof comprises one or more CDRs (eg 1, 2, 3, 4, 5, or 6 CDRs).
- the monoclonal antibody or fragment thereof is a polypeptide comprising EPB41L5 protein as an antigen and binding to it, comprising one or more complementarity determining regions (CDRs) described herein.
- CDRs in the antigen binding protein orient the CDRs so that appropriate antigen binding properties are achieved.
- the antigen binding proteins provided herein can inhibit, block, reduce or modulate p120-catenin interactions with EPB41L5. In other words, by inhibiting the formation of EPB41L5 / p120-catenin complex present in the target it can inhibit the metastasis, growth of cancer mediated by TGF- ⁇ 1.
- the monoclonal antibody or fragment thereof in the present invention, the monoclonal antibody or fragment thereof,
- the monoclonal antibody or fragment thereof in the present invention, the monoclonal antibody or fragment thereof,
- the VH domain, or one or more CDRs may be linked to a constant domain to form a heavy chain.
- the VL domain, or one or more CDRs may be linked to a constant domain to form a light chain.
- Full length heavy and full length light chains combine to form a full length antibody.
- the monoclonal antibody or fragment thereof binds to an epitope of 1 to 6 mer selected from amino acid residues 619 to 624 of EPB41L5 protein represented by SEQ ID NO: 1, and represented by SEQ ID NO: 1.
- EPB41L5 amino acid residues 619 to 624 of EPB41L5 protein represented by SEQ ID NO: 1, and represented by SEQ ID NO: 1.
- the monoclonal antibody or fragment thereof can be used for therapeutic use.
- one or more biological activities of the EPB41L5 gene or a protein encoded therein may be inhibited, inhibited or modulated, and specifically bound to the EPB41L5 protein to bind to the EPB41L5 protein, eg, TGF- ⁇ 1. It can be used very appropriately for therapeutic use by inhibiting cellular signaling substantially induced by EPB41L5 protein through competitive binding of.
- variable region of an immunoglobulin chain is generally the same whole comprising a relatively conserved framework region (FR) linked by three hypervariable regions (more often referred to as "complementarity determining regions", ie CDRs).
- FR framework region
- CDRs complementarity determining regions
- the numbering system can be found in Kabat Sequences of Proteins of Immunological Interest (1987 and 1991, NIH, Bethesda, MD), or Chothia & Lesk, 1987, J. Mol. Biol. 196: 901-917; Chothia. et al., 1989, Nature 342: 878-883).
- variable regions can be provided herein, and as described above, each of these variable regions can be attached to the heavy and light chain constant regions to form a complete antibody heavy and light chain, respectively.
- Each formed heavy and light chain sequence can also be combined to form a complete antibody structure.
- the monoclonal antibody or fragment thereof provided in the present invention may include a variant of the amino acid sequence as long as it can specifically bind EPB41L5 protein.
- changes can be made to the amino acid sequence of an antibody to improve its binding affinity and / or other biological properties.
- modifications include, for example, deletions, insertions and / or substitutions of amino acid sequence residues that make up the antibody.
- amino acid mutations are made based on the relative similarity of amino acid side chain chinahona, such as hydrophobicity, hydrophilicity, charge, size and the like.
- amino acid side chain chinahona such as hydrophobicity, hydrophilicity, charge, size and the like.
- arginine, lysine and histidine are all positively charged residues; Alanine, glycine and serine have similar sizes; It can be seen that phenylalanine, tryptophan and tyrosine have a similar shape.
- arginine, lysine and histidine; Alanine, glycine and serine; Phenylalanine, tryptophan and tyrosine can be referred to as biologically functional equivalents.
- each amino acid is assigned a hydrophobicity index according to its hydrophobicity and charge: isoleucine (+4.5); Valine (+4.2); Leucine (+3.8); Phenylalanine (+2.8); Cysteine / cysteine (+2.5); Methionine (+1.9); Alanine (+1.8); Glycine (-0.4); Threonine (-0.7); Serine (-0.8); Tryptophan (-0.9); Tyrosine (-1.3); Proline (-1.6); Histidine (-3.2); Glutamate (-3.5); Glutamine (-3.5); Aspartate (-3.5); Asparagine (-3.5); Lysine (-3.9); And arginine (-4.5).
- Hydrophobic amino acid indexes are very important in conferring the interactive biological function of proteins. It is known that substitution with amino acids having similar hydrophobicity indexes can retain similar biological activity. When introducing mutations with reference to the hydrophobicity index, substitutions are made between amino acids that exhibit a hydrophobicity index difference of preferably within ⁇ 2, more preferably within ⁇ 1, even more preferably within ⁇ 0.5.
- binding molecules of the present invention are also construed to include sequences that exhibit substantial identity with the sequences set forth in the Sequence Listing.
- the term "substantial identity” means that at least 61% of the parallels between the sequences of the invention and any other sequence are maximally matched and the parallel sequences are analyzed using algorithms commonly used in the art. By a sequence that shows homology, more preferably 70% homology, even more preferably 80% homology, and most preferably 90% homology. Alignment methods for sequence comparison are known in the art. Various methods and algorithms for alignment are described in Smith and Waterman, Adv. Appl. Math. 2: 482 (1981); Needleman and Wunsch, J. Mol. Bio. 48: 443 (1970); Pearson and Lipman, Methods in Mol. Biol.
- NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al., J. Mol. Biol. 215: 403-10 (1990)) is accessible from the National Center for Biological Information (NBCI), etc.
- BLSAT is accessible at http://www.ncbi.nlm.nih.gov/BLAST/. Sequence homology comparison methods using this program can be found online (http://www.ncbi.nlm.nih.gov/BLAST/blast_help.html).
- the binding molecule preferably the antibody
- the binding molecule may be produced by conventional methods of producing the antibody, but may be produced by affinity maturation.
- affinity maturation refers to a process in which activated B cells produce an antibody having an increased affinity for an antigen during an immune response.
- affinity maturation can produce antibodies or antibody fragments produced due to affinity maturation based on the principles of mutation and selection, in the same manner as occurs in nature.
- the present invention is a nucleic acid molecule encoding the monoclonal antibody or fragment thereof; A vector comprising the nucleic acid molecule; Or it provides a host cell comprising the vector.
- the nucleic acid molecules of the present invention may be isolated or recombinant, and include DNA and RNA in single and double chain forms as well as corresponding complementarity sequences.
- An "isolated nucleic acid” is a nucleic acid isolated from a naturally occurring source, which is separated from the surrounding genetic sequence present in the genome of the individual from which the nucleic acid is isolated.
- nucleic acids such as PCR products, cDNA molecules, or oligonucleotides synthesized enzymatically or chemically from a template
- the nucleic acid resulting from this procedure can be understood as an isolated nucleic acid molecule.
- Isolated nucleic acid molecules represent nucleic acid molecules in the form of separate fragments or as components of larger nucleic acid constructs.
- Nucleic acids are “operably linked” when placed in a functional relationship with other nucleic acid sequences.
- the DNA of a presequence or secretion leader is operably linked to the DNA of a polypeptide when expressed as a preprotein, which is the form before the polypeptide is secreted, and the promoter or enhancer is a polypeptide sequence. Operably linked to a coding sequence when influencing transcription of the ribosome binding site, or when ribosome binding sites are arranged to facilitate translation.
- operably linked means that the DNA sequences to be linked are located contiguously, and in the case of a secretory leader, they are present within the same reading frame. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction enzyme sites. If such sites do not exist, the synthetic oligonucleotide adapters or linkers are used in accordance with conventional methods.
- vector refers to a carrier capable of inserting a nucleic acid sequence for introduction into a cell capable of replicating the nucleic acid sequence.
- Nucleic acid sequences can be exogenous or heterologous.
- expression vector refers to a vector comprising a nucleic acid sequence encoding at least a portion of a gene product to be transcribed. In some cases, RNA molecules are then translated into proteins, polypeptides, or peptides. Expression vectors can include various regulatory sequences. In addition to regulatory sequences that regulate transcription and translation, vectors and expression vectors can also include nucleic acid sequences that provide additional functionality.
- the expression vector in the present invention include commercially widely used pCDNA vectors, F, R1, RP1, Col, pBR322, ToL, Ti vectors; Cosmid; Phages such as lambda, lambdoid, M13, Mu, p1 P22, Q ⁇ , T-even, T2, T3, T7; It may be selected from the group consisting of plant viruses, but is not limited thereto, and all expression vectors known to those skilled in the art can be used in the present invention, and the selection of the expression vector depends on the properties of the host cell of interest.
- the introduction of the vector into host cells may be performed by calcium phosphate transfection, viral infection, DEAE-dextran regulated transfection, lipofectamine transfection, or electroporation, but is not limited thereto.
- An introduction method suitable for the expression vector and the host cell can be selected and used.
- the vector contains one or more selection markers, but is not limited thereto, and may be selected depending on whether the product is produced using a vector that does not include the selection marker.
- the selection of the selection marker is selected by the host cell of interest, which is not limited to this invention as it uses methods already known to those skilled in the art.
- a tag sequence may be inserted and fused to an expression vector.
- the tag may include, but is not limited to, a hexa-histidine tag, a hemagglutinin tag, a myc tag, or a flag tag. Any tag that facilitates purification known to those skilled in the art may be used in the present invention.
- host cell includes any eukaryotic and prokaryotic organism and refers to any transformable organism capable of replicating the vector or expressing a gene encoded by the vector.
- the host cell may be transfected or transformed by the vector, which means a process in which exogenous nucleic acid molecules are delivered or introduced into the host cell.
- the host cell of the present invention preferably includes bacterial cells, CHO cells, HeLa cells, HEK293 cells, BHK-21 cells, COS7 cells, COP5 cells, A549 cells, NIH3T3 cells and the like, but is not limited thereto. no.
- the present invention provides an epitope of 1 to 6 mer selected from amino acid residues 619 to 624 of the EPB41L5 protein represented by SEQ ID NO: 1; Nucleic acid molecules encoding the same; Or it provides a vaccine composition for the prevention or treatment of cancer comprising a vector comprising the same as an active ingredient.
- the contents related to EPB41L5, epitopes, nucleic acid molecules, and vectors are the same as described above and are omitted to avoid excessive complexity of the present specification.
- the vaccine may be a live vaccine, an attenuated vaccine or a dead vaccine and the vaccine may also be used as a feed or feed additive.
- the vaccine composition of the present invention can induce not only an immune response but also a systemic immune response to EPB41L5 through active immunity, which can prevent or treat cancer, and active immunity is that when the invading pathogen invades the body itself, Means to be produced and immunized.
- the present invention can be used to prevent or treat cancer by administering the vaccine composition to a subject.
- the cancer of the present invention may be an overexpression of the expression level of the EPB41L5 gene or protein when the EPB41L5 gene and its protein expression level is measured.
- the term “overexpression” refers to the expression level of the EPB41L5 gene or protein encoded by it in comparison to the cells of interest (eg, normal cells that are organs) when the expression level of EPB41L5 is measured by a suitable expression assay. This is an increase of 1.1 to 2 times or more.
- the type of cancer of the present invention is not limited, leukemias and acute lymphocytic leukemia, acute nonlymphocytic leukemias, chronic lymphocytes.
- Lymphomas such as leukemia, chronic myelogenous leukemia, Hodgkin's Disease, non-Hodgkin's lymphomas and multiple myeloma, brain tumors (brain) tumors, glioblastoma, neuroblastoma, rhabdomyosarcoma, retinoblastoma, will Childhood solid tumors, such as Wilms Tumor, bone tumors and soft-tissue sarcomas, lung cancer, breast cancer, prostate cancer ), Urinary cancers, uterine cancers, oral cancers, pancreatic cancer, melanoma and other skin cancers, stomach cancer, ovarian Common solid tumors in adults such as cancer, brain tumors, liver cancer, laryngeal cancer, thyroid cancer, esophageal cancer and testicular cancer May be administered to treat multiple cancers.
- the cancer of the present invention may be cancer stem cells.
- the “cancer stem cell” of the present invention means a cancer cell of a comprehensive meaning having self-renewal and differentiation ability, which are peculiar to stem cells. It is known to exist in tumors and is thought to be caused by abnormal transmission of genetic information of normal stem cells. Cancer stem cells are maintained and proliferated due to the presence of a microenvironment, niche for their survival, and it is known that normal cells, immune-related cells, or differentiated cancer cells existing around them affect these properties.
- the cancer stem cell is a normal tumor growth condition (the "normal tumor growth condition” refers to a state in which there is not enough cellular nutrients (glucose) necessary for cell growth and abundant growth conditions of the tumor microenvironment.
- cancer cells may have resistance to anticancer drugs by proliferating at a slow rate or maintaining a dormant state.
- the expression of transcriptional regulators is regulated unlike normal tumor cells, leading to major metabolic regulation.
- the function of a substance may be different compared to normal cancer cells. Through these different metabolic control mechanisms and the mechanisms linked to these signaling mechanisms that are linked to them, they acquire resistance to apoptosis in nutrient deprivation and refer to cells with infiltration and / or metastatic potential.
- any cell capable of differentiating into a general cancer cell is not limited thereto.
- the present invention is a monoclonal antibody or fragment thereof; Nucleic acid molecules encoding the same; A vector comprising the nucleic acid molecule; Or it provides a composition comprising an inhibitor that inhibits the expression of EPB41L5 gene.
- the composition of the present invention can be used for the prevention or treatment of cancer; Or as a pharmaceutical composition for inhibiting metastasis of cancer.
- composition of the present invention the contents related to the antibody or fragment thereof, nucleic acid molecule, cancer, cancer stem cell, etc. are the same as described in the epitope, monoclonal antibody or fragment thereof and the like are omitted to avoid excessive complexity of the specification.
- the pharmaceutical composition of the present invention comprises (a) the antibody or fragment thereof; Nucleic acid molecules encoding the same; A vector comprising the nucleic acid molecule; Or inhibitors that inhibit expression of the EPB41L5 gene; And (b) a pharmaceutically acceptable carrier.
- the most characteristic feature of the pharmaceutical composition of the present invention targets the EPB41L5 gene or the protein encoded by it, inhibits the expression level or the expression or activity of the EPB41L5 gene, thereby treating cancer or metastasis. It is to suppress.
- the inhibitor of the present invention is one selected from the group consisting of siRNA (small interference RNA), shRNA (short hairpin RNA), miRNA (microRNA), ribozyme, DNAzyme, peptide nucleic acids (PNA), antisense oligonucleotides It may be more than, but is preferably siRNA (small interference RNA) that specifically binds to the mRNA of the gene.
- siRNA small interference RNA
- shRNA short hairpin RNA
- miRNA miRNA
- microRNA miRNA
- PNA peptide nucleic acids
- antisense oligonucleotides It may be more than, but is preferably siRNA (small interference RNA) that specifically binds to the mRNA of the gene.
- the inhibitor inhibits EPB41L5 gene expression, and the siRNA may be siRNA represented by the nucleotide sequence of SEQ ID NO: 4 or siRNA represented by the nucleotide sequence of SEQ ID NO: 5.
- the present invention provides a method for preventing or treating cancer comprising the step of administering the pharmaceutical composition.
- the contents related to the pharmaceutical composition are the same as described in the pharmaceutical composition and are omitted to avoid excessive complexity of the specification.
- prevention of the present invention may be included without limitation as long as the action of blocking the symptoms caused by cancer or inhibiting or delaying the symptoms caused by using the composition of the present invention.
- the "treatment" of the present invention may be included without limitation as long as all the acts to improve or benefit from symptoms caused by cancer using the composition of the present invention.
- Pharmaceutically acceptable carriers included in the composition are those commonly used in the preparation, such as lactose, dextrose, sucrose, sorbitol, mannitol, starch, acacia rubber, calcium phosphate, alginate, gelatin, calcium silicate, microcrystals Cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methyl cellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil, and the like.
- the pharmaceutical composition of the present invention may further include a lubricant, a humectant, a sweetener, a flavoring agent, an emulsifier, a suspending agent, a preservative, and the like.
- a lubricant e.g., talc, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, a kaolin, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, mann
- the vaccine composition and the pharmaceutical composition of the present invention may be administered orally or parenterally, preferably parenterally, for example, by intravenous infusion, topical infusion and intraperitoneal infusion.
- Suitable dosages of the vaccine compositions and pharmaceutical compositions of the present invention may be determined by factors such as formulation method, mode of administration, age, weight, sex, morbidity, food, time of administration, route of administration, rate of excretion and response to the patient. Various, usually skilled, physicians can easily determine and prescribe a dosage effective for the desired treatment or prevention. According to a preferred embodiment of the present invention, the daily dose of the vaccine composition and the pharmaceutical composition of the present invention is 0.0001-100 mg / kg.
- the vaccine composition and the pharmaceutical composition of the present invention may be formulated using a pharmaceutically acceptable carrier and / or excipient according to a method which can be easily carried out by one of ordinary skill in the art. It may be prepared in the form or prepared by incorporating into a multi-dose container. In this case, the formulation may be in the form of a solution, suspension or emulsion in an oil or aqueous medium, or may be in the form of extracts, powders, granules, tablets or capsules, and may further include a dispersant or stabilizer.
- the vaccine composition and the pharmaceutical composition of the present invention may be used as a single therapy, but may also be used in combination with other conventional chemotherapy or radiation therapy, and such combination therapy may be used to more effectively treat cancer.
- Chemotherapeutic agents that can be used with the compositions of the present invention are cisplatin, carboplatin, procarbazine, mechlorethamine, cyclophosphamide, phospho Ifosfamide, melphalan, chlorambucil, bisulfan, nitrosourea, diactinomycin, daunorubicin, doxorubicin , Bleomycin, plicomycin, mitomycin, etoposide, tamoxifen, taxol, transplatinum, 5-fluoro 5-fluorouracil, vincristin, vinblastin, methotrexate, and the like.
- Radiation therapy that can be used with the composition of the present invention is X-ray irradiation, ⁇ -ray irradiation
- the method comprises the steps of: (a) obtaining a sample separated in vitro from the subject; (b) treating said sample with said monoclonal antibody or fragment thereof; And (c) confirming whether the expression level of EPB41L5 included in the sample of the subject is higher than the expression amount of EPB41L5 included in the normal group sample.
- the contents of the disease, cancer, cancer stem cells, monoclonal antibodies, etc. due to the overexpression of EPB41L5 is the same as described above and will be omitted to avoid excessive complexity of the specification.
- the present invention provides a method for quantifying EPB41L5 included in a sample comprising the step of treating a monoclonal antibody or fragment thereof.
- the monoclonal antibody or fragment thereof of the present invention specifically binds to EPB41L5, it can accurately measure the amount of EPB41L5 contained in the sample.
- the present invention provides an EPB41L5 quantification kit comprising the monoclonal antibody or fragment thereof.
- the quantitative kit of the present invention can quantify the amount of EPB41L5 by analyzing the antigen to the antibody through the antigen antibody binding reaction, the antigen-antibody binding reaction is a conventional ELISA (Enzyme-linked immunosorbent assay), RIA (Radioimmnoassay) , Sandwich assay, Western blot on polyacrylamide gel, Immunoblot assay and Immunohstochemical staining is preferably selected from the group consisting of, but not limited thereto. .
- Fixtures for the antigen-antibody binding reaction of the present invention include a well plate and a slide glass made of nitrocellulose membrane, PVDF membrane, polyvinyl resin or polystyrene resin.
- a well plate and a slide glass made of nitrocellulose membrane, PVDF membrane, polyvinyl resin or polystyrene resin.
- One selected from the group consisting of glass) may be used, but is not limited thereto.
- the secondary antibody is preferably labeled with a conventional color developing agent that performs a color reaction, HRP (Horseradish peroxidase), alkaline phosphatase (Colaid phosphatase), colloidal gold (Coloid gold), FITC (Poly L-lysine-fluorescein isothiocyanate ), Any one label selected from the group consisting of Fluorescein and Dye such as Rhodamine-B-isothiocyanate (RITC) may be used.
- a conventional color developing agent that performs a color reaction
- HRP Haseradish peroxidase
- alkaline phosphatase Cold phosphatase
- colloidal gold Coloid gold
- FITC Poly L-lysine-fluorescein isothiocyanate
- Any one label selected from the group consisting of Fluorescein and Dye such as Rhodamine-B-isothiocyanate (RITC) may be used.
- Substrate that induces color development is preferably used according to the labeling reaction, TMB (3,3 ', 5,5'-tetramethyl bezidine), ABTS [2,2'-azino-bis (3-ethylbenzothiazoline -6-sulfonic acid) and OPD (ophenylenediamine) is preferably used, but not limited to any one selected from the group consisting of.
- the present invention provides a monoclonal antibody or fragment thereof that recognizes and specifically binds EPB41L5 as an antigen.
- the present invention can be used for the detection of antibodies that specifically bind to the epitope of EPB41L5, the antibody discovered through this method shows the function of inhibiting the signaling process of EPB41L5, and EPB41L5 is involved by using this function It can be usefully used as a vaccine or therapeutic agent for cancer, especially stomach cancer.
- 1 is a result of performing microarray analysis from a sample of gastric cancer patients, it was confirmed that a high prognosis of gastric cancer patients when the EPB41L5 expression level is high.
- 1A shows the results of an oligonucleotide microarray analysis from gastric cancer patients without lymph node metastasis. Gastric cancer patients were classified into two groups according to gene expression patterns (based on the median value of EPB41L5 expression).
- Figure 1b is a graph of the results of the 10 year survival rule for two groups of gastric cancer patients.
- 1C shows the results of Kaplan Meier flutter analysis for two groups of gastric cancer patients.
- Figure 2 is a variety of experimental data carried out to analyze how EPB41L5 and mesenchymal gene expression is related to TGF ⁇ signal
- Figure 2a is a result of Western blot analysis of various gastric cancer cells.
- FIG. 2B is a graph showing the results of analyzing the expression level of the EPB41L5 gene by performing real-time qPCR on gastric cancer cells treated with TGF- ⁇ 1 (10 ng / ml) and untreated gastric cancer cells for 24 hours.
- the control is EPB41L5 mRNA expression in gastric cancer cells not treated with TGF- ⁇
- TGF- ⁇ 1 is EPB41L5 mRNA expression in gastric cancer cells treated with TGF- ⁇ 1.
- FIG. 2C shows Western blots for gastric cancer cells treated with TGF- ⁇ 1 (10 ng / ml) and untreated gastric cancer cells for 24 hours, showing EMT related genes (EPB41L5, p-Smad2, Smad2, p-Smad3). , Smad3, PAI-1, ⁇ -actin) expression was analyzed.
- FIG. 2D shows endogenous EPB41L5 and E-cadherin expression levels from NCI-N87 cells and KATOIII cells treated with TGF- ⁇ 1 (10 ng / ml) and untreated NCI-N87 cells and KATOIII cells (control) for 24 hours.
- TGF- ⁇ 1 10 ng / ml
- red represents E-cadherin
- blue represents Hochest 33258
- a scale bar represents 20 ⁇ m.
- Figure 2e is a photograph taken of the cell morphology from KATOIII and SNU719 cells with or without TGF- ⁇ 1 treatment. The cell morphology of the presence or absence of TGF- ⁇ 1 was observed through Figure 2e.
- White arrows indicate cells transformed with mesenchymal cells, exposed KATOIII and SNU719 cells. Scale bar indicates 20 ⁇ .
- FIG. 3 shows that Smad-dependent TGF ⁇ signaling can regulate EPB41L5 expression.
- FIG. 3A shows that TGF- ⁇ 1 is treated with or without TGF- ⁇ 1 in MKN45 cells and NCI-N87 cells deficient in Smad4 expression. Analysis by Western blot.
- 3B shows the results of analyzing endogenous EPB41L5 and E-cadherin expression levels from NCI-N87 cells treated with or without TGF- ⁇ 1 through immunofluorescence staining analysis.
- green means EPB41L5
- red means E-cadherin
- a scale bar means 20 ⁇ m.
- Figure 3c is a graph showing the analysis of mRNA fold induction of Smad4, EPB41L5, Slug, PAI-1 from KATOIII cells treated with or without TGF- ⁇ 1 or siSMAD4 # 1 or # 2.
- Experimental results are expressed as mean ⁇ s.e.m, scale bar is 20 ⁇ M. * P ⁇ 0.05, ** P ⁇ 0.01, *** P ⁇ 0.001.
- FIG. 3D shows Western blots of KATOIII cells treated with TGF- ⁇ 1 (10 ng / ml) or siSmad4 # 1, # 2 and untreated KATOIII cells, showing EMT related genes (EPB41L5, p-Smad4, ⁇ PAI -1, ⁇ Slug, ⁇ -tubulin) expression results.
- EMT related genes EPB41L5, p-Smad4, ⁇ PAI -1, ⁇ Slug, ⁇ -tubulin
- FIG. 4 shows that KATOIII cells treated with nothing, KATOIII cells treated with TGF- ⁇ 1 only, and KATOIII cells treated with TGF ⁇ inhibitor (LY2157299) after treatment with TGF- ⁇ 1 were prepared, and endogenous EPB41L5 and E-cadherin expressions were prepared. Analysis by immunofluorescence staining for analysis. Green is EPB41L5, red is E-cadherin, blue is Hochest 33258 and scale bar is 20 ⁇ m.
- Figure 5a confirms that the mobility of gastric cancer cells by EPB41L5 according to the treatment of TGF- ⁇ 1, NC siRNA transfected KATOIII cells, EPB41L5 siRNA # 1, EPB41L5 siRNA # 2 with or without addition of TGF- ⁇ 1 Real-time qPCR results in infected KATOIII cells.
- FIG. 5B is a result of Western blot analysis of KATOIII cells transfected with NC siRNA transfected KATOIII cells, EPB41L5 siRNA # 1, and EPB41L5 siRNA # 2 with or without TGF- ⁇ 1.
- 5C shows the morphological changes of KATOIII cells transfected with NC siRNA transfected KATOIII cells, EPB41L5 siRNA # 1, and EPB41L5 siRNA # 2 and SNU719 cells with or without TGF- ⁇ 1. Cells, modified with a scale bar of 20 ⁇ .
- FIG. 5D shows the results of in vitro migration and infiltration assays for KATOIII cells transfected with NC siRNA transfected KATOIII cells, EPB41L5 siRNA # 1, and EPB41L5 siRNA # 2 with and without TGF- ⁇ 1. Scale bar is 20 ⁇ .
- FIG. 5E shows the results of in vitro migration and infiltration assays for KATOIII cells transfected with NC (sigative control) siRNA transfected KATOIII cells, EPB41L5 siRNA # 1 or EPB41L5 siRNA # 2 with or without TGF- ⁇ 1.
- Experimental results are expressed as mean ⁇ s.e.m, * P ⁇ 0.05, ** P ⁇ 0.01, *** P ⁇ 0.001.
- Figure 6 relates to the specificity of the anti-EPB41L5 monoclonal antibody
- Figure 6a is transfected MKN28 cells with Flag-EPB41L5 construct, and analyzed by Western blot
- Figure 6b is EPB41L5 siRNA (# 1 or # 2), followed by Western blot analysis.
- 6C shows the results of immunofluorescence staining of MKN28 cells (EPB41L5 siRNA) transfected with EPB41L5 siRNA. At this time, green represents EPB41L5.
- 6D is a schematic diagram showing the EPB41L5 domain structure.
- 6E is Western analysis of 293T cells transfected with FL (full length) of EPB41L5, FERM of EPB41L5 and C-terminus of EPB41L5.
- FIG. 6F shows the total lysate of 293T cells transfected with plasmids (1-633, 1-628, 1-623, 1-618, 1-613) consecutively deleted at the C-terminus of EPB41L5. Analysis by Western blot.
- Figure 6g shows the results of Western blot analysis of total lysates of 293T cells transfected with FL (full length) of EPB41L5 and plasmids of 619-624 of EPB41L5.
- FIG. 6H prepares MKN28 cells co-transfected with any one selected from FL (full length) of EPB41L5, FERM of EPB41L5, C-term of EPB41L5, and ⁇ 619-624 of EPB41L5, and immunized against them The result is analyzed by fluorescence staining. At this time, immunofluorescence staining was analyzed using anti-EPB41L5 mAb and anti-Flag antibody. Green is EPB41L5, red is Flag tag, Blue is Hochest and scale bar is 20 ⁇ M.
- Figure 7 confirms that the infiltration and metastasis of gastric cancer cells increased by TGF- ⁇ 1 is inhibited by anti-EPB41L5 monoclonal antibody, by concentration of anti-EPB41L5 mAb in KATOIII cells with or without TGF- ⁇ 1 treatment When processed, it is an image (a) and analysis result graph (b) of its cell migration. Experimental data are expressed as mean ⁇ s.e.m and scale bars are 20 ⁇ m. ** P ⁇ 0.01 and *** P ⁇ 0.001.
- Figure 8 shows the results comparing the degree of inhibition of gastric cancer cell infiltration and metastasis increased by TGF- ⁇ 1 between the monoclonal antibody according to the present invention and the antibody that recognizes other epitopes by the anti-EPB41L5 monoclonal antibody .
- Figure 9 is to confirm the relationship between the lung metastasis of EPB41L5 and gastric cancer cells
- Figure 9a is the result of in vitro migration and infiltration analysis of EPB41L5 overexpressed KATOIII cells and the control (vehicle). At this time, 1% FBS was used as a chemical attractant.
- FIG. 9B quantifies the results of in vitro migration and invasion assays for EPB41L5 overexpressed KATOIII cells and controls, in which cells were randomly selected and counted with Fusion Capt advanced software. will be. Experimental data are expressed as mean ⁇ s.e.m.
- FIG. 9C shows the injection of EPB41L5 overexpressing KATOIII cells (GFP labeled) (EPB41L5 (GFP)) through the tail vein of nude mice (10 per group), followed by lung metastasis analysis by IVIS optical imaging system.
- FIG. 9D is a quantitative intensity measured from the image of FIG. 9C, and a ROI tool was used. Experimental data are expressed as mean radiation efficiency ⁇ s.e.m. * P ⁇ 0.05 and ** P ⁇ 0.01.
- FIG. 10A shows a diagram for preparing a group for injecting EPB41L5 overexpressed KATOIII cells through a nude mouse tail vein and injecting 5 mg / kg of anti-EPB41L5 monoclonal antibody (EPB41L5 + mAb) for two weeks at two-day intervals.
- FIG. 10B shows a control group (Vehicle) and EPB41L5 overexpressed KATOIII cells injected through nude mouse tail vein (EPB41L5), EPB41L5 overexpressed KATO2 cells injected through nude mouse tail vein, and treated for 2 weeks at 2 days intervals.
- the results were analyzed by the IVIS optical imaging system for the group (EPB41L5 + mAb) injected with 5 mg / kg of EPB41L5 monoclonal antibody.
- FIG. 10C is a graph showing the quantification of the intensity through the ROI tool from the image of FIG. 9B. Experimental data are expressed as mean radiation efficiency ⁇ s.e.m. ** P ⁇ 0.01.
- Figure 11 shows the results of Western blot analysis of EBP41L5 protein expression and antibody function in gastric cancer, lung cancer, breast cancer cells using EPB41L5 antibody.
- FIG. 12 is gastric cancer and lung cancer.
- Breast cancer cell lines were treated with EBP41L5 antibody by concentration, respectively.
- an epitope comprising amino acid residues 619 to 624 of the EPB41L5 protein represented by SEQ ID NO: 1; And it provides a vaccine composition for the prevention or treatment of cancer comprising the same.
- composition for preventing or treating cancer comprising the monoclonal antibody or a fragment thereof as an active ingredient.
- Human gastric cancer cell lines AGS, NCI-N87, KATO2, SK-GT-4, MKN1, MKN28, MKN45, SNU1, SNU5, SNU16, SNU216, SNU484, SNU638, SNU668 and SNU719 It was supplied from and used.
- All gastric cancer cells were cultured in RPMI-1640 medium with 10% FBS and 1% antibiotic / antibacterial solution (Corning, Manassas, VA, USA) at 5% CO 2 , 37 ° C. 293FT cells were cultured in DMEM.
- TGF- ⁇ 1 was purchased from Prospec (East Brunswick, NJ, USA) and used and LY2157299 was purchased from Selleckchem (Houston, TX, USA).
- EPB41L5 related DNA constructs encoding the full length, FERM domain, C-terminus, ⁇ 619-624 and 5 amino acids of the sequentially removed C terminus were generated by PCR and the pSG5-KF2M1 flag (Sigma-Aldrich, St. Louis) , MO, USA). All plasmid constructs were confirmed by DNA sequencing.
- the cells were transfected with siRNA using Lipofectamine RNAiMAX (Thermo Fisher Scientific, Rockfod, IL, USA) following the manufacturer's procedure.
- the siRNA used was synthesized in Genolution (Seoul, Korea), EPB41L5-1 (EPB41L5 siRNA # 1; siEPB41L5 # 1) (5'- GC AAUUGGCAGCUUAUAAUUU -3 '), EPB41L5-2 (EPB41L5 siRNA # 2; siEPB41L5 # 2) (5′-UUCAGAUUC GUGCCUAUUCAGUU-3 ′), Smad4-1 5′-GCUACUUACCAUCAU AACAUU-3 ′) and Smad4-2 (5′-GUUCCAUUGCUUACUUUUUUUU-3 ′).
- Monoclonal antibodies were prepared by immunizing mice with amino acid residues 386-637 (SEQ ID NO: 3) of human EPB41L5 antigen, which was obtained by requesting ATgen (Seongnam, South Korea).
- Monoclonal antibodies were prepared using human EPB41L5 antigen 386-637 amino acid residues (SEQ ID NO: 3).
- SEQ ID NO: 3 was selected as an antibody preparation target peptide for efficient antibody preparation.
- the antibody-producing target peptide SEQ ID NO: 3
- cells that produce antibodies to the antigen are generated, and antibody-producing cells (non-cells, B lymphocytes) obtained from the spleen of the mouse are myeloma cells (Myeloma).
- Myeloma myeloma cells
- fusion to obtain hybridoma cells After culturing in HAT medium in which only hybridoma cells can survive, the activity of the antibody was confirmed by ELISA experiment.
- hybridoma cells monoclonal hybridoma cells that specifically recognize EPB41L5 were selected, and the monoclonal hybridoma cells selected above were injected into the abdominal cavity of rats, and then obtained from ascites.
- the antibody was selected and identified a monoclonal antibody (EPB41L5 mAb) that specifically recognizes EPB41L5 by Western blot and immunofluorescence using the EPB41L5 structure and siRNA.
- EPB41L5 Overexpressing cell lines ( EPB41L5 overexpressing generate stable cell lines
- EPB41L5 DNA was cloned into the pCDH-CMV-MCS-EF1-puro vector (Addgene, Cambridge, Mass., USA).
- packaging plasmids pRSV-Rev and pMD2.G were transfected with pCDH-EPB41L5 or pLECE3-GFP in 293FT cells. After incubation for 48 hours, the supernatant was collected and filtered with a 0.45 ⁇ M pore filter.
- KATO2 cells were infected with lentivirus and then selected with 1 ⁇ g / ml puromycin (Sigma-Aldrich). Selected stabilized EPB41L5 overexpressing cell lines were classified as GFP with an Aria II flow cytometer (BD Biosciences, Sparks, MD, USA).
- Cells were lysed in lysis buffer (20 mM Tric-Cl, 150 mM NaCl, 1% Triton X-100, 1.5% MgCl 2 , 1 mM EDTA, 1 mM Na 2 VO 4 , 1 mM phenylmethylsulfonyl fluoride (PMSF) and protease inhibitor cocktail , pH 7.5).
- the lysate was briefly vortexed, centrifuged at 13,000 rpm for 20 minutes at 4 ° C. to take the supernatant and transferred to a new tube. Protein concentration was measured at 660 nm with protein assay reagent (Thermo Fisher Scientific).
- Protein samples of equal concentration were prepared, and each sample was electrophoresed on an SDS-polyacrylamide gel and then transferred to a nitro cellulose transfer membrane (Whatman, Dassel, Germany). Block the membrane in Tris buffer (pH 7.4) containing 0.1% (v / v) Tween 20 (Sigma-Aldrich) and 5% (w / v) nonfat Difco TM skim milk (BD Biosciences) and label with primary antibody (probe).
- Antibodies include EPB41L5 (ATgen, Seongnam, Korea), Flag-tag, ⁇ -actin (Sigma-Aldrich), ⁇ -tubulin (Abcam, Cambridge, UK), T ⁇ RI, T ⁇ RII, Smad2, Smad3, Smad4, p-Smad2, p -Smad3, slug, ZEB1 (Cell signaling, Danvers, MA, USA) and PAI-1 (Santa Cruz, Dallas, TX, USA) were used and their signals were subjected to substrate (Thermo Fisher Scientific) according to the manufacturer's protocol. It was confirmed through.
- RNA Extract total RNA using TRIzol reagent (Takara Bio, Otsu, Shiga, Japan), and synthesize cDNA using PrimeScript Reverse Transcriptase (Takara Bio, Otsu, Shiga, Japan) and oligo (dT) following manufacturer's protocol It was. Quantitative PCR was performed using SYBR Green Master (Roche, Basel, Switzerland) and ABI Prism 7700 sequence detection system (Applied Biosystems, Carlsbad, CA, USA).
- ⁇ -tubulin 5'-TTCTCCATTTACCCGGCACC-3 ') and (5'-GTTAGTGTAGGTTGGGCGCT-3'), EPB41L5 (5'-GAAA GAAGGCCCAGCAAACG-3) ') And (5'-AGATCTCATCCCCCAAGCCT-3'), PAI-1 (5'-CCCCACTTCTTCAGGCTGTT-3 ') and (5'-GCCGTTGAA GTAGAGGGCAT-3'), Slug (5'-TCATCTTTGGGGCGAGTGAG-3 ') and (5 '-TGCAGCTGCTTATGTTTGGC-3'), ZEB1 (5'-TATGAATGCCCA AACTGCAA-3 ') and (5'-TGGTGATGCTGAAAGAGACG-3'), Smad4 (5'-TGCATGACTTTGAGGGACAG-3 ') and (5'-GTGGAAGCCACAGGAATGTT .
- the amount of cDNA was normalized to ⁇ -tubulin. All
- Cell migration was measured by Transwell using a polycarbonate membrane insert (Corning, Manassas, VA, USA) with pores of 8.0 ⁇ m in size.
- inserts of Transwell were coated with Matrigel (BD Biosciences). Place 1 ⁇ 10 5 cell / well into the upper chamber and the lower chamber contains TGF- ⁇ 1, LY2157299 (TGF ⁇ inhibitor) or anti-EPB41L5 monoclonal antibody (mAb), which are chemoattractants, Filled with 600 ⁇ l serum free medium not included. After 24 hours of incubation, non-moving or invading cells were carefully removed from the upper chamber with a cotton swab. Moved or invasive cells were stained with a 20% methanol solution containing 0.2% crystal violet (Sigma-Aldrich) and counted using a microscope at ⁇ 200 magnification. Transfer and infiltration analyzes were performed three times.
- mice Five-week-old athymic BALB / c nu / nu mice were purchased from Orient (Seoul, Korea). Control vectors or pCDH-EPB41L5 and pLECE3-GFP overexpressed KATO2 cells (200 ⁇ l PBS solution containing 2 ⁇ 10 7 cells) were injected into the outer tail vein. Anti-EPB41L5 monoclonal antibody was administered 2 mg daily at 5 mg / kg. IVIS imaging system (Caliper life sciences, Hopkinton, Mass., USA) was used to take and analyze fluorescence images.
- Kaplan-Meier Plotter http://kmplot.com/analysis was used to analyze overall survival from data obtained from gastric cancer patient samples.
- the Affymetrix ID used was 220977_x_at, and the log-rank test used a Kaplan-Meier survival curve.
- Statistical analysis was performed using Student's t-test to compare two groups of independent experiments (both sides), and the data are expressed as mean ⁇ standard deviation (SD). P ⁇ 0.05 was considered statistically significant.
- oligonucleotide microarray analysis was performed. This was done in 78 gastric cancer patients without lymph node metastasis. The patients were classified into first and second groups based on the median expression of EPB41L5 gene. There is a first group located on the left based on the median of the expression levels of the EPB41L5 gene, and a second group located on the right of the median of the expression levels of the EPB41L5 gene.
- the first group with high APEG1, SMPX, GPR177 and EPB41L5 genes was found to have a higher relapse rate or mortality than the second group with no high gene expression (FIG. 1A).
- EPB41L5 which is the target of antibody-based cancer treatment, was selected as the target protein.
- Survival rates for the next 10 years in the two groups based on the median level of EPB41L5 gene expression (FIG. 1B) showed that patients with high expression levels of EPB41L5 gene had lower survival rates than those with low levels. Able to know.
- TGF- ⁇ 1 was treated with gastric cancer cells to investigate whether EPB41L5 gene expression was regulated by TGF ⁇ signal.
- the expression level of EPB41L5 gene was increased in KATOIII, MKN28, SNU1 and SNU719 cells by TGF- ⁇ 1 treatment.
- EPB41L5 gene expression levels were not significantly increased in GC cells deficient in Smad3 / Smad4 (FIG. 2B).
- expression of mesenchymal genes such as PAI-1, Slug, and phosphorylated Smad2 and Smad3 was significantly increased by TGF- ⁇ 1 treatment (FIG. 2C).
- FIG. 2D According to immunofluorescence staining results (FIG. 2D), expression of epidermal marker E-cadherin in transmembrane was decreased, and the expression level of EPB41L5 protein was increased by TGF- ⁇ 1 in the cell membrane of KATOIII. It was confirmed. In addition, gastric cancer cells KATOIII and SNU719 cells were changed to mesenchymal characteristics by TGF- ⁇ 1 treatment (Fig. 2e, Fig. 2f).
- TGF ⁇ signaling regulates the expression level and epithelial-mesenchymal transition of the EPB41L5 gene and proteins encoded by it in cancer, such as gastric cancer cells.
- TGF ⁇ signaling pathway is Smad dependent, which is involved in the regulation of EPB41L5 expression in gastric cancer cells.
- the present invention was intended to analyze the expression level change of EPB41L5 protein when LY2157299 (Galunisertib), a potent TGF ⁇ receptor I inhibitor, was treated.
- FIG. 4 shows that KATOIII cells treated with nothing, KATOIII cells treated with TGF- ⁇ 1 only, and KATOIII cells treated with TGF ⁇ inhibitor (LY2157299) after treatment with TGF- ⁇ 1 were prepared, and endogenous EPB41L5 protein and E-cadherin ( E-cadherin) expression was analyzed by immunofluorescence staining.
- Green is EPB41L5 protein
- red is E-cadherin
- blue is Hochest 33258
- scale bar is 20 ⁇ m.
- EPB41L5 siRNA was transfected into KATOIII cells or SNU719 cells.
- EPB41L5 siRNA # 1 SEQ ID NO: 4: 5'- GC AAUUGGCAGCUUAUAAUUU-3 '
- EPB41L5 siRNA # 2 SEQ ID NO: 5'- UUCAGAUUC GUGCCUAUUCAGUU -3'
- EPB41L5 expression was observed in FK cells transfected with FL and C-terminal constructs and MKN28 cells not transfected with ⁇ 619-624 (FIG. 6H). Taken together, these results indicate that the anti-EPB41L5 monoclonal antibody specifically recognizes the 619-624 amino acid region of EPB41L5.
- sequence of the variable region of the monoclonal antibody prepared in ⁇ Example 6>. was analyzed by Etigen (Korea).
- Etigen Karligen
- sequences of the heavy chain variable region CDRs 1 to 3 and the light chain variable region CDRs 1 to 3 of the monoclonal antibody according to the present invention are as follows.
- Heavy chain variable region CDR1 Gly Tyr Thr Phe Thr Ser Tyr Trp (SEQ ID NO: 6)
- Heavy chain variable region CDR2 Ile Tyr Pro Gly Asn Ser Asp (SEQ ID NO: 7)
- Heavy chain variable region CDR3 Thr Arg Gly Gly Lys Leu Pro Phe Ala Met Asp Tyr (SEQ ID NO: 8)
- Light chain variable region CDR1 Gln Ser Leu Val His Ser Asn Gly Asn Thr Tyr (SEQ ID NO: 9)
- Light chain variable region CDR2 Lys Val Ser (SEQ ID NO: 10)
- Light chain variable region CDR3 Ser Gln Ser Thr His Val Pro Trp Thr (SEQ ID NO: 11)
- anti-EPB41L5 monoclonal antibody The specificity of anti-EPB41L5 monoclonal antibody was attempted. As a result of evaluating the effect of anti-EPB41L5 monoclonal antibody on the migration of GC cells with or without TGF- ⁇ 1 treatment, it was confirmed that TGF- ⁇ 1 effectively increased the migration of KATOIII cells. Furthermore, anti-EPB41L5 monoclonal antibody was found to inhibit the increased cell migration by TGF- ⁇ 1 in KATOIII cells (Fig. 7a, b).
- the degree of cell migration inhibition by anti-EPB41L5 monoclonal antibody was compared according to the difference in the sequence of epitopes recognized by the monoclonal antibody.
- the monoclonal antibody (AtGen) according to the present invention significantly inhibited (100%) the increased cell migration by TGF- ⁇ 1, whereas the 638th to 708th amino acid sequence of EPB41L5 protein was detected.
- the recognized antibody Novus antibody
- antibodies that recognize the 619th to 624th amino acid sequences of the C-terminal region of EPB41L5 very effectively inhibit the mobility of cells increased by TGF- ⁇ 1 as compared to antibodies that specifically bind epitopes composed of other amino acid sequences. It can be seen that.
- the present invention was intended to analyze the effect of EPB41L5 in the migration of gastric cancer cells through in vitro migration and infiltration assay.
- KATOIII cells overexpressing EPB41L5 and KATOIII cells treated with nothing were prepared as their control (Vehicle).
- KATOIII cells and MKN28 cells were prepared as gastric cancer cell lines.
- A549 cells and H226 cells were prepared, and breast cancer cell lines were prepared with MCF7 cells and MDA-MB-231 cells.
- the cells were used by Yonsei University professor Jae-Ho Chung's laboratory and Korea Cell Line Bank. Each cell was incubated in RPMI-1640 medium with 10% FBS and 1% antibiotic / antibacterial solution (Corning, Manassas, VA, USA) at 5% CO 2 , 37 ° C.
- EBP41L5 protein expression in each cell population was confirmed using Western blot (FIG. 11).
- EPB41L5 protein expression was confirmed not only in gastric cancer cell line but also in lung cancer cell line and breast cancer cell line by anti-EPB41L5 monoclonal antibody (FIG. 11). This indicates that the anti-EPB41L5 monoclonal antibody according to the present invention can be effectively used for treatment or prevention in lung cancer and breast cancer as well as gastric cancer.
- KATOIII cells and MKN28 cells were prepared as gastric cancer cell lines.
- Lung cancer cell lines were prepared with A549 cells and H226 cells, and breast cancer cell lines were prepared with MCF7 cells and MDA-MB-231 cells.
- the cells were used by Yonsei University professor Jae-Ho Chung's laboratory and Korea Cell Line Bank.
- Each cell was incubated in RPMI-1640 medium with 10% FBS and 1% antibiotic / antibacterial solution (Corning, Manassas, VA, USA) at 5% CO 2 , 37 ° C.
- EMT Epidermal to Mesenchymal Transition
- EPB41L5 is reported to interact with p120 catenin and paxillin, which destabilize E-cadherin, but focal adhesion kinase also binds to MPP5, a Crumbs complex component that negatively regulates cell polarity.
- Another conjugation protein, ⁇ -catenin coexists with EPB41L5 in the side membrane of renal epithelial cells, and its binding was not confirmed.
- FAK has an N-terminal FERM domain and binds ASAP1 / AMAP1 and paxillin, another binding partners of EPB41L5 at the C-terminus.
- EPB41L5 leads to a poor prognosis of gastric cancer patients, in this regard it was confirmed that EPB41L5 has a high expression rate in cancer cells. Since TGF ⁇ is known to promote gastric cancer metastasis, it is predicted that this expression may be correlated with lymph node metastasis and the prognosis of cancer.As a result of analyzing the relationship between TGF ⁇ and EPB41L5, a number of Smad binding motifs were identified in the EPB41L5 gene promoter. It was.
- EPB41L5 is located on the cell surface and promotes in vitro and in vivo metastasis of GC cells, and thus, it is believed that the antibody which is specific for this may be used as a monoclonal antibody based on treatment, EPB41L5.
- Monoclonal antibodies were developed. EPB41L5 monoclonal antibodies effectively blocked the migration and invasion of gastric cancer cells by TGF- ⁇ 1, and it was confirmed that the increased lung metastasis occurring in cells overexpressing EPB41L5 was significantly inhibited by anti-EPB41L5 monoclonal antibodies.
- the anti-EPB41L5 monoclonal antibody of the present invention significantly inhibited the expression of EPB41L5 protein in each cell group (particularly, gastric cancer cell line) of gastric cancer, lung cancer and breast cancer, and confirmed that the survival rate of cancer cells was reduced.
- the EPB41L5 monoclonal antibody of the present invention is a very effective method for preventing or treating cancer, especially gastric cancer, or inhibiting metastasis.
- the present invention provides a monoclonal antibody or fragment thereof that recognizes and specifically binds EPB41L5 as an antigen.
- the present invention can be used for the detection of antibodies that specifically bind to the epitope of EPB41L5, the antibody discovered through this method shows the function of inhibiting the signaling process of EPB41L5, and EPB41L5 is involved by using this function It can be usefully used as a vaccine or therapeutic agent for cancer, especially stomach cancer.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Biomedical Technology (AREA)
- Genetics & Genomics (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- Oncology (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biophysics (AREA)
- Cell Biology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biotechnology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Mycology (AREA)
- General Chemical & Material Sciences (AREA)
- Physics & Mathematics (AREA)
- Hospice & Palliative Care (AREA)
- Food Science & Technology (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- General Engineering & Computer Science (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Plant Pathology (AREA)
Abstract
본 발명은 TGFβ/Smad3/EPB41L5 분자 메커니즘에 대한 암 세포에서의 영향을 규명하고, 여기서 EPB41L5의 높은 발현이 암 환자의 전반적인 생존률과 관련이 있음을 밝힌 바, EPB41L5가 암의 잠재적인 예후 지표임을 확인하였다. 따라서 본 발명은 EPB41L5를 항원으로 인식하도록 하는 EPB41L5의 에피토프를 특정하고, 이에 특이적으로 결합하는 항체 또는 이의 단편에 관한 것으로, 본 발명에서의 항체는 EPB41L5와 관련된 암에 대한 치료제로서 유용하게 활용될 수 있다.
Description
본 발명은 EPB41L5(Erythrocyte Membrane Protein Band 4.1 Like 5) 단백질의 에피토프 및 이에 특이적으로 결합하는 단일클론항체에 관한 것이다.
암(Cancer)이란 조직을 이루고 있는 세포가 비 정상적으로 무제한 증식하여 종양이 형성되도록 하고, 그에 따라 장기가 정상적인 기능을 수행할 수 없도록 하여 개체의 생명을 위협할 수 있는 매우 치명적인 질환이다. 2017년 한국인 사망원인 1위가 악성 신생물(암)이었으며, 전체사망자 중에서 27.6%가 암으로 인해 사망하였다.
암 질환 중에서 위암은 가장 주요한 사망 원인 중의 하나이다. 특히, 전이성 위암은 전세계적에서 5년 생존률이 30% 미만인 악성 질환으로 알려져 있다. 이러한 전이성 위암의 치료를 위해 새로운 바이오 마커와 관련된 연구들이 진행되어오고 있으나, 그 구체적인 발병기전에 대해서는 명확하게 알려진 바가 없는 실정이다.
현재까지 개발된 표적 치료제는 HER2 표적 치료제, VEGFR2 표적 치료제 등이 있고, 특히 HER2의 경우 Genetech/Roche 사에서 유방암, 난소암 또는 위암의 안 좋은 예후와 관련이 있음을 밝혀, HER2/neu의 세포외 도메인(extracellular domain)에 결합하는 인간화된 단일 클론 항체(Herceptin 또는 Trastuzumab)를 개발한 바 있다. 또한 허셉틴/트라스투주맙(Herceptin/Trastuzumab)은 현재 전세계적으로 판매되는 블록버스터 약으로, 2011년 상반기에만 미국에서 9억 5천만 달러의 판매고를 올렸으나 유방암을 제외한 HER2/neu를 상당량 과발현하는 다른 암들에 대해서는 임상 효과를 나타내지 못할 뿐 아니라 허셉틴/트라스투주맙을 장기 투여한 환자들은 내성을 갖게 된다는 단점이 있다고 알려져 있다.
따라서 암의 성장과 전이와 관련이 있는 생체분자를 규명하고, 이를 표적으로 하여 암의 성장과 전이를 제어할 수 있는 새로운 암 표적 치료의 생물 지표의 발굴에 대한 필요성이 대두되고 있는 실정이다.
상기한 배경기술로서 설명된 사항들은 본 발명의 배경에 대한 이해 증진을 위한 것일 뿐, 이 기술분야에서 통상의 지식을 가진 자에게 이미 알려진 종래기술에 해당함을 인정하는 것으로 받아들여져서는 안 될 것이다.
본 발명의 일 목적은 서열번호 1의 아미노산 서열로 표시되는 EPB41L5 단백질의 619 내지 624 번째 아미노산 잔기 중에서 선택되는 1 내지 6 mer의 에피토프를 제공하는 것이다.
본 발명의 다른 목적은 서열번호 1로 표시되는 EPB41L5 단백질을 항원으로 인식하여 이에 특이적으로 결합하는 단일클론항체 또는 이의 단편을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 단일클론항체 또는 이의 단편을 코딩하는 핵산분자; 및 이를 포함하는 벡터를 제공하는 것이다.
본 발명의 또 다른 목적은 서열번호 1로 표시되는 EPB41L5 단백질의 619 내지 624 번째 아미노산 잔기 중에서 선택되는 1 내지 6 mer의 에피토프; 이를 코딩하는 핵산 분자; 또는 이를 포함하는 벡터를 유효성분으로 포함하는 암의 예방 또는 치료용 백신 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 단일클론항체 또는 이의 단편; 이를 코딩하는 핵산분자; 또는 상기 핵산분자를 포함하는 벡터를 유효성분으로 포함하는 암의 예방, 개선 또는 치료용 약제학적 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은 EPB41L5의 과발현에 의한 질환의 진단을 위한 정보를 제공하는 방법을 제공하는 것이다.
본 발명의 다른 목적 및 이점은 하기의 발명의 상세한 설명, 청구범위 및 도면에 의해 보다 명확하게 된다.
본 발명자들은 정상대조군에 비하여 EPB41L5(Erythrocyte Membrane Protein Band 4.1 Like 5) 단백질의 과발현이 암의 성장과 전이와 관련이 있음을 확인하였고, 이를 표적으로 하여 암의 성장 및 전이를 제어할 수 있는 신규 암 표적 치료 생물 지표를 발굴하고자 예의 노력한 결과, TGFβ-EPB41L5 신호전달기전을 통해 암의 성장 및 전이를 억제하는 EPB41L5 단백질의 에피토프를 확인함으로써 본 발명을 완성하였다.
본 발명의 일 양태에 따르면, 본 발명은 서열번호 1로 표시되는 EPB41L5 단백질의 619 내지 624 번째 아미노산 잔기 중에서 선택되는 1 내지 6 mer의 에피토프를 제공한다.
본 발명에서 상기 EPB41L5 단백질은 서열번호 1로 표시될 수 있으며, GenBank No. NM_020909에서 서열정보를 확인할 수 있다.
본 발명에서 상기 EPB41L5(Erythrocyte membrane protein band 4.1 like 5) 단백질은 N-말단에 FREM 도메인과 C-말단에 비상동성 서열을 갖는 Erythrocyte Membrane Protein Band 4.1의 슈퍼패밀리(superfamily)의 NBL4 하위 그룹에 속한다.
본 명세서에서, 용어 "에피토프"라 함은 항체 또는 이의 단편이 특이적으로 결합할 수 있는 항원의 국소화된(localized) 부위를 의미한다. 에피토프는 대체로 아미노산 또는 당 측쇄와 같은 분자의 표면기로 이루어지고, 일반적으로 특이적인 3차원 구조 특성 및 특이적 전하 특성을 갖는다. 입체형태적 및 비-입체형태적 에피토프는 변성 용매의 존재 하에서 입체형태적 에피토프에 대한 결합은 손실되지만 비-입체형태적 에피토프에 대해서는 손실되지 않는다는 점에서 구별된다. 에피토프는 결합에 직접 관련되는 아미노산 잔기 (에피토프의 면역우성 성분으로도 칭해짐) 및 결합에 직접 관련되지 않는 기타 아미노산 잔기, 예컨대 특이적 항원 결합 펩티드에 의해 효과적으로 차단되는 아미노산 잔기 (즉, 아미노산 잔기가 특이적 항원 결합 펩티드의 풋프린트(footprint) 내에 존재함)를 포함할 수 있다.
본 발명에서 상기 에피토프는 EPB41L5 단백질의 619, 620, 621, 622, 623 및 624 위치의 아미노산 잔기 중에서 선택되는 어느 하나 이상의 아미노산을 포함할 수 있다.
본 발명에서 상기 에피토프는 EPB41L5 단백질의 619 내지 624 번째 아미노산 서열로 이루어진 것일 수 있고, 바람직하게는 서열번호 2로 표시되는 아미노산 서열로 이루어진 것일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서 상기 위치의 아미노산을 포함하는 에피토프는 그 구조를 유지하기 위하여, 백신이나 조성물로 이용될 때 담체와 결합된 형태로 이용할 수 있다. 본 발명에 따른 담체는 생체 적합하며 본 발명에서 목적하는 효과를 거둘 수 있는 것이라면 특별히 이에 제한되지 않으나, 바람직하게는 펩타이드, 혈청 알부민, 면역 글로불린, 헤모시아닌 및 다당체 등에서 선택될 수 있다.
본 발명의 또 다른 양태에 따르면, 본 발명은 서열번호 1로 표시되는 EPB41L5 단백질을 항원으로 인식하여 이에 특이적으로 결합하는 단일클론항체 또는 이의 단편을 제공한다.
본 발명 바람직한 구현예에 따르면, 본 발명의 항체 또는 이의 단편은 EPB41L5의 619 내지 624 번째 아미노산 잔기 중에서 선택되는 1 내지 6 mer의 에피토프(epitope)에 결합할 수 있다.
상피-중배엽 전이(EMT)는 위암전지의 주요한 원인 중 하나로, 많은 연구 그룹에서 TGFβ의 신호전달기전이 상피-중배엽 전이를 조절하는 것으로 알려진 바 있다. TGFβ 리간드가 세린/트레오닌 키나아제인 TGFβ 수용체 Ⅱ에 의해 TGFβ 수용체 I에 결합하게 되면, TGFβ 수용체 이량체의 활성화에 의해 Smad2/3가 인산화에 의해 활성화되면 co-Smad인 Sma4와 결합하여 핵 내로 이동하여 상피-중배엽 전이 과정과 관련 있는 유전자 PAI-1, ZEB1, Slug를 조절한다. TGF-β1 발현이 위암 환자의 점액, 혈청, 조직에서 높게 나타나며, 높은 TGF-β1 발현이 위암 환자의 낮은 생존률과 관련있다는 일부 연구 보고가 있다.
본 발명에서 oligonucleotide microarray와 Kaplan-Meier 생존분석을 통해 EPB41L5 유전자 및 이에 의해 코딩되는 단백질의 발현 수준이 높을 때, 암 환자의 생존율이 낮음을 확인하였고, KATOⅢ, MKN28, SNU1, SNU719 네 개의 위암 세포주에서 EPB41L5 mRNA와 단백질 발현은 TGF-β1에 의해 증가되었음을 확인하였으며, TGF-β1에 의해 증가된 EPB41L5 발현은 Smad-의존성 TGFβ 신호 기전에 의해 조절되고 있음을 확인하였다. TGFβ 신호 기전에 의해 증가된 EPB41L5 단백질은 세포부착물질인 p120-catenin과 상호작용하여 암의 전이에 영향을 줄 수 있다. 이에, 본 발명에 따른 상기 단일클론항체 또는 이의 단편은 EPB41L5/p120-catenin 복합체 형성될 때 결합되는 아미노산 서열을 에피토프로하여 특이적으로 결합하기 때문에, EPB41L5/p120-catenin 복합체의 형성을 효과적으로 억제함으로써 암 발생, 전이, 성장 등을 매우 효과적으로 억제할 수 있다.
본 발명의 바람직한 구현예에 따르면, 상기 단일클론항체 또는 이의 단편은 서열번호 1로 표시되는 EPB41L5에 특이적으로 결합하고, EPB41L5와 p120-catenin 간의 상호작용을 차단하는 것으로, 서열번호 1로 표시되는 EPB41L5 단백질을 항원으로 사용하여 제조된 것이라면 특별히 이에 제한되지 않으나, 가장 바람직하게는 서열번호 2의 아미노산 서열을 항원으로 이용한 것일 수 있으나, 이에 제한되는 것은 아니다.
본 명세서에서, 용어 "에피토프"라 함은 항체 또는 이의 단편이 특이적으로 결합할 수 있는 항원의 국소화된(localized) 부위를 의미한다. 예를 들어, 항원인 폴리펩타이드 중 연속적인 아미노산이 에피토프가 될 수 있으며, 폴리펩타이드에서 3차 구조상 접힘(folding)에 의해 비연속적인 2 또는 그 이상의 부위가 함께 에피토프가 될 수 있다. 에피토프는 항원의 독특한 3차원 구조에서, 연속 또는 비연속의 아미노산을 최소 2개 이상, 최소 3개 이상, 최소 4개 이상, 최소 5개 이상, 최소 6개 이상, 최소 7개 이상, 최소 8개 이상, 최소 9개 이상, 최소 10개 이상, 최소 11개 이상, 최소 12개 이상, 최소 13개 이상, 최소 14개 이상 또는 최소 15개 이상 포함할 수 있다. 본 발명의 항체 또는 이의 단편은 EPB41L5를 항원으로 인식하여 이에 특이적으로 결합하는데, EPB41L5는 상기 619 내지 624 번째 아미노산 잔기 중에서 선택되는 1 내지 6 mer를 에피토프로 하여 특이적으로 결합할 수 있으며, 상기 에피토프는 1 또는 그 이상의 아미노산을 포함할 수 있다.
주어진 항체가 결합하는 에피토프를 결정하는 방법(예를 들어, 에피토프 맵핑)은 항체에 대한 반응성 테스트를 통한 면역블로팅(immunoblotting) 및 면역침강(immunoprecipitation) 시험 등 다양한 방법이 있다. 에피토프의 3차원 공간 구조를 결정하는 방법은 x-레이 결정학(x-ray crystallography), 2차원 핵자기 공명법(2-dimensional nuclear magnetic resonance) 및 HDX-MS 등 다양한 방법을 이용하여 수행할 수 있다(Epitope Mapping Protocols in Methods in Molecular Biology, Vol. 66, G. E. Morris, Ed. (1996)).
본 발명의 바람직한 구현예에 따르면, 본 발명의 항체 또는 이의 단편이 결합할 수 있는 에피토프는 NMR 분광학, X-ray 회절 결정학, ELISA 분석, HDX-MS(hydrogen/deuterium exchange coupled with mass spectrometry), 어레이 기반 올리고-펩타이드 스캐닝(array-based oligo-peptide scanning assays), 및/또는 돌연변이 유발 맵핑(mutagenesis mapping)을 통해 결정될 수 있다(Giege R et al., (1994) Acta Crystallogr D Biol Crystallogr 50(Pt 4): 339-350; McPherson A (1990) Eur J Biochem 189: 1-23; Chayen NE (1997) Structure 5: 1269-1274; McPherson A (1976) J Biol Chem 251: 6300-6303).
본 명세서에서, 용어 "항체"는 면역글로불린 분자 중 어느 유형의 항체(예를 들어, IgG, IgE, IgM, IgD, IgA, 또는 IgY)일 수 있으며, 어느 하위 유형의 항체(예를 들어, 인간에 있어서 IgG1, IgG2, IgG3, 및 IgG4; 및 마우스에 있어서 IgG1, IgG2a, IgG2b, 및 IgG3)일 수 있다. 면역글로불린(예를 들어, IgG1)은 다양한 알로타입(allotype)이 존재할 수 있으며, 본 명세서에서 용어 "항체"는 일반적으로 알려진 아이소타입(isotype) 및 알로타입(allotype)을 포함한다. 또한, 본 명세서에서 용어 "항체"는 IgG1, IgG2, IgG3, 또는 IgG4 이거나, 이의 하이브리드(hybrid) 유형일 수 있다(예를 들어, IgG2 및 IgG4의 하이브리드).
본 명세서에서 용어 "단일클론항체" 또는 "monoclonal antibody"는 특정 에피토프에 대한 단일 결합 특이성(single binding specificity) 및 친화도(affinity)를 나타내는 항체를 의미한다.
본 발명의 단일클론항체는 예를 들어 문헌 [Kohler et al., Nature 256, 495 (1975)]에서 처음 설명된 하이브리도마 방법에 의해 생산될 수 있거나, 재조합 DNA 방법에 의해 생산될 수 있다. 단일클론항체는 또한 예를 들어 문헌 [Clackson et al., Nature 352, 624-628 (1991)] 및 [Marks et al., J. Mol. Biol. 222, 581-597 (1991)]에 기재된 기술을 이용하여 파지 항체 라이브러리로부터 단리될 수 있다. 단일클론항체는 임의의 적합한 공급원으로부터 입수할 수 있는데 본 발명에서의 단일클론항체는 EPB41L5 항원을 발현하는 세포 또는 EPB41L5 항원을 코딩하는 핵산 형태의 관심있는 항원으로 면역화시킨 마우스로부터 얻은 세포로부터 제조한 하이브리도마로부터 입수할 수 있다. 단일클론항체는 또한 면역화된 인간 또는 비-인간 포유동물, 예를 들어 래트, 개, 영장류 등의 항체-발현 세포로부터 유래된 하이브리도마로부터 입수할 수 있다.
본 명세서에서 상기 단일클론항체는 이의 단편을 포함하는 의미로 사용되며, 상기 단편은 바람직하게는 항원 결합 단편(antigen binding fragment)을 의미한다. 상기 단편은 당업계에 알려진 다양한 방법을 이용하여 제조할 수 있다. 예를 들어, 파파인(Fab 단편의 생산) 또는 펩신(F(ab')2)과 같은 효소를 이용하여 면역글로불린 분자의 단백질분해성 절단(proteolytic cleavage)을 통하여, Fab 및 F(ab')2 단편을 제조할 수 있다.
본 명세서에서 용어 "단편"은 Fab, Fab', F(ab')2, Fv, scFV(single chain Fv), 또는 모노머의 VH 또는 VL 도메인을 포함하는 sdAb일 수 있으며, 상기 단편에 대해서는 당업계에 잘 알려져 있다.
본 발명에서 상기 항체는 키메라 항체, 인간화 항체(humanized antibody), 이가(bivalent), 양특이성 분자, 미니바디(minibody), 도메인 항체, 이중특이적 항체(bispecific antibody), 항체 모방체, 디아바디(diabody), 트리아바디(triabody), 테트라바디(tetrabody), 또는 이의 단편일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서 상기 "키메라 항체"는, 생쥐 항체의 가변 영역 및 인간 항체의 불변 영역을 재조합 시킨 항체로서, 생쥐 항체에 비하여 면역 반응이 크게 개선된 항체이다.
또한, 본 발명에서 상기 "인간화 항체"는 인간이 아닌 종에서 유래한 항체의 단백질 서열을 인간에서 자연적으로 생산된 항체 변이체와 유사하도록 변형시킨 항체를 의미한다. 그 예로 상기 인간화 항체는 생쥐 유래의 CDR을 인간 항체 유래의 FR과 재조합시켜 인간화 가변 영역을 제조하고, 이를 바람직한 인간 항체의 불변 영역과 재조합시켜 인간화 항체를 제조할 수 있다.
본 발명의 단일클론항체 또는 이의 단편은 EPB41L5 유전자 또는 이에 의해 코딩되는 단백질에 의해 매개되는 암의 성장과 전이와 관련된 생리학적 효과를 억제한다. 구체적으로 암에 있어서 TGF-β1의 증가가 확인되었고, TGF-β1에 의해 EPB41L5 단백질의 발현 수준이 증가되는데, EPB41L5 단백질의 발현 수준은 Smad 의존성 TGFβ 신호기전에 의해 조절된다. 즉 TGF-β1에 의해 증가된 EPB41L5 단백질의 발현 수준은 상피-중배엽 전이 과정을 통해 암의 이동성과 침윤에 영향을 주는 것으로, 상술한 항원 결합 단백질을 포함하는 단일클론항체 또는 이의 단편을 처리하여 EPB41L5 단백질에 의해 매개되는 세포신호전달 등을 매우 효과적으로 억제할 수 있다.
본 발명에서 "성장을 억제한다"는 본 발명의 단일클론항체 또는 이의 단편과 접촉되지 않은 동일한 세포의 성장과 비교하여 단일클론항체 또는 이의 단편과 접촉되었을 때 세포 성장의 임의 측정 가능한 감소(예를 들어 약 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%의 세포 배양액의 성장 억제를 포함한다)를 포함하도록 의도되며, 상기 세포 성장의 감소는 다양한 메커니즘에 의해 발생할 수 있다.
상기 단일클론항체 또는 이의 단편은 하나 이상의 CDR(예를 들어 1, 2, 3, 4, 5, 또는 6개의 CDR)을 포함한다. 상기 단일클론항체 또는 이의 단편은 EPB41L5 단백질을 항원으로 하여, 이에 결합하도록 하는 것으로, 본원에서 설명되는 하나 이상의 상보성 결정 구역(CDR)을 포함하는 폴리펩티드이다. 상기 항원 결합 단백질에서 CDR은 적합한 항원 결합 특성이 달성되도록 CDR을 배향시킨다. 본원에서 제공되는 항원 결합 단백질은 EPB41L5와 p120-catenin 상호작용을 저해하거나 차단하거나 감소시키거나 조정할 수 있다. 즉 이를 통해 대상 내에 존재하는 EPB41L5/p120-catenin 복합체 형성을 저해함으로써 TGF-β1에 의해 매개되는 암의 전이, 성장을 억제할 수 있다.
본 발명에서 상기 단일클론항체 또는 이의 단편은,
서열번호 6으로 표시되는 중쇄 CDR1; 서열번호 7로 표시되는 중쇄 CDR2; 및 서열번호 8로 표시되는 중쇄 CDR3;을 포함하는 중쇄 가변영역; 및 서열번호 9로 표시되는 경쇄 CDR1; 서열번호 10으로 표시되는 경쇄 CDR2; 및 서열번호 11로 표시되는 경쇄 CDR3;을 포함하는 경쇄 가변영역;을 포함하는 것일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서 상기 단일클론항체 또는 이의 단편은,
서열번호 12로 표시되는 중쇄 가변영역; 및 서열번호 13으로 표시되는 경쇄 가변영역;을 포함하는 것일 수 있으나, 이에 제한되는 것은 아니다.
VH 도메인, 또는 하나 또는 그 이상의 CDR은 중쇄(heavy chain)를 형성하기 위하여 불변 도메인에 연결될 수 있다. 또한, VL 도메인, 또는 하나 또는 그 이상의 CDR은 경쇄(light chain)를 형성하기 위하여 불변 도메인에 연결될 수 있다. 전장(full length) 중쇄 및 전장 경쇄가 결합하여 전장 항체를 구성한다.
본 발명에서 상기 단일클론항체 또는 이의 단편은 앞서 설명한 바와 같이, 서열번호 1로 표시되는 EPB41L5 단백질의 619 내지 624 번째 아미노산 잔기 중에서 선택되는 1 내지 6 mer의 에피토프에 결합하는 것으로, 서열번호 1로 표시되는 EPB41L5에 특이적으로 결합함으로써 EPB41L5와 p120-catenin 간의 상호작용을 차단하는 효과를 나타낸다.
본 발명에서 상기 단일클론항체 또는 이의 단편은 치료 용도로 사용될 수 있다. 구체적으로, 상기 EPB41L5 유전자 또는 이에 의해 코딩되는 단백질의 하나 이상의 생물학적 활성을 억제하거나 저해하거나 조정할 수 있고, EPB41L5 단백질에 특이적으로 결합하여, 상기 EPB41L5 단백질과 결합 가능한 단백질, 예를 들면 TGF-β1과의 경쟁적 결합을 통해 실질적으로 EPB41L5 단백질에 의해 유도되는 세포신호전달 등을 억제함으로써 치료 용도로 매우 적절하게 사용될 수 있다.
면역글로불린 사슬의 가변 구역은 일반적으로 가변 구역은 일반적으로 3개의 초가변 구역(보다 종종 "상보성 결정 구역", 즉 CDR로 불림)에 의해 연결된 비교적 보존된 프레임워크 구역 (FR)을 포함하는 동일한 전체 구조를 보인다. 상기 언급된 각각의 중쇄/경쇄쌍의 2개의 사슬로부터의 CDR은 대개 프레임워크 구역에 의해 정렬되어, 표적 단백질 (예를 들어, PCSK9) 상의 특이적 에피토프와 특이적으로 결합하는 구조를 형성한다. N-말단으로부터 C-말단으로, 천연 발생 경쇄 및 중쇄 가변 구역은 모두 일반적으로 다음 순서의 이들 요소와 일치한다: FR1, CDR1, FR2, CDR2, FR3, CDR3 및 FR4. 각각의 이들 도메인 내의 위치를 점령하는 아미노산에 숫자를 배정하기 위한 넘버링 시스템이 고안되었다. 상기 넘버링 시스템은 문헌 ([Kabat Sequences of Proteins of Immunological Interest (1987 and 1991, NIH, Bethesda, MD)], 또는 [Chothia & Lesk, 1987, J. Mol. Biol.196:901-917]; [Chothia et al., 1989, Nature 342:878-883])에 정의되어 있다.
다양한 중쇄 및 경쇄 가변 구역이 본원을 통해 제공될 수 있으며, 앞서 설명한 바와 같이 각각의 이들 가변 구역은 상기 중쇄 및 경쇄 불변 구역에 부착되어 각각 완전한 항체 중쇄 및 경쇄를 형성할 수 있다. 또한 각각의 형성된 중쇄 및 경쇄 서열은 조합되어 완전한 항체 구조를 형성할 수 있다.
본 발명에서 제공하는 상기 단일클론항체 또는 이의 단편은 EPB41L5 단백질에 특이적으로 결합할 수 있는 한, 상기 아미노산 서열의 변이체를 포함할 수 있다. 예를 들면, 항체의 결합 친화도 및/또는 기타 생물학적 트성을 개선시키기 위하여 항체의 아미노산 서열에 변화를 줄 수 있다. 이러한 변형은 예를 들면 항체를 이루는 아미노산 서열 잔기의 결실, 삽입 및/또는 치환을 포함한다.
이러한 아미노산 변이는 아미노산 곁사슬 치호나체의 상대적 유사성, 예컨대, 소수성, 친수성, 전하, 크기 등에 기초하여 이루어진다. 아미노산 곁사슬 치환체의 크기, 모양 및 종류에 대한 분석에 의하여, 아르기닌, 라이신과 히스티딘은 모두 양전하를 띤 잔기이고; 알라닌, 글라이신과 세린은 유사한 크기를 갖으며; 페닐알라닌, 트립토판과 타이로신은 유사한 모양을 갖는다는 것을 알 수 있다. 따라서 이러한 고려 사항에 기초하여, 아르기닌, 라이신 및 히스티딘; 알라닌, 글라이신 및 세린; 그리고 페닐알라닌, 트립토판 및 타이로신은 생물학적으로 기능 균등물이라 할 수 있다.
변이를 도입하는 데 있어서, 아미노산의 소수성 인덱스 (hydropathic index)가 고려될 수 있다. 각각의 아미노산은 소수성과 전하에 따라 소수성 인덱스가 부여되어 있다: 아이소루이신(+4.5); 발린(+4.2); 루이신(+3.8); 페닐알라닌(+2.8); 시스테인/시스타인(+2.5); 메티오닌(+1.9); 알라닌(+1.8); 글라이신(-0.4); 쓰레오닌(-0.7); 세린(-0.8); 트립토판(-0.9); 타이로신(-1.3); 프롤린(-1.6); 히스티딘(-3.2); 글루타메이트(-3.5); 글루타민(-3.5); 아스파르테이트(-3.5); 아스파라긴(-3.5); 라이신(-3.9); 및 아르기닌(-4.5). 단백질의 상호적인 생물학적 기능(interactive biological function)을 부여하는 데 있어서 소수성 아미노산 인덱스는 매우 중요하다. 유사한 소수성 인덱스를 가지는 아미노산으로 치환하여야 유사한 생물학적 활성을 보유할 수 있다는 것은 공지된 사실이다. 소수성 인덱스를 참조하여 변이를 도입시키는 경우, 바람직하게는 ±2 이내, 보다 바람직하게는 ± 1 이내, 보다 더 바람직하게는 ± 0.5 이내의 소수성 인덱스 차이를 나타내는 아미노산 사이에 치환을 한다.
한편, 유사한 친수성 값(hydrophilicity value)을 가지는 아미노산 사이의 치환이 균등한 생물학적 활성을 갖는 단백질을 초래한다는 것도 잘 알려져 있다. 미국 특허 제4,554,101호에 개시된 바와 같이, 다음의 친수성 값이 각각의 아미노산 잔기에 부여되어 있다: 아르기닌(+3.0); 라이신(+3.0); 아스팔테이트(+3.0± 1); 글루타메이트(+3.0±1); 세린(+0.3); 아스파라긴(+0.2); 글루타민(+0.2); 글라이신(0); 쓰레오닌(-0.4); 프롤린(-0.5±1); 알라닌(-0.5); 히스티딘(-0.5); 시스테인(-1.0); 메티오닌(-1.3); 발린(-1.5); 루이신(-1.8); 아이소루이신(-1.8); 타이로신(-2.3); 페닐알라닌(-2.5); 트립토판(-3.4). 친수성 값을 참조하여 변이를 도입시키는 경우, 바람직하게는 ± 2 이내, 보다 바람직하게는 ± 1 이내, 보다 더 바람직하게는 ± 0.5 이내의 친수성 값 차이를 나타내는 아미노산 사이에서 치환을 수행할 수 있다.
분자의 활성을 전체적으로 변경시키지 않는 단백질에서의 아미노산 교환은 당해 분야에 공지되어 있다(H. Neurath, R.L.Hill, The Proteins, Academic Press, New York (1979)). 가장 통상적으로 일어나는 교환은 아미노산 잔기 Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser, Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Tyr/Phe, Ala/Pro, Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Gln/Glu 간의 교환이다.
상술한 생물학적 균등 활성을 갖는 변이를 고려한다면, 본 발명의 결합 분자는 서열목록에 기재된 서열과 실질적인 동일성(substantial identity)을 나타내는 서열도 포함하는 것으로 해석된다.
본 발명에서 용어 "실질적인 동일성"이란, 본 발명의 서열과 임의의 다른 서열을 최대한 대응되도록 병렬하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 병렬된 서열을 분석한 경우에, 최소 61%의 상동성, 보다 바람직하게는 70%의 상동성, 보다 더 바람직하게는 80%의 상동성, 가장 바람직하게는 90%의 상동성을 나타내는 서열을 의미한다. 서열비교를 위한 얼라인먼트 방법은 당업계에 공지되어 있다. 얼라인먼트에 대한 다양한 방법 및 알고리즘은 Smith and Waterman, Adv. Appl. Math. 2:482(1981); Needleman and Wunsch, J. Mol. Bio.48:443(1970); Pearson and Lipman, Methods in Mol. Biol. 24: 307-31(1988); Higgins and Sharp, Gene 73:237-44(1988); Higgins and Sharp, CABIOS 5:151-3(1989); Corpet et al., Nuc. Acids Res. 16:10881-90(1988); Huang et al., Comp. Appl. BioSci. 8:155-65(1992) and Pearson et al., Meth. Mol. Biol. 24:307-31(1994)에 개시되어 있다. NCBI Basic Local Alignment Search Tool (BLAST) (Altschul et al., J. Mol. Biol. 215:403-10(1990))은 NBCI (National Center for Biological Information) 등에서 접근 가능하며, 인터넷상에서 blastp, blasm, blastx, tblastn and tblastx와 같은 서열 분석 프로그램과 연동되어 이용할 수 있다. BLSAT는 http://www.ncbi.nlm.nih.gov/BLAST/에서 접속 가능하다. 이 프로그램을 이용한 서열 상동성 비교 방법은 온라인(http://www.ncbi.nlm.nih.gov/BLAST/ blast_help.html)을 통해 확인할 수 있다.
본 발명에서 상기 결합 분자, 바람직하게 상기 항체는, 항체를 생산하는 통상의 방법에 의해 생성될 수 있지만, 친화도 성숙(Affinity maturation)에 의해 생성될 수 있다.
본 발명에서 상기 "친화도 성숙(Affinity maturation)"은, 활성화된 B 세포가 면역 반응 과정에서 항원에 대한 친화도가 증가된 항체를 생산하는 과정을 의미한다. 본 발명의 목적상 상기 친화도 성숙은 자연에서 일어나는 과정과 동일하게, 돌연변이와 선택의 원리에 기초하여 친화도 성숙으로 인해 생성된 항체 또는 항체 단편을 생성할 수 있다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상기 단일클론항체 또는 이의 단편을 코딩하는 핵산분자; 상기 핵산분자를 포함하는 벡터; 또는 상기 벡터를 포함하는 숙주세포를 제공한다.
본 발명의 상기 핵산분자는 단리된 것이거나 재조합된 것일 수 있으며, 단일쇄 및 이중쇄 형태의 DNA 및 RNA뿐만 아니라 대응하는 상보성 서열이 포함된다. "단리된 핵산"은 천연 생성 원천에서 단리된 핵산의 경우, 핵산이 단리된 개체의 게놈에 존재하는 주변 유전 서열로부터 분리된 핵산이다. 주형으로부터 효소적으로 또는 화학적으로 합성된 핵산, 예컨대 PCR 산물, cDNA 분자, 또는 올리고뉴클레오타이드의 경우, 이러한 절차로부터 생성된 핵산이 단리된 핵산분자로 이해될 수 있다. 단리된 핵산분자는 별도 단편의 형태 또는 더 큰 핵산 구축물의 성분으로서의 핵산분자를 나타낸다. 핵산은 다른 핵산 서열과 기능적 관계로 배치될 때 "작동가능하게 연결"된다. 예를 들면, 전서열 또는 분비 리더(leader)의 DNA는 폴리펩타이드가 분비되기 전의 형태인 전단백질(preprotein)로서 발현되는 경우 폴리펩타이드의 DNA에 작동가능하게 연결되고, 프로모터 또는 인핸서는 폴리펩타이드 서열의 전사에 영향을 주는 경우 코딩 서열에 작동가능하게 연결되며, 또는 리보솜 결합 부위는 번역을 촉진하도록 배치될 때 코딩 서열에 작동가능하게 연결된다. 일반적으로 "작동가능하게 연결된"은 연결될 DNA 서열들이 인접하여 위치함을 의미하며, 분비 리더의 경우 인접하여 동일한 리딩 프레임 내에 존재하는 것을 의미한다. 그러나 인핸서는 인접하여 위치할 필요는 없다. 연결은 편리한 제한 효소 부위에서 라이게이션에 의해 달성된다. 이러한 부위가 존재하지 않는 경우, 합성 올리고뉴클레오타이드 어댑터 또는 링커를 통상적인 방법에 따라 사용한다.
본 명세서에서 용어 "벡터"는 핵산 서열을 복제할 수 있는 세포로의 도입을 위해서 핵산 서열을 삽입할 수 있는 전달체를 의미한다. 핵산 서열은 외생 (exogenous) 또는 이종 (heterologous)일 수 있다.
본 명세서에서 용어 "발현 벡터"는 전사되는 유전자 산물 중 적어도 일부분을 코딩하는 핵산 서열을 포함한 벡터를 의미한다. 일부의 경우에는 그 후 RNA 분자가 단백질, 폴리펩타이드, 또는 펩타이드로 번역된다. 발현 벡터에는 다양한 조절서열을 포함할 수 있다. 전사 및 번역을 조절하는 조절서열과 함께 벡터 및 발현 벡터에는 또 다른 기능도 제공하는 핵산 서열도 포함될 수 있다.
본 발명에서 상기 발현 벡터의 구체적인 예시로는 상업적으로 널리 사용되는 pCDNA 벡터, F, R1, RP1, Col, pBR322, ToL, Ti 벡터; 코스미드; 람다, 람도이드(lambdoid), M13, Mu, p1 P22, Qμ, T-even, T2, T3, T7 등의 파아지; 식물 바이러스로 이루어진 군으로부터 선택될 수 있으나, 이에 제한되는 것은 아니며, 당업자에게 발현 벡터로 알려진 모든 발현 벡터는 본 발명에 사용 가능하고, 발현 벡터를 선택할 때에는 목적으로 하는 숙주 세포의 성질에 따른다. 숙주세포로의 벡터 도입 시 인산칼슘 트랜스펙션, 바이러스 감염, DEAE-덱스트란 조절 트랜스펙션, 리포펙타민 트랜스펙션 또는 전기천공법에 의해 수행될 수 있으나 이에 한정되는 것은 아니며 당업자는 사용하는 발현 벡터 및 숙주 세포에 알맞은 도입 방법을 선택하여 이용할 수 있다. 바람직하게 벡터는 하나 이상의 선별 마커를 함유하나 이에 한정되지 않으며, 선별 마커를 포함하지 않은 벡터를 이용하여 생산물 생산 여부에 따라 선별이 가능하다. 선별 마커의 선택은 목적하는 숙주 세포에 의해 선별되며, 이는 이미 당업자에게 알려진 방법을 이용하므로 본 발명은 이에 제한되지 않는다.
본 발명에서 상기 핵산분자를 정제를 용이하게 하기 위하여 태그 서열을 발현 벡터 상에 삽입하여 융합시킬 수 있다. 상기 태그로는 헥사-히스티딘 태그, 헤마글루티닌 태그, myc 태그 또는 flag 태그를 포함하나 이에 한정되는 것은 아니며 당업자에게 알려진 정제를 용이하게 하는 태그는 모두 본 발명에서 이용 가능하다.
본 명세서에서 용어 "숙주세포"는 진핵생물 및 원핵생물을 포함하며, 상기 벡터를 복제할 수 있거나 벡터에 의해 코딩되는 유전자를 발현할 수 있는 임의의 형질 전환 가능한 생물을 의미한다. 숙주세포는 상기 벡터에 의해 형질감염(transfected) 또는 형질전환(transformed) 될 수 있으며, 이는 외생의 핵산분자가 숙주세포 내에 전달되거나 도입되는 과정을 의미한다.
본 발명의 숙주세포는 바람직하게는 세균(bacteria)세포, CHO 세포, HeLa 세포, HEK293 세포, BHK-21 세포, COS7 세포, COP5 세포, A549 세포, NIH3T3 세포 등을 들 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 다른 양태에 따르면, 본 발명은 서열번호 1로 표시되는 EPB41L5 단백질의 619 내지 624 번째 아미노산 잔기 중에서 선택되는 1 내지 6 mer의 에피토프; 이를 코딩하는 핵산분자; 또는 이를 포함하는 벡터를 유효성분으로 포함하는 암의 예방 또는 치료용 백신 조성물을 제공한다.
본 발명의 상기 백신 조성물에서, EPB41L5, 에피토프, 핵산분자, 벡터와 관련된 내용은 앞서 기재한 바와 동일하여 본 명세서의 과도한 복잡성을 피하기 위해 생략한다.
상기 백신은 생백신, 약독화 백신 또는 사백신일 수 있으며, 백신을 사료 또는 사료 첨가제로도 사용할 수 있다.
본 발명의 백신 조성물은 능동 면역을 통하여 EPB41L5에 대하여 면역반응 뿐만 아니라 전신면역반응을 유도할 수 있어, 암을 예방 또는 치료할 수 있고, 능동 면역은 병원체가 침입하였을 때 생체 스스로가 자기 몸속에 항체가 생성되게 하여 면역되는 것을 의미한다.
또한, 본 발명은 상기 백신 조성물을 개체에 투여하여 암의 예방 또는 치료에 이용될 수 있다.
본 발명의 상기 암은 EPB41L5 유전자 및 이의 단백질 발현 수준을 측정한 경우 EPB41L5 유전자 또는 단백질의 발현 수준이 과발현된 것일 수 있다.
본 명세서에서 사용된 용어 "과발현"은 적합한 발현 분석법을 통해 EPB41L5 발현 수준을 측정한 경우에 있어서, 비교 대상 세포(예컨대, 해당 기관인 정상 세포)과 비교하여 EPB41L5 유전자 또는 이에 의해 코딩되는 단백질의 발현 수준이 1.1~2배 이상 증가되어 있는 것을 의미한다.본 발명의 암의 종류는 제한되지 않으며, 백혈병(leukemias) 및 급성 림프구 백혈병(acute lymphocytic leukemia), 급성 비림프구 백혈병(acute nonlymphocytic leukemias), 만성 림프구 백혈병(chronic lymphocytic leukemia), 만성 골수 백혈병(chronic myelogenous leukemia), 호지킨 병(Hodgkin's Disease), 비호지킨 림프종(non-Hodgkin's lymphomas) 및 다발 골수종(multiple myeloma) 등과 같은 림프종(lymphomas), 뇌종양(brain tumors), 교모세포종(glioblastoma), 신경모세포종(neuroblastoma), 횡문근육종 (Rhabdomyosarcoma), 망막모세포종(retinoblastoma), 윌름즈종양(Wilms Tumor), 골종양(bone tumors) 및 연부조직육종(soft-tissue sarcomas) 등과 같은 소아 고형 종양(childhood solid tumors), 폐암(lung cancer), 유방암(breast cancer), 전립선암(prostate cancer), 요로암(urinary cancers), 자궁암(uterine cancers), 구강암(oral cancers), 췌장암(pancreatic cancer), 흑색종(melanoma) 및 기타 피부암(skin cancers), 위암(stomach cancer), 난소암(ovarian cancer), 뇌종양(brain tumors), 간암(liver cancer), 후두암(laryngeal cancer), 갑상선암(thyroid cancer), 식도암(esophageal cancer) 및 고환암(testicular cancer) 등과 같은 성인들의 통상의 고형 종양(common solid tumors)들을 포함하여 다수의 암들을 치료하도록 투여될 수 있다.
본 발명의 상기 암은 암 줄기세포일 수 있다.
본 발명의 상기 "암 줄기세포"란, 줄기세포 특유의 능력인 자가재생이나 분화능력을 가지고 있는 포괄적인 의미의 암세포를 의미한다. 종양 내 존재하는 것으로 알려져 있으며 정상 줄기세포의 유전적인 정보의 비정상적인 전이로 인해 발생하는 것으로 생각되고 있다. 암줄기세포는 그들이 생존하기 위한 미세환경, 니쉬(niche)의 존재로 인해 유지, 증식되며 주변에 존재하는 정상 세포, 면역관련 세포 또는 분화된 암세포가 이들 특성 유지와 증식에 영향을 미치는 것으로 알려져 있다. 상기 암 줄기세포는 정상적인 종양의 생장 조건(상기 "정상적인 종양의 생장 조건"이란 세포 성장에 필요한 영양분(포도당)이 충분하고 종양미세환경의 생장 여건이 풍족하여 세포 스트레스가 없는 상태를 지칭한다.)에서 일반적인 암세포와 상이하게 느린 속도로 증식하거나 휴지기(dormant state) 상태를 유지하여 항암제에 대한 저항성을 가지고 있을 수 있으며, 예를 들어, 전사조절인자의 발현이 정상적인 종양세포와 달리 통제되어 주요 대사조절물질의 기능이 일반 암세포와 비교하여 상이할 수 있다. 이러한 상이한 대사조절 능력과 이에 기전적으로 연계된 세포신호전달계의 조절을 통해 영양 결핍 상태에서 세포 사멸(apoptosis)에 대한 저항성을 획득하고 침윤 및/또는 전이능이 있는 세포를 포괄적으로 지칭한다. 그러나 일반적인 암 세포로 분화할 수 있는 세포라면 이에 제한되지 않는다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상기 단일클론항체 또는 이의 단편; 이를 코딩하는 핵산분자; 상기 핵산분자를 포함하는 벡터; 또는 EPB41L5 유전자의 발현을 억제하는 억제제를 포함하는 조성물을 제공한다.
본 발명의 바람직한 구현예에 따르면, 본 발명의 조성물은 암의 예방 또는 치료; 또는 암의 전이 억제용 약제학적 조성물로 사용될 수 있다.
본 발명의 상기 조성물에서, 항체 또는 이의 단편, 핵산 분자, 암, 암 줄기세포 등과 관련된 내용은 상기 에피토프, 단일클론항체 또는 이의 단편 등에 기재한 바와 동일하여 명세서의 과도한 복잡성을 피하기 위해 생략한다.
본 발명의 약제학적 조성물은 (a) 상기 항체 또는 이의 단편; 이를 코딩하는 핵산분자; 상기 핵산분자를 포함하는 벡터; 또는 EPB41L5 유전자의 발현을 억제하는 억제제; 및 (b) 약제학적으로 허용되는 담체를 포함할 수 있다.
본 발명의 상기 약제학적 조성물의 가장 큰 특징은 EPB41L5 유전자 또는 이에 의해 코딩되는 단백질을 표적으로 하여, 상기 EPB41L5 유전자의 발현 수준 또는 상기 EPB41L5 단백질의 발현 또는 활성을 억제하여, 암을 치료하거나 또는 전이를 억제시킨다는 것이다.
본 발명의 상기 억제제는 siRNA(small interference RNA), shRNA(short hairpin RNA), miRNA(microRNA), 리보자임(ribozyme), DNAzyme, PNA(peptide nucleic acids), 안티센스 올리고뉴클레오타이드로 이루어진 군으로부터 선택된 1 종 이상일 수 있으나, 바람직하게는 상기 유전자의 mRNA에 특이적으로 결합하는 siRNA(small interference RNA)이다. 상기 억제제는 EPB41L5 유전자 발현을 억제하는 것으로, 상기 siRNA는 서열번호 4의 염기서열로 표시되는 siRNA 또는 서열번호 5의 염기서열로 표시되는 siRNA일 수 있다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상기 약제학적 조성물을 투여하는 단계를 포함하는 암의 예방 또는 치료방법을 제공한다.
본 발명의 상기 암의 예방 또는 치료방법에서, 약제학적 조성물과 관련된 내용은 상기 약제학적 조성물에 기재한 바와 동일하여 명세서의 과도한 복잡성을 피하기 위해 생략한다.
본 발명의 상기 “예방”은 본 발명의 상기 조성물을 이용하여 암에 기인한 증상을 차단하거나, 그 증상을 억제 또는 지연시킬 수 있는 모든 행위라면 제한없이 포함될 수 있다.
본 발명의 상기 “치료”는 본 발명의 상기 조성물을 이용하여 암에 기인한 증상이 호전될 수 있도록 하거나, 이롭게 될 수 있도록 하는 모든 행위라면 제한없이 포함될 수 있다.본 발명의 백신 조성물과 약제학적 조성물에 포함되는 약제학적으로 허용되는 담체는 제제시에 통상적으로 이용되는 것으로서, 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산 칼슘, 알기네이트, 젤라틴, 규산 칼슘, 미세결정성 셀룰로스, 폴리비닐피롤리돈, 셀룰로스, 물, 시럽, 메틸 셀룰로스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘 및 미네랄 오일 등을 포함하나, 이에 한정되는 것은 아니다. 본 발명의 약제학적 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등을 추가로 포함할 수 있다. 적합한 약제학적으로 허용되는 담체 및 제제는 Remington's Pharmaceutical Sciences (19th ed., 1995)에 상세히 기재되어 있다.
본 발명의 백신 조성물과 약제학적 조성물은 경구 또는 비경구로 투여할 수 있고, 바람직하게는 비경구 투여이며, 예컨대, 정맥 내 주입, 국소 주입 및 복강 주입 등으로 투여할 수 있다.
본 발명의 백신 조성물과 약제학적 조성물의 적합한 투여량은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 다양하며, 보통으로 숙련된 의사는 소망하는 치료 또는 예방에 효과적인 투여량을 용이하게 결정 및 처방할 수 있다. 본 발명의 바람직한 구현예에 따르면, 본 발명의 백신 조성물과 약제학적 조성물의 1일 투여량은 0.0001-100 ㎎/㎏이다.
본 발명의 백신 조성물과 약제학적 조성물은 당해 발명이 속하는 기술분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있는 방법에 따라, 약제학적으로 허용되는 담체 및/또는 부형제를 이용하여 제제화 함으로써 단위 용량 형태로 제조되거나 또는 다용량 용기 내에 내입시켜 제조될 수 있다. 이때 제형은 오일 또는 수성 매질중의 용액, 현탁액 또는 유화액 형태이거나 엑스제, 분말제, 과립제, 정제 또는 캅셀제 형태일 수도 있으며, 분산제 또는 안정화제를 추가적으로 포함할 수 있다.
본 발명의 백신 조성물과 약제학적 조성물은 단독의 요법으로 이용될 수 있으나, 다른 통상적인 화학 요법 또는 방사 요법과 함께 이용될 수도 있으며, 이러한 병행 요법을 실시하는 경우에는 보다 효과적으로 암 치료를 할 수 있다. 본 발명의 조성물과 함께 이용될 수 있는 화학 요법제는 시스플라틴(cisplatin), 카르보플라틴(carboplatin), 프로카르바진(procarbazine), 메클로레타민(mechlorethamine), 시클로포스파미드(cyclophosphamide), 이포스파미드(ifosfamide), 멜팔란(melphalan), 클로라부실(chlorambucil), 비술판(bisulfan), 니트로소우레아(nitrosourea), 디악티노마이신(dactinomycin), 다우노루비신(daunorubicin), 독소루비신(doxorubicin), 블레오마이신(bleomycin), 플리코마이신(plicomycin), 미토마이신(mitomycin), 에토포시드(etoposide), 탁목시펜(tamoxifen), 택솔(taxol), 트랜스플라티눔(transplatinum), 5-플루오로우라실(5-fluorouracil), 빈크리스틴(vincristin), 빈블라스틴(vinblastin) 및 메토트렉세이트(methotrexate) 등을 포함한다. 본 발명의 조성물과 함께 이용될 수 있는 방사 요법은 X-선 조사 및 γ-선 조사 등이다.
본 발명의 또 다른 양태에 따르면, EPB41L5의 과발현에 의한 질환의 진단을 위한 정보를 제공하는 방법을 제공한다.
본 발명에서 상기 방법은 (a) 피검자로부터 체외로 분리된 샘플을 취득하는 단계; (b) 상기 단일클론항체 또는 이의 단편을 상기 샘플에 처리하는 단계; 및 (c) 상기 피검자의 샘플 중에 포함된 EPB41L5의 발현양이 정상군 샘플 중에 포함된 EPB41L5의 발현양 보다 높은지 여부를 확인하는 단계;를 포함한다.
본 발명의 상기 정보를 제공하는 방법에서, EPB41L5 과발현에 의한 질환, 암, 암 줄기세포, 단일클론항체 등에 대한 내용은 앞서 기재한 바와 동일하여 명세서의 과도한 복잡성을 피하기 위해 생략한다.
본 발명의 또 다른 양태에 따르면, 본 발명은 단일클론항체 또는 이의 단편을 처리하는 단계를 포함하는, 샘플 중에 포함된 EPB41L5의 정량 방법을 제공한다.
본 발명의 단일클론항체 또는 이의 단편은 EPB41L5에 특이적으로 결합하기 때문에 이를 이용하면 샘플 중에 포함된 EPB41L5의 양을 정확하게 측정 가능하다.
본 발명의 상기 정량 방법에서, EPB41L5 과발현에 의한 질환, 암, 암 줄기세포, 단일클론항체 등에 대한 내용은 앞서 기재한 바와 동일하여 명세서의 과도한 복잡성을 피하기 위해 생략한다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상기 단일클론항체 또는 이의 단편을 포함하는 EPB41L5 정량 키트를 제공한다.
본 발명의 정량 키트는 항원항체 결합반응을 통하여 상기 항체에 대한 항원을 분석함으로써 EPB41L5 양을 정량할 수 있으며, 상기 항원-항체 결합반응은 통상의 ELISA(Enzyme-linked immunosorbent assay), RIA(Radioimmnoassay), 샌드위치 측정법(Sandwich assay), 폴리아크릴아미드 겔 상의 웨스턴 블롯(Western Blot), 면역블롯 분석(Immunoblot assay) 및 면역조직화학염색 방법(Immnohistochemical staining)으로 이루어지는 군에서 선택되는 것이 바람직하나 이에 제한되지 않는다.
본 발명의 상기 항원-항체 결합 반응을 위한 고정체로는 니트로셀룰로오스 막, PVDF막, 폴리비닐(Polyvinyl) 수지 또는 폴리스티렌(Polystyrene) 수지로 합성된 웰 플레이트(Well plate) 및 유리로 된 슬라이드 글라스(Slide glass)로 이루어지는 군으로부터 선택되는 것이 사용될 수 있으나, 이제 제한되는 것은 아니다.
상기 2차 항체는 발색반응을 하는 통상의 발색제로 표지되는 것이 바람직하며, HRP(Horseradish peroxidase), 알칼리성 인산분해효소(Alkaline phosphatase), 콜로이드 골드(Coloid gold), FITC(Poly L-lysine-fluorescein isothiocyanate), RITC(Rhodamine-B-isothiocyanate) 등의 형광물질(Fluorescein) 및 색소(Dye)로 이루어지는 군으로부터 선택되는 어느 하나의 표지체가 사용될 수 있다. 발색을 유도하는 기질은 발색반응을 하는 표지체에 따라 사용하는 것이 바람직하며, TMB(3,3',5,5'-tetramethyl bezidine), ABTS[2,2'-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid)] 및 OPD(ophenylenediamine)로 이루어지는 군으로부터 선택되는 어느 하나를 사용하는 것이 바람직하나 이에 제한되는 것은 아니다.
본 발명의 특징 및 이점을 요약하면 다음과 같다:
(1) 본 발명은 EPB41L5를 항원으로 인식하여 이에 특이적으로 결합하는 단일클론항체 또는 이의 단편을 제공한다.
(2) 본 발명은 EPB41L5의 에피토프에 특이적으로 결합하는 항체발굴에 활용할 수 있으며, 이 방법을 통해 발굴한 항체는 EPB41L5의 신호전달과정을 억제하는 기능을 보이며 이 기능을 이용하여 EPB41L5가 관여하는 암 특히 위암에 대한 백신 또는 치료제로서 유용하게 활용될 수 있다.
도 1은 위암 환자 표본으로부터 마이크로어레이 분석을 수행한 결과로, EPB41L5 발현 수준이 높으면 위암 환자의 예후가 좋지 않음을 확인하였다. 도 1a는 림프절 전이가 없는 위암 환자로부터 올리고뉴클레이타이드 마이크로어레이 분석을 수행한 결과이다. 위암 환자는 유전자 발현 양상(EPB41L5 발현 중간 값 기준)에 따라 두 그룹으로 분류하였다. 도 1b는 위암 환자의 두 그룹에 대한 10년 동안의 생존룰을 분석한 결과 그래프이다. 도 1c는 위암 환자 두 그룹에 대한 Kaplan Meier 플러터 분석을 실시한 결과이다.
도 2는 EPB41L5 및 간엽(mesenchymal) 유전자 발현이 TGFβ 신호와 어떠한 관련성을 가지는지 분석하기 위해 수행한 다양한 실험데이터로, 도 2a는 다양한 위암세포들을 웨스턴 블롯으로 분석한 결과이다.
도 2b는 24시간 동안 TGF-β1(10 ng/ml)을 처리한 위암 세포 및 처리하지 않은 위암 세포들에 대하여 실시간 qPCR을 수행함으로써, EPB41L5 유전자의 발현 수준을 분석한 결과 그래프이다. 이때, control는 TGF-β1을 처리하지 않은 위암세포에서 EPB41L5 mRNA 발현을 나타낸 것이고, TGF-β1은 TGF-β1을 처리한 위암세포에서 EPB41L5 mRNA 발현을 나타낸 것이다.
도 2c는 24시간 동안 TGF-β1(10 ng/ml)을 처리한 위암 세포 및 처리하지 않은 위암 세포들에 대하여 웨스턴 블롯을 수행하여, EMT 관련 유전자(EPB41L5, p-Smad2, Smad2, p-Smad3, Smad3, PAI-1, β-actin) 발현정도를 분석한 결과이다.
도 2d는 24시간 동안 TGF-β1(10 ng/ml)을 처리한 NCI-N87 세포와 KATOⅢ 세포 및 처리하지 않은 NCI-N87 세포와 KATOⅢ 세포(control)로부터 내인성 EPB41L5 및 E-cadherin 발현 수준을 분석한 결과이다. 이때 녹색은 EPB41L5, 빨간색은 E-카데린(E-cadherin), 파란색은 Hochest 33258을 나타내며, 스케일 막대는 20 ㎛를 의미한다.
도 2e는 TGF-β1 처리하거나 처리하지 않은 KATOⅢ 및 SNU719 세포로부터 세포 형태를 촬영한 사진이다. 도 2e를 통해 TGF-β1의 존재 유무에 따른 세포 형태가 관찰되었다. 흰색 화살표는 간엽세포로 형질전환된 세포를 나타내는 것으로, 노출된 KATOⅢ 및 SNU719 세포. 스케일 바는 20 μM을 나타낸다.
도 3은 Smad에 의존적인 TGFβ 신호전달이 EPB41L5 발현을 조절할 수 있음을 확인한 실험결과로, 도 3a는 Smad4의 발현이 결핍된 MKN45 세포 및 NCI-N87 세포에 TGF-β1을 처리하거나 처리하지 않은 뒤에 웨스턴 블롯으로 분석한 결과이다.
도 3b는 면역형광 염색 분석을 통해 TGF-β1로 처리하거나, 처리하지 않은 NCI-N87 세포로부터 내인성 EPB41L5 및 E-카데린 발현 수준을 분석한 결과이다. 이때 녹색은 EPB41L5, 빨간색은 E-카데린이며, 스케일 막대는 20 ㎛를 의미한다.
도 3c는 TGF-β1 또는 siSMAD4 #1 또는 #2로 처리하거나, 처리하지 않은 KATOⅢ 세포로부터 Smad4, EPB41L5, Slug, PAI-1의 mRNA fold induction을 분석하여 나타낸 그래프이다. 실험 결과는 평균 ± s.e.m로 표기하였고, 스케일 막대는 20 μM이다. * P <0.05, ** P <0.01, *** P <0.001.
도 3d는 TGF-β1(10 ng/ml) 또는 siSmad4 #1, #2를 처리한 KATOⅢ 세포 및 처리하지 않은 KATOⅢ 세포들에 대하여 웨스턴 블롯을 수행하여, EMT 관련 유전자(EPB41L5, p-Smad4, αPAI-1, αSlug, α-tubulin) 발현정도를 분석한 결과이다.
도 4는 아무것도 처리하지 않은 KATOⅢ 세포, TGF-β1만 처리한 KATOⅢ 세포, TGF-β1을 처리한 후 TGFβ 억제제(LY2157299)를 처리한 KATOⅢ 세포를 준비하고, 이를 내인성 EPB41L5 및 E-카데린 발현을 분석하기 위해 면역형광 염색으로 분석한 결과이다. 녹색은 EPB41L5, 빨간색은 E-카데린, 파란색은 Hochest 33258이고, 스케일 막대는 20 ㎛이다.
도 5a은 TGF-β1의 처리에 따른 EPB41L5에 의해 위암 세포의 이동성이 조절되는 것을 확인한 것으로, TGF-β1의 첨가유무에 따른 NC siRNA 형질감염된 KATOⅢ 세포, EPB41L5 siRNA#1, EPB41L5 siRNA#2로 형질감염된 KATOⅢ 세포에서의 실시간 qPCR 결과이다.
도 5b는 TGF-β1의 첨가유무에 따른 NC siRNA 형질감염된 KATOⅢ 세포, EPB41L5 siRNA#1, EPB41L5 siRNA#2로 형질감염된 KATOⅢ 세포에서의 웨스턴 블랏 분석결과이다.
도 5c는 TGF-β1의 첨가유무에 따른 NC siRNA 형질감염된 KATOⅢ 세포, EPB41L5 siRNA#1, EPB41L5 siRNA#2로 형질감염된 KATOⅢ 세포와 SNU719 세포의 형태학적 변화를 나타낸 결과로, 흰색 화살표는 중간엽 세포로 변형된 세포를 나타내며, 스케일 막대는 20 μM이다.
도 5d는 TGF-β1의 첨가유무에 따른 NC siRNA 형질감염된 KATOⅢ 세포, EPB41L5 siRNA#1, EPB41L5 siRNA#2로 형질감염된 KATOⅢ 세포에 대한 시험관 내 이동 및 침윤 분석결과 이미지이다. 스케일 막대는 20 μM이다.
도 5e는 TGF-β1의 첨가유무에 따른 NC(negative control) siRNA 형질감염된 KATOⅢ 세포, EPB41L5 siRNA#1 또는 EPB41L5 siRNA#2로 형질감염된 KATOⅢ 세포에 대한 시험관 내 이동 및 침윤 분석 결과이다. 실험 결과는 평균 ± s.e.m로 표기하였고, * P <0.05, ** P <0.01, *** P <0.001.
도 6은 항-EPB41L5 단일클론항체의 특이성에 관한 것으로, 도 6a는 MKN28 세포를 Flag-EPB41L5 구조물로 형질감염시킨 후, 이를 웨스턴 블랏으로 분석한 결과이고, 도 6b는 MKN28 세포를 EPB41L5 siRNA(#1 또는 #2)로 형질감염시킨 후, 이를 웨스턴 블랏으로 분석한 결과이다.
도 6c는 EPB41L5 siRNA로 형질감염된 MKN28 세포(EPB41L5 siRNA)를 면역형광염색으로 분석한 결과이다. 이때, 녹색은 EPB41L5을 나타낸다.
도 6d는 EPB41L5 도메인 구조를 나타낸 개략도이다.
도 6e는 EPB41L5의 FL(전장), EPB41L5의 FERM 및 EPB41L5의 C-말단으로 형질감염된 293T 세포에 대한 웨스턴 분석결과이다.
도 6f는 EPB41L5의 C-말단에서 5개의 아미노산 잔기가 연속적으로 결실된 플라스미드(1-633, 1-628, 1-623, 1-618, 1-613)로 형질감염된 293T 세포의 전체 용해물을 웨스턴 블랏으로 분석한 결과이다.
도 6g는 EPB41L5의 FL(전장)과 EPB41L5의 △ 619-624의 플라스미드로 형질감염된 293T 세포의 전체 용해물을 웨스턴 블랏으로 분석한 결과이다.
도 6h는 EPB41L5의 FL(전장), EPB41L5의 FERM, EPB41L5의C-term 및 EPB41L5의 △ 619-624 중에서 선택되는 어느 하나와 EPB41L5 siRNA이 공-형질감염된 MKN28 세포를 각각 제조하고, 이들에 대하여 면역형광염색으로 분석한 결과이다. 이때, 면역형광염색은 항-EPB41L5 mAb 및 항-Flag 항체를 사용하여 분석하였다. 녹색은 EPB41L5, 빨간색은 Flag tag, 파란색은 Hochest이고, 스케일 바는 20 μM이다.
도 7은 TGF-β1에 의해 증가된 위암 세포의 침윤과 전이를 항-EPB41L5 단일클론항체에 의해 억제되고 있음을 확인한 것으로, TGF-β1을 처리유무에 따른 KATOⅢ 세포에 항-EPB41L5 mAb를 농도별로 처리하였을 때, 이의 세포 이동에 대한 이미지(a)와 분석 결과 그래프(b)이다. 실험 데이터는 평균 ± s.e.m으로 표기하였고, 스케일 막대는 20 ㎛이다. ** P <0.01 및 *** P <0.001.
도 8은 본 발명에 따른 단일클론항체와 다른 에피토프를 인지하는 항체간의 TGF-β1에 의해 증가된 위암 세포의 침윤과 전이를 항-EPB41L5 단일클론항체에 의해 억제되는 정도를 비교한 결과를 나타낸 것이다.
도 9는 EPB41L5과 위암 세포의 폐 전이와의 관련성을 확인하기 위한 것으로, 도 9a는 EPB41L5 과발현된 KATOⅢ 세포와 대조군(vehicle)에 대한 시험관 내 이동과 침윤 분석을 수행한 결과이다. 이때, 1% FBS를 화학유인물질로 사용하였다.
도 9b는 EPB41L5 과발현된 KATOⅢ 세포와 대조군(vehicle)에 대한 시험관 내 이동과 침윤 분석을 수행한 결과를 정량화한 것으로, 각 군에서 15개의 세포를 무작위로 선택하여 Fusion Capt 고급 소프트웨어를 통해 셀 계수한 것이다. 실험 데이터는 평균 ± s.e.m로 표기하였다.
도 9c는 EPB41L5 과발현 KATOⅢ 세포(GFP 표지)(EPB41L5(GFP))를 누드 마우스의 꼬리 정맥을 통해 주입하고(각 그룹당 10 마리), 이에 대한 폐 전이 추후를 IVIS 광학 영상 시스템으로 분석한 것이다. 도 9d는 도 9c의 영상으로부터 측정한 강도를 정량한 것으로, ROI tool을 사용하였다. 실험 데이터는 평균 복사 효율 ± s.e.m로 표기하였다. * P <0.05 및 ** P <0.01.
도 10a는 EPB41L5 과발현된 KATOⅢ 세포를 누드 마우스 꼬리 정맥을 통해 주입하고, 2일 간격으로 2주동안 항-EPB41L5 단일클론항체를 5 ㎎/㎏씩 주입한(EPB41L5+mAb)군을 제조하기 위한 다이아그램이다.
도 10b는 대조군(Vehicle)과 EPB41L5 과발현된 KATOⅢ 세포를 누드 마우스 꼬리 정맥을 통해 주입한(EPB41L5)군, EPB41L5 과발현된 KATO² 세포를 누드 마우스 꼬리 정맥을 통해 주입하고, 2일 간격으로 2주동안 항-EPB41L5 단일클론항체를 5 ㎎/㎏씩 주입한(EPB41L5+mAb)군에 대한 IVIS 광학 영상 시스템으로 분석결과이다.
도 10c는 도 9b의 영상으로부터 ROI 도구를 통해 강도를 정량화하여 나타낸 그래프이다. 실험 데이터는 평균 복사 효율 ± s.e.m로 표기하였다. ** P <0.01.
도 11은 EPB41L5 항체를 이용하여 위암, 폐암, 유방암 세포에서 EBP41L5 단백질 발현과 항체 기능을 웨스턴 블랏으로 분석한 결과이다.
도 12는 위암, 폐암. 유방암 세포주에 각각 농도별 EBP41L5 항체를 처리하여 세포 생존률을 분석한 결과를 나타낸 그래프이다.
본 발명의 일 구현예에 따르면, 서열번호 1로 표시되는 EPB41L5 단백질의 619 내지 624 번째 아미노산 잔기를 포함하는 에피토프; 및 이를 포함하는 암의 예방 또는 치료용 백신 조성물을 제공한다.
본 발명의 다른 구현 예에 따르면, 서열번호 6으로 표시되는 중쇄 CDR1; 서열번호 7로 표시되는 중쇄 CDR2; 및 서열번호 8로 표시되는 중쇄 CDR3;을 포함하는 중쇄 가변영역; 및 서열번호 9로 표시되는 경쇄 CDR1; 서열번호 10으로 표시되는 경쇄 CDR2; 및 서열번호 11로 표시되는 경쇄 CDR3;을 포함하는 경쇄 가변영역;을 포함하는 것인, 단일클론항체 또는 이의 단편을 제공하는 것이다.
본 발명의 또 다른 구현 예에 따르면, 상기 단일클론항체 또는 이의 단편을 유효성분으로 포함하는 암의 예방 또는 치료용 조성물을 제공하는 것이다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시 예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시 예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실험방법
1. 환자표본
oligonucelotide microarray와 생존율 분석을 위해 위암 환자 표본은 임상 시험 센터 세브란스 병원(IRB No : 4-2016-0013)로부터 제공받아 진행하였다.
2. 세포 배양 및 시약
인간 위암 세포주인 AGS, NCI-N87, KATO², SK-GT-4, MKN1, MKN28, MKN45, SNU1, SNU5, SNU16, SNU216, SNU484, SNU638, SNU668 및 SNU719는 연세대학교 정재호 교수님 연구실(서울, 한국)로부터 제공받아 사용하였다.
모든 위암 세포는 5% CO2, 37 ℃에서 10% FBS와 1% 항생제/항균제 용액(코닝, Manassas, VA, USA)이 첨가된 RPMI-1640 배지로 배양하였다. 293FT 세포는 DMEM에서 배양하였다. TGF-β1은 Prospec(East Brunswick, NJ, USA)로부터 구입하여 사용하였고, LY2157299는 Selleckchem(Houston, TX, USA)로부터 구입하여 사용하였다.
3. 플라스미드(plasmid)
전체 길이, FERM 도메인, C-말단, △ 619-624 및 순차적으로 제거된 C 말단의 5 개 아미노산을 코딩하는 EPB41L5 관련 DNA 구조물을 PCR에 의해 생성하고 pSG5-KF2M1 플래그(Sigma-Aldrich, St. Louis, MO, USA)를 복제하였다. 모든 플라스미드 구조물은 DNA 시퀀싱를 통해 확인하였다.
4. siRNA 형질감염(transfection)
제조사의 절차에 따라 Lipofectamine RNAiMAX(Thermo Fisher Scientific, Rockfod, IL, USA)를 사용하여 세포에 siRNA를 형질감염시켰다. 사용된 siRNA는 Genolution(Seoul, Korea)에서 합성된 것으로, EPB41L5-1(EPB41L5 siRNA#1; siEPB41L5#1)(5'- GC AAUUGGCAGCUUAUAAUUU -3'), EPB41L5-2(EPB41L5 siRNA#2; siEPB41L5#2)(5'- UUCAGAUUC GUGCCUAUUCAGUU -3'), Smad4-1 5'-GCUACUUACCAUCAU AACAUU -3 ') 및 Smad4-2 (5'-GUUCCAUUGCUUACUUUUUUUUU-3')이다.
5. 단일클론항체(Monoclonal antibody)_항-EPB41L5 mAb
단일클론항체는 인간 EPB41L5 항원 386 내지 637번째 아미노산 잔기(서열번호 3)를 마우스에 면역처리하여 제조되었고, 이는 ATgen(성남, 대한민국)에 의뢰하여 획득하였다.
1) 마우스의 면역화 및 하이브리도마 세포 제작
단일클론항체는 인간 EPB41L5 항원 386 내지 637번째 아미노산 잔기(서열번호 3)을 이용하여 제조되었다. 효율적인 항체의 제조를 위하여 서열번호 3을 항체 제작 타겟 펩타이드로 선택하였다.
상기 항체 제작 타겟 펩타이드(서열번호 3)을 마우스에 주사한 후, 항원에 대한 항체를 생산하는 세포를 생성하고, 마우스의 비장으로부터 얻은 항체생산세포(비 세포, B lymphocyte)를 골수종 세포 (Myeloma)와 융합하여 하이브리도마 세포를 획득하였다. 하이브리도마 세포만이 생존할 수 있는 HAT 배지에서 배양한 후, 항체의 활성을 ELISA 실험을 통해 확인하였다.
2) 선별 및 확보
상기 하이브리도마 세포들 중에서 EPB41L5를 특이적으로 인식하는 단일클론 하이브리도마 세포를 선정한 후, 쥐의 복강 내에 상기 선정된 단일클론 하이브리도마 세포를 주입한 후, 복수 (ascites)로부터 획득하였다. 복수에서 회수한 본 발명의 단일클론항체는 단백질 A와 단백질 G 컬럼 등의 사용에 의하여 정제하였다.
이후 상기 항체는 EPB41L5 구조물과 siRNA를 사용하여 웨스턴 블랏과 면역 형광법으로 EPB41L5를 특이적으로 인식하는 단일클론항체(EPB41L5 mAb)를 선별 및 확인하였다.
6.
EPB41L5
과발현 세포주(
EPB41L5
overexpressing
stable cell lines) 생성
EPB41L5 DNA를 pCDH-CMV-MCS-EF1-puro 벡터(Addgene, Cambridge, MA, USA)에 클로닝 하였다. 렌티 바이러스 입자를 생성하기 위해, 패키징 플라스미드 pRSV-Rev 및 pMD2.G를 293FT 세포에서 pCDH-EPB41L5 또는 pLECE3-GFP와 함께 형질감염시켰다. 48 시간 배양한 후, 상등액을 수집하고 0.45 μM 기공 필터로 여과하였다. KATO² 세포를 렌티 바이러스로 감염시킨 후 1 ㎍/㎖ 퓨로마이신(Sigma-Aldrich)으로 선별하였다. 선별된 안정화 EPB41L5 과발현 세포주를 Aria II 유동 세포 계측기(BD Biosciences, Sparks, MD, USA)로 GFP로 분류하였다.
7. 웨스턴 블랏 분석
세포를 용해 완충액(20 mM Tric-Cl, 150mM NaCl, 1 % Triton X-100, 1.5 % MgCl2, 1mM EDTA, 1mM Na2VO4, 1 mM 페닐메틸술포닐 플루오라이드(PMSF) 및 프로테아제 억제제 칵테일, pH 7.5 )으로 용해시켰다. 용해물을 간단히 볼텍싱하고, 4 ℃에서 13,000 rpm으로 20 분간 원심분리하여 상등액을 취해 새로운 튜브로 옮겼다. 단백질 농도는 단백질 분석 시약(Thermo Fisher Scientific)으로 660 nm에서 측정하였다. 동일한 농도의 단백질 시료를 준비하고, 각 시료를 SDS-폴리아크릴아미드 겔에서 전기영동한 다음 니트로 셀룰로오스 전달막(Whatman, Dassel, Germany)으로 옮겼다. 0.1%(v/v) Tween 20(Sigma-Aldrich)과 5%(w/v) 무지방 DifcoTM 탈지유(BD Biosciences)를 함유하는 트리스 완충액(pH 7.4)에서 막을 블로킹하고, 1차 항체로 표지(probe)하였다. 항체로는 EPB41L5(ATgen, 한국 성남), Flag-tag, β-actin(Sigma-Aldrich), α-tubulin(Abcam, Cambridge, 영국), TβRI, TβRII, Smad2, Smad3, Smad4, p-Smad2, p-Smad3, 슬러그, ZEB1(Cell signaling, Danvers, MA, USA) 및 PAI-1(Santa Cruz, Dallas, TX, USA)을 사용하였고, 이들의 신호는 제조자의 프로토콜에 따라 기질(Thermo Fisher Scientific)을 통해 확인하였다.
8. RNA 분리 및 실시간 정량 PCR(qPCR)
TRIzol 시약(Takara Bio, Otsu, Shiga, Japan)을 사용하여 총 RNA를 추출하고, 제조사의 프로토콜을 따라 PrimeScript Reverse Transcriptase(Takara Bio, Otsu, Shiga, Japan)와 oligo(dT)를 사용하여 cDNA를 합성하였다. SYBR Green Master(Roche, Basel, Switzerland)와 ABI Prism 7700 서열 검출 시스템(Applied Biosystems, Carlsbad, CA, USA)을 사용하여 정량적 PCR(quantitative PCR)을 수행 하였다. 하기 프라이머를 사용하여 이들의 전사를 확인하였다: α-튜불린(α-tubulin)(5'-TTCTCCATTTACCCGGCACC-3') 및 (5'-GTTAGTGTAGGTTGGGCGCT-3'), EPB41L5(5'- GAAA GAAGGCCCAGCAAACG-3') 및 (5'- AGATCTCATCCCCCAAGCCT-3'), PAI-1(5'-CCCCACTTCTTCAGGCTGTT-3') 및 (5'-GCCGTTGAA GTAGAGGGCAT-3'), Slug(5'-TCATCTTTGGGGCGAGTGAG-3') 및 (5'-TGCAGCTGCTTATGTTTGGC-3'), ZEB1(5'-TATGAATGCCCA AACTGCAA-3') 및 (5'-TGGTGATGCTGAAAGAGACG-3'), Smad4 (5'-TGCATGACTTTGAGGGACAG-3') 및 (5'-GTGGAAGCCACAGGAATGTT-3'). cDNA의 양은 α-튜불린으로 표준화하였다. 모든 실험은 3번 반복하여 수행하였으며, 상대적 발현 수준 및 표준편차는 비교방법으로 계산하여 나타내었다.
9. 면역형광분석(Immunofluorescence analysis)
세포를 챔버 슬라이드(SPL life sciences, 포천시, 한국)에서 배양하고, 실온에서 30분 동안 4% 파라포름알데히드으로 고정시켰다. PBS로 세척한 후, 고정된 세포를 3% BSA와 함께 1시간 동안 항온배양하여 비특이적 항체들을 블록시켰다. Anti-EPB41L5, Anti-E-카데린(cadherin) 및 항-Flag-tag를 4 ℃에서 밤새 배양한 다음 Alexa Fluor 488 또는 Alexa Fluor 549-conjugated goat anti-rabbit 또는 마우스 2 차 항체(Thermo Fisher Scientific)로 염색하였다. 핵(Nuclei)은 Hoechst 33258로 염색하였고, 상기 시료들은 LSM710 공초점 현미경(Carl Zeiss, Oberkochen, Germany)으로 영상화하였다.
10. 시험관 내 이동 및 침윤 분석(in vitro migration and invasion assay)
세포이동은 8.0 μm 크기의 기공을 갖는 폴리카보네이트 막 삽입물(insert)(Corning, Manassas, VA, USA)를 사용하여 트랜스웰(Transwell)로 측정하였다. 침윤 분석을 위해서는, 트랜스웰(Transwell)의 삽입물(insert)을 Matrigel(BD Biosciences)으로 코팅하였다. 1x105 cell/well을 상부(upper) 챔버에 넣고, 하부(lower) 챔버를 화학유인물질(chemoattractant)인 TGF-β1, LY2157299(TGFβ 억제제) 또는 항-EPB41L5 단일클론항체(mAb)를 포함하거나, 포함하지 않은 600㎕의 무혈청 배지로 채웠다. 24시간 배양한 다음, 이동하지 않았거나 침입한 세포(invading cell)들을 면봉으로 조심스럽게 상부 챔버에서 제거하였다. 이동되거나 침윤된 세포(invasive cell)들을 0.2% 크리스탈 바이올렛(Sigma-Aldrich)을 포함한 20% 메탄올 용액으로 염색하고, Х 200 배율의 현미경을 이용하여 계수하였다. 이동 및 침윤 분석은 3 번 반복하여 수행하였다.
11. 생체 내 전이 검정(In vivo metastasis assay)
5 주령의 무흉성증(athymic) BALB/c nu/nu 마우스는 Orient(Seoul, Korea)에서 구입하여 사용하였다. 대조군 벡터 또는 pCDH-EPB41L5 및 pLECE3-GFP 과발현된 KATO² 세포(2 Х 107 세포를 포함하는 200 ㎕ PBS 용액)를 외측 꼬리 정맥에 주사하였다. 항-EPB41L5 단일클론항체는 5 mg/kg씩 매일 2주 동안 투여되었다. 형광 이미지를 촬영하고, 분석하기 위해 IVIS 이미징 시스템(Caliper life sciences, Hopkinton, MA, USA)을 사용하였다.
12. 통계 분석
위암 환자 표본로부터 얻은 데이터에서 전체 생존률을 분석하기 위해 Kaplan-Meier Plotter(http://kmplot.com/analysis)를 사용하였다. 사용된 Affymetrix ID는 220977_x_at이고, log-rank 테스트는 Kaplan-Meier 생존 곡선을 사용하였다. 통계 분석은 독립적인 실험(양면)의 두 그룹을 비교하기 위해 Student 's t-test를 사용하여 수행되었고, 데이터는 평균 ± 표준 편차(SD)로 나타내었다. P <0.05는 통계적으로 유의하다고 간주되었다.
실시예
<실시예 1>. 위암 환자 표본에서 EPB41L5 유전자의 발현 수준 분석
GC에서 중요한 표적 분자를 확인하기 위하여, 올리고뉴클레오타이드 마이크로어레이 분석을 실시하였다. 이는 림프절(lymph node) 전이가 없는 78명 위암 환자들을 대상으로 수행하였다. 상기 환자들은 EPB41L5 유전자의 발현 중간값을 기준으로 제1, 제2 그룹으로 분류하였다. EPB41L5 유전자의 발현 수준의 중간값을 기준으로 좌측에 위치하는 제1 그룹, EPB41L5 유전자의 발현 수준의 중간값을 기준으로 우측에 위치하는 제2 그룹이 있다.
APEG1, SMPX, GPR177 및 EPB41L5 유전자가 높은 제1 그룹은 상기 유전자 발현이 높지 않은 제2 그룹보다 재발률이나 사망률이 더 높은 것을 확인하였다(도 1a). APEG1, SMPX, GPR177 및 EPB41L5 유전자 중에서도 항체-기반 암 치료의 대상이 되는 EPB41L5을 표적 단백질로 선택하였다. EPB41L5 유전자의 발현 수준의 중간값을 기준으로 한 두 그룹에서의 향후 10년간 생존율을 분석한 결과(도 1b), EPB41L5 유전자의 발현 발현이 높은 환자들이 낮은 수준의 환자들에 비해 생존율이 더 낮은 것을 알 수 있다.
또한 암 환자 두 그룹에 대한 Kaplan Meier 플러터 분석을 실시한 것으로, 876 명의 위암 환자를 대상으로 수행한 결과, GEO, EGA, TCGA와 같은 데이터베이스를 사용하는 Kaplan Meier 플로터에서 EPB41L5 발현이 높은 위암 환자는 생존율 역시 낮다는 것을 확인하였다(HR 1.73, P 2.8E-10)(도 1c). 이러한 임상적 결과들을 통해, EPB41L5 발현 수준이 위암 환자의 불량 예후와 관련이 있음을 알 수 있다. 다시 말해 EPB41L5 유전자의 발현 수준이 높은 위암 환자는 생존율이 낮았다.
<실시예 2>. 위암 세포에서 TGF-β1과 EPB41L5 단백질의 발현 양상 분석
본 발명에서 어떤 위암 세포가 TGFβ 신호에 반응하는지를 조사하고자 하였다. 여러 위암 세포주를 대상으로 웨스턴 블롯 분석을 실시하여, TGFβ 시그널링과 관련성이 있는 단백질 수준을 분석하였다(도 2a). 그 결과, NCI-N87, MKN45, SNU216 및 SNU484 세포에서는 Smad3 또는 Smad4가 검출되지 않았음을 확인하였다.
이후, TGF-β1를 위암 세포에 처리하여 EPB41L5 유전자 발현이 TGFβ 신호에 의해 조절되는지 여부를 조사하고자 하였고, 그 결과 EPB41L5 유전자의 발현 수준은 TGF-β1 처리에 의해 KATOⅢ, MKN28, SNU1 및 SNU719 세포에서 유의하게 증가하였으나, Smad3/Smad4이 결함된 GC 세포에서는 EPB41L5 유전자 발현 수준이 유의적으로 증가하지 않았다(도 2b). 또한 TGF-β1 처리에 의해서 PAI-1, Slug 및 인산화된 Smad2, Smad3와 같은 간엽(mesenchymal) 유전자의 발현이 유의하게 증가하였다(도 2c).
면역형광(Immunofluorescence) 염색분석 결과(도 2d)에 따르면 막내외(transmembrane)에 존재하는 상피마커 E-cadherin의 발현이 감소하고, EPB41L5 단백질의 발현 수준이 KATOⅢ의 세포막에서 TGF-β1에 의해 증가함을 확인하였다. 또한, 위암 세포인 KATOⅢ와 SNU719 세포는 TGF-β1 처리에 의해 간엽성(mesenchymal characteristics)으로 변화되었다(도 2e, 도 2f).
상기 결과를 통해 TGFβ 신호가 암, 예를 들면 위암 세포에서 EPB41L5 유전자 및 이에 의해 코딩되는 단백질의 발현 수준과 상피 간엽 전이(epithelial-mesenchymal transition)를 조절한다는 것을 알 수 있다.
<
실시예
3>. Smad
의존성
TGFβ
신호전달을 통한
EPB41L5
단백질의 발현 수준 조절
TGF-β1에 의해 유도된 EPB41L5 단백질의 발현 수준의 증가가 Smad 의존성인지 아닌지를 확인하기 위하여, Smad4가 결핍된 MKN45(Smad4 녹-다운된 MKN45) 및 NCI-N87 세포(위암)에서 웨스턴 블롯과 면역형광 염색을 수행하였다. TGF-β1를 처리한 각 세포들에서 이들 유전자와 EPB41L5 단백질 수준이 변화하지 않음을 확인하였다(도 3a, 3b). 또한, TGF-β1로 처리할 경우 각 세포들에서 EPB41L5, PAI-1 및 Slug이 상향 조절되었으며, siRNA를 사용하여 Smad4가 녹-다운된(knock-downed)된 MKN28 세포에서는 EPB41L5, PAI-1 및 Slug 발현이 억제되었음을 확인하였다(도 3c, 도 3d).
이러한 결과를 종합하면 TGFβ 신호 전달 경로가 Smad에 의존적이고, 이는 위암 세포에서 EPB41L5 발현 조절에 관여하고 있음을 의미하는 것이다.
<실시예 4>. TGF-β1의 EPB41L5 단백질과의 관련성 분석
본 발명은 강력한 TGFβ 수용체 I 억제제인 LY2157299(Galunisertib)을 처리하였을 때, EPB41L5 단백질의 발현 수준 변화를 분석하고자 하였다.
도 4는 아무것도 처리하지 않은 KATOⅢ 세포, TGF-β1만 처리한 KATOⅢ 세포, TGF-β1을 처리한 후 TGFβ 억제제(LY2157299)를 처리한 KATOⅢ 세포를 준비하고, 이를 내인성 EPB41L5 단백질 및 E-카데린(E-cadherin) 발현을 분석하기 위해 면역형광 염색으로 분석한 결과이다. 녹색은 EPB41L5 단백질, 빨간색은 E-카데린, 파란색은 Hochest 33258이고, 스케일 막대는 20 ㎛이다.
도 4에 나타난 바와 같이, TGF-β1만을 KATOⅢ 세포에 처리한 것과, TGF-β1과 LY2157299를 순차적으로 처리한 KATOⅢ 세포를 면역형광 염색한 결과, TGF-β1에 의해서 EPB41L5 단백질의 발현 수준이 증가되나, LY2157299에 의해서는 억제되고 있음을 확인하였다.
<실시예 5>. 위암 세포의 이동성에 대한 EPB41L5의 영향 분석
EPB41L5가 TGFβ 신호에 반응하여 위암 세포의 이동에 영향을 주는지 여부를 확인하고자 하였다. 이를 위해 KATOⅢ 세포 또는 SNU719 세포에 EPB41L5 siRNA를 형질감염 시켰다. 구체적으로 EPB41L5 결핍을 위해 2가지 유형의 siRNA(EPB41L5 siRNA#1(서열번호 4: 5'- GC AAUUGGCAGCUUAUAAUUU -3 '), EPB41L5 siRNA#2(서열번호 5: 5'- UUCAGAUUC GUGCCUAUUCAGUU -3'))를 사용하였다. NC siRNA 형질감염된 KATOⅢ 세포와 비교하여 EPB41L5 siRNA#1, EPB41L5 siRNA#2로 형질감염된 KATOⅢ 세포에서 EPB41L5 및 PAI-1의 유전자와 단백질 수준이 유의하게 감소되었음을 확인하였다(도 5a, 5b). 그러나 EPB41L5 siRNA#1, EPB41L5 siRNA#2로 형질감염된 KATOⅢ 세포에서 인산화된 Smad3(αp-Smad3)과 Smad3(αSmad3)에는 변화가 관찰되지 않았다(도 5b).
또한, NC siRNA 형질감염된 KATOⅢ 세포, EPB41L5 siRNA#1, EPB41L5 siRNA#2로 형질감염된 KATOⅢ 세포에 TGF-β1을 처리하였을 때, 간엽전이 여부와 위암세포의 이동성을 분석한 결과, EPB41L5이 결핍될 경우 간엽전이와 위암 세포의 이동성에 대한 TGF-β1의 영향을 차단하고 있음을 확인하였다(도 5c, 5d, 5e). 즉 EPB41L5은 TGFβ에 의해 유도되는 세포 전이와 위암 세포의 이동에 필수적인 요소임을 알 수 있다.
<
실시예
6>. 항-
EPB41L5
mAb(단일클론항체)는
C-말단의 619-624 AA 서열을 인식함
본 발명은 전이에서 세포 부착 분자가 중요한 역할을 수행하기 때문에, 이를 기반으로 단일클론항체와 펩타이드를 이용한다면 새로운 치료제의 개발이 가능할 것이라 여기고, EPB41L5에 대한 단일클론항체(mAb)를 개발하고자 하였다.
개발된 항체의 특이성을 입증하기 위하여 Flag-EPB41L5 또는 EPB41L5 siRNA로 형질감염된 위암 세포를 웨스턴 블랏과 면역형광분석으로 분석하였다. 그 결과 Flag-EPB41L5로 형질감염된 위암세포에서 과발현된 EPB41L5가 검출되었고(도 6a), EPB41L5 siRNA로 형질감염된 위암세포(NC, siRNA#1 또는 siRNA#2)에서 EPB41L5가 침묵하고 있음을 확인하였다(도 6b). 또한, EPB41L5 siRNA로 형질감염된 위암 세포를 면역형광염색법으로 분석한 결과 EPB41L5가 위암 세포에서 항-EPB41L5 단일클론항체에 의해 분명히 검출되었음을 알 수 있다(도 6c). 본 발명에서의 항-EPB41L5 단일클론항체는 웨스턴 블랏 분석을 통해 분석한 결과, EPB41L5의 N 말단 FERM 도메인이 아닌 EPB41L5의 C-말단을 인식하고 있음을 확인하였다(도 6d, 6e).
또한, EPB41L5의 C-말단에서 5 아미노산을 순차적으로 제거한 항체를 확인한 결과, 항체가 EPB41L5의 C-말단의 아미노산 619-624를 인식한다는 것을 확인하였다(도 6f, 6g). 투과하지 못하는 면역형광염색의 특성을 고려하여 내인성 EPB41L5의 발현을 억제하기 위해 EPB41L5의 FL(전장), EPB41L5의 FERM, EPB41L5의 C-term 및 EPB41L5의 △ 619-624 중에서 선택되는 어느 하나의 플라스미드와 EPB41L5 siRNA를 공-형질감염시켰다. 이에 외인성 EPB41L5 발현을 항-Flag 항체를 사용하여 분석하였다. EPB41L5 발현은 FL 및 C-말단 구조체로 형질감염된 FK 세포와 △ 619-624로 형질 감염되지 않은 MKN28 세포에서 확인되었다(도 6h). 이들 결과를 종합하면, 항-EPB41L5 단일클론항체가 EPB41L5의 619-624 아미노산 영역을 특이적으로 인식하고 있음을 알 수 있다.
<실시예 7>. 항-EPB41L5 단일클론항체의 가변영역 서열 분석
상기 <실시예 6>.에서 제작된 단일클론항체의 가변영역의 서열을 에이티젠(한국)에 의뢰하여 분석하였다. 그 결과, 본 발명에 따른 단일클론항체의 중쇄가변영역 및 경쇄가변영역의 서열은 하기와 같다.
중쇄가변영역
(서열번호 12) QVQLKESGTVLARPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGAIYPGNSDTSYNQKFKDKAKLTAVTSTSTAYMELSSLTDEASAVYYCTRGGKLPFAMDYWGQGTSVTVSS
경쇄가변영역
(서열번호 13) DVLMTQTPLSLPVSLGDQASMSCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPWTFGGGTKLEIK
나아가, 본 발명에 따른 단일클론항체의 중쇄가변영역 CDR 1 내지 3과 경쇄가변영역 CDR 1 내지 3의 서열은 하기와 같다.
중쇄가변영역 CDR1: Gly Tyr Thr Phe Thr Ser Tyr Trp (서열번호 6)
중쇄가변영역 CDR2: Ile Tyr Pro Gly Asn Ser Asp(서열번호 7)
중쇄가변영역 CDR3: Thr Arg Gly Gly Lys Leu Pro Phe Ala Met Asp Tyr(서열번호 8)
경쇄가변영역 CDR1: Gln Ser Leu Val His Ser Asn Gly Asn Thr Tyr(서열번호 9)
경쇄가변영역 CDR2: Lys Val Ser(서열번호 10)
경쇄가변영역 CDR3: Ser Gln Ser Thr His Val Pro Trp Thr(서열번호 11)
<실시예 8>. 항-EPB41L5 단일클론항체의 치료효과
항-EPB41L5 단일클론항체의 특이성을 검증하고자 하였다. 본 실험에서 TGF-β1 처리를 하거나 하지 않고 GC 세포의 이동에 대한 항-EPB41L5 단일클론항체의 효과를 평가한 결과, TGF-β1은 KATOⅢ 세포의 이동을 효율적으로 증가시켰음을 확인하였다. 나아가, 항-EPB41L5 단일클론항체는 KATOⅢ 세포에서 TGF-β1에 의해 증가된 세포 이동을 저해함을 확인하였다(도 7a, b).
<실시예 9>. 항-EPB41L5 단일클론항체의 전이 억제 효과 비교
상기 <실시예 8>.과 동일한 방법으로 단일클론항체가 인지하는 에피토프의 서열의 차이에 따른 항-EPB41L5 단일클론항체에 의한 세포 이동 저해 정도를 비교하였다. 도 8에서 보는 바와 같이, 본 발명에 따른 단일클론항체(AtGen)의 경우에는 TGF-β1에 의해 증가된 세포 이동을 현저하게 저해(100%)하는 반면, EPB41L5 단백질의 638 내지 708 번째 아미노산 서열을 인지하는 항체(Novus 항체)의 경우에는 TGF-β1에 의해 증가된 세포 이동을 거의 저해하지 못하는 것을 확인하였다. 이에, EPB41L5의 C-터미널 부위의 619 내지 624 번째 아미노산 서열을 인지하는 항체는 다른 아미노산 서열로 구성된 에피토프에 특이적으로 결합하는 항체와 비교하여 TGF-β1에 의해 증가된 세포의 이동성을 매우 효과적으로 저해할 수 있음을 알 수 있다.
<실시예 10>. EPB41L5과 위암 세포 전이와의 관련성 분석
앞선 실험들을 통해 TGF-β1에 의해 증가된 EPB41L5 발현이 생체 내(in vitro)에서 위암 세포의 이동과 침윤에 관여하고 있음을 확인하였다. 이에 본 발명에서는 시험관 내 이동 및 침윤 분석법을 통해 위암 세포의 이동에 있어서 EPB41L5의 효과를 분석하고자 하였다.
구체적으로, EPB41L5를 과발현시킨 KATOⅢ 세포와, 이의 대조군(Vehicle)으로 아무것도 처리되지 않은 KATOⅢ 세포를 준비하였다.
EPB41L5를 과발현시킨 KATOⅢ 세포로부터, 시험관 내 이동 및 침윤 분석을 수행한 결과, EPB41L5를 과발현시킨 KATOⅢ 세포는 실질적으로 세포의 이동과 침윤이 향상되었음을 확인하였다(도 9a, 9b). 생체 내에서 EPB41L5의 발현에 의한 위암 세포의 영향을 관찰하기 위하여, EPB41L5 과발현된 KATOⅢ 세포를 누드 마우스의 꼬리 정맥을 통해 주사하였다. 그 결과 대조군(Vehicle(GFP))에 비해 위암 세포의 폐전이가 EPB41L5(GFP) 군에서 유의하게 증가하였음을 확인하였다(도 9c, 9d). 종합하면 EPB41L5가 위암 세포의 생체 내 전이를 촉진한다는 것을 알 수 있다.
<실시예 11>. 항-EPB41L5 단일클론항체의 위암 세포 전이 억제능 확인
항-EPB41L5 단일클론항체의 생체내 효능을 확인하고자 하였다. 이를 위해 대조군(Vehicle)과 EPB41L5 과발현된 KATOⅢ 세포를 누드 마우스 꼬리 정맥을 통해 주입한(EPB41L5)군, EPB41L5 과발현된 KATOⅢ 세포를 누드 마우스 꼬리 정맥을 통해 주입하고, 2일 간격으로 2주동안 항-EPB41L5 단일클론항체를 5 ㎎/㎏씩 주입한(EPB41L5+mAb)군을 준비하였다(도 10a).
EPB41L5 과발현 세포를 주입한 누드 마우스에서는 암의 폐전이가 증가하였으나, 항-EPB41L5 단일클론항체를 주입한 군에서는 위암 세포의 폐전이가 대조군보다 감소하였음을 확인할 수 있다(도 10b, 10c). 이를 통해 본 발명에 따른 항-EPB41L5 단일클론항체가 효과적으로 진행성 위암에 대해 치료 또는 예방 효과를 나타내고 있음을 알 수 있다.
<
실시예
12>. 항-
EPB41L5
단일클론항체의
EBP41L5
단백질 특이적 인식 기능 확인
항-EPB41L5 단일클론항체의 EBP41L5에 대한 특이성을 확인하고자 하였다. 이를 위해 위암(Gastric cancer) 세포주로 KATOⅢ 세포와 MKN28 세포를 준비하였다. 폐암(Lung cancer) 세포주로는 A549 세포와 H226 세포를 준비하였고, 유방암(Breast cancer) 세포주로는 MCF7 세포와 MDA-MB-231 세포를 준비하였다. 상기 세포는 연세대 정재호 교수님 연구실 및 한국세포주은행으로부터 제공받아 사용하였다. 각 세포는 5% CO2, 37 ℃에서 10% FBS와 1% 항생제/항균제 용액(코닝, Manassas, VA, USA)이 첨가된 RPMI-1640 배지로 배양하였다.
항-EPB41L5 단일클론항체를 이용하여, 각 세포군에서 EBP41L5 단백질 발현을 웨스턴 블랏을 이용해 확인하였다(도 11). 그 결과, 항-EPB41L5 단일클론항체에 의해 위암 세포주뿐만 아니라, 폐암 세포주와 유방암 세포주에서도 EPB41L5 단백질 발현을 확인하였다(도 11). 이를 통해 본 발명에 따른 항-EPB41L5 단일클론항체가 위암뿐만 아니라, 폐암과 유방암에서도 효과적으로 치료 또는 예방을 위해 사용될 수 있음을 나타내고 있다.
<실시예 11>. 항-EPB41L5 단일클론항체의 세포 특이적 독성 확인
다양한 세포에 대한 본 발명의 항-EPB41L5 단일클론항체의 세포 생존율을 확인하고자 하였다. 이를 위해 위암(Gastric cancer) 세포주로 KATOⅢ 세포와 MKN28 세포를 준비하였다. 폐암(Lung cancer) 세포주로는 A549 세포와 H226 세포를 준비하였고, 유방암(Breast cancer) 세포주로는 MCF7 세포와 MDA-MB-231 세포를 준비하였다. 상기 세포는 연세대 정재호 교수님 연구실 및 한국세포주은행으로부터 제공받아 사용하였다.
각 세포는 5% CO2, 37 ℃에서 10% FBS와 1% 항생제/항균제 용액(코닝, Manassas, VA, USA)이 첨가된 RPMI-1640 배지로 배양하였다.
각 세포군에 항-EPB41L5 단일클론항체를 0, 2, 4, 6 ㎍씩 주입하고, 24 시간이 지난 후, 각 세포군의 세포 생존율(cell Viability, %)을 확인하기 위해 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltertrazolium bromide(MTT) reduction 방법을 통해 확인하였다(도 12). 그 결과, 항-EPB41L5 단일클론항체를 주입한 경우 농도별로 세포 생존률이 감소하는 것을 확인하였는 바, 본 발명의 항-EPB41L5 단일클론항체가 효과적으로 진행성 암 혹은 위암에 대해 치료 또는 예방 효과를 나타내고 있음을 알 수 있다(도 12).
<결론>
세포 부착 단백질은 암 전이에서 중요한 역할을 수행하고 있다. 따라서 세포 부착 단백질에 대한 항체를 이용함으로써, 암 전이에 대한 치료제 개발 가능성이 논의되고 있는 실정이다. 본 발명자는 전이와 관련된 새로운 접착 분자 또는 복합체를 기반으로 하는 새로운 치료법을 개발하고자 노력한 바, 본 발명을 완성하기에 이르렀다. EMT(상피간엽이행; Epithelial to Mesenchymal Transition)는 세포-세포 접합 및 세포 극성의 상실과 중간엽형 표현형을 가능하게하는 악틴 세포 골격의 재구성을 가지고있다. EPB41L5는 E-cadherin을 불안정화시키는 p120 카테닌 및 paxillin과 상호 작용한다고 보고되어 있으나, focal adhesion kinase 또한 세포 극성을 부정적으로 조절하는 Crumbs complex 성분 인 MPP5와 결합한다고 알려져 있다. 다른 접합 단백질인 β-catenin은 신장 상피 세포의 측막의 EPB41L5와 공존하며, 그 결합은 확인되지 않았다. FAK는 N 말단의 FERM 도메인을 가지고 있고 C 말단의 EPB41L5의 또 다른 결합 파트너 인 ASAP1/AMAP1 및 paxillin과 결합한다.
본 발명에서 EPB41L5가 위암 환자의 불량 예후를 초래한다는 것을 밝혔고, 이와 관련하여 EPB41L5는 암 세포에서 높은 발현율을 나타냄을 확인하였다. 한편 TGF β는 위암 전이를 촉진한다는 알려져 있으므로, 이 발현이 림프절 전이와 암의 예후에 상관관계가 있을 것이라 예측하고, TGFβ와 EPB41L5의 관련성을 분석한 결과 EPB41L5 유전자 프로모터에서 다수의 Smad 결합 모티프를 확인하였다.
이에, EPB41L5의 녹다운으로, TGF-β1-유도된 중간엽 전이와 GC 세포의 이동성 증가를 배제함을 확임함으로써, EPB41L5가 TGFβ 신호전달기전에 있어서 주요 인자임을 확인하였다. 이러한 결과를 종합하면 위암세포에서는 TGFβ/Smad3/EPB41L5 경로를 통한 상피간엽 전이 과정으로 암 세포의 이동과 침윤을 제어할 수 있음을 알 수 있다.
본 발명에서 EPB41L5가 세포 표면에 위치하고, GC 세포의 시험관내 및 생체내 전이를 촉진하고 있음을 확인한 바, 이를 특이적으로 하는 항체는 치료를 기반으로 하는 단일클론항체로서 사용 가능될 것이라 여겨, EPB41L5 단일클론항체를 개발하였다. EPB41L5 단일클론항체는 TGF-β1에 의한 위암 세포의 이동 및 침윤을 효과적으로 차단하였고, EPB41L5이 과발현된 세포에서 발생하는 증가한 폐전이는 항-EPB41L5 단일클론항체에 의해 유의하게 억제되었음을 확인하였다.
또한, 본 발명의 항-EPB41L5 단일클론항체는 위암, 폐암, 유방암의 각 세포군(특히, 위암 세포주)에서 EPB41L5 단백질 발현을 유의하게 억제하였고, 암 세포의 생존률을 감소시키는 것을 확인하였다.
따라서, 본 발명의 EPB41L5 단일클론항체는 암, 특히 위암을 예방하거나 치료하거나 전이를 억제하는데에 매우 효과적인 방법임을 알 수 있다.
이상으로 본 발명의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적인 기술은 단지 바람직한 구현 예일 뿐이며, 이에 본 발명의 범위가 제한되는 것이 아닌 점은 명백하다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항과 그의 등가물에 의하여 정의된다고 할 것이다.
본 발명의 특징 및 이점을 요약하면 다음과 같다:
(1) 본 발명은 EPB41L5를 항원으로 인식하여 이에 특이적으로 결합하는 단일클론항체 또는 이의 단편을 제공한다.
(2) 본 발명은 EPB41L5의 에피토프에 특이적으로 결합하는 항체발굴에 활용할 수 있으며, 이 방법을 통해 발굴한 항체는 EPB41L5의 신호전달과정을 억제하는 기능을 보이며 이 기능을 이용하여 EPB41L5가 관여하는 암 특히 위암에 대한 백신 또는 치료제로서 유용하게 활용될 수 있다.
Claims (24)
- 서열번호 1로 표시되는 EPB41L5(Erythrocyte Membrane Protein Band 4.1 Like 5) 단백질의 619 내지 624 번째 아미노산 잔기 중에서 선택되는 1 내지 6 mer의 에피토프.
- 제1항에 있어서,상기 에피토프는 EPB41L5 단백질의 아미노산 위치 619 내지 624번째의 아미노산 서열로 이루어진 것인, 에피토프.
- 서열번호 1로 표시되는 EPB41L5 단백질을 항원으로 인식하여 이에 특이적으로 결합하는 단일클론항체 또는 이의 단편.
- 제3항에 있어서,상기 단일클론항체 또는 이의 단편은 서열번호 1로 표시되는 EPB41L5 단백질의 619 내지 624 번째 아미노산 잔기 중에서 선택되는 1 내지 6 mer의 에피토프에 결합하는 것인, 단일클론항체 또는 이의 단편.
- 제3항에 있어서,상기 단일클론항체 또는 이의 단편은,서열번호 6으로 표시되는 중쇄 CDR1; 서열번호 7로 표시되는 중쇄 CDR2; 및 서열번호 8로 표시되는 중쇄 CDR3;을 포함하는 중쇄 가변영역; 및서열번호 9로 표시되는 경쇄 CDR1; 서열번호 10으로 표시되는 경쇄 CDR2; 및 서열번호 11로 표시되는 경쇄 CDR3;을 포함하는 경쇄 가변영역;을 포함하는 것인, 단일클론항체 또는 이의 단편.
- 제3항에 있어서,상기 단일클론항체 또는 이의 단편은 EPB41L5와 TGF-β1 간의 상호작용을 차단하는 것인, 단일클론항체 또는 이의 단편.
- 제3항에 있어서,상기 항체는 키메라 항체, 인간화 항체(humanized antibody), 이가(bivalent), 양특이성 분자, 미니바디(minibody), 도메인 항체, 이중특이적 항체(bispecific antibody), 항체 모방체, 디아바디(diabody), 트리아바디(triabody), 테트라바디(tetrabody) 또는 이의 단편인, 단일클론항체 또는 이의 단편.
- 제3항의 단일클론항체 또는 이의 단편을 코딩하는 핵산분자.
- 제8항의 핵산분자를 포함하는 벡터.
- 제9항의 벡터를 포함하는 숙주세포.
- 서열번호 1로 표시되는 EPB41L5 단백질의 619 내지 624 번째 아미노산 잔기 중에서 선택되는 1 내지 6 mer의 에피토프; 이를 코딩하는 핵산분자; 또는 이를 포함하는 벡터를 유효성분으로 포함하는 암의 예방 또는 치료용 백신 조성물.
- 제11항에 있어서,상기 암은 암 줄기세포인 것인, 암의 예방 또는 치료용 백신 조성물.
- 제3항의 단일클론항체 또는 이의 단편; 이를 코딩하는 핵산분자; 상기 핵산분자를 포함하는 벡터; 또는 EPB41L5 유전자의 발현을 억제하는 억제제로 구성된 군으로부터 선택되는 적어도 어느 하나를 유효성분으로 포함하는 암의 예방 또는 치료용 약제학적 조성물.
- 제13항에 있어서,상기 EPB41L5 유전자의 발현을 억제하는 억제제는 siRNA, shRNA, miRNA, 리보자임, DNAzyme, 펩타이드 핵산(peptide nucleic acid, PNA) 및 안티센스 올리고뉴클레오티드로 이루어진 군으로부터 선택되는 적어도 어느 하나인 것인, 암의 예방 또는 치료용 약제학적 조성물.
- 제14항에 있어서,상기 siRNA는 서열번호 4의 염기서열로 표시되는 siRNA 또는 서열번호 5의 염기서열로 표시되는 siRNA인 것인, 암의 예방 또는 치료용 약제학적 조성물.
- 제13항에 있어서,상기 암은 암 줄기세포인 것인, 암의 예방 또는 치료용 약제학적 조성물.
- 제3항의 단일클론항체 또는 이의 단편; 이를 코딩하는 핵산분자; 상기 핵산분자를 포함하는 벡터; 또는 EPB41L5 유전자의 발현을 억제하는 억제제로 구성된 군으로부터 선택되는 적어도 어느 하나를 유효성분으로 포함하는 암의 전이 억제용 약제학적 조성물.
- 제16항에 있어서,상기 암은 암줄기세포인 것인, 암의 전이 억제용 약제학적 조성물.
- (a) 피검자로부터 체외로 분리된 샘플을 취득하는 단계;(b) 제 3 항의 단일클론항체 또는 이의 단편을 상기 샘플에 처리하는 단계; 및(c) 상기 피검자의 샘플 중에 포함된 EPB41L5의 발현양이 정상군 샘플 중에 포함된 EPB41L5의 발현양 보다 높은지 여부를 확인하는 단계;를 포함하는 EPB41L5의 과발현에 의한 질환의 진단을 위한 정보를 제공하는 방법.
- 제19항에 있어서,상기 EPB41L5의 과발현에 의한 질환은 암인 것인, 방법.
- 제20항에 있어서,상기 암은 암 줄기세포인 것인, 방법.
- 제19항에 있어서,상기 상기 EPB41L5의 과발현에 의한 질환은 전이암인 것인, 방법.
- 제3항의 단일클론항체 또는 이의 단편을 처리하는 단계를 포함하는, 샘플 중에 포함된 EPB41L5 단백질을 정량하는 방법.
- 제3항의 단일클론항체 또는 이의 단편을 포함하는 EPB41L5 단백질의 정량 키트.
Priority Applications (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
JP2021530760A JP2021533817A (ja) | 2018-08-09 | 2019-08-08 | Epb41l5タンパク質のエピトープおよび単クローン抗体 |
US17/265,755 US20210252145A1 (en) | 2018-08-09 | 2019-08-08 | Epitope of epb41l5, and monoclonal antibody |
CN201980052708.2A CN112638939A (zh) | 2018-08-09 | 2019-08-08 | 一种epb41l5的表位及单克隆抗体 |
EP19846519.7A EP3835317A4 (en) | 2018-08-09 | 2019-08-08 | EPITOPE OF EPB41L5 AND MONOCLONAL ANTIBODY |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR10-2018-0093045 | 2018-08-09 | ||
KR20180093045 | 2018-08-09 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2020032614A1 true WO2020032614A1 (ko) | 2020-02-13 |
Family
ID=69414989
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2019/009960 WO2020032614A1 (ko) | 2018-08-09 | 2019-08-08 | Epb41l5 단백질의 에피토프 및 단일클론항체 |
Country Status (6)
Country | Link |
---|---|
US (1) | US20210252145A1 (ko) |
EP (1) | EP3835317A4 (ko) |
JP (1) | JP2021533817A (ko) |
KR (3) | KR102125703B1 (ko) |
CN (1) | CN112638939A (ko) |
WO (1) | WO2020032614A1 (ko) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4554101A (en) | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
JP2015021800A (ja) * | 2013-07-17 | 2015-02-02 | 国立大学法人北海道大学 | 腎癌の再発リスクの予測に用いるための診断薬及びキット、並びに予測方法 |
JP2017108686A (ja) * | 2015-12-17 | 2017-06-22 | 国立大学法人北海道大学 | 膵癌の再発リスクの予測に用いるための診断薬及びキット、並びに予測方法 |
Family Cites Families (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1852974A (zh) * | 2003-06-09 | 2006-10-25 | 密歇根大学董事会 | 用于治疗和诊断癌症的组合物和方法 |
JP6202362B2 (ja) * | 2013-03-04 | 2017-09-27 | 国立大学法人北海道大学 | 乳癌乳房温存療法後の局所再発リスクの予測に用いるための診断薬並びに予測方法 |
-
2019
- 2019-08-08 WO PCT/KR2019/009960 patent/WO2020032614A1/ko unknown
- 2019-08-08 EP EP19846519.7A patent/EP3835317A4/en active Pending
- 2019-08-08 KR KR1020190096797A patent/KR102125703B1/ko active IP Right Grant
- 2019-08-08 CN CN201980052708.2A patent/CN112638939A/zh active Pending
- 2019-08-08 JP JP2021530760A patent/JP2021533817A/ja active Pending
- 2019-08-08 US US17/265,755 patent/US20210252145A1/en active Pending
-
2020
- 2020-06-17 KR KR1020200073319A patent/KR102268847B1/ko active IP Right Grant
- 2020-06-17 KR KR1020200073313A patent/KR102268846B1/ko active IP Right Grant
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4554101A (en) | 1981-01-09 | 1985-11-19 | New York Blood Center, Inc. | Identification and preparation of epitopes on antigens and allergens on the basis of hydrophilicity |
JP2015021800A (ja) * | 2013-07-17 | 2015-02-02 | 国立大学法人北海道大学 | 腎癌の再発リスクの予測に用いるための診断薬及びキット、並びに予測方法 |
JP2017108686A (ja) * | 2015-12-17 | 2017-06-22 | 国立大学法人北海道大学 | 膵癌の再発リスクの予測に用いるための診断薬及びキット、並びに予測方法 |
Non-Patent Citations (19)
Title |
---|
"Epitope Mapping Protocols in Methods in Molecular Biology", vol. 66, 1996 |
"Remington's Pharmaceutical Sciences", 1995 |
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 10 |
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883 |
CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
CORPET ET AL., NUC. ACIDS RES., vol. 16, 1988, pages 10881 - 90 |
DATABASE Protein 21 May 2018 (2018-05-21), "band 4 .1 -like protein 5 isoform 1 [Homo sapiens", XP055689102, retrieved from NCBI Database accession no. NP_065960.2 * |
H. NEURATHR.L.HILL: "The Proteins", 1979, ACADEMIC PRESS |
HASHIMOTO, A . ET AL.: "ZEB1 induces EPB41L5 in the cancer mesenchymal program that drives ARF6-based invasion, metastasis and drug resistance", ONCOGENESIS, vol. 5, no. e259, e259, 2016, pages 1 - 10, XP055689096 * |
HASHIMOTO, S. ET AL.: "Lysophosphatidic acid activates Arf6 to promote the mesenchymal malignancy of renal cancer", NATURE COMMUNICATIONS, vol. 7, no. 10656, 2016, pages 1 - 11, XP055689100 * |
HIGGINSSHARP, CABIOS, vol. 5, 1989, pages 151 - 3 |
HIGGINSSHARP, GENE, vol. 73, 1988, pages 237 - 44 |
HUANG ET AL., COMP. APPL. BIOSCI., vol. 8, 1992, pages 155 - 65 |
MARKS ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
NEEDLEMANWUNSCH, J. MOL. BIO., vol. 48, 1970, pages 443 |
PEARSON ET AL., METH. MOL. BIOL., vol. 24, 1994, pages 307 - 31 |
PEARSONLIPMAN, METHODS IN MOL. BIOL., vol. 24, 1988, pages 307 - 31 |
See also references of EP3835317A4 |
SMITHWATERMAN, ADV. APPL. MATH., vol. 2, 1981, pages 482 |
Also Published As
Publication number | Publication date |
---|---|
JP2021533817A (ja) | 2021-12-09 |
US20210252145A1 (en) | 2021-08-19 |
EP3835317A4 (en) | 2022-04-27 |
KR20200074072A (ko) | 2020-06-24 |
EP3835317A1 (en) | 2021-06-16 |
KR20200074071A (ko) | 2020-06-24 |
KR20200018320A (ko) | 2020-02-19 |
KR102268846B1 (ko) | 2021-06-25 |
CN112638939A (zh) | 2021-04-09 |
KR102268847B1 (ko) | 2021-06-25 |
KR102125703B1 (ko) | 2020-06-24 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2019098682A1 (ko) | 항-her2 항체 또는 그의 항원 결합 단편, 및 이를 포함하는 키메라 항원 수용체 | |
WO2015005632A1 (ko) | Dll4와 vegf에 특이적으로 결합하는 신규 이중표적 단백질 및 이의 용도 | |
WO2017010744A1 (ko) | 엑소좀 단백질 eif3a 특이반응 오토항체검출용 항원 조성물 및 이를 이용한 간암진단법 | |
WO2010087594A9 (ko) | 시디93 또는 이의 가용성 단편의 용도 | |
WO2020005003A1 (ko) | Lag-3에 특이적으로 결합하는 단클론항체 및 이의 용도 | |
WO2019132533A1 (ko) | 항-pd-l1 항체 및 이의 용도 | |
EP4039704A1 (en) | Anti-pd-1 antibody and use thereof | |
WO2020116963A1 (ko) | 엔도텔린 수용체 a 활성 조절 항체 | |
WO2020145669A1 (ko) | 항 베타 1 인테그린 인간화 항체 및 이를 포함하는 암치료용 약학 조성물 | |
WO2017171373A2 (ko) | Egfr 표적 제제에 대한 저항성을 억제하기 위한 조성물 | |
WO2019216675A1 (ko) | 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체 | |
KR20220101126A (ko) | 항-Siglec-9 항체 분자 | |
WO2017074013A1 (ko) | 인간 및 마우스 sema3a에 교차결합하는 항체 및 그의 용도 | |
WO2020032614A1 (ko) | Epb41l5 단백질의 에피토프 및 단일클론항체 | |
WO2015130115A1 (en) | Novel antibody specific for tspan8 and uses thereof | |
WO2022216014A1 (ko) | 항-cntn4 항체 및 그의 용도 | |
WO2022131889A1 (ko) | Taci 단백질의 용도 | |
WO2022231032A1 (ko) | 항-cntn4 특이적 항체 및 그의 용도 | |
WO2021112640A1 (ko) | 항-tm4sf4 항체 및 이의 용도 | |
WO2020242200A1 (ko) | 엔도텔린 수용체 a 결합력이 향상된 항체 | |
Lee et al. | Ectopic overexpression of coiled-coil domain containing 110 delays G2/M Entry in U2-OS cells | |
WO2017142294A1 (ko) | EGFRvIII에 대한 항체 및 이의 용도 | |
WO2023224390A1 (ko) | Ccr7의 활성 조절 항체 | |
WO2019022274A1 (ko) | Pauf 단백질에 특이적으로 결합하는 항체 및 이의 용도 | |
WO2022244908A1 (ko) | 항-bcam 항체 또는 그의 항원 결합 단편 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19846519 Country of ref document: EP Kind code of ref document: A1 |
|
ENP | Entry into the national phase |
Ref document number: 2021530760 Country of ref document: JP Kind code of ref document: A |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2019846519 Country of ref document: EP Effective date: 20210309 |