WO2017179862A1 - 안정성이 개선된 ｈｅｒ２에 특이적으로 결합하는 항체 - Google Patents

안정성이 개선된 ｈｅｒ２에 특이적으로 결합하는 항체 Download PDF

Info

Publication number
WO2017179862A1
WO2017179862A1 PCT/KR2017/003827 KR2017003827W WO2017179862A1 WO 2017179862 A1 WO2017179862 A1 WO 2017179862A1 KR 2017003827 W KR2017003827 W KR 2017003827W WO 2017179862 A1 WO2017179862 A1 WO 2017179862A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
amino acid
antigen
binding fragment
Prior art date
Application number
PCT/KR2017/003827
Other languages
English (en)
French (fr)
Inventor
이종서
김규태
이영하
황인식
고봉국
Original Assignee
앱클론(주)
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 앱클론(주) filed Critical 앱클론(주)
Priority to US16/093,486 priority Critical patent/US11248059B2/en
Priority to CA3020825A priority patent/CA3020825C/en
Priority to CN201780023274.4A priority patent/CN109071672B/zh
Priority to JP2018554349A priority patent/JP6713059B2/ja
Priority to EP17782617.9A priority patent/EP3444279B1/en
Priority to ES17782617T priority patent/ES2955743T3/es
Priority to AU2017251298A priority patent/AU2017251298B2/en
Publication of WO2017179862A1 publication Critical patent/WO2017179862A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • A61K2039/507—Comprising a combination of two or more separate antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation

Definitions

  • the present invention relates to an improved stability of HER2 antibodies used for the prevention or treatment of HER2 (Human Epidermal Growth Factor Receptor 2) related diseases, particularly cancer.
  • HER2 Human Epidermal Growth Factor Receptor 2
  • the HER2 / neu (ErbB2) gene encodes 185 kDa transmembrane and glycoproteins and is one of a family of epidermal growth factor receptors (EGFRs).
  • the HER2 protein consists of an extracellular domain of 620 amino acid residues, a transmembrane domain of 23 amino acid residues and an intracellular domain of 490 amino acid residues having tyrosine kinase activity (Akiyama T, et al., Science , 232 ( 4758): 1644-1646 (1986).
  • trastuzumab antibodies commercialized as Herceptin TM , US Pat. No. 5,821,337): Sapino, A., et al., Annals of Oncology (2007) 18: 1963-1968; Bussolati, G, et al., British Journal of Cancer (2005) 92, 1261-1267; and Glazyrin A, et al., J Histology & Cytochemistry (2007) 55 (1): 25-33.
  • trastuzumab antibodies have been commercially successful, these antibodies are only effective in some patients with HER2 overexpression. Therefore, through co-administration with trastuzumab, there is an attempt to improve the prognosis of cancer patients who do not respond or have a slight response to trastuzumab.
  • WO 2008/031531 discloses a method of inhibiting cancer metastasis by co-administering trastuzumab and pertuzumab, which bind the same target HER2, and WO 2014/185704 discloses a different method of trastuzumab and HER2.
  • a method of displaying anticancer activity by co-administering hz1E11 that binds to an epitope is disclosed.
  • Improving the stability of therapeutic antibodies may be a way to increase the overall efficiency, such as reducing costs, increasing efficacy, and reducing side effects. Therefore, studies have been carried out to secure antibodies with improved stability through modifications to the sequences of therapeutic antibodies (WO 2010/047509; Diepold, K., et al., PLos One (2012) 7 (1): e30295; Correia, IR., MAbs (2010) 2 (3): 221-232).
  • the present inventors have tried to improve the structural stability of the antibody hz1E11 (refer to Korean Patent No. 1346346) already developed by the present inventors.
  • Structural stability of the antibody is an important consideration in the commercial development of the drug, if the stability of the structure is not good quality control is disadvantageous, the efficacy is reduced and the side effects are increased.
  • the inventors have discovered four amino acid residues that can significantly affect stability among amino acid residues at various positions of hz1E11, and prepared substitution variants of these amino acid residues to improve stability and improve productivity and efficacy with the parent antibody. A similar variant of hz1E11 was completed.
  • HER2 Human Epidermal Growth Factor Receptor 2
  • Another object of the present invention is to provide a nucleic acid molecule encoding an antibody or antigen-binding fragment thereof against HER2 which exhibits improved stability.
  • Still another object of the present invention is to provide a recombinant vector comprising the nucleic acid molecule.
  • Another object of the present invention to provide a host cell transformed with the recombinant vector.
  • Another object of the present invention to provide a pharmaceutical composition for preventing or treating cancer.
  • Still another object of the present invention is to provide a method for preventing or treating cancer, comprising administering the pharmaceutical composition for preventing or treating cancer to a subject.
  • Still another object of the present invention is to provide a kit for diagnosing cancer.
  • the invention provides (a) (i) complementarity determining region (HDR) CDR1 of SEQ ID NO: 1, (ii) CDRH2 of SEQ ID NO: 2, and (iii) SEQ ID NO: 3 A heavy chain variable region comprising a CDRH3 of; At least one of a fourth amino acid residue and a fifth amino acid residue in the second sequence is mutated to another amino acid; (b) for Human Epidermal Growth Factor Receptor 2 (HER2) exhibiting improved stability comprising a light chain variable region comprising CDRL1 of SEQ ID NO: 4, CDRL2 of SEQ ID NO: 5 and CDRL3 of SEQ ID NO: 6 An antibody or antigen binding fragment thereof is provided.
  • HDR complementarity determining region
  • the present inventors have tried to improve the structural stability of the antibody hz1E11 (refer to Korean Patent No. 1346346) already developed by the present inventors.
  • Structural stability of the antibody is an important consideration in the commercial development of the drug, if the stability of the structure is not good quality control is disadvantageous, the efficacy is reduced and the side effects are increased.
  • the inventors have discovered four amino acid residues that can significantly affect stability among amino acid residues at various positions of hz1E11, and prepared substitution variants of these amino acid residues to improve stability and improve productivity and efficacy with the parent antibody. A similar variant of hz1E11 was completed.
  • amino acid residues are located in CDRH2 of the heavy chain variable region.
  • the fourth and fifth amino acid residues of CDRH2 of SEQ ID NO: 2 are residues that affect the structural stability. When at least one of the two amino acids is substituted with another amino acid, stability is improved while maintaining the productivity and efficacy of the parent antibody.
  • Asn, the fourth amino acid residue of CDRH2, may be substituted with any other amino acid.
  • the fourth amino acid residue in SEQ ID NO: 2 of the CDRH2 is substituted with Ala, Gly, Cys, Ile, Leu, Met, Phe, Trp or Val, and more specifically, Ala, Gly, Substituted with Ile, Leu or Val, even more specifically with Ala or Gly, most particularly with Ala.
  • Gly the fifth amino acid residue of CDRH2, may be substituted with any other amino acid.
  • the fifth amino acid residue in SEQ ID NO: 2 of the CDRH2 is substituted with Ala, Cys, Ile, Leu, Met, Phe, Trp or Val, and more specifically, Ala, Ile, Leu or Substituted with Val, even more specifically with Ala or Val, most particularly with Ala.
  • the amino acid substitution strategy adopted in the present invention is to replace the original amino acid with another amino acid, wherein the replacing amino acid is selected to have a structurally small and stable R- group having the least reactivity possible.
  • the CDRH2 of the substitution-mutated SEQ ID NO: 2 sequence includes the amino acid sequence of SEQ ID NO: 9, the amino acid sequence of SEQ ID NO: 10 or the amino acid sequence of SEQ ID NO: 11 .
  • the variant antibody of the present invention may improve stability by adding mutations to the light chain variable region in addition to the heavy chain variable region.
  • the variable region of the antibody of the present invention comprises the amino acid sequence of SEQ ID NO: 12, SEQ ID NO: 13 or SEQ ID NO: 14.
  • the invention provides (a) (i) complementarity determining region (HDR) CDR1 of SEQ ID NO: 1, (ii) CDRH2 of SEQ ID NO: 2, and (iii) SEQ ID NO: 3 A heavy chain variable region comprising the CDRH3 of the amino acid sequence of; And (b) a light chain variable region comprising SEQ ID NO: 8, wherein at least one of the 56th amino acid residue and the 57th amino acid residue of the SEQ ID NO: 8 sequence is substituted and substituted with another amino acid,
  • HER2 Human Epidermal Growth Factor Receptor 2
  • two amino acid residues are located in the framework region, not in the CDRs of the light chain variable region.
  • 56th amino acid residue and 57th amino acid residue of SEQ ID NO: 8 are residues that affect the structural stability.
  • stability is improved while maintaining the productivity and efficacy of the parent antibody.
  • Asp the 56th amino acid residue of SEQ ID NO: 8, can be substituted with any other amino acid.
  • the 56th amino acid residue of SEQ ID NO: 8 is substituted with Ala, Gly, Cys, Ile, Leu, Met, Phe, Trp or Val, and more specifically, Ala, Gly, Ile, Substituted with Leu or Val, even more specifically with Ala or Gly, most specifically with Ala.
  • the 57th amino acid residue of SEQ ID NO: 8 can be substituted with any other amino acid.
  • the 57th amino acid residue of SEQ ID NO: 8 is substituted with Ala, Cys, Ile, Leu, Met, Phe, Trp or Val, and more specifically, with Ala, Ile, Leu or Val Substituted, and more specifically, substituted with Ala or Val, most specifically with Ala.
  • the amino acid sequence of the substitution-mutated SEQ ID NO: 8 sequence includes the amino acid sequence of SEQ ID NO: 12, amino acid sequence of SEQ ID NO: 13 or SEQ ID NO: 14 of the sequence do.
  • Antibodies of the invention have excellent killing or proliferative ability against cancer cells of various HER2-expressing.
  • the term “killing” or “proliferation suppression” used while referring to cancer cells is used interchangeably.
  • antibody refers to a specific antibody to HER2, which includes antigen binding fragments of antibody molecules as well as complete antibody forms.
  • a complete antibody is a structure having two full length light chains and two full length heavy chains, each of which is linked by heavy and disulfide bonds.
  • the heavy chain constant region has gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ) and epsilon ( ⁇ ) types and subclasses gamma 1 ( ⁇ 1), gamma 2 ( ⁇ 2), and gamma 3 ( ⁇ 3). ), Gamma 4 ( ⁇ 4), alpha 1 ( ⁇ 1) and alpha 2 ( ⁇ 2).
  • the constant regions of the light chains have kappa ( ⁇ ) and lambda ( ⁇ ) types (Cellular and Molecular Immunology, Wonsiewicz, MJ, Ed., Chapter 45, pp. 41-50, WB Saunders Co. Philadelphia, PA (1991); Nisonoff, A., Introduction to Molecular Immunology, 2nd Ed., Chapter 4, pp. 45-65, sinauer Associates, Inc., Sunderland, MA (1984)).
  • the term “antigen binding fragment” means a fragment having antigen binding function and includes Fab, F (ab '), F (ab') 2 , Fv, and the like.
  • Fab in the antibody fragment has a structure having a variable region of the light and heavy chains, a constant region of the light chain and the first constant region of the heavy chain (C H1 ) having one antigen binding site.
  • F (ab ') 2 antibodies are produced by disulfide bonds of cysteine residues in the hinge region of Fab'.
  • Double-chain Fv is a non-covalent bond in which the heavy chain variable region and the light chain variable region are linked, and the single-chain Fv is generally shared by the variable region of the heavy chain and the short chain variable region through a peptide linker. It may be linked by bond or directly at the C-terminus to form a dimer-like structure such as a double chain Fv.
  • Such antibody fragments can be obtained using proteolytic enzymes (for example, restriction digestion of the entire antibody with papain can yield Fab and cleavage with pepsin can yield F (ab ') 2 fragment), or It can be produced through genetic recombination technology.
  • proteolytic enzymes for example, restriction digestion of the entire antibody with papain can yield Fab and cleavage with pepsin can yield F (ab ') 2 fragment
  • It can be produced through genetic recombination technology.
  • the antibody is preferably in the form of Fab or in the form of a complete antibody.
  • the heavy chain constant region may be selected from any one isotype of gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ) or epsilon ( ⁇ ).
  • the constant regions are gamma 1 (IgG1), gamma 3 (IgG3) and gamma 4 (IgG4), most preferably the gamma 1 (IgG1) isotype.
  • the light chain constant region may be kappa or lambda type, preferably kappa type.
  • preferred antibodies of the present invention are in Fab or IgG1 form with kappa ( ⁇ ) light chain and gamma 1 ( ⁇ 1) heavy chain.
  • the term “heavy chain” refers to an entirety comprising a variable region domain V H and three constant region domains C H1 , C H2 and C H3 comprising an amino acid sequence having sufficient variable region sequence to confer specificity to the antigen. It means both length heavy chains and fragments thereof.
  • the term “light chain” herein also refers to both the full-length light chain and fragments thereof comprising the variable region domain V L and the constant region domain C L comprising an amino acid sequence having sufficient variable region sequence to confer specificity to the antigen. do.
  • complementarity determining region refers to the amino acid sequences of the hypervariable regions of immunoglobulin heavy and light chains (Kabat et al., Sequences of Proteins of Immunological Interest, 4th Ed., US Department of Health and Human Services, National Institutes of Health (1987)).
  • the heavy chains (CDRH1, CDRH2 and CDRH3) and light chains (CDRL1, CDRL2 and CDRL3) each contain three CDRs. CDRs provide key contact residues for the antibody to bind antigen or epitope.
  • Antibodies of the invention include monoclonal antibodies, multispecific antibodies, human antibodies, humanized antibodies, chimeric antibodies, single chain Fvs (scFV), single chain antibodies, Fab fragments, F (ab ') fragments, disulfide-binding Fvs (sdFV) And anti-idiotype (anti-Id) antibodies, epitope-binding fragments of the antibodies, and the like.
  • the present invention provides a nucleic acid molecule encoding the antibody to the HER2 of the present invention or an antigen-binding fragment thereof.
  • nucleic acid molecule is meant to encompass DNA (gDNA and cDNA) and RNA molecules inclusively, and the nucleotides that are the basic structural units in nucleic acid molecules are naturally modified nucleotides, as well as modified sugar or base sites. Analogues (Scheit, Nucleotide Analogs, John Wiley, New York (1980); Uhlman and Peyman, Chemical Reviews , 90: 543-584 (1990)).
  • the present invention provides a recombinant vector comprising the nucleic acid molecule of the present invention described above.
  • vector refers to a plasmid vector as a means for expressing a gene of interest in a host cell; Cosmid vector; And viral vectors such as bacteriophage vectors, adenovirus vectors, retrovirus vectors, and adeno-associated virus vectors, and the like.
  • the nucleic acid molecule encoding the light chain variable region and the nucleic acid molecule encoding the heavy chain variable region in the vector of the present invention are operatively linked with the promoter.
  • operably linked refers to the functional binding between a nucleic acid expression control sequence (eg, an array of promoters, signal sequences, or transcriptional regulator binding sites) and other nucleic acid sequences, thereby The regulatory sequence will control the transcription and / or translation of said other nucleic acid sequence.
  • a nucleic acid expression control sequence eg, an array of promoters, signal sequences, or transcriptional regulator binding sites
  • the recombinant vector system of the present invention can be constructed through various methods known in the art, and specific methods thereof are disclosed in Sambrook et al., Molecular Cloning, A Laboratory Manual , Cold Spring Harbor Laboratory Press (2001). This document is incorporated herein by reference.
  • Vectors of the present invention can typically be constructed as vectors for cloning or vectors for expression.
  • the vector of the present invention can be constructed using prokaryotic or eukaryotic cells as hosts.
  • promoters derived from the genome of mammalian cells e.g., metallothionine promoter, ⁇ -actin promoter, human heroglobin promoter and Human muscle creatine promoter
  • promoters derived from mammalian viruses e.g., adenovirus late promoter, vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus promoter, tk promoter of HSV, mouse breast tumor virus (MMTV) promoter, LTR promoter of HIV, promoter of Moroni virus, promoter of Epstein Barr virus (EBV) and promoter of Loews sacoma virus (RSV)
  • adenovirus late promoter vaccinia virus 7.5K promoter
  • SV40 promoter cytomegalovirus promoter
  • tk promoter of HSV e.g., mouse breast tumor virus (MMTV) promoter
  • LTR promoter of HIV e.g., promoter of Moroni virus, promoter of Ep
  • Vectors of the invention may be fused with other sequences to facilitate purification of the antibody expressed therefrom.
  • Sequences to be fused include, for example, glutathione S-transferase (Pharmacia, USA), maltose binding protein (NEB, USA), FLAG (IBI, USA) and 6x His (hexahistidine; Quiagen, USA).
  • the protein expressed by the vector of the present invention is an antibody
  • the expressed antibody can be easily purified through a Protein A column or the like without additional sequences for purification.
  • the expression vector of the present invention as an optional marker, and includes antibiotic resistance genes commonly used in the art, for example, ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neo There are genes resistant to mycin and tetracycline.
  • the present invention provides a host cell transformed with the recombinant vector.
  • Host cells capable of stably and continuously cloning and expressing the vectors of the present invention are known in the art and can be used with any host cell, for example, suitable eukaryotic host cells of the vector are monkey kidney cells (COS7: monkey). kidney cells, NSO cells, SP2 / 0, Chinese hamster ovary (CHO) cells, W138, baby hamster kidney (BHK) cells, MDCK, myeloma cell lines, HuT 78 cells and HEK-293 cells Including but not limited to.
  • the present invention provides a pharmaceutical composition
  • a pharmaceutical composition comprising (a) a pharmaceutically effective amount of the HER2 antibody or antigen-binding fragment thereof of the present invention; And (b) provides a pharmaceutical composition for preventing or treating cancer comprising a pharmaceutically acceptable carrier.
  • the present invention is directed to an antibody or antigen-binding fragment thereof according to the above-described HER2 of the present invention; And it provides a pharmaceutical composition for preventing or treating cancer comprising a histidine-buffer containing 1 to 200 mM histidine.
  • the concentration of histidine contained in the histidine-buffer may be 1 to 200 mM, more specifically 1 to 150 mM, 1 to 100 mM, 1 to 50 mM, 1 to 40 mM, 1-30 mM, 1-20 mM, and most specifically 10 mM.
  • the histidine-buffer may have a pH of 5 to 7, more specifically 5 to 6.5, 5.5 to 6.5, and most specifically 6 may be.
  • the histidine-buffer may include 50-300 mM sodium chloride, more specifically 10-200 mM, 50-200 mM, 100-200 mM, most specifically 150 mM.
  • the HER2 antibody or antigen-binding fragment thereof of the present invention shows superior stability even under severe conditions when stored in the histidine-buffered solution as compared to the case where stored in PBS buffer. Therefore, the pharmaceutical composition for preventing or treating cancer containing the histidine-buffer of the present invention has an excellent effect on improving the stability of the pharmaceutical composition comprising the HER2 antibody of the present invention or an antigen-binding fragment thereof as an active ingredient.
  • the pharmaceutical composition of the present invention uses the above-described HER2 antibody or antigen-binding fragment thereof as an active ingredient, the contents in common between the two are repeated in order to avoid excessive complexity of the present specification by repeated description. Omit.
  • the HER2 antibody of the present invention when co-administered with trastuzumab, results in a significantly improved apoptosis of cancer cells (especially breast cancer cells, more specifically HER2-expressing breast cancer cells). It can kill and is very effective for the treatment of cancer (especially breast cancer, more specifically HER2-expressing breast cancer).
  • the pharmaceutical composition further comprises trastuzumab antibody.
  • Cancers that can be prevented or treated by the compositions of the present invention include various cancers known in the art, for example breast cancer, ovarian cancer, gastric cancer, lung cancer, liver cancer, bronchial cancer, nasopharyngeal cancer, laryngeal cancer, pancreatic cancer, bladder cancer , Colon cancer, colon cancer, cervical cancer, brain cancer, prostate cancer, bone cancer, head and neck cancer, skin cancer, thyroid cancer, parathyroid cancer or ureter cancer.
  • cancers that can be prevented or treated by the compositions of the present invention are HER2-expressing cancers, and more specifically HER2-expressing breast cancers.
  • Pharmaceutically acceptable carriers included in the pharmaceutical compositions of the present invention are those commonly used in the preparation, such as lactose, dextrose, sucrose, sorbitol, mannitol, starch, acacia rubber, calcium phosphate, alginate, gelatin, Calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water, syrup, methyl cellulose, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil, and the like It doesn't happen.
  • the pharmaceutical composition of the present invention may further include a lubricant, a humectant, a sweetener, a flavoring agent, an emulsifier, a suspending agent, a preservative, and the like.
  • a lubricant e.g., talc, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, kaolin, a kaolin, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, sorbitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, mannitol, mann
  • compositions of the present invention can be administered parenterally, such as intravenous, subcutaneous, intramuscular, intraperitoneal, topical, intranasal, pulmonary and rectal.
  • Suitable dosages of the pharmaceutical compositions of the invention vary depending on factors such as the formulation method, mode of administration, age, weight, sex, morbidity, condition of food, time of administration, route of administration, rate of excretion and response to reaction, Usually a skilled practitioner can easily determine and prescribe a dosage effective for the desired treatment or prophylaxis.
  • the daily dose of the pharmaceutical composition of the present invention is 0.0001-100 mg / kg.
  • pharmaceutically effective amount means an amount sufficient to prevent or treat cancer.
  • compositions of the present invention may be prepared in unit dosage form by formulating with a pharmaceutically acceptable carrier and / or excipient according to methods which can be easily carried out by those skilled in the art. Or may be prepared by incorporation into a multi-dose container.
  • the formulations may be in the form of solutions, suspensions or emulsions in oils or aqueous media or in the form of extracts, powders, suppositories, powders, granules, tablets or capsules, and may further comprise dispersants or stabilizers.
  • the pharmaceutical composition of the present invention further comprises trastuzumab antibody.
  • trastuzumab refers to the antibody disclosed in US Pat. No. 5,821,337.
  • the present invention provides a method for preventing cancer comprising administering to a subject a pharmaceutical composition comprising the above-described antibody against HER2 of the present invention or an antigen-binding fragment thereof as an active ingredient. Or provide a method of treatment.
  • administer refers to administering a therapeutically effective amount of a composition of the invention directly to a subject (an individual) in need thereof so that the same amount is formed in the subject's body. Say that.
  • a “therapeutically effective amount” of a composition means a content of the composition that is sufficient to provide a therapeutic or prophylactic effect to a subject to which the composition is to be administered, and includes “prophylactically effective amount”.
  • the term “subject” includes, without limitation, human, mouse, rat, guinea pig, dog, cat, horse, cow, pig, monkey, chimpanzee, baboon or rhesus monkey. Specifically, the subject of the present invention is a human.
  • the method of preventing or treating cancer of the present invention is a method comprising administering a pharmaceutical composition for preventing or treating cancer, which is an aspect of the present invention, and thus avoids excessive complexity of the present disclosure with respect to overlapping contents. To omit them.
  • the above-described antibodies to HER2 or antigen-binding fragments thereof of the present invention can be used for diagnosis, such as diagnosing cancer.
  • the present invention provides a kit for diagnosing cancer, comprising the above-described antibody against HER2 of the present invention or an antigen-binding fragment thereof.
  • the diagnostic kit of the present invention comprises the above-described HER2 antibody of the present invention or antigen-binding fragment thereof, and diagnoses the same disease as the pharmaceutical composition of the present invention. In order to avoid excessive complexity, the description is omitted.
  • kits described above contain antibodies, they can basically be made suitable for various immunoassays or immunostaining.
  • the immunoassay or immunostaining may include radioimmunoassay, radioimmunoprecipitation, immunoprecipitation, enzyme-linked immunosorbent assay (ELISA), capture-ELISA, inhibition or competition assay, sandwich assay, flow cytometry, immunofluorescence staining and Immunoaffinity tablets, including but not limited to.
  • the immunoassay or method of immunostaining is described in Enzyme Immunoassay , ET Maggio, ed., CRC Press, Boca Raton, Florida, 1980; Gaastra, W., Enzyme-linked immunosorbent assay (ELISA), in Methods in Molecular Biology , Vol. 1, Walker, JM ed., Humana Press, NJ, 1984; And Ed Harlow and David Lane, Using Antibodies: A Laboratory Manual , Cold Spring Harbor Laboratory Press, 1999, which is incorporated herein by reference.
  • antibodies labeled with radioisotopes may be used to detect HER2 protein.
  • a specific embodiment of the present invention comprises the steps of (i) coating the sample to be analyzed on the surface of the solid substrate; (ii) reacting the sample with a HER2 antibody as a primary antibody; (iii) reacting the resultant of step (ii) with the secondary antibody to which the enzyme is bound; And (iv) measuring the activity of the enzyme.
  • Suitable as the solid substrate are hydrocarbon polymers (eg polystyrene and polypropylene), glass, metals or gels, most particularly microtiter plates.
  • hydrocarbon polymers eg polystyrene and polypropylene
  • glass e.g polystyrene and polypropylene
  • metals or gels most particularly microtiter plates.
  • Enzymes bound to the secondary antibody include, but are not limited to, enzymes catalyzing color reaction, fluorescence, luminescence or infrared reaction, for example, alkaline phosphatase, ⁇ -galactosidase, hose Radish peroxidase, luciferase and cytochrome P 450 .
  • alkaline phosphatase When alkaline phosphatase is used as the enzyme binding to the secondary antibody, bromochloroindolyl phosphate (BCIP), nitro blue tetrazolium (NBT), naphthol-AS-B1-phosphate (naphthol-AS) as a substrate Chloronaphthol, aminoethylcarbazole, diaminobenzidine, D-luciferin, lucigenin (bis) if colorimetric substrates such as -B1-phosphate) and enhanced chemifluorescence (ECF) are used, and horse radish peroxidase is used -N-methylacridinium nitrate), resorupin benzyl ether, luminol, Amflex Red reagent (10-acetyl-3,7-dihydroxyphenoxazine), p-phenylenediamine-HCl and pyrocatechol (HYR), TMB (tetramethyl
  • certain embodiments of the invention comprise the steps of: (i) coating a HERR2 antibody on the surface of a solid substrate as a capturing antibody; (ii) reacting the capture antibody with the sample; (iii) reacting the product of step (ii) with a HER2 detecting antibody to which a label which generates a signal is bound; And (iv) measuring the signal resulting from the label.
  • the detection antibody carries a label which generates a detectable signal.
  • the label may include chemicals (eg biotin), enzymes (alkaline phosphatase, ⁇ -galactosidase, horse radish peroxidase and cytochrome P 450 ), radioactive substances (eg C 14 , I 125 , P 32 and S 35 ), fluorescent materials (eg, fluorescein), luminescent materials, chemiluminescent and fluorescence resonance energy transfer (FRET).
  • chemicals eg biotin
  • enzymes alkaline phosphatase, ⁇ -galactosidase, horse radish peroxidase and cytochrome P 450
  • radioactive substances eg C 14 , I 125 , P 32 and S 35
  • fluorescent materials eg, fluorescein
  • luminescent materials eg, chemiluminescent and fluorescence resonance energy transfer (FRET).
  • FRET fluorescence resonance energy transfer
  • Measurement of the final enzyme activity or signal in the ELISA method and the capture-ELISA method can be carried out according to various methods known in the art. If biotin is used as a label, the signal can be easily detected with streptavidin and luciferin if luciferase is used.
  • Samples that may be applied to the kits of the present invention include, but are not limited to, cells, tissues or tissue-derived extracts, lysates or purified products, blood, plasma, serum, lymph or ascites.
  • Antibodies of the invention can be used for in vivo or in vitro imaging.
  • the present invention provides a composition for imaging comprising the above-described antibody of the present invention and a label bound conjugate for generating a detectable signal bound to the antibody.
  • Labels that generate the detectable signal include T1 contrast material (eg, Gd chelate compound), T2 contrast material (eg, superparamagnetic material (eg, magnetite, Fe 3 O 4 , ⁇ -Fe 2 O 3 , manganese ferrite, cobalt) Ferrites and nickel ferrites)), radioisotopes (e.g., 11 C, 15 O, 13 N, P 32 , S 35 , 44 Sc, 45 Ti, 118 I, 136 La, 198 Tl, 200 Tl, 205 Bi, and 206 Bi), fluorescent materials (fluorescein, phycoerythrin, rhodamine, lissamine, and Cy3 and Cy5), chemiluminescent groups, magnetic particles, mass labels or electron-dense particles It is not limited to this.
  • T1 contrast material eg, Gd chelate compound
  • T2 contrast material eg, superparamagnetic material (eg, magnetite, Fe 3 O 4 , ⁇ -F
  • the present invention improves the stability of the antibody by substituting specific site amino acid residues of the parent antibody, thereby improving the drug compatibility.
  • the mutant antibody of the present invention has almost the same productivity and efficacy, and greatly improves stability.
  • the variant antibodies of the present invention exhibit excellent properties such as reduced production cost, reduced efficacy, and reduced side effects in the development of HER2-specific antibodies.
  • HER2 is an ELISA result of analyzing whether the antibody having improved stability specifically binds to HER2 among ErbB family proteins (HER1, HER2, HER3, and HER4) to which HER2 belongs.
  • hz15E3, trastuzumab, AMG-888 (Li C. et al., Discov Med. 2013 Sep; 16 (87): 79-92) were used as control antibodies.
  • Anti-HER2 Ab represents trastuzumab
  • Anti-EGFR Ab represents hz15E3
  • Anti-HER3 Ab represents AMG-888.
  • 2nd only represents a negative control group.
  • hIgG negative control with human IgG
  • TRA trastuzumab
  • hIgG represents negative control with human IgG and TRA represents trastuzumab.
  • variable and constant region portions of the heavy and light chains were amplified and cloned.
  • Primers used for amplification are shown in Table 2, using the above-described primers and GoTaq DNA polymerase (Promega, Cat. No. M3005) at 95 °C 30 seconds, 57 °C 30 seconds, 72 °C 60 seconds PCR The reaction was repeated 30 times.
  • PCR products of the amplified variable region and the constant region were purified by using a Qiaquick gel extraction kit (QIAGEN, Cat. No. 28706) after electrophoresis on 1% agarose gel.
  • the PCR product of the variable region and the PCR region of the constant region are mixed in the same amount, and then an overlap extension PCR is performed using the forward primer of the variable region and the reverse primer of the constant region.
  • the gene product was prepared and purified in the same manner as above.
  • the overlap extension PCR was carried out by repeating the reaction of GoTaq DNA polymerase (Promega, Cat. No. M3005) for 30 seconds at 94 °C, 30 seconds at 57 °C, 120 seconds at 72 °C.
  • the cloning vector of the mutated antibody of Example 1 was constructed according to the method disclosed in Korean Patent No. 1434652.
  • FreeStyle TM 293F Invitrogen, Cat. No. R790-07 animal cells were transiently transfected with polyethylenimine (Polyscience Inc., Cat. No. 23966) to transfect the cloned vector and removed from the cell culture.
  • Modified antibodies were purified using Protein-A Ceramic HyperD F resin (PALL, Cat No. 20078-028). Purified antibodies were quantified using UV analysis, and concentration and purity were confirmed by Coomassie blue staining after SDS-PAGE.
  • hz1E11.10 and hz1E11.20 transformed with only the heavy chain alone showed better productivity than the parental antibody hz1E11.
  • hz1E11.01 and hz1E11.02, which modified only the light chain chain alone were found to be worse in productivity. It is shown in Table 4 that the antibody which modified the light chain and the heavy chain at the same time shows the productivity slightly lower than the productivity of the parent antibody hz1E11.
  • ELISA was used as a method for confirming whether the antibody to HER2 having improved stability binds to the target HER2.
  • ECD extracellular domain
  • the extracellular domain (ECD) region of the ERBB family protein was produced using animal cells and used as an antigen. Cloning of the DNA in the form of the hinge and Fc region (CH 2 -CH 3 ) of human IgG1 at the C-terminus of ECD to pCEP4 vector (Invitrogen, Cat. No. V044-50) using HindIII and BamHI restriction enzymes It was. Subsequently, the cloned vector was transiently transfected with FreeStyle TM 293F (Invitrogen, Cat. No.
  • EGFR-ECF-Fc HER2-ECD-Fc
  • HER3-ECD-Fc ChromPure human IgG (hIgG, Jackson Immunoresearch Lab. Inc., Cat.No. 009-000-003) at a concentration of 1 ⁇ g / mL Costar
  • TBS-T 0.05% Triton X-100
  • 300 ⁇ l of TBS-T / SM 2% skim milk
  • the stability of the HER2 antibody was added and the antibody was bound for 1 hour at 37 °C.
  • the anti-mouse IgG-HRP (Pierce, Cat. No. 31439) was diluted 1: 5,000 in TBS-T / SM as a secondary antibody, and the antibody was bound for 1 hour at 37 ° C.
  • TMB PurModics, Cat.No. TMBC-1000-01
  • 1 N sulfuric acid sulfuric acid, DukSan, Cat. No. 254
  • Absorbance at 450 nm was measured using Victor X3 (PerkinElmer, Cat. No. 2030-0030) and confirmed that it did not specifically bind to HER2-ECD-Fc.
  • Anti-EGFR Ab (hz15E3), anti-HER2 Ab (trastuzumab), and anti-HER3 Ab (AMG-888), which bind to EGFR, were used as controls to confirm that ELISA was normally performed. It was confirmed that the eight antibodies modified to improve stability specifically binds only to HER2 (FIG. 1).
  • Cell viability assay was performed to confirm the cell proliferation inhibitory effect of the modified antibodies to improve the stability.
  • NCI-N87 cells a representative gastric cancer cell line overexpressing HER2, alone or in combination with trastuzumab.
  • the developed antibody and trastuzumab were used in a 1: 1 ratio (weight ratio).
  • NCI-N87 ATCC, Cat No. CRL-5822, 10,000 cells / well
  • Final concentrations of the treated antibodies were up to 20 ⁇ g / mL for each antibody and were serially diluted 1: 4 and run at 9 concentrations.
  • the developed antibody and trastuzumab were in a 1: 1 ratio (for example, in FIG. 3, TRA 1 ⁇ g / mL and the developed antibody 1 when the dose was 1 ⁇ g / mL). ⁇ g / mL).
  • NCI-N87 cells were further cultured for 4 days, and then CCK-8 was added to the final 10% and treated at 37 ° C. for 3 hours. Thereafter, the absorbance was measured at 450 nm using Victor X-3. Absorbance of cells not treated with antibody was set at 100% and relative survival was calculated (FIGS. 2 and 3).
  • HER2 antibodies with enhanced stability showed proliferation inhibitory effect against NCI-N87 cell line in response to trastuzumab. Moreover, the developed antibody was superior in inhibiting cancer cell proliferation with respect to NCI-N87 cell line compared with trastuzumab alone in combination with trastuzumab as in the parent antibody hz1E11 (FIGS. 2 and 3).
  • the present inventors performed an acceleration / stress test (accelerated test, stress test) on the parent antibodies hz1E11 and mutant antibodies hz1E11.10 and hz1E11.11 obtained from CHO cells.
  • Each of the above antibodies is buffered in PBS buffer (137 mM Sodium chloride, 2.7 mM potassium chloride, 4.3 mM sodium phosphate, 1.4 mM potassium, pH 7.4), or histidine buffer (10 mM Histidine, 150 mM Sodium chloride, pH 6.0).
  • PBS buffer 137 mM Sodium chloride, 2.7 mM potassium chloride, 4.3 mM sodium phosphate, 1.4 mM potassium, pH 7.4
  • histidine buffer 10 mM Histidine, 150 mM Sodium chloride, pH 6.0.
  • SEC Size exclusion chromatography
  • CEX cation-exchange chromatography
  • Samples prepared above were prepared using a constant temperature and humidity cabinet (CEO No. TH-DG-150) and a refrigerator (JEO TECH, Cat No. CLG-150S), respectively. 5%), 40 ⁇ 3 °C (humidity 75 ⁇ 5%) and stored in a temperature / humidity conditions, and the stability of each sample was analyzed at 0 and 4 weeks from the storage time.
  • the analysis of the sample was performed using an Agilent 1260 infinity HPLC instrument, and the size-exclusion chromatography confirmed the ratio of monomers to confirm the stability according to the conditions.
  • the cation-exchange chromatography Stability was confirmed by checking the ratio of the main peak.
  • each antibody protein was analyzed for monomer ratio analysis using 100 mM sodium phosphate (pH 6.8) (Monobasic, Fluka, Cat No.17844; Dibasic, Fluka, Cat No71633) solution mobile phase conditions under TSK-gel G3000SWXL (7.8 X 300 mm)
  • a protein peak was detected at UV280 nm while flowing for 20 minutes at a rate of 0.8 mL / min.
  • the aggregates of protein elute before the main peak from the column, and the monomer purity was calculated by comparing the peak area of the aggregate with the area of the main peak.
  • the protein was diluted to 1 mg / mL with 10 mM sodium phosphate (pH 7.0) (Monobasic, Fluka, Cat No.17844; Dibasic, Fluka, Cat No.71633) buffer to 20 ⁇ L was injected into a Bio Mab (NP10, PK, 4.6 x 250 mm) HPLC column (Agilent, Cat No.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Molecular Biology (AREA)
  • Microbiology (AREA)
  • Oncology (AREA)
  • Biomedical Technology (AREA)
  • Biochemistry (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Hospice & Palliative Care (AREA)
  • Cell Biology (AREA)
  • Biotechnology (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicinal Preparation (AREA)

Abstract

본 발명은 모항체의 특정 부위 아미노산 잔기를 치환하여, 항체의 안정성을 향상시켜 의약적합성(druggability)을 개선한 발명이다. 본 발명의 변이체 항체는 모항체인 hz1E11과 비교하여, 생산성과 효능이 거의 동일하면서 안정성이 크게 향상되어 있다. 따라서, 본 발명의 변이체 항체는, HER2-특이적 항체 개발에 있어서, 생산 비용 절감, 효능 감소 억제 및 부작용 감소 등의 우수한 특성을 나타낸다.

Description

안정성이 개선된 ＨＥＲ２에 특이적으로 결합하는 항체
본 특허출원은 2016년 4월 12일에 대한민국 특허청에 제출된 대한민국 특허 출원 제10-2016-0044747호에 대하여 우선권을 주장하며, 상기 특허출원의 개시 사항은 본 명세서에 참조로서 삽입된다.
본 발명은 HER2(Human Epidermal Growth Factor Receptor 2) 관련 질환, 특히 암의 예방 또는 치료에 이용되는 안정성이 향상된 HER2 항체에 관한 것이다.
HER2/neu(ErbB2) 유전자는 185 kDa 세포막통과 당단백질을 코딩하며 이는 EGFR(epidermal growth factor receptors)의 패밀리 중 하나이다. HER2 단백질은 620개 아미노산 잔기로 이루어진 세포외 도메인, 23개 아미노산 잔기의 세포막통과 도메인 및 타이로신 키나아제 활성을 갖는 490 아미노산 잔기의 세포내 도메인으로 구성되어 있다(Akiyama T, et al., Science, 232(4758):1644-1646(1986)).
한편, 다양한 특성을 갖는 HER2 항체가 많은 문헌에 개시되어 있으며, 이들 HER2 항체들 중에서 상업적으로 가장 성공한 항체는 트라스투주맙(trastuzumab) 항체(HerceptinTM으로 상업화 됨, U.S. Pat. No. 5,821,337)이다: Sapino, A., et al., Annals of Oncology (2007) 18: 1963-1968; Bussolati, G, et al., British Journal of Cancer (2005) 92, 1261-1267; and Glazyrin A, et al., J Histology & Cytochemistry (2007) 55(1):25-33.
트라스투주맙 항체가 상업적으로 성공하기는 하였지만, 이 항체는 HER2가 과발현된 일부 환자에서만 그 효과를 보인다. 따라서 트라스투주맙과의 병용투여를 통하여, 트라스투주맙에 반응하지 않거나 미미하게 반응하는 암환자의 예후를 개선하려는 시도가 있다. 그 예로 WO 2008/031531은 동일한 표적인 HER2와 결합하는 트라스투주맙과 퍼투주맙(pertuzumab)을 병용투여하여 암 전이를 억제하는 방법을 개시하고 있으며, WO 2014/185704는 트라스투주맙과 HER2의 상이한 에피토프에 결합하는 hz1E11을 병용투여하여 항암 활성을 보이는 방법을 개시하고 있다.
치료용 항체의 안정성 향상은 비용 절감 및 효능 증대, 부작용 감소 등의 종합적인 효율성을 높이는 방법이 될 수 있다. 따라서 치료용 항체의 서열에 대한 변형을 통하여 안정성이 향상된 항체를 확보하는 연구가 수행되고 있다(WO 2010/047509; Diepold, K., et al., PLos One (2012) 7(1): e30295; Correia, IR., MAbs (2010) 2(3): 221-232).
본 명세서 전체에 걸쳐 다수의 논문 및 특허문헌이 참조되고 그 인용이 표시되어 있다. 인용된 논문 및 특허문헌의 개시 내용은 그 전체로서 본 명세서에 참조로 삽입되어 본 발명이 속하는 기술 분야의 수준 및 본 발명의 내용이 보다 명확하게 설명된다.
본 발명자들은 본 발명자들에 의해 이미 개발된 항체인 hz1E11(참조: 대한민국 특허 제1453462호)의 구조적 안정성을 개선하고자 노력하였다. 항체의 구조적 안정성은 의약의 상업적 개발 과정에서 중요한 고려 요소로서, 구조의 안정성이 우수하지 않으면 품질 관리가 불리해지고 효능이 감소되며 부작용이 증가하는 문제점이 있다. 본 발명자들은 hz1E11의 다양한 위치의 아미노산 잔기들 중에서, 안정성에 크게 영향을 미칠 수 있는 아미노산 잔기를 4개 발굴하고, 이 아미노산 잔기의 치환 변이체들을 제조하여, 안정성이 개선되고 생산성과 효능을 모항체와 유사한 hz1E11의 변이체를 완성시켰다.
따라서, 본 발명의 목적은 개선된 안정성을 나타내는 HER2(Human EpidermalGrowth Factor Receptor 2)에 대한 항체 또는 그의 항원 결합 단편을 제공하는 데 있다.
본 발명의 다른 목적은 개선된 안정성을 나타내는 HER2에 대한 항체 또는 그의 항원 결합 단편을 코딩하는 핵산 분자를 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 핵산 분자를 포함하는 재조합 벡터를 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 재조합 벡터로 형질전환 된 숙주세포를 제공하는 데 있다.
본 발명의 또 다른 목적은 암 예방 또는 치료용 약제학적 조성물을 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 암 예방 또는 치료용 약제학적 조성물을 대상체에 투여하는 단계를 포함하는 암의 예방 또는 치료방법을 제공하는 데 있다.
본 발명의 또 다른 목적은 암 진단용 키트를 제공하는 데 있다.
본 발명의 다른 목적 및 이점은 하기의 발명의 상세한 설명, 청구범위 및 도면에 의해 보다 명확하게 된다.
본 발명의 일 양태에 따르면, 본 발명은 (a) (i) 서열목록 제1서열의 CDR(complementarity determining region)H1, (ii) 서열목록 제2서열의 CDRH2 및 (iii) 서열목록 제3서열의 CDRH3을 포함하는 중쇄 가변영역; 상기 서열목록 제2서열에서 4번째 아미노산 잔기 및 5번째 아미노산 잔기 중 최소 하나는 다른 아미노산으로 치환 변이된 것이고; (b) 서열목록 제4서열의 CDRL1, 서열목록 제5서열의 CDRL2 및 서열목록 제6서열의 CDRL3을 포함하는 경쇄 가변영역을 포함하는 개선된 안정성을 나타내는HER2(Human EpidermalGrowth Factor Receptor 2)에 대한 항체 또는 그의 항원 결합 단편을 제공한다.
본 발명자들은 본 발명자들에 의해 이미 개발된 항체인 hz1E11(참조: 대한민국 특허 제1453462호)의 구조적 안정성을 개선하고자 노력하였다. 항체의 구조적 안정성은 의약의 상업적 개발 과정에서 중요한 고려 요소로서, 구조의 안정성이 우수하지 않으면 품질 관리가 불리해지고 효능이 감소되며 부작용이 증가하는 문제점이 있다. 본 발명자들은 hz1E11의 다양한 위치의 아미노산 잔기들 중에서, 안정성에 크게 영향을 미칠 수 있는 아미노산 잔기를 4개 발굴하고, 이 아미노산 잔기의 치환 변이체들을 제조하여, 안정성이 개선되고 생산성과 효능을 모항체와 유사한 hz1E11의 변이체를 완성시켰다.
본 발명자들이 규명한 4개의 아미노산 중에서, 두 개의 아미노산 잔기는 중쇄 가변영역의 CDRH2에 위치한다. 구체적으로, 서열목록 제2서열의 CDRH2의 4번째 아미노산 잔기 및 5번째 아미노산 잔기가 구조적 안정성에 영향을 미치는 잔기들이다. 상기 두 아미노산 중 최소 하나를 다른 아미노산으로 치환 하는 경우, 모항체의 생산성 및 효능은 유지하면서 안정성은 개선된다.
본 발명에 따르면, CDRH2의 4번째 아미노산 잔기인 Asn은 다른 어떤 아미노산으로도 치환 가능한다.
본 발명의 일 구현예에 따르면, CDRH2의 서열목록 제2서열에서 4번째 아미노산 잔기는 Ala, Gly, Cys, Ile, Leu, Met, Phe, Trp 또는 Val으로 치환되며, 보다 구체적으로 Ala, Gly, Ile, Leu 또는 Val으로 치환되고, 보다 더 구체적으로 Ala 또는 Gly으로 치환되며, 가장 구체적으로 Ala으로 치환된다.
본 발명에 따르면, CDRH2의 5번째 아미노산 잔기인 Gly은 다른 어떤 아미노산으로도 치환 가능한다.
본 발명의 일 구현예에 따르면, CDRH2의 서열목록 제2서열에서 5번째 아미노산 잔기는 Ala, Cys, Ile, Leu, Met, Phe, Trp 또는 Val으로 치환되며, 보다 구체적으로 Ala, Ile, Leu 또는 Val으로 치환되고, 보다 더 구체적으로 Ala 또는 Val으로 치환되며, 가장 구체적으로 Ala으로 치환된다.
본 발명에서 채택된 아미노산 치환 전략은 원래의 아미노산을 다른 아미노산으로 치환하되, 치환하는 아미노산은 가능한 반응성이 낮은 R-기를 가지며 구조적으로 작고 안정한 것을 선택하는 것이다.
본 발명의 일 구현예에 따르면, 상기 치환 변이된 서열목록 제2서열의 CDRH2는 서열목록 제9서열의 아미노산 서열, 서열목록 제10서열의 아미노산 서열 또는 서열목록 제11서열의 아미노산 서열을 포함한다.
본 발명의 일 구현예에 따르면, 본 발명의 변이체 항체는 중쇄 가변영역 이외에 경쇄 가변영역에 변이를 가하여 안정성을 향상시킬 수 있다. 구체적으로, 본 발명의 항체의 가변영역은 서열목록 제12서열, 서열목록 제13서열 또는 서열목록 제14서열의 아미노산 서열을 포함한다.
본 발명의 일 양태에 따르면, 본 발명은 (a) (i) 서열목록 제1서열의 CDR(complementarity determining region)H1, (ii) 서열목록 제2서열의 CDRH2 및 (iii) 서열목록 제3서열의 아미노산 서열의 CDRH3을 포함하는 중쇄 가변영역; 및 (b) 서열목록 제8서열을 포함하는 경쇄 가변영역을 포함하며, 상기 서열목록 제8서열의 56번째 아미노산 잔기 및 57번째 아미노산 잔기 중 최소 하나가 다른 아미노산으로 치환 변이된 것을 특징으로 하는, 개선된 안정성을 나타내는 HER2(Human EpidermalGrowth Factor Receptor 2)에 대한 항체 또는 그의 항원 결합 단편을 제공한다.
본 발명자들이 규명한 4개의 아미노산 중에서, 두 개의 아미노산 잔기는 경쇄 가변영역의 CDR이 아닌 프레임워크 부위에 위치해 있다. 구체적으로, 서열목록 제8서열의 56번째 아미노산 잔기 및 57번째 아미노산 잔기가 구조적 안정성에 영향을 미치는 잔기들이다. 상기 두 아미노산 중 최소 하나를 다른 아미노산으로 치환 하는 경우, 모항체의 생산성 및 효능은 유지하면서 안정성은 개선된다.
본 발명에 따르면, 서열목록 제8서열의 56번째 아미노산 잔기인 Asp은 다른 어떤 아미노산으로도 치환 가능한다.
본 발명의 일 구현예에 따르면, 서열목록 제8서열의 56번째 아미노산 잔기는 Ala, Gly, Cys, Ile, Leu, Met, Phe, Trp 또는 Val으로 치환되고, 보다 구체적으로 Ala, Gly, Ile, Leu 또는 Val으로 치환되며, 보다 더 구체적으로 Ala 또는 Gly으로 치환되고, 가장 구체적으로 Ala으로 치환된다.
본 발명에 따르면, 서열목록 제8서열의 57번째 아미노산 잔기인 Gly은 다른 어떤 아미노산으로도 치환 가능한다.
본 발명의 일 구현예에 따르면, 서열목록 제8서열의 57번째 아미노산 잔기는 Ala, Cys, Ile, Leu, Met, Phe, Trp 또는 Val으로 치환되며, 보다 구체적으로 Ala, Ile, Leu 또는 Val으로 치환되고, 보다 더 구체적으로 Ala 또는 Val으로 치환되며, 가장 구체적으로 Ala으로 치환된다.
본 발명의 일 구현예에 따르면, 상기 치환 변이된 서열목록 제8서열의 아미노산 서열은 서열목록 제12서열의 아미노산 서열, 서열목록 제13서열의 아미노산 서열 또는 서열목록 제14서열의 아미노산 서열을 포함한다.
본 발명의 항체는 다양한 HER2-발현의 암 세포에 대하여 우수한 살상능 또는 증식 억제능을 갖는다. 본 명세서에서, 암 세포를 언급하면서 사용되는 용어 “살상” 또는 “증식 억제”는 동일한 의미로 혼용된다.
본 명세서에서, 용어 “항체(antibody)”는 HER2에 대한 특이 항체로서, 완전한 항체 형태뿐만 아니라 항체 분자의 항원 결합 단편을 포함한다.
완전한 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다. 중쇄 불변 영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 및 엡실론(ε) 타입을 가지고 서브클래스로 감마1(γ1), 감마2(γ2), 감마3(γ3), 감마4(γ4), 알파1(α1) 및 알파2(α2)를 가진다. 경쇄의 불변영역은 카파(κ) 및 람다(λ) 타입을 가진다 (Cellular and Molecular Immunology, Wonsiewicz, M. J., Ed., Chapter 45, pp. 41-50, W. B. Saunders Co. Philadelphia, PA(1991); Nisonoff, A., Introduction to Molecular Immunology, 2nd Ed., Chapter 4,pp. 45-65, sinauer Associates, Inc., Sunderland, MA (1984)).
본 명세서에서, 용어 “항원 결합 단편”은 항원 결합 기능을 보유하고 있는 단편을 의미하며, Fab, F(ab'), F(ab')2 및 Fv 등을 포함한다. 항체 단편 중 Fab는 경쇄 및 중쇄의 가변영역과 경쇄의 불변 영역 및 중쇄의 첫 번째 불변 영역(CH1)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C-말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 다이설파이드 결합을 이루면서 생성된다. Fv는 중쇄 가변부위 및 경쇄 가변부위만을 가지고 있는 최소의 항체조각으로 Fv 단편을 생성하는 재조합 기술은 PCT 국제 공개특허출원 WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086 및 WO 88/09344에 개시되어 있다. 이중쇄 Fv(two-chain Fv)는 비공유 결합으로 중쇄 가변부위와 경쇄 가변부위가 연결되어 있고 단쇄 Fv(single-chain Fv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변 영역과 단쇄의 가변 영역이 공유 결합으로 연결되거나 또는 C-말단에서 바로 연결되어 있어서 이중쇄 Fv와 같이 다이머와 같은 구조를 이룰 수 있다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻을 수 있고(예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다), 또는 유전자 재조합 기술을 통하여 제작할 수 있다.
본 발명에서 항체는 바람직하게는 Fab 형태이거나 완전한 항체 형태이다. 또한, 중쇄 불변 영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 또는 엡실론(ε) 중의 어느 한 이소타입으로부터 선택될 수 있다. 바람직하게는, 불변영역은 감마1(IgG1), 감마 3(IgG3) 및 감마 4(IgG4)이고, 가장 바람직하게는 감마 1(IgG1) 이소타입이다. 경쇄 불변 영역은 카파 또는 람다 형일 수 있으며, 바람직하게는 카파형이다. 따라서, 본 발명의 바람직한 항체는 카파(κ) 경쇄와 감마1(γ1) 중쇄를 가지는 Fab 형태 또는 IgG1 형태이다.
본 명세서에서, 용어“중쇄”는 항원에 특이성을 부여하기 위한 충분한 가변 영역 서열을 갖는 아미노산 서열을 포함하는 가변 영역 도메인 VH 및 3 개의 불변 영역 도메인 CH1, CH2 및 CH3를 포함하는 전체길이 중쇄 및 이의 단편을 모두 의미한다. 또한 본 명세서에서 용어“경쇄”는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변 영역 도메인 VL 및 불변 영역 도메인 CL을 포함하는 전체길이 경쇄 및 이의 단편을 모두 의미한다.
본 명세서에서, 용어 “CDR(complementarity determining region)”은 면역글로블린 중쇄 및 경쇄의 고가변 영역(hypervariable region)의 아미노산 서열을 의미한다(Kabat et al., Sequences of Proteins of Immunological Interest, 4th Ed., U.S. Department of Health and Human Services, National Institutes of Health (1987)). 중쇄(CDRH1, CDRH2 및 CDRH3) 및 경쇄(CDRL1, CDRL2 및 CDRL3)에는 각각 3개의 CDRs이 포함되어 있다. CDR은 항체가 항원 또는 에피토프에 결합하는 데 있어서 주요한 접촉 잔기를 제공한다.
본 발명의 항체는 단일클론 항체, 다특이적 항체, 인간 항체, 인간화 항체, 키메라 항체, 단쇄 Fvs(scFV), 단쇄 항체, Fab 단편, F(ab')단편, 다이설파이드-결합 Fvs(sdFV) 및 항-이디오타입(항-Id) 항체, 그리고 상기 항체들의 에피토프-결합 단편 등을 포함하나, 이에 한정되는 것은 아니다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상술한 본 발명의 HER2에 대한 항체 또는 그의 항원 결합 단편을 코딩하는 핵산 분자를 제공한다.
본 명세서에서 용어 "핵산 분자“는 DNA(gDNA 및 cDNA) 그리고 RNA 분자를 포괄적으로 포함하는 의미를 갖으며, 핵산 분자에서 기본 구성 단위인 뉴클레오타이드는 자연의 뉴클레오타이드뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다(Scheit, Nucleotide Analogs, John Wiley, New York(1980); Uhlman 및 Peyman, Chemical Reviews, 90:543-584(1990)).
본 발명의 다른 양태에 따르면, 본 발명은 상술한 본 발명의 핵산 분자를 포함하는 재조합 벡터를 제공한다.
본 명세서에서 용어 “벡터”는 숙주 세포에서 목적 유전자를 발현시키기 위한 수단으로 플라스미드 벡터; 코즈미드 벡터; 그리고 박테리오파아지 벡터, 아데노바이러스 벡터, 레트로바이러스 벡터 및 아데노-연관 바이러스 벡터 같은 바이러스 벡터 등을 포함된다.
본 발명의 바람직한 구현예에 따르면, 본 발명의 벡터에서 경쇄 가변영역을 코딩하는 핵산 분자 및 중쇄 가변영역을 코딩하는 핵산 분자는 프로모터와 작동적으로 결합(operatively linked)되어 있다.
본 명세서에서, 용어 “작동적으로 결합된”은 핵산 발현 조절 서열(예: 프로모터, 시그널 서열, 또는 전사조절인자 결합 위치의 어레이)과 다른 핵산 서열사이의 기능적인 결합을 의미하며, 이에 의해 상기 조절 서열은 상기 다른 핵산 서열의 전사 및/또는 해독을 조절하게 된다.
본 발명의 재조합 벡터 시스템은 당업계에 공지된 다양한 방법을 통해 구축될 수 있으며, 이에 대한 구체적인 방법은 Sambrook et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press(2001)에 개시되어 있으며, 이 문헌은 본 명세서에 참조로서 삽입된다.
본 발명의 벡터는 전형적으로 클로닝을 위한 벡터 또는 발현을 위한 벡터로서 구축될 수 있다. 또한, 본 발명의 벡터는 원핵 세포 또는 진핵 세포를 숙주로 하여 구축될 수 있다.
예를 들어, 본 발명의 벡터가 발현 벡터이고, 진핵 세포를 숙주로 하는 경우에는, 포유동물 세포의 지놈으로부터 유래된 프로모터(예: 메탈로티오닌 프로모터, β-액틴 프로모터, 사람 헤로글로빈 프로모터 및 사람 근육 크레아틴 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터(예: 아데노바이러스 후기 프로모터, 백시니아 바이러스 7.5K 프로모터, SV40 프로모터, 사이토메갈로바이러스 프로모터, HSV의 tk 프로모터, 마우스 유방 종양 바이러스(MMTV) 프로모터, HIV의 LTR 프로모터, 몰로니 바이러스,의 프로모터 엡스타인 바 바이러스(EBV)의 프로모터 및 로우스 사코마 바이러스(RSV)의 프로모터)가 이용될 수 있으며, 전사 종결 서열로서 폴리아데닐화 서열을 일반적으로 갖는다.
본 발명의 벡터는 그로부터 발현되는 항체의 정제를 용이하게 하기 위하여, 다른 서열과 융합될 수도 있다. 융합되는 서열은 예컨대, 글루타티온 S-트랜스퍼라제(Pharmacia, USA), 말토스 결합 단백질(NEB, USA), FLAG(IBI, USA) 및 6x His(hexahistidine; Quiagen, USA) 등이 있다.
또한, 본 발명의 벡터에 의해 발현되는 단백질이 항체이기 때문에, 정제를 위한 추가적인 서열 없이도, 발현된 항체는 단백질 A 컬럼 등을 통하여 용이하게 정제할 수 있다.
한편, 본 발명의 발현 벡터는 선택표지로서, 당업계에서 통상적으로 이용되는 항생제 내성 유전자를 포함하며, 예를 들어 암피실린, 겐타마이신, 카베니실린, 클로람페니콜, 스트렙토마이신, 카나마이신, 제네티신, 네오마이신 및 테트라사이클린에 대한 내성 유전자가 있다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상기 재조합 벡터로 형질전환 된 숙주세포를 제공한다.
본 발명의 벡터를 안정되면서 연속적으로 클로닝 및 발현시킬 수 있는 숙주 세포는 당업계에 공지되어 어떠한 숙주 세포도 이용할 수 있으며, 예컨대, 상기 벡터의 적합한 진핵세포 숙주 세포는 원숭이 신장 세포7(COS7: monkey kidney cells), NSO 세포, SP2/0, 차이니즈 햄스터 난소(CHO: Chinese hamster ovary) 세포, W138, 어린 햄스터 신장(BHK: baby hamster kidney) 세포, MDCK, 골수종 세포주, HuT 78 세포 및 HEK-293 세포를 포함하나 이에 한정되지 않는다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상술한 (a) 본 발명의 HER2 항체 또는 그의 항원 결합 단편의 약제학적 유효량; 및 (b) 약제학적으로 허용되는 담체를 포함하는 암 예방 또는 치료용 약제학적 조성물을 제공한다.
또한, 본 발명의 또 다른 양태에 다르면, 본 발명은 상술한 본 발명의 HER2에 대한 항체 또는 그의 항원 결합 단편; 및 1 내지 200 mM의 히스티딘을 포함하는 히스티딘-완충액을 포함하는 암 예방 또는 치료용 약제학적 조성물을 제공한다.
본 발명의 일 구현예에 따르면, 상기 히스티딘-완충액에 포함된 히스티딘의 농도는 1 내지 200 mM 일 수 있고, 보다 구체적으로는 1 내지 150 mM, 1 내지 100 mM, 1 내지 50 mM, 1 내지 40 mM, 1 내지 30 mM, 1 내지 20 mM일 수 있으며, 가장 구체적으로는 10 mM일 수 있다.
또한, 본 발명의 다른 구현예에 따르면, 상기 히스티딘-완충액의 pH는 5 내지 7일 수 있고, 보다 구체적으로는 5 내지 6.5, 5.5 내지 6.5일 수 있으며, 가장 구체적으로는 6일 수 있다.
또한, 본 발명의 또 다른 구현예에 따르면, 상기 히스티딘-완충액은 50-300 mM의 염화나트륨(sodium chloride)을 포함할 수 있고, 보다 구체적으로는 10-200 mM, 50-200 mM, 100-200 mM일 수 있으며, 가장 구체적으로는 150 mM일 수 있다.
본 발명의 일 실시예에 따르면, 본 발명의 HER2 항체 또는 그의 항원 결합 단편은 상기한 상기 히스티딘-완충액에서 보관되는 경우에 PBS 완충액에서 보관되는 경우와 비교하여 가혹조건에서도 월등히 우수한 안정성을 나타낸다. 따라서, 본 발명의 히스티딘-완충액을 포함하는 암 예방 또는 치료용 약제학적 조성물은 본 발명의 HER2 항체 또는 그의 항원 결합 단편을 유효성분으로 포함하는 약제학적 조성물의 안정성 향상에 탁월한 효과가 있다.
본 발명의 약제학적 조성물은 상술한 본 발명의 HER2 항체 또는 그의 항원 결합 단편을 유효성분으로 이용하기 때문에, 이 둘 사이에 공통된 내용은 반복 기재에 의해 본 명세서의 과도한 복잡성을 피하기 위하여, 그 기재를 생략한다.
하기의 실시예에서 입증된 바와 같이, 본 발명의 HER2 항체는 트라스투주맙과 병용 투여하는 경우, 암 세포(특히, 유방암 세포, 보다 구체적으로 HER2-발현 유방암 세포)를 크게 개선된 세포살상능으로 살상시킬 수 있어, 암(특히, 유방암, 보다 구체적으로 HER2-발현 유방암)의 치료에 매우 유효하다. 본 발명의 일 구현예에 따르면, 약제학적 조성물은 트라스투주맙 항체를 추가적으로 포함한다.
본 발명의 조성물에 의해 예방 또는 치료될 수 있는 암은 당업계에 공지된 다양한 암을 포함하며, 예를 들어 유방암, 난소암, 위암, 폐암, 간암, 기관지암, 비인두암, 후두암, 췌장암, 방광암, 대장암, 결장암, 자궁경부암, 뇌암, 전립선암, 골암, 두경부암, 피부암, 갑상선암, 부갑상선암 또는 요관암을 포함한다.
구체적으로, 본 발명의 조성물에 의해 예방 또는 치료될 수 있는 암은 HER2-발현 암이고, 보다 구체적으로 HER2-발현 유방암이다.
본 발명의 약제학적 조성물에 포함되는 약제학적으로 허용되는 담체는 제제시에 통상적으로 이용되는 것으로서, 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산 칼슘, 알기네이트, 젤라틴, 규산 칼슘, 미세결정성 셀룰로스, 폴리비닐피롤리돈, 셀룰로스, 물, 시럽, 메틸 셀룰로스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘 및 미네랄 오일 등을 포함하나, 이에 한정되는 것은 아니다. 본 발명의 약제학적 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등을 추가로 포함할 수 있다. 적합한 약제학적으로 허용되는 담체 및 제제는 Remington's Pharmaceutical Sciences (19th ed., 1995)에 상세히 기재되어 있다.
본 발명의 약제학적 조성물은 비경구로 투여할 수 있고, 예컨대 정맥내 주입, 피하 주입, 근육 주입, 복강 주입, 국소 투여, 비내 투여, 폐내 투여 및 직장내 투여 등으로 투여할 수 있다.
본 발명의 약제학적 조성물의 적합한 투여량은 제제화 방법, 투여 방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 다양하며, 보통으로 숙련된 의사는 소망하는 치료 또는 예방에 효과적인 투여량을 용이하게 결정 및 처방할 수 있다. 본 발명의 바람직한 구현예에 따르면, 본 발명의 약제학적 조성물의 1일 투여량은 0.0001-100 ㎎/㎏이다. 본 명세서에서 용어 “약제학적 유효량”은 암의 예방 또는 치료하는 데 충분한 양을 의미한다.
본 발명의 약제학적 조성물은 당해 발명이 속하는 기술분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있는 방법에 따라, 약제학적으로 허용되는 담체 및/또는 부형제를 이용하여 제제화 함으로써 단위 용량 형태로 제조되거나 또는 다용량 용기 내에 내입시켜 제조될 수 있다. 이때 제형은 오일 또는 수성 매질중의 용액, 현탁액 또는 유화액 형태이거나 엑스제, 산제, 좌제, 분말제, 과립제, 정제 또는 캅셀제 형태일 수도 있으며, 분산제 또는 안정화제를 추가적으로 포함할 수 있다.
본 발명의 일 구현예에 따르면, 본 발명의 약제학적 조성물은 트라스투주맙 항체를 추가적으로 포함한다. 본 명세서에서, 용어 “트라스투주맙(trastuzumab)”은 미국 특허 제5,821,337호에 개시된 항체를 의미한다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상술한 본 발명의 HER2에 대한 항체 또는 그의 항원 결합 단편을 유효성분으로 포함하는 약제학적 조성물을 대상체(subject)에 투여하는 단계를 포함하는 암의 예방 또는 치료방법을 제공한다.
본 명세서에서 사용된 용어, "투여" 또는 "투여하다"는 본 발명의 조성물의 치료적 유효량을 상기 조성물을 필요로 하는 대상체(개체)에 직접적으로 투여함으로써 대상체의 체내에서 동일한 양이 형성되도록 하는 것을 말한다.
조성물의 "치료적 유효량"은 조성물을 투여하고자 하는 대상체에게 치료적 또는 예방적 효과를 제공하기에 충분한 조성물의 함량을 의미하며, 이에 "예방적 유효량"을 포함하는 의미이다. 또한, 본 명세서에서 사용된 용어, "대상체"는 제한 없이 인간, 마우스, 랫트, 기니아 피그, 개, 고양이, 말, 소, 돼지, 원숭이, 침팬지, 비비 또는 붉은털 원숭이를 포함한다. 구체적으로는, 본 발명의 대상체는 인간이다.
본 발명의 상기 암의 예방 또는 치료방법은, 본 발명의 일 양태인 암의 예방 또는 치료용 약제학적 조성물을 투여하는 단계를 포함하는 방법이므로, 중복되는 내용에 대해서는 본 명세서 기재의 과도한 복잡성을 피하기 위해 생략하도록 한다.
본 발명의 상술한 HER2에 대한 항체 또는 그의 항원 결합 단편은 진단, 예컨대 암을 진단하는 데 이용될 수 있다.
따라서, 본 발명의 또 다른 양태에 따르면, 본 발명은 상술한 본 발명의 HER2에 대한 항체 또는 그의 항원 결합 단편을 포함하는 암 진단용 키트를 제공한다.
본 발명의 진단 키트는 상술한 본 발명의 HER2 항체 또는 그의 항원 결합 단편을 포함하며, 본 발명의 약제학적 조성물과 동일한 질환을 진단하는바, 이 둘 사이에 공통된 내용은 반복 기재에 의한 본 명세서의 과도한 복잡성을 피하기 위하여, 그 기재를 생략한다.
상술한 키트는 항체를 포함하기 때문에, 기본적으로 다양한 면역분석(immunoassay) 또는 면역염색(immunostaining)에 적합하게 제작될 수 있다. 상기 면역분석 또는 면역염색은 방사능면역분석, 방사능면역침전, 면역침전, ELISA(enzyme-linked immunosorbent assay), 캡처-ELISA, 억제 또는 경쟁 분석, 샌드위치 분석, 유세포 분석(flow cytometry), 면역형광염색 및 면역친화성 정제를 포함하지만, 이에 한정되는 것은 아니다. 상기 면역분석 또는 면역염색의 방법은 Enzyme Immunoassay, E. T. Maggio, ed., CRC Press, Boca Raton, Florida, 1980; Gaastra, W., Enzyme-linked immunosorbent assay(ELISA), in Methods in Molecular Biology, Vol. 1, Walker, J.M. ed., Humana Press, NJ, 1984; 및 Ed Harlow and David Lane, Using Antibodies:A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1999에 기재되어 있으며, 상기 문헌은 본 명세서에 참조로서 삽입된다.
예를 들어, 본 발명의 방법이 방사능면역분석 방법에 따라 실시되는 경우, 방사능동위원소(예컨대, C14, I125, P32 및 S35)로 레이블링된 항체가 HER2 단백질을 검출하는 데 이용될 수 있다. 본 발명이 ELISA 방식으로 실시되는 경우, 본 발명의 특정 실시예는 (i) 분석하고자 하는 시료를 고체 기질의 표면에 코팅하는 단계; (ii) 일차항체로서의 HER2 항체와 상기 시료를 반응시키는 단계; (iii) 상기 단계 (ii)의 결과물을 효소가 결합된 이차항체와 반응시키는 단계; 및 (iv) 상기 효소의 활성을 측정하는 단계를 포함한다.
상기 고체 기질로 적합한 것은 탄화수소 폴리머(예컨대, 폴리스틸렌 및 폴리프로필렌), 유리, 금속 또는 젤이며, 가장 구체적으로는 마이크로타이터 플레이트이다.
상기 이차항체에 결합된 효소는 발색반응, 형광반응, 발광반응 또는 적외선 반응을 촉매하는 효소를 포함하나, 이에 한정되지 않으며, 예를 들어, 알칼린 포스파타아제, β-갈락토시다아제, 호스 래디쉬 퍼옥시다아제, 루시퍼라아제 및 사이토크롬 P450을 포함한다. 상기 이차항체에 결합하는 효소로서 알칼린 포스파타아제가 이용되는 경우에는, 기질로서 브로모클로로인돌일 포스페이트(BCIP), 니트로 블루 테트라졸리움(NBT), 나프톨-AS-B1-포스페이트(naphthol-AS-B1-phosphate) 및 ECF(enhanced chemifluorescence)와 같은 발색반응 기질이 이용되고, 호스 래디쉬 퍼옥시다아제가 이용되는 경우에는 클로로나프톨, 아미노에틸카바졸, 디아미노벤지딘, D-루시페린, 루시게닌(비스-N-메틸아크리디늄 니트레이트), 레소루핀 벤질 에테르, 루미놀, 암플렉스 레드 시약(10-아세틸-3,7-디하이드록시페녹사진), HYR(p-phenylenediamine-HCl and pyrocatechol), TMB(tetramethylbenzidine), ABTS(2,2-Azine-di[3-ethylbenzthiazoline sulfonate]), o-페닐렌디아민(OPD) 및 나프톨/파이로닌, 글루코스 옥시다아제와 t-NBT(nitroblue tetrazolium) 및 m-PMS(phenzaine methosulfate)과 같은 기질이 이용될 수 있다.
본 발명이 캡처-ELISA 방식으로 실시되는 경우, 본 발명의 특정 실시예는 (i) 포획항체(capturing antibody)로서 HERR2 항체를 고체 기질의 표면에 코팅하는 단계; (ii) 포획항체와 시료를 반응시키는 단계; (iii) 상기 단계 (ii)의 결과물을 시그널을 발생시키는 레이블이 결합되어 있는 HER2 검출항체(detecting antibody)와 반응시키는 단계; 및 (iv) 상기 레이블로부터 발생하는 시그널을 측정하는 단계를 포함한다.
상기 검출 항체는 검출 가능한 시그널을 발생시키는 레이블을 가지고 있다. 상기 레이블은 화학물질(예컨대, 바이오틴), 효소(알칼린 포스파타아제, β-갈락토시다아제, 호스 래디쉬 퍼옥시다아제 및 사이토크롬 P450), 방사능물질(예컨대, C14, I125, P32 및 S35), 형광물질(예컨대, 플루오레신), 발광물질, 화학발광물질( chemiluminescent) 및 FRET(fluorescence resonance energy transfer)을 포함하나, 이에 한정되는 것은 아니다. 다양한 레이블 및 레이블링 방법은 Ed Harlow and David Lane, Using Antibodies:A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1999에 기재되어 있다.
상기 ELISA 방법 및 캡처-ELISA 방법에서 최종적인 효소의 활성 측정 또는 시그널의 측정은 당업계에 공지된 다양한 방법에 따라 실시될 수 있다. 만일, 레이블로서 바이오틴이 이용된 경우에는 스트렙타비딘으로, 루시퍼라아제가 이용된 경우에는 루시페린으로 시그널을 용이하게 검출할 수 있다.
본 발명의 키트에 적용될 수 있는 시료는 세포, 조직 또는 조직-유래 추출물, 파쇄물(lysate) 또는 정제물, 혈액, 혈장, 혈청, 림프 또는 복수를 포함하나, 이에 한정되지 않는다.
본 발명의 항체는 인 비보 또는 인 비트로 이미징에 이용될 수 있다. 본 발명의 다른 양태에 따르면, 본 발명은 상술한 본 발명의 항체 및 상기 항체에 결합된 검출 가능한 신호를 발생시키는 레이블이 결합된 결합체를 포함하는 이미지용 조성물을 제공한다.
상기 검출 가능한 신호를 발생시키는 레이블은 T1 조영물질(예컨대, Gd 킬레이트 화합물), T2 조영물질(예컨대, 초상자성 물질(예: 마그네타이트, Fe3O4,γ-Fe2O3, 망간 페라이트, 코발트 페라이트 및 니켈 페라이트)), 방사성 동위 원소(예컨대, 11C, 15O, 13N, P32, S35, 44Sc, 45Ti, 118I, 136La, 198Tl, 200Tl, 205Bi 및 206Bi), 형광물질(플루오리신 (fluorescein), 피코에리트린 (phycoerythrin), 로다민, 리사민 (lissamine), 그리고 Cy3와 Cy5), 화학발광단, 자기입자, 매스 표지 또는 전자밀집입자를 포함하나 이에 제한되는 것은 아니다.
본 발명의 특징 및 이점을 요약하면 다음과 같다:
(a) 본 발명은 모항체의 특정 부위 아미노산 잔기를 치환하여, 항체의 안정성을 향상시켜 의약적합성(druggability)을 개선한 발명이다.
(b) 본 발명의 변이체 항체는 모항체인 hz1E11과 비교하여, 생산성과 효능이 거의 동일하면서 안정성이 크게 향상되어 있다.
(c) 따라서, 본 발명의 변이체 항체는, HER2-특이적 항체 개발에 있어서, 생산 비용 절감, 효능 감소 억제 및 부작용 감소 등의 우수한 특성을 나타낸다.
도 1은 안정성이 향상된 항체가 HER2가 속한 ErbB 패밀리 단백질(HER1, HER2, HER3 및 HER4) 중 HER2에 특이적으로 결합하는지 여부를 분석한 ELISA 결과이다. hz15E3, 트라스투주맙, AMG-888(참조: Li C. et al., Discov Med. 2013 Sep;16(87):79-92)이 대조군 항체로 이용되었다. 그래프에서, Anti-HER2 Ab는 트라스투주맙, Anti-EGFR Ab는 hz15E3, Anti-HER3 Ab는 AMG-888를 나타낸다. 한편, 2nd only는 음성대조군을 나타낸다.
도 2는 개발된 항체와 트라스투주맙을 NCI-N87 세포에 단독처리 시에 세포사멸이 일어난 암 세포의 비율을 분석한 결과이다. 그래프에서, hIgG는 인간 IgG로 음성대조군을 나타내고, TRA는 트라스투주맙을 나타낸다.
도 3은 개발된 항체와 트라스투주맙을 NCI-N87 세포에 병용처리 시에 세포사멸이 일어난 암 세포의 비율을 분석한 결과이다. 그래프에서, hIgG는 인간 IgG로 음성대조군을 나타내고, TRA는 트라스투주맙을 나타낸다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예
실시예 1: 안정성 향상을 위한 항체의 변형
개발된 항체인 hz1E11(참조: 대한민국 특허 제1453462호)의 안정성을 향상시키기 위하여, 다양한 위치의 아미노산 잔기들이 항체의 안정성에 어떠한 영향을 미치는지를 분석하였다. 분석결과를 통하여 안정성에 영향을 미칠 수 있는 부위로 중쇄 및 경쇄 사슬의 가변부위 네 곳의 아미노산이 확인되었다. 모항체인 hz1E11의 중쇄 및 경쇄사슬 가변부위 아미노산 서열은 표 1과 같으며, 중쇄 사슬의 부위 중 Kabat 넘버링에 따라 52a, 53에 해당하는 Asn(N) 및 Gly(G)과 경쇄 사슬 부위 중 56, 57에 해당하는 Asp(D) 및 Gly(G)을 오버랩핑 PCR을 이용하여 Ala(A)으로 변형시켰다.
중쇄 및 경쇄 사슬의 가변부위와 불변영역 부분을 증폭한 후에 이를 연결하여 클로닝하였다. 증폭에 사용된 프라이머는 표 2와 같으며, 상술한 프라이머 및 GoTaq DNA 중합효소(Promega, Cat. No. M3005)를 이용하여 95℃에서 30초, 57℃에서 30초, 72℃에서 60초의 PCR 반응을 30회 반복하였다. 증폭된 가변영역과 불변영역의 각 PCR 산물들을 1% 아가로스 젤에서 전기영동 후 Qiaquick gel 추출 키트(QIAGEN, Cat. No. 28706)을 이용하여 정제하였다. 가변영역과 불변영역을 연결하기 위하여 가변영역의 PCR 산물과 불변영역의 PCR 산물을 동량 혼합한 다음, 가변영역의 정방향 프라이머 및 불변영역의 역방향 프라이머를 이용하여 중첩 연장 PCR(overlap extension PCR)을 수행하여 유전자 산물을 제조하고, 상기와 동일한 방법으로 정제하였다. 상기 중첩 연장 PCR은 GoTaq DNA 중합효소(Promega, Cat. No. M3005)를 이용하여 94℃에서 30초, 57℃에서 30초, 72℃에서 120초의 반응을 30회 반복하여 실시하였다.
각각의 부위가 안정성에 미치는 영향을 확인하기 위하여, 단독으로 변형된 항체와 두 곳의 아미노산 서열을 변형시킨 항체까지 총 8종의 항체를 확보하였다(표 3).
모항체(hz1E11) 아미노산 서열
중쇄 사슬의 가변 부위 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYTMSWVRQAPGKGLEWVAYIS NGGGSTY YPDTVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARHLGGTASFDYWGQGTLVTVSS
경쇄 사슬의 가변 부위 DIQMTQSPSSLSASVGDRVTITCLASQTIGTWLAWYQQKPGKAPKLLIYVATSLA DG VPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQNAYAPWTFGQGTKVEIK
가변영역 증폭을 위한 프라이머
프라이머명 서열
F_N52aA GTAGCCTACATCTCCGCCGGGGGCGGAAGTAC
R_N52aA GTACTTCCGCCCCCGGCGGAGATGTAGGCTAC
F_G53A CTACATCTCCAACGCCGGCGGAAGTACGTA
R_G53A TACGTACTTCCGCCGGCGTTGGAGATGTAG
F_D56A GCAACGAGTCTCGCTGCCGGTGTGCCTTCCAGA
R_D56A TCTGGAAGGCACACCGGCAGCGAGACTCGTTGC
F_G57A CGAGTCTCGCTGACGCCGTGCCTTCCAGATTT
R_G57A AAATCTGGAAGGCACGGCGTCAGCGAGACTCG
　- 　항체 변이 위치
변이된 항체 hz1E11.10 중쇄 N52aA
hz1E11.20 중쇄 G53A
hz1E11.01 경쇄 D56A
hz1E11.02 경쇄 G57A
hz1E11.11 중쇄 N52aA/경쇄 D56A
hz1E11.12 중쇄 N52aA/경쇄 G57A
hz1E11.21 중쇄 G53A/경쇄 D56A
hz1E11.22 중쇄 G53A/경쇄 G57A
　모항체 hz1E11 -
실시예 2: 변형된 항체의 생산성 확인
안정성을 향상시키기 위한 변형이 모항체인 hz1E11의 생산성에 영향을 미치는지를 확인하기 위하여 생산성 분석을 수행하였다. 실시예 1의 변이된 항체의 클로닝 벡터를 대한민국 특허 제1453462호에 개시된 방법에 따라 제작하였다. FreeStyleTM 293F(Invitrogen, Cat. No. R790-07) 동물세포에 폴리에틸렌이민(Polyscience Inc., Cat. No. 23966)을 이용하여 상기 클로닝된 벡터를 일시 형질전환(transient transfection)시키고, 세포 배양액으로부터 Protein-A Ceramic HyperD F 레진(PALL, Cat No. 20078-028)을 이용하여 변형된 항체를 정제하였다. 정제된 항체는 UV분석을 이용하여 정량하고 SDS-PAGE 후 쿠마시 블루 염색을 통하여 농도 및 순도를 확인하였다. 생산성 분석에 따르면, 중쇄 사슬만 단독으로 변형시킨 hz1E11.10과 hz1E11.20은 모항체인 hz1E11보다 생산성이 더 좋아진 것을 확인할 수 있었다. 하지만 경쇄 사슬만을 단독으로 변형시킨 hz1E11.01과 hz1E11.02는 오히려 생산성이 나빠지는 것을 확인하였다. 경쇄 사슬과 중쇄 사슬을 동시에 변형시킨 항체는 모항체인 hz1E11의 생산성보다 조금 낮은 수준의 생산성을 보인다는 사실이 표 4에 나타나 있다.
　항체 배양 볼륨(ml) 생산양(㎍) 수율(mg/L)
hz1E11.10 30 1.414 47.1
hz1E11.20 30 1.264 42.1
hz1E11.01 30 0.784 26.1
hz1E11.02 30 0.750 25.0
hz1E11.11 30 0.857 28.6
hz1E11.12 30 0.783 26.1
hz1E11.21 30 0.640 21.3
hz1E11.22 30 0.845 28.2
hz1E11 30 0.992 33.1
실시예 3: HER2에 대한 항체 개발
안정성이 향상된 HER2에 대한 항체가 표적인 HER2에 결합하는지 유무를 확인하기 위한 방법으로는 ELISA 방법을 이용하였다. ELISA를 진행하기 위하여, ERBB 패밀리 단백질의 세포 외부 도메인(extracellular domain, ECD) 부위를 동물세포를 이용하여 생산한 후 항원으로 사용하였다. ECD의 C-말단에 인간 IgG1의 힌지 및 Fc 부위(CH2-CH3)가 결합된 형태의 DNA를 pCEP4 벡터(Invitrogen, Cat. No. V044-50)에 HindIII와 BamHI 제한효소를 이용하여 클로닝하였다. 이어, FreeStyleTM 293F(Invitrogen, Cat. No. R790-07) 세포에 폴리에틸렌이민(Polyscience Inc., Cat. No. 23966)을 이용하여 상기 클로닝된 벡터를 일시 형질전환(transient transfection)시키고, 세포 배양액으로부터 EGFR-ECF Fc,HER2-ECD Fc, HER3-ECD Fc 융합 단백질을 Protein-A Ceramic HyperD F 레진(PALL, Cat No. 20078-028)을 이용하여 정제하였다. 정제된 단백질을 Protein assay dye(Bio-Rad, Cat. No. 500-0006)를 이용하여 정량하고 SDS-PAGE 후 쿠마시 블루 염색을 통하여 농도 및 순도를 확인하였다.
EGFR-ECF-Fc, HER2-ECD-Fc, HER3-ECD-Fc 혹은 ChromPure human IgG(hIgG, Jackson Immunoresearch Lab. Inc., Cat. No. 009-000-003)를 1 ㎍/mL의 농도로 Costar 96-웰 플레이트(Corning, Cat. No. 3590)에 상온에서 1시간동안 고착시켰다. TBS-T(0.05% Triton X-100)로 3회 세척 후 300 ㎕의 TBS-T/SM(2% skim milk)로 상온에서 30분 동안 블록킹하였다. 블록킹된 플레이트를 3회 세척 후 안정성이 향상된 HER2 항체를 넣고 37℃에서 1시간동안 항체를 결합시켰다. 3회 세척 후 2차 항체로 항 마우스 IgG-HRP(Pierce, Cat. No. 31439)을 TBS-T/SM에 1:5,000으로 희석하여 넣고 37℃에서 1시간동안 항체를 결합시켰다. 3회 세척 후 TMB(SurModics, Cat. No. TMBC-1000-01)를 넣고 상온에서 5분간 발색하였으며, 1 N 황산(sulfuric acid, DukSan, Cat. No. 254)을 추가하여 발색을 정지시켰다. 450 nm에서 흡광도를 Victor X3(PerkinElmer, Cat. No. 2030-0030)를 이용하여 측정하고 HER2-ECD-Fc에 특이적으로 결합하지 확인하였다. ELISA가 정상적으로 수행되었는지 확인하기 위한 대조군으로 EGFR에 결합하는 anti-EGFR Ab(hz15E3), anti-HER2 Ab(트라스투주맙), anti-HER3 Ab(AMG-888)을 사용하였다. 안정성 향상을 위하여 변형된 8종의 항체는 HER2에만 특이적으로 결합하는 것을 확인하였다(도1).
실시예 4: 개발된 항체들의 세포 성장 억제 효능 비교
안정성 향상을 위해 변형된 항체들의 세포 증식 억제 효능을 확인하기 위한 세포 생존율 분석(cell viability assay)을 수행하였다.
세포 생존능 분석은 HER2가 과발현되는 대표적인 위암 세포주인 NCI-N87 세포를 대상으로 단독 혹은 트라스투주맙과 병용처리하여 진행되었다. 병용처리의 경우 개발된 항체와 트라스투주맙을 1:1 비율(중량비)로 혼합하여 사용하였다. 96-웰 플레이트에 NCI-N87(ATCC, Cat No. CRL-5822, 10,000 cells/well)을 80 ㎕ 부피로 96-웰 플레이트에 분주하여 24시간동안 배양하며 고착시켰다. 다음날 항체 40㎕를 상기 배양 중인 세포에 첨가하였다. 처리한 항체의 최종 농도는 각각의 항체 당 최대 20 ㎍/mL이고 1:4로 순차적으로 희석하여 9개 농도에서 진행하였다. 트라스투주맙과 병용처리의 경우에는 개발된 항체와 트라스투주맙을 1:1 비율로 하였다(예를 들어, 도 3에서, 투여량이 1 ㎍/mL인 경우 TRA 1 ㎍/mL 및 개발된 항체 1 ㎍/mL을 투여한 것이다). 항체 처리 후 NCI-N87 세포를 4일동안 추가 배양한 후 CCK-8을 최종 10%가 되도록 첨가하고 37℃에서 3시간동안 처리하였다. 이후 Victor X-3를 이용하여 450 nm에서 흡광도를 측정하였다. 항체를 처리하지 않은 세포의 흡광도를 100%로 설정하고 상대적인 생존율을 계산하였다(도 2 및 도 3).
안정성이 향상된 8종의 HER2 항체는 트라스투주맙에 반응하는 NCI-N87 세포주에 대하여 증식 억제 효능을 보였다. 더욱이, 개발된 항체는 모항체인 hz1E11과 마찬가지로 트라스투주맙과의 병용처리 시 트라스투주맙 단독에 비하여 NCI-N87 세포주에 대하여 암세포 증식 억제 효능이 우수하였다(도 2 및 도 3).
실시예 5: 모항체 및 개발된 항체들의 보관 완충액에 따른 안정성 비교
본 발명자들은 개발된 변이 항체들의 안정성을 확인하기 위하여, CHO세포로부터 수득한 모항체 hz1E11과 변이 항체인 hz1E11.10, hz1E11.11에 대하여 가속/가혹 테스트(accelerated test, Stress test)를 수행하였다.
상기 각각의 항체들은 PBS 완충액(137 mM Sodium chloride, 2.7 mM potassium chloride, 4.3 mM sodium phosphate, 1.4 mM potassium, pH 7.4), 또는 히스티딘 완충액(10 mM Histidine, 150 mM Sodium chloride, pH 6.0)에 완충액 별로 보관하였다. 상기 각 완충액에 보관되어 있는 각각의 항체들을 HPLC용 바이알(Agilent, Cat No.5188-6591)에 200 μL씩 분주하여 블루 스크류 캡(Agilent, Cat No.5182-0717)으로 뚜껑을 닫아 샘플을 준비하였다.
크기 배제 크로마토그래피(Size exclusion chromatography, SEC) 샘플은 1 mg/mL의 농도로 준비하고, 양이온-교환 크로마토그래피(cation-exchange chromatography, CEX) 샘플은 10 mg/mL의 농도로 준비하였다.
상기 준비한 샘플들을 각각 항온항습장(제이오텍, Cat No. TH-DG-150)과 냉장고(제이오텍, Cat No. CLG-150S)를 이용하여 4±3℃, 25±3℃ (습도 60±5%), 40±3℃(습도 75±5%)의 온/습도 조건에서 보관하며, 보관 시점으로부터 0주, 4주에 각 샘플들의 안정성을 분석하였다. 샘플에 대한 분석은 Agilent 1260 infinity HPLC장비를 사용하였으며 크기 배제 크로마토그래피(size-exclusion chromatography)로는 단량체의 비율을 확인하여 조건에 따른 안정성을 확인하였고, 양이온-교환 크로마토그래피(cation-exchange chromatography)로는 주성분(main peak)의 비율을 확인하여 안정성을 확인하였다.
구체적으로, 단량체 비율 분석을 위해 각 항체 단백질 50 μL를 100 mM sodium phosphate (pH 6.8)(Monobasic, Fluka, Cat No.17844; Dibasic, Fluka, Cat No71633)용액 이동상 조건하에서 TSK-gel G3000SWXL (7.8 X 300 mm) HPLC 칼럼(TOSOH, Part No.8541)에 주입한 후, 0.8 mL/min의 속도로 20분간 흘려주면서 UV280 nm에서 단백질 피크를 검출하였다. 단백질의 응집체는 칼럼으로부터 주 피크보다 앞서 용출되며, 응집체의 피크 면적과 주 피크의 면적을 비교하여 단량체의 순도를 계산하였다.
주성분(Main peak) 비율의 분석을 위해 단백질을 10 mM sodium phosphate(pH7.0)(Monobasic, Fluka, Cat No.17844; Dibasic, Fluka, Cat No.71633) 버퍼로 1 mg/mL로 희석하여 20 μL를 Bio Mab (NP10, PK, 4.6 x 250 mm) HPLC 칼럼(Agilent, Cat No. 5190-2415)에 주입한 후, 1 mL/min의 속도로 10 mM sodium phosphate(pH 7.0)(Monobasic, Fluka, Cat No.17844; Dibasic, Fluka, Cat No.71633), 1M Sodium chloride(GENERAY, Cat No.0241) 버퍼를 0~10% 농도구배(gradient)로 40분간 흘려주면서 UV 280 nm에서 단백질 피크를 검출하였다.
PBS 조성의 완충액에서의 크기 배제 크로마토그래피와 양이온-교환 크로마토그래피를 통한 항체의 안정성 분석 결과는 표 5 및 표 6에 나타내었다.
또한, 히스티딘 조성의 완충액에서의 크기 배제 크로마토그래피와 양이온-교환 크로마토그래피를 통한 항체의 안정성 분석 결과는 표 7 및 표 8에 나타내었다.
항체 온도 0 주(monomer;%) 4 주(monomer;%) 12 주(monomer;%)
hz1E11 (PBS) 4℃ 97.8 99.0 98.2
25℃ 98.6 97.8
40℃ 96.7 95.4
hz1E11.10 (PBS) 4℃ 99.0 99.4 98.7
25℃ 98.4 98.5
40℃ 97.7 96.7
hz1E11.11 (PBS) 4℃ 98.5 99.4 98.2
25℃ 98.0 97.6
40℃ 96.9 95.0
항체 온도 0 주(main peak;%) 4 주(main peak;%) 12 주(main peak;%)
hz1E11 (PBS) 4℃ 62.8 60.3 62.9
25℃ 45.3 29.9
40℃ 4.8 0.0
hz1E11.10 (PBS) 4℃ 77.4 80.4 66.9
25℃ 63.0 42.6
40℃ 38.5 0.0
hz1E11.11 (PBS) 4℃ 88.1 75.7 74.0
25℃ 58.5 48.3
40℃ 27.0 0.0
항체 온도 0 주(monomer;%) 4 주(monomer;%) 12 주(monomer;%)
hz1E11 (His) 4℃ 98.0 99.2 98.1
25℃ 99.0 98.3
40℃ 97.3 97.0
hz1E11.10 (His) 4℃ 99.3 99.7 99.0
25℃ 98.4 99.3
40℃ 98.2 98.2
hz1E11.11 (His) 4℃ 99.0 100.0 98.6
25℃ 98.1 98.7
40℃ 98.0 97.9
항체 온도 0 주(main peak;%) 4 주(main peak;%) 12 주(main peak;%)
hz1E11 (His) 4℃ 61.5 61.5 56.0
25℃ 61.3 56.2
40℃ 52.8 29.3
hz1E11.10 (His) 4℃ 78.8 70.7 81.7
25℃ 69.1 69.2
40℃ 62.0 46.6
hz1E11.11 (His) 4℃ 72.2 76.9 76.4
25℃ 69.1 69.0
40℃ 65.1 49.1
SEC분석 결과 3종의 모든 항체가 95% 이상의 단량체를 가지는 것으로 확인이 되었으며, CEX 분석 결과 모항체인 hz1E11 보다 본 발명의 변이 항체인 hz1E11.10과 hz1E11.11의 주성분 함량이 높은 것으로 확인이 되었다. 특히 히스티딘 조성의 완충액의 경우, PBS 조성의 완충액과 비교하여 이것으로 변이항체들이 모항체보다 향상된 안정을 보이는 것으로 확인이 되었다.
이상으로 본 발명의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적인 기술은 단지 바람직한 구현 예일 뿐이며, 이에 본 발명의 범위가 제한되는 것이 아닌 점은 명백하다. 따라서 본 발명의 실질적인 범위는 첨부된 청구항과 그의 등가물에 의하여 정의된다고 할 것이다.

Claims (27)

  1. (a) (i) 서열목록 제1서열의 CDR(complementarity determining region)H1, (ii) 서열목록 제2서열의 CDRH2 및 (iii) 서열목록 제3서열의 CDRH3을 포함하는 중쇄 가변영역; 상기 서열목록 제2서열에서 4번째 아미노산 잔기 및 5번째 아미노산 잔기 중 최소 하나는 다른 아미노산으로 치환 변이된 것이고;
    (b) 서열목록 제4서열의 CDRL1, 서열목록 제5서열의 CDRL2 및 서열목록 제6서열의 CDRL3을 포함하는 경쇄 가변영역을 포함하는 개선된 안정성을 나타내는 HER2(Human EpidermalGrowth Factor Receptor 2)에 대한 항체 또는 그의 항원 결합 단편.
  2. 제 1 항에 있어서, 상기 서열목록 제2서열에서 4번째 아미노산 잔기는 Ala, Gly, Cys, Ile, Leu, Met, Phe, Trp 또는 Val으로 치환된 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  3. 제 2 항에 있어서, 상기 서열목록 제2서열에서 4번째 아미노산 잔기는 Ala, Gly, Ile, Leu 또는 Val으로 치환된 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  4. 제 3 항에 있어서, 상기 서열목록 제2서열에서 4번째 아미노산 잔기는 Ala 또는 Gly으로 치환된 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  5. 제 1 항에 있어서, 상기 서열목록 제2서열에서 5번째 아미노산 잔기는 Ala, Cys, Ile, Leu, Met, Phe, Trp 또는 Val으로 치환된 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  6. 제 5 항에 있어서, 상기 서열목록 제2서열에서 5번째 아미노산 잔기는 Ala, Ile, Leu 또는 Val으로 치환된 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  7. 제 6 항에 있어서, 상기 서열목록 제2서열에서 5번째 아미노산 잔기는 Ala 또는 Val으로 치환된 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  8. 제 1 항에 있어서, 상기 치환 변이된 서열목록 제2서열의 CDRH2는 서열목록 제9서열의 아미노산 서열, 서열목록 제10서열의 아미노산 서열 또는 서열목록 제11서열의 아미노산 서열을 포함하는 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  9. 제 1 항에 있어서, 상기 경쇄 가변영역은 서열목록 제12서열, 서열목록 제13서열 또는 서열목록 제14서열의 아미노산 서열을 포함하는 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  10. (a) (i) 서열목록 제1서열의 CDR(complementarity determining region)H1, (ii) 서열목록 제2서열의 CDRH2 및 (iii) 서열목록 제3서열의 아미노산 서열의 CDRH3을 포함하는 중쇄 가변영역; 및
    (b) 서열목록 제8서열을 포함하는 경쇄 가변영역을 포함하며, 상기 서열목록 제8서열의 56번째 아미노산 잔기 및 57번째 아미노산 잔기 중 최소 하나가 다른 아미노산으로 치환 변이된 것을 특징으로 하는, 개선된 안정성을 나타내는 HER2(Human EpidermalGrowth Factor Receptor 2)에 대한 항체 또는 그의 항원 결합 단편.
  11. 제 10 항에 있어서, 상기 서열목록 제8서열의 56번째 아미노산 잔기는 Ala, Gly, Cys, Ile, Leu, Met, Phe, Trp 또는 Val으로 치환된 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  12. 제 11 항에 있어서, 상기 서열목록 제8서열의 56번째 아미노산 잔기는 Ala, Gly, Ile, Leu 또는 Val으로 치환된 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  13. 제 12 항에 있어서, 상기 서열목록 제8서열의 56번째 아미노산 잔기는 Ala 또는 Gly으로 치환된 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  14. 제 10 항에 있어서, 상기 서열목록 제8서열의 57번째 아미노산 잔기는 Ala, Cys, Ile, Leu, Met, Phe, Trp 또는 Val으로 치환된 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  15. 제 14 항에 있어서, 상기 서열목록 제8서열의 57번째 아미노산 잔기는 Ala, Ile, Leu 또는 Val으로 치환된 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  16. 제 15 항에 있어서, 상기 서열목록 제8서열의 57번째 아미노산 잔기는 Ala 또는 Val으로 치환된 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  17. 제 10 항에 있어서, 상기 경쇄 가변병역은 서열목록 제12서열의 아미노산 서열, 서열목록 제13서열의 아미노산 서열 또는 서열목록 제14서열의 아미노산 서열을 포함하는 것을 특징으로 하는 항체 또는 그의 항원 결합 단편.
  18. 제 1 항 내지 제 17 항 중 어느 한 항의 HER2에 대한 항체 또는 그의 항원 결합 단편을 코딩하는 핵산 분자.
  19. 제 18 항의 핵산 분자를 포함하는 재조합 벡터.
  20. 제 19 항의 재조합 벡터로 형질전환 된 숙주세포.
  21. (a) 제 1 항 내지 제 17 항 중 어느 한 항의 HER2에 대한 항체 또는 그의 항원 결합 단편의 약제학적 유효량; 및 (b) 약제학적으로 허용되는 담체를 포함하는 암 예방 또는 치료용 약제학적 조성물.
  22. 제 21 항에 있어서, 상기 약제학적 조성물은 트라스투주맙 항체를 추가적으로 포함하는 것을 특징으로 하는 조성물.
  23. 제 1 항 내지 제 17 항 중 어느 한 항의 HER2에 대한 항체 또는 그의 항원 결합 단편을 포함하는 암 진단용 키트.
  24. 제 1 항 내지 제 17 항 중 어느 한 항의 HER2에 대한 항체 또는 그의 항원 결합 단편; 및 1 내지 200 mM의 히스티딘을 포함하는 히스티딘-완충액을 포함하는 암 예방 또는 치료용 약제학적 조성물.
  25. 제 24 항에 있어서, 상기 히스티딘-완충액의 pH는 5 내지 7인 것을 특징으로 하는 암 예방 또는 치료용 약제학적 조성물.
  26. 제 25 항에 있어서, 상기 히스티딘-완충액은 50-300 mM의 염화 나트륨을 포함하는 것을 특징으로 하는 암 예방 또는 치료용 약제학적 조성물.
  27. 제 1 항 내지 제 17 항 중 어느 한 항의 HER2에 대한 항체 또는 그의 항원 결합 단편을 유효성분으로 포함하는 약제학적 조성물을 대상체(subject)에 투여하는 단계를 포함하는 암의 예방 또는 치료방법.
PCT/KR2017/003827 2016-04-12 2017-04-12 안정성이 개선된 ｈｅｒ２에 특이적으로 결합하는 항체 WO2017179862A1 (ko)

Priority Applications (7)

Application Number Priority Date Filing Date Title
US16/093,486 US11248059B2 (en) 2016-04-12 2017-04-12 Antibody having improved stability and specifically binding to HER2
CA3020825A CA3020825C (en) 2016-04-12 2017-04-12 Antibodies specifically binding to her2
CN201780023274.4A CN109071672B (zh) 2016-04-12 2017-04-12 稳定性改善的特异性地结合在人表皮生长因子受体2的抗体
JP2018554349A JP6713059B2 (ja) 2016-04-12 2017-04-12 安定性が改善されたｈｅｒ２に特異的に結合する抗体
EP17782617.9A EP3444279B1 (en) 2016-04-12 2017-04-12 Antibody having improved stability and specifically binding to her2
ES17782617T ES2955743T3 (es) 2016-04-12 2017-04-12 Anticuerpo con estabilidad mejorada y que se une específicamente a HER2
AU2017251298A AU2017251298B2 (en) 2016-04-12 2017-04-12 Antibody having improved stability and specifically binding to HER2

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20160044747 2016-04-12
KR10-2016-0044747 2016-04-12

Publications (1)

Publication Number Publication Date
WO2017179862A1 true WO2017179862A1 (ko) 2017-10-19

Family

ID=60042607

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2017/003827 WO2017179862A1 (ko) 2016-04-12 2017-04-12 안정성이 개선된 ｈｅｒ２에 특이적으로 결합하는 항체

Country Status (9)

Country Link
US (1) US11248059B2 (ko)
EP (1) EP3444279B1 (ko)
JP (1) JP6713059B2 (ko)
KR (1) KR101796277B1 (ko)
CN (1) CN109071672B (ko)
AU (1) AU2017251298B2 (ko)
CA (1) CA3020825C (ko)
ES (1) ES2955743T3 (ko)
WO (1) WO2017179862A1 (ko)

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20230071864A (ko) 2021-11-15 2023-05-24 앱클론(주) Cd137에 특이적으로 결합하는 어피바디 및 이의 용도
CN117224689B (zh) * 2023-11-16 2024-02-23 上海复宏汉霖生物技术股份有限公司 联合抗her2抗体和化疗剂治疗胃癌的用途

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20030074634A (ko) * 2000-11-30 2003-09-19 메다렉스, 인코포레이티드 인간 항체의 제조를 위한 형질전환 트랜스염색체 설치류
US20100047230A1 (en) * 2005-02-21 2010-02-25 Hellenic Pasteur Institute Anti her2/neu antibody
US8609095B2 (en) * 2010-03-04 2013-12-17 Symphogen A/S Anti-HER2 antibodies and compositions
KR101453462B1 (ko) * 2013-05-16 2014-10-23 앱클론(주) Her2에 특이적으로 결합하는 항체
WO2015074528A1 (zh) * 2013-11-19 2015-05-28 烟台荣昌生物工程有限公司 抗her2抗体及其缀合物

Family Cites Families (7)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP1400536A1 (en) 1991-06-14 2004-03-24 Genentech Inc. Method for making humanized antibodies
EP1392360B1 (en) * 2001-06-01 2011-11-30 Cornell Research Foundation, Inc. Modified antibodies to prostate-specific membrane antigen and uses thereof
EP3263596A1 (en) * 2002-12-16 2018-01-03 Genentech, Inc. Immunoglobulin variants and uses thereof
CA2517074A1 (en) * 2003-02-27 2004-09-10 Yeda Research And Development Co., Ltd. Nucleic acid molecules, polypeptides, antibodies and compositions containing same useful for treating and detecting influenza virus infection
WO2008031531A1 (en) 2006-09-15 2008-03-20 F. Hoffmann-La Roche Ag Tumor therapy with a combination of anti-her2 antibodies
WO2010047509A2 (ko) 2008-10-24 2010-04-29 아주대학교 산학협력단 친화도와 안정성이 향상된 항 ｄｒ5 항체, 및 이를 포함하는 암 예방 또는 치료용 조성물
CN104311662B (zh) * 2013-03-08 2017-06-23 上海赛伦生物技术股份有限公司 一种稳定性高的人源抗vegf抗体及其应用

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20030074634A (ko) * 2000-11-30 2003-09-19 메다렉스, 인코포레이티드 인간 항체의 제조를 위한 형질전환 트랜스염색체 설치류
US20100047230A1 (en) * 2005-02-21 2010-02-25 Hellenic Pasteur Institute Anti her2/neu antibody
US8609095B2 (en) * 2010-03-04 2013-12-17 Symphogen A/S Anti-HER2 antibodies and compositions
KR101453462B1 (ko) * 2013-05-16 2014-10-23 앱클론(주) Her2에 특이적으로 결합하는 항체
WO2015074528A1 (zh) * 2013-11-19 2015-05-28 烟台荣昌生物工程有限公司 抗her2抗体及其缀合物

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
See also references of EP3444279A4 *

Also Published As

Publication number Publication date
US11248059B2 (en) 2022-02-15
CA3020825A1 (en) 2017-10-19
ES2955743T3 (es) 2023-12-05
CN109071672A (zh) 2018-12-21
KR101796277B1 (ko) 2017-11-13
EP3444279C0 (en) 2023-07-26
JP6713059B2 (ja) 2020-06-24
AU2017251298A1 (en) 2018-11-29
JP2019521644A (ja) 2019-08-08
KR20170117330A (ko) 2017-10-23
US20190153118A1 (en) 2019-05-23
EP3444279A1 (en) 2019-02-20
CN109071672B (zh) 2021-11-19
CA3020825C (en) 2022-01-25
EP3444279B1 (en) 2023-07-26
EP3444279A4 (en) 2019-04-24
AU2017251298B2 (en) 2020-04-16

Similar Documents

Publication Publication Date Title
WO2019098682A1 (ko) 항-her2 항체 또는 그의 항원 결합 단편, 및 이를 포함하는 키메라 항원 수용체
WO2020076105A1 (ko) 신규 항-c-kit 항체
KR101748707B1 (ko) ｃ-Ｍｅｔ에 특이적으로 결합하는 항체 및 그를 이용한 암 진단용 키트
WO2020111913A1 (en) Anti-4-1bb antibody and use thereof
KR101541927B1 (ko) 인간 사이토메갈로바이러스 중화 항체 및 이의 용도
WO2013051878A2 (en) Antibody specifically binding to epitope in sema domain of c-met
WO2021091359A1 (ko) 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체
WO2017179862A1 (ko) 안정성이 개선된 ｈｅｒ２에 특이적으로 결합하는 항체
WO2017074013A1 (ko) 인간 및 마우스 sema3a에 교차결합하는 항체 및 그의 용도
JP2023521362A (ja) Ｃｄ７３免疫チェックポイントを抑制するためのモノクローナル抗体及びその抗原結合断片並びにその使用
WO2020116963A1 (ko) 엔도텔린 수용체 a 활성 조절 항체
WO2016084993A1 (ko) 신규 EGFRvIII 항체 및 이를 포함하는 조성물
WO2022216014A1 (ko) 항-cntn4 항체 및 그의 용도
WO2022154288A1 (ko) 단백질 키나아제 a의 촉매 서브 유닛 알파에 특이적으로 결합하는 단일클론항체 및 이를 활용한 암 진단 용도
WO2022025585A1 (ko) 항-lilrb1 항체 및 그의 용도
WO2020242200A1 (ko) 엔도텔린 수용체 a 결합력이 향상된 항체
WO2017142294A1 (ko) EGFRvIII에 대한 항체 및 이의 용도
JP2022550121A (ja) Ｌｉｆに特異的な結合分子及びその使用
WO2023101438A1 (ko) Smo 인간 항체
WO2023027534A1 (ko) 신규 항 muc1항체 및 이의 용도
WO2018182266A1 (ko) 항-emap ii 항체 및 이의 용도
WO2022098173A1 (ko) 코로나바이러스 스파이크 단백질에 특이적인 항체 및 이의 용도
WO2019035630A2 (ko) 인간 상피 성장 인자 수용체 변이체 ⅲ에 결합하는 항체 및 그의 항체 단편
WO2022092644A1 (ko) Wars 중화항체 및 이의 용도
WO2024014619A1 (ko) 사스-코로나 바이러스 2 중화 항체

Legal Events

Date Code Title Description
ENP Entry into the national phase

Ref document number: 2018554349

Country of ref document: JP

Kind code of ref document: A

Ref document number: 3020825

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2017782617

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2017782617

Country of ref document: EP

Effective date: 20181112

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17782617

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2017251298

Country of ref document: AU

Date of ref document: 20170412

Kind code of ref document: A