WO2024014619A1 - 사스-코로나 바이러스 2 중화 항체 - Google Patents

사스-코로나 바이러스 2 중화 항체 Download PDF

Info

Publication number
WO2024014619A1
WO2024014619A1 PCT/KR2022/014794 KR2022014794W WO2024014619A1 WO 2024014619 A1 WO2024014619 A1 WO 2024014619A1 KR 2022014794 W KR2022014794 W KR 2022014794W WO 2024014619 A1 WO2024014619 A1 WO 2024014619A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
heavy chain
light chain
antibody
antigen
Prior art date
Application number
PCT/KR2022/014794
Other languages
English (en)
French (fr)
Inventor
이성진
고해리
이득기
김영현
이해천
Original Assignee
(재) 스크립스코리아항체연구원
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by (재) 스크립스코리아항체연구원 filed Critical (재) 스크립스코리아항체연구원
Publication of WO2024014619A1 publication Critical patent/WO2024014619A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/08—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses
    • C07K16/10—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from viruses from RNA viruses
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
    • G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
    • G01N33/56983—Viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
    • G01N2333/08—RNA viruses
    • G01N2333/165—Coronaviridae, e.g. avian infectious bronchitis virus

Definitions

  • the present invention relates to a neutralizing antibody or antigen-binding fragment thereof against SARS-coronavirus 2 or a mutant virus thereof.
  • COVID-19 or SARS-CoV2
  • SARS-CoV2 continues to mutate (alpha, beta, gamma, delta, omicron, etc.) from the form that initially occurred in Wuhan, China, and as of 2022, BA, a new mutation of omicron with further enhanced transmissibility.
  • mutate alpha, beta, gamma, delta, omicron, etc.
  • BA.2.12.1, BA.4, and BA.5 have occurred and are threatening civilization.
  • the present inventors made diligent efforts to develop antibodies with inhibitory efficacy against various coronavirus variants, including delta mutations, omicron mutations, etc. As a result of the above efforts, 16 antibody candidates with similar CDR sequences were selected, and it was confirmed that some of these antibodies showed excellent neutralizing efficacy not only against delta mutations but also against omicron mutations, thereby completing the present invention.
  • the purpose of the present invention is to provide a neutralizing antibody or antigen-binding fragment thereof against SARS-CoV2 or its mutant virus.
  • Another object of the present invention is to provide a nucleic acid molecule encoding the antibody or antigen-binding fragment thereof.
  • Another object of the present invention is to provide a vector containing the above nucleic acid molecule.
  • Another object of the present invention is to provide cells containing the vector.
  • Another object of the present invention is to treat SARS-coronavirus 2 (SARS) comprising the antibody or antigen-binding fragment thereof, a nucleic acid molecule encoding the antibody or antigen-binding fragment thereof, or a vector containing the nucleic acid molecule as an active ingredient.
  • SARS SARS-coronavirus 2
  • the aim is to provide a pharmaceutical composition for preventing or treating viral infection -CoV2) or its mutant virus.
  • Another object of the present invention is the step of administering to a subject a pharmaceutically effective amount of the antibody or antigen-binding fragment thereof, a nucleic acid molecule encoding the antibody or antigen-binding fragment thereof, or a vector containing the nucleic acid molecule.
  • the purpose is to provide a method of preventing or treating SARS-CoV2 or its variant virus infection.
  • Another object of the present invention is to provide a therapeutic use (for use in therapy) of the antibody or antigen-binding fragment thereof, a nucleic acid molecule encoding the antibody or antigen-binding fragment thereof, or a vector containing the nucleic acid molecule. .
  • Another object of the present invention is to treat SARS-coronavirus 2 (SARS) comprising the antibody or antigen-binding fragment thereof, a nucleic acid molecule encoding the antibody or antigen-binding fragment thereof, or a vector containing the nucleic acid molecule as an active ingredient.
  • SARS-coronavirus 2 SARS-coronavirus 2
  • -CoV2 SARS-coronavirus 2
  • -CoV2 SARS-coronavirus 2
  • the present invention is a neutralizing antibody or antigen-binding fragment thereof against SARS-CoV2 or a mutant virus thereof,
  • the antibody or antigen-binding fragment thereof comprises light chain CDR1, CDR2 and CDR3 and heavy chain CDR1, CDR2 and CDR3,
  • the light chain CDR1 has the following general formula 1; Light chain CDR2 has the following general formula 2; Light chain CDR3 has the following general formula 3; Heavy chain CDR1 has the following general formula 4; Heavy chain CDR2 has the following general formula 5; and the heavy chain CDR3 is represented by an amino acid sequence of Formula 6, Formula 7, or Formula 8 below:
  • X 41 is N, D or G; X 42 is A, S, Y or D.);
  • X 51 is W, A, G, E, V, M or L;
  • X 52 is Y or S;
  • X 53 is S, H, Y or P;
  • X 54 is N, is D, S, H or G;
  • X 55 is D, S, G or N;
  • X 56 is G or S;
  • X 57 is N or S; 59 does not exist or is T.);
  • X 81 is R or K
  • X 82 is P, D, Y, F, N, S or G
  • X 83 is K, F, G, Q, D, L, H, is P, A or T
  • X 84 is T, G, N, W, P or F
  • X 85 is S, P, T, D, V, G or W).
  • antibody refers to a protein molecule that acts as a receptor that specifically recognizes an antigen, including immunoglobulin molecules that are immunologically reactive with a specific antigen, and includes polyclonal antibodies and monoclonal antibodies. Includes all.
  • Antibodies include antigen-binding fragments of antibody molecules (antibody fragments) as well as full-length antibody forms.
  • a complete antibody has a structure of two full-length light chains and two full-length heavy chains, with each light chain connected to the heavy chain by a disulfide bond.
  • the heavy chain constant region has gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ), and epsilon ( ⁇ ) types and is subclassed as gamma1 ( ⁇ 1), gamma2 ( ⁇ 2), and gamma3 ( ⁇ 3). ), gamma 4 ( ⁇ 4), alpha 1 ( ⁇ 1), and alpha 2 ( ⁇ 2).
  • the constant region of the light chain has kappa ( ⁇ ) and lambda ( ⁇ ) types.
  • antigen-binding fragment of an antibody refers to a fragment that specifically recognizes an antigen and possesses an antigen-antibody binding function within the entire antibody molecule, and includes single-domain antibodies (sdAb) and single-chain antibodies (scFv). ), Fab, F(ab'), F(ab')2, and Fv.
  • fragments include a monovalent fragment consisting of VL, VH, C ⁇ (or CL) and CH1 domains (Fab fragment); a bivalent fragment comprising two Fab fragments connected by a disulfide bridge in the hinge region (F(ab')2 fragment); Fd fragment consisting of VH and CH1 domains; an Fv fragment consisting of the VL and VH domains of one arm of the antibody and a disulfide-linked Fv (sdFv); dAb fragment consisting of VH domain; and separate complementarity determining regions (CDRs) or combinations of two or more separate CDRs that may be optionally joined by a linker.
  • CDRs complementarity determining regions
  • the scFv can be connected by a linker so that the VL and VH regions are paired to form a single protein chain to form a monovalent molecule.
  • Such single chain antibodies are also included in antibody fragments.
  • the antibody or antibody fragment may include a tetramer antibody comprising two heavy chain molecules and two light chain molecules; antibody light chain monomer; antibody heavy chain monomer; Antibody light chain dimer, antibody heavy chain dimer; intrabody; monovalent antibody; camel antibody; and single-domain antibodies (sdAb).
  • Fv is a minimal antibody fragment containing only the heavy chain variable region and the light chain variable region.
  • the recombinant technology for generating the Fv fragment is described in PCT International Publication Patent Applications WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086 and It is disclosed in WO 88/09344.
  • Double-chain Fv two-chain Fv
  • single-chain Fv single-chain Fv (single-chain Fv) is generally shared between the heavy chain variable region and the short chain variable region through a peptide linker.
  • Fab can be obtained by restriction digestion of the entire antibody with papain
  • F(ab')2 fragment can be obtained by digestion with pepsin
  • gene It can also be produced through recombinant technology.
  • the term “heavy chain” refers to a full-length heavy chain and fragments thereof comprising a variable region domain VH and three constant region domains CH1, CH2, and CH3, including an amino acid sequence having sufficient variable region sequence to confer specificity to an antigen. means all.
  • the term “light chain” herein refers to a full-length light chain and fragments thereof comprising a variable region domain VL and a constant region domain C ⁇ (or CL) containing an amino acid sequence having a sufficient variable region sequence to confer specificity to an antigen. It all means.
  • CDR complementarity determining region
  • the heavy chain (HCDR1, HCDR2, and HCDR3) and light chain (LCDR1, LCDR2, and LCDR3) each contain three CDRs, which provide key contact residues for the antibody to bind to the antigen or epitope.
  • the CDRs are interspersed in more conserved regions named framework regions (FR).
  • FR framework regions
  • antibodies or antibody fragments of the present invention includes variants with conservative amino acid substitutions in the CDR regions.
  • additional changes can be made to the amino acid sequence of the antibody to further improve its half-life, biocompatibility, and other biological properties in addition to its binding affinity.
  • the antibody of the present invention or the nucleic acid molecule encoding it is interpreted to also include sequences showing substantial identity with the sequences described in the sequence listing. The above substantial identity is at least 60% when aligning the sequence of the present invention and any other sequence to correspond as much as possible and analyzing the aligned sequence using an algorithm commonly used in the art.
  • Homology refers to a sequence showing 70% homology, according to another specific example, 80% homology, and according to another specific example, 90% homology.
  • Alignment methods for sequence comparison are known in the art. Various methods and algorithms for alignment are discussed in Smith and Waterman, Adv. Appl. Math . (1981) 2:482 Needleman and Wunsch, J. Mol. Bio . (1970) 48:443; Pearson and Lipman, Methods in Mol. Biol . (1988) 24: 307-31; Higgins and Sharp, Gene (1988) 73:237-44; Higgins and Sharp, CABIOS (1989) 5:151-3; Corpet et al . Nuc. Acids Res . (1988) 16:10881-90; Huang et al . Comp. Appl. BioScience . (1992) 8:155-65 and Pearson et al . Meth. Mol. Biol . (1994) 24:307-31.
  • Coronaviruses are generally known to be the cause of cold symptoms in birds and mammals.
  • Severe Acute Respiratory Syndrome (SARS) and Middle East Respiratory Syndrome (MERS) were prevalent due to coronaviruses, and recently, they have been receiving attention again due to COVID-19 (novel coronavirus) that occurred in Wuhan, China.
  • SARS-CoV 2 The virus that causes COVID-19 is SARS-CoV 2, a variant of the coronavirus. Unlike existing coronaviruses, SARS-CoV 2 has a mutation in the 'spike', an external device for contacting respiratory epithelial cells.
  • the mutated virus includes various mutated viruses such as alpha, beta, gamma, delta, omicron, lambda, mu, etc., which are currently in the past, have become prevalent, or are likely to become prevalent in the future, and are preferably delta-mutated or omicron-mutated viruses. However, it is not limited to this.
  • the mutant virus is an omicron mutant virus.
  • X 14 and X 15 are S or T.
  • the heavy chain CDR1 of the antibody or antigen-binding fragment thereof is such that X 42 is A, Y or D.
  • the heavy chain CDR2 of the antibody or antigen-binding fragment thereof is such that X 51 is G or L; X 53 is H, Y or P; X 54 is N or G; X 55 is S, G or N; X 58 is K, T or N.
  • the heavy chain CDR3 of the antibody or antigen-binding fragment thereof is represented by the amino acid sequence of General Formula 7, where X 702 is D; X 703 is P or A, X 704 is F or W; X 705 is P or T; X 706 is G or L; X 707 is R or H; X 709 is S or F; X 710 is either N or S.
  • the heavy chain CDR3 of the antibody or antigen-binding fragment thereof is represented by the amino acid sequence of General Formula 8, where X 81 is K; X 82 is Y; X 83 is Q; X 84 is W; X 85 is D.
  • the antibody or antigen-binding fragment thereof includes light chain CDR1, CDR2 and CDR3 and heavy chain CDR1, CDR2 and CDR3, and is represented by the following amino acid sequence:
  • the light chain CDR1 is SEQ ID NO: 9
  • the light chain CDR2 is SEQ ID NO: 20
  • the light chain CDR3 is SEQ ID NO: 28
  • the heavy chain CDR1 is SEQ ID NO: 41
  • the heavy chain CDR2 is SEQ ID NO: 48
  • the heavy chain CDR3 is SEQ ID NO: 64;
  • the light chain CDR1 is SEQ ID NO: 10
  • the light chain CDR2 is SEQ ID NO: 21
  • the light chain CDR3 is SEQ ID NO: 29
  • the heavy chain CDR1 is SEQ ID NO: 42
  • the heavy chain CDR2 is SEQ ID NO: 49
  • the heavy chain CDR3 is SEQ ID NO: 65;
  • the light chain CDR1 is SEQ ID NO: 11
  • the light chain CDR2 is SEQ ID NO: 22
  • the light chain CDR3 is SEQ ID NO: 30
  • the heavy chain CDR1 is SEQ ID NO: 41
  • the heavy chain CDR2 is SEQ ID NO: 50
  • the heavy chain CDR3 is SEQ ID NO: 66;
  • the light chain CDR1 is SEQ ID NO: 11
  • the light chain CDR2 is SEQ ID NO: 22
  • the light chain CDR3 is SEQ ID NO: 30
  • the heavy chain CDR1 is SEQ ID NO: 41
  • the heavy chain CDR2 is SEQ ID NO: 51
  • the heavy chain CDR3 is SEQ ID NO: 67;
  • the light chain CDR1 is SEQ ID NO: 12
  • the light chain CDR2 is SEQ ID NO: 23
  • the light chain CDR3 is SEQ ID NO: 31
  • the heavy chain CDR1 is SEQ ID NO: 43
  • the heavy chain CDR2 is SEQ ID NO: 52
  • the heavy chain CDR3 is SEQ ID NO: 68;
  • the light chain CDR1 is SEQ ID NO: 13
  • the light chain CDR2 is SEQ ID NO: 24
  • the light chain CDR3 is SEQ ID NO: 32
  • the heavy chain CDR1 is SEQ ID NO: 43
  • the heavy chain CDR2 is SEQ ID NO: 53
  • the heavy chain CDR3 is SEQ ID NO: 69;
  • the light chain CDR1 is SEQ ID NO: 14
  • the light chain CDR2 is SEQ ID NO: 24
  • the light chain CDR3 is SEQ ID NO: 33
  • the heavy chain CDR1 is SEQ ID NO: 42
  • the heavy chain CDR2 is SEQ ID NO: 54
  • the heavy chain CDR3 is SEQ ID NO: 70;
  • the light chain CDR1 is SEQ ID NO: 11
  • the light chain CDR2 is SEQ ID NO: 22
  • the light chain CDR3 is SEQ ID NO: 34
  • the heavy chain CDR1 is SEQ ID NO: 41
  • the heavy chain CDR2 is SEQ ID NO: 55
  • the heavy chain CDR3 is SEQ ID NO: 71;
  • the light chain CDR1 is SEQ ID NO: 11
  • the light chain CDR2 is SEQ ID NO: 22
  • the light chain CDR3 is SEQ ID NO: 35
  • the heavy chain CDR1 is SEQ ID NO: 44
  • the heavy chain CDR2 is SEQ ID NO: 56
  • the heavy chain CDR3 is SEQ ID NO: 72;
  • the light chain CDR1 is SEQ ID NO: 15, the light chain CDR2 is SEQ ID NO: 25, the light chain CDR3 is SEQ ID NO: 36, the heavy chain CDR1 is SEQ ID NO: 45, the heavy chain CDR2 is SEQ ID NO: 57, and the heavy chain CDR3 is SEQ ID NO: 73;
  • the light chain CDR1 is SEQ ID NO: 11
  • the light chain CDR2 is SEQ ID NO: 22
  • the light chain CDR3 is SEQ ID NO: 30
  • the heavy chain CDR1 is SEQ ID NO: 42
  • the heavy chain CDR2 is SEQ ID NO: 58
  • the heavy chain CDR3 is SEQ ID NO: 74;
  • the light chain CDR1 is SEQ ID NO: 16
  • the light chain CDR2 is SEQ ID NO: 24
  • the light chain CDR3 is SEQ ID NO: 37
  • the heavy chain CDR1 is SEQ ID NO: 41
  • the heavy chain CDR2 is SEQ ID NO: 59
  • the heavy chain CDR3 is SEQ ID NO: 75;
  • the light chain CDR1 is SEQ ID NO: 11
  • the light chain CDR2 is SEQ ID NO: 22
  • the light chain CDR3 is SEQ ID NO: 30
  • the heavy chain CDR1 is SEQ ID NO: 46
  • the heavy chain CDR2 is SEQ ID NO: 60
  • the heavy chain CDR3 is SEQ ID NO: 76;
  • the light chain CDR1 is SEQ ID NO: 17, the light chain CDR2 is SEQ ID NO: 26, the light chain CDR3 is SEQ ID NO: 38, the heavy chain CDR1 is SEQ ID NO: 46, the heavy chain CDR2 is SEQ ID NO: 61, and the heavy chain CDR3 is SEQ ID NO: 77;
  • the light chain CDR1 is SEQ ID NO: 18, the light chain CDR2 is SEQ ID NO: 27, the light chain CDR3 is SEQ ID NO: 39, the heavy chain CDR1 is SEQ ID NO: 47, the heavy chain CDR2 is SEQ ID NO: 62, and the heavy chain CDR3 is SEQ ID NO: 78; or
  • the light chain CDR1 is SEQ ID NO: 19
  • the light chain CDR2 is SEQ ID NO: 23
  • the light chain CDR3 is SEQ ID NO: 40
  • the heavy chain CDR1 is SEQ ID NO: 41
  • the heavy chain CDR2 is SEQ ID NO: 63
  • the heavy chain CDR3 is SEQ ID NO: 79.
  • the antibody or antigen-binding fragment thereof of the invention may comprise light chains FR1, FR2, FR3 and FR4 and/or heavy chains FR1, FR2, FR3 and FR4.
  • the light chain FR1 is SEQ ID NO: 1
  • the light chain FR2 is SEQ ID NO: 2
  • the light chain FR3 is SEQ ID NO: 3
  • the light chain FR4 is SEQ ID NO: 4
  • the heavy chain FR1 is SEQ ID NO: 5
  • the heavy chain FR2 is SEQ ID NO: Number 6
  • heavy chain FR3 may be represented by the amino acid sequence of SEQ ID NO: 7
  • heavy chain FR4 may be represented by the amino acid sequence of SEQ ID NO: 8.
  • the present invention provides a nucleic acid molecule encoding the antibody or antigen-binding fragment thereof.
  • nucleic acid molecule is meant to comprehensively include DNA (gDNA and cDNA) and RNA molecules, and nucleotides, which are the basic structural units in nucleic acid molecules, include not only natural nucleotides but also analogs with modified sugar or base sites. (analogue) is also included (Scheit, Nucleotide Analogs, John Wiley, New York (1980); Uhlman and Peyman, Chemical Reviews, (1990) 90:543-584).
  • sequences of nucleic acid molecules encoding the heavy and light chain variable regions of the present invention may be modified. The modifications include additions, deletions, or non-conservative or conservative substitutions of nucleotides.
  • the nucleic acid molecule of the present invention is interpreted to also include a nucleotide sequence showing substantial identity to the above-mentioned nucleotide sequence.
  • the above substantial identity is at least 80% when the nucleotide sequence of the present invention and any other sequence are aligned to correspond as much as possible, and the aligned sequence is analyzed using an algorithm commonly used in the art.
  • Homology in one specific example, means a nucleotide sequence showing at least 90% homology, and in another specific example, at least 95% homology.
  • the present invention provides a vector containing a nucleic acid molecule encoding the above-described antibody or antigen-binding fragment thereof of the present invention.
  • vector refers to a carrier capable of inserting a polynucleotide sequence for introduction into cells capable of replicating the polynucleotide (nucleic acid) sequence.
  • Polynucleotide sequences may be exogenous or heterologous.
  • Vectors include, but are not limited to, plasmids, cosmid vectors, and viral vectors (retrovirus, adenovirus, and adeno-associated virus vectors, etc.).
  • expression vector refers to a vector containing a nucleotide sequence encoding at least a portion of the gene product to be transcribed. In some cases, the RNA molecule is then translated into a protein, polypeptide, or peptide. Expression vectors may contain various control sequences. In addition to regulatory sequences that regulate transcription and translation, vectors and expression vectors may also contain nucleic acid sequences that also serve other functions.
  • the present invention provides a cell containing the above-described vector.
  • the term “cell” includes eukaryotic cells and prokaryotic cells, and refers to any transformable cell capable of replicating the vector or expressing the gene encoded by the vector.
  • Cells may be transfected, transduced, or transformed by the vector, which refers to a process in which an exogenous polynucleotide (nucleic acid molecule) is transferred or introduced into a host cell.
  • transformation refers to include transfected and transduced.
  • the (host) cells of the present invention are not limited, but are preferably insect cells or mammalian cells, more preferably Sf9 for insect cells, HEK293 cells, HeLa cells, ARPE-19 cells, RPE- 1 cells, HepG2 cells, Hep3B cells, Huh-7 cells, C8D1a cells, Neuro2A cells, CHO cells, MES13 cells, BHK-21 cells, COS7 cells, COP5 cells, A549 cells, MCF-7 cells, HC70 cells, HCC1428 cells , BT-549 cells, PC3 cells, LNCaP cells, Capan-1 cells, Panc-1 cells, MIA PaCa-2 cells, SW480 cells, HCT166 cells, LoVo cells, A172 cells, MKN-45 cells, MKN-74 cells, Kato-III cells, NCI-N87 cells, HT-144 cells, SK-MEL-2 cells, SH-SY5Y cells, C6 cells, HT-22 cells, PC-12 cells, NIH3T3 cells
  • the host cell of the present invention is preferably an isolated host cell.
  • the present invention includes the above-described antibody or antigen-binding fragment thereof of the present invention, a nucleic acid molecule encoding the antibody or antigen-binding fragment thereof, or a vector containing the nucleic acid molecule as an active ingredient.
  • the present invention comprises the step of administering to a subject a pharmaceutically effective amount of a nucleic acid molecule encoding the above-described antibody or antigen-binding fragment thereof of the present invention, or a vector containing the nucleic acid molecule.
  • a pharmaceutically effective amount of a nucleic acid molecule encoding the above-described antibody or antigen-binding fragment thereof of the present invention or a vector containing the nucleic acid molecule.
  • the present invention provides a nucleic acid molecule encoding the above-described antibody or antigen-binding fragment thereof of the present invention, or a vector containing the nucleic acid molecule for use in therapy.
  • the therapeutic use is preferably the treatment of SARS-CoV2 or its variant virus infection.
  • prevention refers to suppressing the occurrence of a disease or disease in a subject who has not been diagnosed as having the disease or disease but is likely to develop the disease or disease.
  • treatment refers to (a) inhibiting the development of a disease, condition or symptom; (b) alleviation of a disease, condition or symptom; or (c) means eliminating a disease, condition or symptom.
  • the composition of the present invention may itself be a composition for treating viral infections, or may be administered together with other pharmacological ingredients and applied as a treatment adjuvant to improve its therapeutic responsiveness. Accordingly, in this specification, the term “treatment” or “therapeutic agent” includes the meaning of “treatment aid” or “treatment aid.”
  • administer refers to directly administering a therapeutically effective amount of the composition of the present invention to a subject so that the same amount is formed in the subject's body.
  • the term "pharmaceutically effective amount” or “therapeutically effective amount” refers to the content of the composition in which the pharmacological ingredients in the composition are contained in a sufficient amount to provide a therapeutic or preventive effect to the individual to whom the pharmaceutical composition of the present invention is to be administered. This means “prophylactically effective amount” is included.
  • the term “subject” includes, without limitation, humans, mice, rats, guinea pigs, dogs, cats, horses, cows, pigs, monkeys, chimpanzees, baboons, or rhesus monkeys. Specifically, the subject of the present invention is a human.
  • the pharmaceutical composition of the present invention contains a pharmaceutically acceptable carrier or excipient.
  • the pharmaceutical composition of the present invention is prepared in unit dosage form by formulating it using a pharmaceutically acceptable carrier and/or excipient according to a method that can be easily performed by a person skilled in the art. Alternatively, it can be manufactured by placing it in a multi-capacity container.
  • the pharmaceutical composition according to the present invention can be formulated and used in various forms according to conventional methods.
  • it can be formulated into oral dosage forms such as powders, granules, tablets, capsules, suspensions, emulsions, syrups, etc., and can be formulated and used in the form of external preparations, suppositories, and sterile injection solutions.
  • composition of the present invention may contain one or more known active ingredients with antiviral activity.
  • the pharmaceutical composition of the present invention can be administered orally or parenterally, preferably parenterally, for example, intravenous injection, transdermal administration, subcutaneous injection, intramuscular injection, intravitreal injection, subretinal injection. Subretinal injection, suprachoroidal injection, eye drop administration, intracerebroventricular injection, intrathecal injection, intraamniotic injection, intraarterial intraarterial injection, intraarticular injection, intracardiac injection, intracavernous injection, intracerebral injection, intracisternal injection, intracoronary injection (intracoronary injection), intracranial injection, intradural injection, epidural injection, intrahippocampal injection, intranasal injection, intraosseous injection injection, intraperitoneal injection, intrapleural injection, intraspinal injection, intrathoracic injection, intrathymic injection, intrauterine injection , intravaginal injection, intraventricular injection, intravesical injection, subconjunctival injection, intratumoral injection, local injection and intraperitoneal injection. It can be
  • Preparations for parenteral administration include sterilized aqueous solutions, non-aqueous solutions, suspensions, emulsions, freeze-dried preparations, and suppositories.
  • Non-aqueous solvents and suspensions may include propylene glycol, polyethylene glycol, vegetable oil such as olive oil, and injectable ester such as ethyl oleate.
  • injectable ester such as ethyl oleate.
  • As a base for suppositories witepsol, macrogol, tween 61, cacao, laurin, glycerogeratin, etc. can be used.
  • the dosage of the pharmaceutical composition of the present invention may vary depending on the formulation method, administration method, administration time, and/or administration route of the pharmaceutical composition, and the type and degree of response to be achieved by administration of the pharmaceutical composition. , various factors including the type, age, weight, general health condition, symptoms or degree of disease, gender, diet, excretion, drugs used simultaneously or simultaneously with the subject, other components of the composition, etc. of the subject to be administered, and It may vary depending on similar factors well known in the pharmaceutical field, and a person skilled in the art can easily determine and prescribe an effective dosage for the desired treatment.
  • the administration route and administration method of the pharmaceutical composition of the present invention may be independent and are not particularly limited, and any administration route and administration method may be used as long as the pharmaceutical composition can reach the desired area. can be followed.
  • the present invention provides a nucleic acid molecule encoding the antibody or antigen-binding fragment thereof of the present invention described above, or a vector containing the nucleic acid molecule as an active ingredient.
  • -CoV2 a mutant virus infection composition for diagnosis is provided.
  • diagnosis includes determination of an individual's susceptibility to a specific disease, determination of whether an individual currently has a specific disease, and determination of the prognosis of an individual suffering from a specific disease. do.
  • the antibody of the present invention which specifically binds to SARS-CoV2 or its mutant virus, can accurately determine the presence of the virus in a biological sample and is useful for early establishment of a treatment strategy. It can be.
  • the term "diagnostic composition” refers to an integrated mixture or device containing the antibodies of the present invention to determine whether a subject is infected with a virus, and may also be expressed as a “diagnostic kit.” .
  • biological sample refers to tissue, cells, whole blood, serum, plasma, saliva, nasal secretions, urine, lymph fluid, spinal fluid, tissue autopsy samples (brain, skin, lymph nodes, spinal cord, etc.), cell culture supernatant, and ruptured tissue. Including, but not limited to, eukaryotic and bacterial expression systems.
  • Detection of viruses in biological samples can be done using colorimetric methods, electrochemical methods, fluorimetric methods, luminometry, particle counting methods, visual assessment or scintillation. This can be performed through detection of antigen-antibody complex formation using a scintillation counting method.
  • detection refers to a series of processes for determining whether an antigen-antibody complex is formed. Detection can be performed using various labels including enzymes, fluorescent substances, ligands, luminescent substances, microparticles, or radioactive isotopes.
  • Enzymes used as detection labels include, for example, acetylcholinesterase, alkaline phosphatase, ⁇ -D-galactosidase, horseradish peroxidase, and ⁇ -latamase, and fluorescent substances include fluorine.
  • Resin, Eu 3+ , Eu 3+ chelate or cryptate are included, ligands include biotin derivatives, luminescent substances include acridinium ester and isoluminol derivatives, and microparticles include It includes colloidal gold and colored latex, and radioactive isotopes may include 57 Co, 3 H, 125 I, and 125 I-Bonton Hunter reagent.
  • antigen-antibody complexes can be detected using enzyme-linked immunosorbent assay (ELISA).
  • ELISA enzyme-linked immunosorbent assay
  • the antibody of the present invention may have a detection label, and if it does not have a detection label, the antibody of the invention can be captured and confirmed by processing another antibody with a detection label.
  • the present invention provides a neutralizing antibody or antigen-binding fragment thereof against SARS-CoV2 or a mutant virus thereof.
  • the neutralizing antibody of the present invention has an inhibitory effect on SARS-coronavirus 2 and its mutant viruses (e.g., delta mutant, omicron mutant, etc.), and thus inhibits SARS-coronavirus 2 or its mutant virus infection. It can be useful for prevention or treatment.
  • SARS-coronavirus 2 and its mutant viruses e.g., delta mutant, omicron mutant, etc.
  • Figure 1 shows a schematic diagram of the antibody candidate selection process using biopanning.
  • Figure 2 shows the results of screening SARS-CoV2 mutant virus neutralizing antibody candidates through ELISA analysis.
  • Figure 3 shows the results of confirming the binding ability of 13 neutralizing antibody candidates according to antigen (SARS-CoV2, B1.617.2 and B.1.1.529) using ELISA technique.
  • Figure 4 shows the results of measuring the binding ability of Delta mutations and omicron mutations of SKAI-DS10, DS63, and DS84 antibodies selected through antibody-antigen protein thermal shift analysis (PTS) to the RBD antigen.
  • PTS antibody-antigen protein thermal shift analysis
  • Figure 5 is a schematic diagram of a pseudovirus system production method for verifying the neutralizing ability of selected antibodies.
  • Figure 6 shows the results of neutralizing ability verification of neutralizing antibody candidates using pseudoviruses.
  • Figure 7 shows the results of neutralizing efficacy verification (EC50 and EC90) of three types of antibody candidates at different concentrations on pseudovirus.
  • Figure 8 shows the EC50 and EC90 concentrations for each neutralizing antibody according to virus mutation.
  • Figure 9 shows the results of neutralization efficacy verification and Antibody-dependent-enhancement (ADE) verification using the SARS-CoV2 surrogate virus neutralization test kit.
  • Figure 10 shows the affinity verification results of antibody SKAI-DS84 through surface plasmon response analysis.
  • SARS-CoV-2 delta mutant RBD was combined with epoxy magnetic beads and incubated with phage expressing scFv. Afterwards, the phage bound to the SARS-CoV-2 delta mutant RBD was eluted and then infected with new ER2537 cells. Biopanning was repeated 5 times through the same process, and antibody candidates were selected through ELISA ( Figure 1).
  • the scFv sequence that binds to the RBDs of the 16 SARS-CoV2 mutant viruses identified was inserted into the human IgG two vector system (Antibody design Labs).
  • the IgG conversion method amplified the antibody gene binding site using forward and reverse primers containing restriction enzyme sites.
  • VH primers were designed to have restriction sites for BspE1 at the 5' end and Bsa1 at the 3' end, and for VL, BssH11 and BsmB1 restriction sites were designed at the 5' and 3' ends, respectively.
  • the amplified VH fragment was inserted into the cloning site of the TGEC-HC vector (Antibody design Labs), one of the two vector systems, and the VL domain was inserted into the cloning site of the TGEX-LC vector (Antibody design Labs). All restriction enzymes were used from New England Biolabs. Escherichia coli DH5 ⁇ -competent cells were used for plasmid amplification, and all monoclonal antibody candidates were confirmed through restriction enzyme mapping and DNA sequencing (Macrogen, Korea). The two cloned heavy and light chain IgG plasmids were simultaneously transfected into ExpiCHO cells.
  • each heavy chain and light chain human IgG plasmid was prepared by mixing with Expifectamine TM CHO (thermofisher), and the complex was co-transfected into the prepared cells at 6 x 10 6 cells/ml. The next day, Expifectamine TM CHO enhancer and ExpiCHO TM media (Thermofisher) were added. Cells were harvested when cell viability was approximately 75% (approximately 7 days after transfection). To purify the generated antibody, a monoclonal antibody was purified using protein A resin (Amicogen). For purification of human IgG, protein A agarose resin and affinity chromatography column (Bio-rad) were used.
  • the resulting antibody was mixed with 1 ml of Protein A resin and incubated at 4°C for 6 hours. This mixture was placed on an affinity chromatography column and eluted using 0.1 M glycine HCl buffer (pH 2.7). Finally, the purified antibody was concentrated using a 100 Kda cutoff amicon (Merckmillipore).
  • 13 human IgG neutralizing antibodies were produced.
  • the binding ability of the 13 neutralizing antibody candidates (1 ⁇ g/ml) was confirmed through ELISA using the SARS-CoV2 RBD, delta RBD, and RBD antigen (Genscript) of the omicron variant (predominant species as of January 22).
  • 10 types of antibodies that bind to the SARS-CoV2 RBD 9 types of antibodies that bind to the delta mutant RBD, and 3 types of antibodies that bind to the omicron were identified.
  • the antibodies that bind to all 3 types of antigens are SKAI-DS63 and SKAI-DS84. , confirmed with SKAI-DS95 ( Figure 3).
  • SKAI-DS10 which has the best binding ability to SARS-CoV2 and two types of delta mutant antigens
  • SKAI-DS63 and SKAI-DS84 which have above-average binding ability to all three antigens, were used as experimental groups, and Eli Lilly's bamlanivimab was used as a positive control group. (Research only, ProteoGenix) and R&D system's MAB10540 were used, and additional experiments were performed using human IgG as the negative control group.
  • the binding ability of the selected SKAI-DS10, DS63, and DS84 antibodies was re-verified through antibody-antigen protein thermal shift analysis (PTS) using delta-mutated and omicron-mutated RBD antigens.
  • PTS antibody-antigen protein thermal shift analysis
  • the principle of protein thermal shift is a verification method that confirms the binding ability of an antigen and an antibody by measuring the temperature (Tm) at which the antigen-antibody dissociates when the temperature is increased over time in antigen-antibody binding.
  • a pseudovirus system was constructed to verify the neutralizing ability of the selected neutralizing antibody candidates (Figure 5).
  • Packaging plasmid psPAX2
  • transgene plasmid pLenti-sffv-NanoLuc-PGK-RFP-T2A-PURO
  • plasmid expressing SARS-CoV2 S protein were co-transfected into HEK293T cells and the virus was released 72 hours later. After harvesting, it was concentrated 30 to 50 times using Takara's lentivirus concentrator. Afterwards, the candidate antibody and pseudovirus were incubated at 37 degrees for 1 hour and then infected with ACE2-Huh7.5 cells.
  • EC50 0.09.
  • ADE Fc ⁇ RII-dependent Antibody-dependent-enhancement
  • the present inventors selected SKAI-DS84 antibody, which had the highest degree of neutralization against omicron mutations, as a candidate antibody and measured the affinity of the antibody.
  • the antigen-antibody affinity between the SKAI-DS84 antibody and the omicron RBD BA.1 and BA.2 (stealth omicron) antigens purchased from invivogen was confirmed using biacore T200 equipment. It was confirmed that Omicron RBD BA.1 and BA.2 differ in four gene sequences at the RBD site.
  • affinity value (Kd) between the SKAI - DS84 antibody and the omicron RBD BA.1 antigen was confirmed to be 5.12 9 M was confirmed ( Figure 10). Therefore, it was confirmed that the SKAI-DS84 antibody showed strong binding to the omicron RBD (RBD mutation sequences of BA.1 and BA.2: S371F, T376A, D405N, R408S).

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Virology (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Hematology (AREA)
  • Urology & Nephrology (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Microbiology (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Communicable Diseases (AREA)
  • General Chemical & Material Sciences (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Biophysics (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Biotechnology (AREA)
  • Cell Biology (AREA)
  • Oncology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Genetics & Genomics (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

본 발명은 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스에 대한 중화 항체 또는 이의 항원 결합 단편에 관한 것이다. 본 발명의 중화 항체는 사스-코로나 바이러스 2 및 이의 변이 바이러스 (예를 들어, 델타변이, 오미크론변이 등)에 대한 저해 효능을 갖는 바, 사스-코로나 바이러스 2 또는 이의 변이 바이러스 감염의 예방 또는 치료에 유용하게 활용될 수 있다.

Description

사스-코로나 바이러스 2 중화 항체
본 발명은 사스-코로나 바이러스 2 또는 이의 변이 바이러스에 대한 중화 항체 또는 이의 항원 결합 단편에 관한 것이다.
세기별 주기로 발생하던 전염병이 21세기 들어서 지난 20년 동안 사스, 신종플루, 메르스, 에볼라 그리고 코로나19까지 다섯 차례나 발생하였으며, 전문가들은 신종 감염병 발생주기가 과거 10년 보다 짧아져, 3년 이내로 단축될 것으로 전망하고 있다(Zhou, P. et al. A pneumonia outbreak associated with a new coronavirus of probable bat origin. Nature 579, 270-273 (2020).
특히, 코로나19 및 이의 바이러스 변이에 대해 주요국들은 초기 방역에 실패하며 감염병 대응체계에서 문제점이 노출되었으며, 미국 및 주요 유럽 국가들에서 높은 사망자 수와 치명률을 기록하였다. 2020년 전 세계적으로 확산된 코로나19로 인한 잠재적인 경제적 손실이 작게는 5조8,000억달러(약 7,130조원)에서 많게는 8조8,000억달러(1경원)에 달할 것으로 추정되고 있으며, 이중 아시아가 최대 2조5,000억달러의 손실을 기록해 전 세계 손실액의 약 30%를 차지하게 될 것으로 분석되고 있다 (아시아개발은행(ADB) 2020년 발표 https://m.newspim.com/news/view/20200515000682).
코로나19 또는 SARS-CoV2는 초기 중국 우한시에서 발생된 형태로부터 지속적인 변이(알파, 베타, 감마, 델타, 오미크론 등)가 발생되고 있으며, 2022년 현재 전파력이 더욱 증강된 오미크론의 새로운 변이인 BA.2(스텔스 오미크론), BA.2.12.1, BA.4 및 BA.5 등이 발생하며 인류를 위협하고 있다.
하지만, 상기 알파 및 델타변이와 더불어, 오미크론변이 바이러스에까지 중화능을 갖는 항체의 개발은 더딘 실정이며, 이에 대한 시장의 요구가 급증하고 있는 상황이다.
본 명세서 전체에 걸쳐 다수의 논문 및 특허문헌이 참조되고 그 인용이 표시되어 있다. 인용된 논문 및 특허문헌의 개시 내용은 그 전체로서 본 명세서에 참조로 삽입되어 본 발명이 속하는 기술 분야의 수준 및 본 발명의 내용이 보다 명확하게 설명된다.
이에 본 발명자들은 델타변이, 오미크론변이 등을 포함하는 다양한 코로나변이바이러스에 대한 저해 효능을 갖는 항체를 개발하고자 예의 노력을 하였다. 상기 노력의 결과, 유사한 CDR 서열을 갖는 16개의 항체 후보군을 선별하였으며, 이 중 일부의 항체는 델타변이 뿐만 아니라 오미크론변이에까지 탁월한 중화효능을 나타낸다는 것을 확인함으로써 본 발명을 완성하게 되었다.
따라서 본 발명의 목적은, 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스에 대한 중화 항체 또는 이의 항원 결합 단편을 제공하는데 있다.
본 발명의 다른 목적은, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자를 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 핵산분자를 포함하는 벡터를 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 벡터를 포함하는 세포를 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자, 또는 상기 핵산분자를 포함하는 벡터를 유효성분으로 포함하는 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스 감염의 예방 또는 치료용 약제학적 조성물을 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자, 또는 상기 핵산분자를 포함하는 벡터의 약제학적 유효량을 대상체에게 투여하는 단계를 포함하는 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스 감염의 예방 또는 치료방법을 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자, 또는 상기 핵산분자를 포함하는 벡터의 치료용도(for use in therapy)를 제공하는데 있다.
본 발명의 또 다른 목적은, 상기 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자, 또는 상기 핵산분자를 포함하는 벡터를 유효성분으로 포함하는 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스 감염의 진단용 조성물을 제공하는데 있다.
본 발명의 다른 목적 및 이점은 하기의 발명의 상세한 설명, 청구범위 및 도면에 의해 보다 명확하게 된다.
본 발명의 일 양태에 따르면, 본 발명은 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스에 대한 중화 항체 또는 이의 항원 결합 단편으로서,
상기 항체 또는 이의 항원 결합 단편은 경쇄 CDR1, CDR2 및 CDR3과 중쇄 CDR1, CDR2 및 CDR3를 포함하며,
상기 경쇄 CDR1은 하기 일반식 1; 경쇄 CDR2는 하기 일반식 2; 경쇄 CDR3은 하기 일반식 3; 중쇄 CDR1은 하기 일반식 4; 중쇄 CDR2는 하기 일반식 5; 및 중쇄 CDR3은 하기 일반식 6, 일반식 7 또는 일반식 8의 아미노산 서열로 표시되는 것을 특징으로 하는, 항체 또는 이의 항원 결합 단편을 제공한다:
일반식 1
X11-G-S-S-S-N-I-G-X12-X13-X14-V-X15
(상기 일반식 1에서, X11은 S 또는 T이며; X12는 S 또는 N이며; X13은 N 또는 T이며; X14는 Y, D, A, N, T 또는 S이며; X15는 S, T, Y 또는 N이다.);
일반식 2
X21-X22-X23-X24
(상기 일반식 2에서, X21은 S, A 또는 D이며; X22는 D 또는 N이며; X23은 N 또는 S이며; X24는 N, K, H 또는 Q이다.);
일반식 3
X31-X32-W-D-X33-S-L-X34-X35
(상기 일반식 3에서, X31은 A 또는 G이며; X32는 T, A, 또는 S이며; X33은 A, Y 또는 D이며; X34는 S 또는 N이며; X35는 A 또는 G이다.);
일반식 4
X41-Y-X42-M-S
(상기 일반식 4에서, X41은 N, D 또는 G이며; X42는 A, S, Y 또는 D이다.);
일반식 5
X51-I-X52-X53-X54-X55-X56-X57-X58-X59
(상기 일반식 5에서, X51은 W, A, G, E, V, M 또는 L이며; X52는 Y 또는 S이며; X53은 S, H, Y 또는 P이며; X54는 N, D, S, H 또는 G이며; X55는 D, S, G 또는 N이며; X56은 G 또는 S이며; X57은 N 또는 S이며; X58은 N, K, T 또는 I이며; X59는 존재하지 않거나 T이다.);
일반식 6
X601-X602-X603-X604-X605-X606-X607-X608-X609-X610-X611-X612-X613-X614-D-A-M-D-V
(상기 일반식 6에서, X601은 R 또는 K이며; X602는 F, V 또는 A이며; X603은 P, T 또는 I이며; X604는 V, G 또는 L이며; X605는 P, T 또는 R이며; X606은 S 또는 C이며; X607은 W, H 또는 I이며; X608은 R, S 또는 P이며; X609는 N, G 또는 L이며; X610은 T, S 또는 G이며; X611은 W 또는 C이며; X612는 S 또는 Y이며; X613은 S 또는 Y이며; X614는 Y, S 또는 A이다.);
일반식 7
X701-X702-X703-X704-X705-X706-X707-X708-X709-X710-F-D-V
(상기 일반식 7에서, X701은 R 또는 K이며; X702는 D 또는 G이며; X703은 P, A 또는 V이며, X704는 F, W 또는 P이며; X705는 P, T 또는 E이며; X706은 G, L 또는 I이며; X707은 R, H 또는 A이며; X708은 S 또는 P이며; X709는 S, F 또는 P이며; X710은 N, S 또는 R이다.);
일반식 8
X81-X82-X83-X84-X85-F-D-Y
(상기 일반식 8에서, X81은 R 또는 K이며; X82는 P, D, Y, F, N, S 또는 G이며; X83은 K, F, G, Q, D, L, H, P, A 또는 T이며; X84는 T, G, N, W, P 또는 F이며; X85는 S, P, T, D, V, G 또는 W이다.).
본 명세서에서 용어 "항체(antibody)"는 면역학적으로 특정 항원과 반응성을 갖는 면역글로불린 분자를 포함하는, 항원을 특이적으로 인식하는 수용체 역할을 하는 단백질 분자를 의미하며 다클론항체 및 단클론항체를 모두 포함한다.
항체는 완전한 전장(full-length) 항체 형태뿐만 아니라 항체 분자의 항원 결합 단편(항체 단편)을 포함한다. 완전한 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조로서 각각의 경쇄는 중쇄와 이황화 결합으로 연결되어 있다. 중쇄 불변영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 및 엡실론(ε) 타입을 가지고 서브클래스로 감마1(γ1), 감마2(γ2), 감마3(γ3), 감마4(γ4), 알파1(α1) 및 알파2(α2)를 가진다. 경쇄의 불변영역은 카파(kappa, κ) 및 람다(lambda, λ) 타입을 가진다.
본 명세서에서 용어 "항체의 항원 결합 단편"은 전체 항체 분자 내에서 항원을 특이적으로 인식하고 항원-항체 결합 기능을 보유하는 단편을 의미하며, 단일-도메인 항체(sdAb), 단일쇄 항체(scFv), Fab, F(ab'), F(ab')2 및 Fv 등을 포함한다. 단편의 예로는, VL, VH, Cκ (또는 CL) 및 CH1 도메인으로 구성된 1가 단편(Fab 단편); 힌지 영역에서 이황화물 브릿지에 의해 연결된 2개의 Fab 단편을 포함하는 2가 단편(F(ab')2 단편); VH 및 CH1 도메인으로 구성된 Fd 단편; 항체의 하나의 암(arm)의 VL 및 VH 도메인, 및 이황화물-연결된 Fv(sdFv)로 구성된 Fv 단편; VH 도메인으로 구성된 dAb 단편; 및 분리된 상보성 결정 영역(CDR) 또는 링커에 의해 선택적으로 이어질 수 있는 둘 이상의 분리된 CDR의 조합을 포함한다. 또한, scFv는 VL과 VH 영역이 쌍을 이루어 1가 분자를 형성한 단일 단백질 사슬을 이루도록 링커에 의해 이어질 수 있다. 이러한 단일쇄 항체도 항체의 단편에 포함된다. 또한, 상기 항체 또는 항체의 단편은 2개의 중쇄 분자와 2개의 경쇄 분자를 포함하는 테트라머 항체; 항체 경쇄 모노머; 항체 중쇄 모노머; 항체 경쇄 다이머, 항체 중쇄 다이머; 인트라바디; 1가 항체; 낙타 항체; 및 단일-도메인 항체(sdAb)를 포함한다.
Fv는 중쇄 가변영역 및 경쇄 가변영역만을 가지고 있는 최소의 항체조각으로 Fv 단편을 생성하는 재조합 기술은 PCT 국제 공개특허출원 WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086 및 WO 88/09344에 개시되어 있다. 이중쇄 Fv(two-chain Fv)는 비공유 결합으로 중쇄 가변영역과 경쇄 가변영역이 연결되어 있고 단쇄 Fv(single-chain Fv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변영역과 단쇄의 가변영역이 공유결합으로 연결되거나 또는 C-말단에서 바로 연결되어 있어서 이중쇄 Fv와 같이 다이머와 같은 구조를 이룰 수 있다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻을 수 있고(예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다), 유전자 재조합 기술을 통하여 제작할 수도 있다.
본 명세서에서 용어 "중쇄"는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변영역 도메인 VH 및 3개의 불변영역 도메인 CH1, CH2 및 CH3을 포함하는 전체길이 중쇄 및 이의 단편을 모두 의미한다. 또한, 본 명세서 용어 "경쇄"는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 가변영역 도메인 VL 및 불변영역 도메인 Cκ (또는 CL)를 포함하는 전체길이 경쇄 및 이의 단편을 모두 의미한다.
본 명세서에서, 용어 "CDR(complementarity determining region)"은 면역글로블린의 중쇄 및 경쇄의 고가변 영역(hypervariable region)의 아미노산 서열을 의미한다(Kabat et al. Sequences of Proteins of Immunological Interest, 4th Ed., U.S. Department of Health and Human Services, National Institutes of Health (1987)). 중쇄(HCDR1, HCDR2 및 HCDR3) 및 경쇄(LCDR1, LCDR2 및 LCDR3)에는 각각 3개의 CDR이 포함되어 있으며, 이들 CDR은 항체가 항원 또는 에피토프에 결합하는 데 있어서 주요한 접촉 잔기를 제공한다. 상기 CDR은 프레임워크 영역(FR)이라고 명명된 더 보존된 영역들에 산재된다. 각 VH 및 VL은 3개의 CDR과 4개의 FR로 이루어지며, 이들은 FR1, CDR1, FR2, CDR2, FR3, CDR3 및 FR4 순서로 아미노-말단에서 카복시-말단으로 배열된다.
본 발명의 항체 또는 항체 단편의 범위에는 CDR 영역에 보존적 아미노산 치환을 갖는 변이체가 포함된다. 예를 들면, 항체의 결합 친화도 외에 반감기, 생체 적합성 기타 생물학적 특성을 보다 개선시키기 위하여 항체의 아미노산 서열에 추가적인 변화를 줄 수 있다. 이러한 생물학적 균등 활성을 갖는 변이를 고려한다면, 본 발명의 항체 또는 이를 코딩하는 핵산 분자는 서열목록에 기재된 서열과 실질적인 동일성(substantial identity)을 나타내는 서열도 포함하는 것으로 해석된다. 상기의 실질적인 동일성은, 상기한 본 발명의 서열과 임의의 다른 서열을 최대한 대응되도록 얼라인하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 얼라인된 서열을 분석한 경우에, 최소 60%의 상동성, 일 특정예에 따르면 70%의 상동성, 다른 특정예에 따르면 80%의 상동성, 또 다른 특정예에 따르면 90%의 상동성을 나타내는 서열을 의미한다. 서열비교를 위한 얼라인먼트 방법은 당업계에 공지되어 있다. 얼라인먼트에 대한 다양한 방법 및 알고리즘은 Smith and Waterman, Adv. Appl. Math. (1981) 2:482 Needleman and Wunsch, J. Mol. Bio. (1970) 48:443; Pearson and Lipman, Methods in Mol. Biol. (1988) 24: 307-31; Higgins and Sharp, Gene (1988) 73:237-44; Higgins and Sharp, CABIOS (1989) 5:151-3; Corpet et al. Nuc. Acids Res. (1988) 16:10881-90; Huang et al. Comp. Appl. BioSci. (1992) 8:155-65 및 Pearson et al. Meth. Mol. Biol. (1994) 24:307-31에 개시되어 있다.
코로나바이러스는 일반적으로 조류와 포유류에서 감기 증상을 뷰발하는 원인체로 알려져 있다. 과거에는 중증 급성 호흡기 중후군(SARS) 및 중동 호흡기 증후군(MERS)가 코로나바이러스로 인해 유행하였으며, 최근에는 중국 우한시에서 발생한 코로나바이러스감염증-19(신종코로나바이러스)로 인해 다시 주목받고 있다.
COVID-19의 원인 바이러스는 코로나바이러스의 변종인 SARS-CoV 2이다. 기존의 코로나바이러스와는 다르게 SARS-CoV 2는 호흡기 상피세포에 접촉하기 위한 외부장치인 '스파이크'에 변이가 있다.
상기 변이 바이러스는 알파, 베타, 감마, 델타, 오미크론, 람다, 뮤 등 현재 과거 또는 유행이 되었거나, 향후 유행할 가능성이 있는 다양한 변이 바이러스를 포함하며, 바람직하게는 델타변이 또는 오미크론변이 바이러스인 것이나, 이에 제한되는 것은 아니다.
본 발명의 바람직한 구현에에 따르면, 상기 변이 바이러스는 오미크론변이 바이러스인 것이다.
본 발명의 바람직한 구현에에 따르면, 상기 항체 또는 이의 항원 결합 단편의 경쇄 CDR1은 X14 및 X15가 S 또는 T인 것이다.
본 발명의 바람직한 구현에에 따르면, 상기 항체 또는 이의 항원 결합 단편의 경쇄 CDR2는 X21이 A 또는 D이며; X22가 D이며; X24가 N, H 또는 Q인 것이다.
본 발명의 바람직한 구현에에 따르면, 상기 항체 또는 이의 항원 결합 단편의 경쇄 CDR3은 X32가 A이며; X33은 D이며; X34는 S인 것이다.
본 발명의 바람직한 구현에에 따르면, 상기 항체 또는 이의 항원 결합 단편의 중쇄 CDR1은 X42가 A, Y 또는 D인 것이다.
본 발명의 바람직한 구현에에 따르면, 상기 항체 또는 이의 항원 결합 단편의 중쇄 CDR2는 X51이 G 또는 L이며; X53이 H, Y 또는 P이며; X54가 N 또는 G이며; X55가 S, G 또는 N이며; X58이 K, T 또는 N인 것이다.
본 발명의 바람직한 구현에에 따르면, 상기 항체 또는 이의 항원 결합 단편의 중쇄 CDR3은 상기 일반식 7의 아미노산 서열로 표시되며, X702는 D이며; X703은 P 또는 A이며, X704는 F 또는 W이며; X705는 P 또는 T이며; X706은 G 또는 L이며; X707은 R 또는 H이며; X709는 S 또는 F이며; X710은 N 또는 S인 것이다.
본 발명의 바람직한 구현에에 따르면, 상기 항체 또는 이의 항원 결합 단편의 중쇄 CDR3은 상기 일반식 8의 아미노산 서열로 표시되며, X81은 K이며; X82는 Y이며; X83은 Q 이며; X84는 W이며; X85는 D인 것이다.
본 발명의 바람직한 구현에에 따르면, 상기 항체 또는 이의 항원 결합 단편은 경쇄 CDR1, CDR2 및 CDR3과 중쇄 CDR1, CDR2 및 CDR3를 포함하며, 하기의 아미노산 서열로 표시되는 것이다:
(1) 상기 경쇄 CDR1은 서열번호 9, 경쇄 CDR2는 서열번호 20, 경쇄 CDR3은 서열번호 28, 중쇄 CDR1은 서열번호 41, 중쇄 CDR2는 서열번호 48 및 중쇄 CDR3은 서열번호 64;
(2) 상기 경쇄 CDR1은 서열번호 10, 경쇄 CDR2는 서열번호 21, 경쇄 CDR3은 서열번호 29, 중쇄 CDR1은 서열번호 42, 중쇄 CDR2는 서열번호 49 및 중쇄 CDR3은 서열번호 65;
(3) 상기 경쇄 CDR1은 서열번호 11, 경쇄 CDR2는 서열번호 22, 경쇄 CDR3은 서열번호 30, 중쇄 CDR1은 서열번호 41, 중쇄 CDR2는 서열번호 50 및 중쇄 CDR3은 서열번호 66;
(4) 상기 경쇄 CDR1은 서열번호 11, 경쇄 CDR2는 서열번호 22, 경쇄 CDR3은 서열번호 30, 중쇄 CDR1은 서열번호 41, 중쇄 CDR2는 서열번호 51 및 중쇄 CDR3은 서열번호 67;
(5) 상기 경쇄 CDR1은 서열번호 12, 경쇄 CDR2는 서열번호 23, 경쇄 CDR3은 서열번호 31, 중쇄 CDR1은 서열번호 43, 중쇄 CDR2는 서열번호 52 및 중쇄 CDR3은 서열번호 68;
(6) 상기 경쇄 CDR1은 서열번호 13, 경쇄 CDR2는 서열번호 24, 경쇄 CDR3은 서열번호 32, 중쇄 CDR1은 서열번호 43, 중쇄 CDR2는 서열번호 53 및 중쇄 CDR3은 서열번호 69;
(7) 상기 경쇄 CDR1은 서열번호 14, 경쇄 CDR2는 서열번호 24, 경쇄 CDR3은 서열번호 33, 중쇄 CDR1은 서열번호 42, 중쇄 CDR2는 서열번호 54 및 중쇄 CDR3은 서열번호 70;
(8) 상기 경쇄 CDR1은 서열번호 11, 경쇄 CDR2는 서열번호 22, 경쇄 CDR3은 서열번호 34, 중쇄 CDR1은 서열번호 41, 중쇄 CDR2는 서열번호 55 및 중쇄 CDR3은 서열번호 71;
(9) 상기 경쇄 CDR1은 서열번호 11, 경쇄 CDR2는 서열번호 22, 경쇄 CDR3은 서열번호 35, 중쇄 CDR1은 서열번호 44, 중쇄 CDR2는 서열번호 56 및 중쇄 CDR3은 서열번호 72;
(10) 상기 경쇄 CDR1은 서열번호 15, 경쇄 CDR2는 서열번호 25, 경쇄 CDR3은 서열번호 36, 중쇄 CDR1은 서열번호 45, 중쇄 CDR2는 서열번호 57 및 중쇄 CDR3은 서열번호 73;
(11) 상기 경쇄 CDR1은 서열번호 11, 경쇄 CDR2는 서열번호 22, 경쇄 CDR3은 서열번호 30, 중쇄 CDR1은 서열번호 42, 중쇄 CDR2는 서열번호 58 및 중쇄 CDR3은 서열번호 74;
(12) 상기 경쇄 CDR1은 서열번호 16, 경쇄 CDR2는 서열번호 24, 경쇄 CDR3은 서열번호 37, 중쇄 CDR1은 서열번호 41, 중쇄 CDR2는 서열번호 59 및 중쇄 CDR3은 서열번호 75;
(13) 상기 경쇄 CDR1은 서열번호 11, 경쇄 CDR2는 서열번호 22, 경쇄 CDR3은 서열번호 30, 중쇄 CDR1은 서열번호 46, 중쇄 CDR2는 서열번호 60 및 중쇄 CDR3은 서열번호 76;
(14) 상기 경쇄 CDR1은 서열번호 17, 경쇄 CDR2는 서열번호 26, 경쇄 CDR3은 서열번호 38, 중쇄 CDR1은 서열번호 46, 중쇄 CDR2는 서열번호 61 및 중쇄 CDR3은 서열번호 77;
(15) 상기 경쇄 CDR1은 서열번호 18, 경쇄 CDR2는 서열번호 27, 경쇄 CDR3은 서열번호 39, 중쇄 CDR1은 서열번호 47, 중쇄 CDR2는 서열번호 62 및 중쇄 CDR3은 서열번호 78; 또는
(16) 상기 경쇄 CDR1은 서열번호 19, 경쇄 CDR2는 서열번호 23, 경쇄 CDR3은 서열번호 40, 중쇄 CDR1은 서열번호 41, 중쇄 CDR2는 서열번호 63 및 중쇄 CDR3은 서열번호 79.
본 발명의 항체 또는 이의 항원 결합 단편은 경쇄 FR1, FR2, FR3 및 FR4및/또는 중쇄 FR1, FR2, FR3 및 FR4를 포함할 수 있다.
본 발명의 바람직한 구현에에 따르면, 상기 상기 경쇄 FR1은 서열번호 1, 경쇄 FR2는 서열번호 2, 경쇄 FR3은 서열번호 3, 경쇄 FR4는 서열번호 4, 중쇄 FR1은 서열번호 5, 중쇄 FR2는 서열번호 6, 중쇄 FR3은 서열번호 7 및 중쇄 FR4는 서열번호 8의 아미노산 서열로 표시될 수 있다.
본 발명의 다른 양태에 따르면, 본 발명은 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자를 제공한다.
본 명세서에서 용어 "핵산 분자"는 DNA(gDNA 및 cDNA) 그리고 RNA 분자를 포괄적으로 포함하는 의미를 가지며, 핵산 분자에서 기본 구성단위인 뉴클레오타이드는 자연의 뉴클레오타이드뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다(Scheit, Nucleotide Analogs, John Wiley, New York(1980); Uhlman 및 Peyman, Chemical Reviews, (1990) 90:543-584). 본 발명의 중쇄 및 경쇄 가변영역을 코딩하는 핵산 분자의 서열은 변형될 수 있다. 상기 변형은 뉴클레오타이드의 추가, 결실, 또는 비보존적 치환 또는 보존적 치환을 포함한다.
본 발명의 핵산 분자는 상기한 뉴클레오타이드 서열에 대하여 실질적인 동일성을 나타내는 뉴클레오타이드 서열도 포함하는 것으로 해석된다. 상기의 실질적인 동일성은, 상기한 본 발명의 뉴클레오타이드 서열과 임의의 다른 서열을 최대한 대응되도록 얼라인하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 얼라인 된 서열을 분석한 경우에, 최소 80%의 상동성, 일 특정예에서는 최소 90%의 상동성, 다른 특정예에서는 최소 95%의 상동성을 나타내는 뉴클레오타이드 서열을 의미한다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 본 발명의 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자를 포함하는 벡터를 제공한다.
본 명세서에서 용어 "벡터"는 상기 폴리뉴클레오타이드(핵산) 서열을 복제할 수 있는 세포로의 도입을 위해서 폴리뉴클레오타이드 서열을 삽입할 수 있는 전달체를 의미한다. 폴리뉴클레오타이드 서열은 외생(Exogenous) 또는 이종(Heterologous)일 수 있다. 벡터로서는 플라스미드, 코스미드 벡터 및 바이러스 벡터(레트로바이러스, 아데노바이러스 및 아데노-부속 바이러스 벡터 등)를 들 수 있으나, 이에 제한되지 않는다. 당업자는 표준적인 재조합 기술에 의해 벡터를 구축할 수 있다(Maniatis, et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Press, Cold Spring Harbor, N.Y., 1988; 및 Ausubel et al., In: Current Protocols in Molecular Biology, John, Wiley & Sons, Inc, NY, 1994 등).
본 명세서에서 용어 "발현 벡터"는 전사되는 유전자 산물 중 적어도 일부분을 코딩하는 뉴클레오타이드 서열을 포함한 벡터를 의미한다. 일부의 경우에는 그 후 RNA 분자가 단백질, 폴리펩타이드, 또는 펩타이드로 번역된다. 발현 벡터에는 다양한 조절서열을 포함할 수 있다. 전사 및 번역을 조절하는 조절서열과 함께 벡터 및 발현 벡터에는 또 다른 기능도 제공하는 핵산 서열도 포함될 수 있다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 벡터를 포함하는 세포를 제공한다.
본 명세서에서 용어 "세포"는 진핵세포 및 원핵세포를 포함하며, 상기 벡터를 복제할 수 있거나 벡터에 의해 코딩되는 유전자를 발현할 수 있는 임의의 형질 전환 가능한 세포를 의미한다. 세포는 상기 벡터에 의해 형질감염(Transfected), 형질도입(Transduced) 또는 형질전환(Transformed) 될 수 있으며, 이는 외생의 폴리뉴클레오타이드(핵산분자)가 숙주세포 내에 전달되거나 도입되는 과정을 의미한다. 본 명세서에서 용어 "형질전환"은 상기 형질감염(Transfected) 및 형질도입(Transduced)을 포함하는 의미로 사용된다.
본 발명의(숙주)세포는 제한되지 않으나, 바람직하게는 곤충세포 또는 포유동물 세포, 보다 바람직하게는 곤충세포의 경우 Sf9, 포유동물 세포의 경우 HEK293 세포, HeLa 세포, ARPE-19 세포, RPE-1 세포, HepG2 세포, Hep3B 세포, Huh-7 세포, C8D1a 세포, Neuro2A 세포, CHO 세포, MES13 세포, BHK-21 세포, COS7 세포, COP5 세포, A549 세포, MCF-7 세포, HC70 세포, HCC1428 세포, BT-549 세포,PC3 세포, LNCaP 세포, Capan-1 세포, Panc-1 세포, MIA PaCa-2 세포, SW480 세포, HCT166 세포, LoVo 세포, A172 세포, MKN-45 세포, MKN-74 세포, Kato-III 세포, NCI-N87 세포, HT-144 세포, SK-MEL-2 세포, SH-SY5Y 세포, C6 세포, HT-22 세포, PC-12 세포, NIH3T3 세포 등을 이용할 수 있다.
본 발명의 숙주세포는 바람직하게는 단리된 숙주세포이다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 본 발명의 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자, 또는 상기 핵산분자를 포함하는 벡터를 유효성분으로 포함하는 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스 감염의 예방 또는 치료용 약제학적 조성물을 제공한다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 본 발명의 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자, 또는 상기 핵산분자를 포함하는 벡터의 약제학적 유효량을 대상체에게 투여하는 단계를 포함하는 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스 감염의 예방 또는 치료방법을 제공한다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 본 발명의 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자, 또는 상기 핵산분자를 포함하는 벡터의 치료용도(for use in therapy)를 제공한다.
상기 치료용도는 바람직하게는 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스 감염의 치료용도인 것이다.
본 명세서에서 용어 "예방"은 질환 또는 질병을 보유하고 있다고 진단된 적은 없으나, 이러한 질환 또는 질병에 걸릴 가능성이 있는 대상체에서 질환 또는 질병의 발생을 억제하는 것을 의미한다.
본 명세서에서 용어 "치료"는 (a) 질환, 질병 또는 증상의 발전의 억제; (b) 질환, 질병 또는 증상의 경감; 또는 (c) 질환, 질병 또는 증상을 제거하는 것을 의미한다. 본 발명의 조성물은 그 자체로 바이러스 감염 치료용 조성물이 될 수도 있고, 혹은 다른 약리성분과 함께 투여되어 이의 치료 반응성을 향상시키는 치료 보조제로 적용될 수도 있다. 이에, 본 명세서에서 용어 "치료" 또는 "치료제"는 "치료 보조" 또는 "치료 보조제"의 의미를 포함한다.
본 명세서에서 용어 "투여" 또는 "투여하다"는 본 발명의 조성물의 치료적 유효량을 대상체에 직접적으로 투여함으로써 대상체의 체내에서 동일한 양이 형성되도록 하는 것을 말한다.
본 발명에서 용어 "약제학적 유효량" 또는 "치료적 유효량"은 본 발명의 약제학적 조성물을 투여하고자 하는 개체에게 조성물 내의 약리성분이 치료적 또는 예방적 효과를 제공하기에 충분한 정도로 함유된 조성물의 함량을 의미하며, 이에 "예방적 유효량"을 포함하는 의미이다.
본 명세서에서 용어 "대상체"는 제한없이 인간, 마우스, 래트, 기니아 피그, 개, 고양이, 말, 소, 돼지, 원숭이, 침팬지, 비비 또는 붉은털 원숭이를 포함한다. 구체적으로는, 본 발명의 대상체는 인간이다.
본 발명의 바람직한 구현예에 따르면, 본 발명의 약학적 조성물은 약제학적으로 허용되는 담체 또는 부형제를 포함한다.
본 발명의 약제학적 조성물은 당해 발명이 속하는 기술분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있는 방법에 따라, 약제학적으로 허용되는 담체 및/또는 부형제를 이용하여 제제화 함으로써 단위 용량 형태로 제조되거나 또는 다용량 용기 내에 내입시켜 제조될 수 있다.
본 발명에 따른 약제학적 조성물은 통상의 방법에 따라 다양한 형태로 제형화하여 사용될 수 있다. 예컨대, 산제, 과립제, 정제, 캡슐제, 현탁액, 에멀젼, 시럽 등의 경구형 제형으로 제형화할 수 있고, 외용제, 좌제 및 멸균 주사용액의 형태로 제형화하여 사용될 수 있다.
본 발명의 조성물은 항 바이러스 활성을 가진 공지의 유효성분을 1종 이상 함유할 수 있다.
본 발명의 약제학적 조성물은 경구 또는 비경구로 투여할 수 있고, 바람직하게는 비경구 투여이며, 예컨대, 정맥 내 주입, 경피 투여, 피하 주입, 근육 내 주입, 유리체 내 주입(intravitreal injection), 망막 하 주입(subretinal injection), 맥락막위공간 주입(suprachoroidal injection), 점안 투여(eye drop administration), 뇌실 내 주입(intracerebroventricular injection), 척추강 내 주입(intrathecal injection), 양막 내 주입 (intraamniotic injection), 동맥 내 주입 (intraarterial injection), 관절강 내 주입 (intraarticular injection), 심장 내 주입 (intracardiac injection), 음경해면체 내 주입 (intracavernous injection), 뇌 내 주입 (intracerebral injection), 뇌수조 주입 (intracisternal injection), 관상 내 주입 (intracoronary injection), 두개 내 주입 (intracranial injection), 경막 내 주입 (intradural injection), 경막 외 주입 (epidural injection), 해마 내 주입 (intrahippocampal injection), 비강 내 주입 (intranasal injection), 골강 내 주입 (intraosseous injection), 복강 내 주입 (intraperitoneal injection), 흉강 내 주입 (intrapleural injection), 척수 내 주입 (intraspinal injection), 흉곽 내 주입 (intrathoracic injection), 흉선 내 주입 (intrathymic injection), 자궁 내 주입 (intrauterine injection), 질 내 주입 (intravaginal injection), 심실 내 주입 (intraventricular injection), 방광 내 주입 (intravesical injection), 결막 하 주입 (subconjunctival injection) , 종양 내 주입 (intratumoral injection), 국소 주입 및 복강 주입(intraperitoneal injection) 등으로 투여할 수 있다.
상기 비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제, 좌제가 포함된다. 비수성용제, 현탁용제로는 프로필렌글리콜(Propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세로제라틴 등이 사용될 수 있다.
본 발명의 약제학적 조성물의 투여량은 상기 약제학적 조성물의 제제화 방법, 투여 방식, 투여 시간 및/또는 투여 경로 등에 의해 다양해질 수 있으며, 상기 약제학적 조성물의 투여로 달성하고자 하는 반응의 종류와 정도, 투여 대상이 되는 개체의 종류, 연령, 체중, 일반적인 건강 상태, 질병의 증세나 정도, 성별, 식이, 배설, 해당 개체에 동시 또는 이시에 함께 사용되는 약물 기타 조성물의 성분 등을 비롯한 여러 인자 및 의약 분야에서 잘 알려진 유사 인자에 따라 다양해질 수 있으며, 당해 기술 분야에서 통상의 지식을 가진 자는 목적하는 치료에 효과적인 투여량을 용이하게 결정하고 처방할 수 있다.
본 발명의 약제학적 조성물의 투여 경로 및 투여 방식은 각각 독립적일 수 있으며, 그 방식에 있어 특별히 제한되지 아니하며, 목적하는 해당 부위에 상기 약학적 조성물이 도달할 수 있는 한 임의의 투여 경로 및 투여 방식에 따를 수 있다.
본 발명의 또 다른 양태에 따르면, 본 발명은 전술한 본 발명의 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자, 또는 상기 핵산분자를 포함하는 벡터를 유효성분으로 포함하는 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스 감염의 진단용 조성물을 제공한다.
본 발명에서 사용되는 항체 또는 그의 항원결합 단편과 대상이 되는 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스에 대해서는 이미 상술하였으므로, 과도한 중복을 피하기 위하여 그 기재를 생략한다.
본 명세서에서 용어 "진단"은 특정 질환에 대한 개체의 감수성(susceptibility)의 판정, 특정 질환을 현재 개체가 가지고 있는 지 여부의 판정, 및 특정 질환에 걸린 한 객체의 예후(prognosis)의 판정을 포함한다.
사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스에 특이적으로 결합하는 본 발명의 항체는 생물학적 시료 내 바이러스의 존재를 정확하게 판정할 수 있으며, 치료 전략을 조기에 수립하는 데에 유용하게 이용될 수 있다.
본 명세서에서 용어 "진단용 조성물"은 대상체의 바이러스 감염 여부를 판단하기 위해 본 발명의 항체를 포함하는 통합적인 혼합물(mixture) 또는 장비(device)를 의미하며, 이에 "진단용 키트"로 표현될 수도 있다.
본 명세서에서 용어 "생물학적 시료"란 조직, 세포, 전혈, 혈청, 혈장, 타액, 비강 분비물, 뇨, 림프액, 척수액, 조직 부검 시료(뇌, 피부, 림프절, 척수 등), 세포 배양 상등액, 파열된 진핵세포 및 세균 발현계를 포함하나, 이에 제한되지는 않는다.
생물학적 시료에서 바이러스의 검출은, 비색법(colormetric method), 전기화학법(electrochemical method), 형광법(fluorimetric method), 발광법(luminometry), 입자계수법(particle counting method), 육안측정법(visual assessment) 또는 섬광계수법(scintillation counting method)을 이용한 항원-항체 복합체 형성의 검출을 통하여 수행할 수 있다. 본 명세서에서 용어 "검출"은 항원-항체 복합체의 형성 여부를 판정하기 위한 일련의 과정을 의미한다. 검출은 효소, 형광물, 리간드, 발광물, 미소입자 또는 방사성 동위원소를 포함하는 다양한 표지체를 사용하여 실시할 수 있다.
검출 표지체로서 사용되는 효소는 예를 들어 아세틸콜린에스테라제, 알칼라인 포스파타제, β-D-갈락토시다제, 호스래디쉬 퍼옥시다제 및 β-라타마제를 포함하며, 형광물로는 플루오레세인, Eu3+, Eu3+ 킬레이트 또는 크립테이트 등을 포함하고, 리간드로는 바이오틴 유도체 등을 포함하며, 발광물로는 아크리디늄 에스테르 및 이소루미놀 유도체 등을 포함하고, 미소입자로는 콜로이드 금 및 착색된 라텍스 등을 포함하며, 방사성 동위원소로는 57Co, 3H, 125I 및 125I-볼톤(Bonton) 헌터(Hunter) 시약 등을 포함할 수 있다.
본 발명의 일구현예에 따르면, 항원-항체 복합체를 효소면역흡착법(ELISA)을 이용하여 검출할 수 있다. 본 발명의 항체는 검출 표지를 가질 수 있으며, 검출표지를 가지지 않을 경우는 본 발명의 항체를 포획할 수 있고 검출 표지를 가지는 또 다른 항체를 처리하여 확인할 수 있다.
본 발명의 특징 및 이점을 요약하면 다음과 같다:
(i) 본 발명은 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스에 대한 중화 항체 또는 이의 항원 결합 단편을 제공한다.
(ii) 본 발명의 중화 항체는 사스-코로나 바이러스 2 및 이의 변이 바이러스 (예를 들어, 델타변이, 오미크론변이 등)에 대한 저해 효능을 갖는 바, 사스-코로나 바이러스 2 또는 이의 변이 바이러스 감염의 예방 또는 치료에 유용하게 활용될 수 있다.
도 1은 바이오패닝을 이용한 항체후보군 선별 과정에 대한 모식도를 나타낸다.
도 2는 ELISA분석법을 통한 SARS-CoV2 변이바이러스 중화항체 후보군 선별 결과를 나타낸다.
도 3은 ELISA 기법을 이용한 13개의 중화항체 후보군의 항원(SARS-CoV2, B1.617.2 and B.1.1.529)에 따른 결합능 확인 결과이다.
도 4는 antibody-antigen protein thermal shift analysis (PTS)를 통해 선별된 SKAI-DS10, DS63 및 DS84 항체의 Delta 변이 및 omicron 변이의 RBD 항원에 대한 결합능력을 측정한 결과이다.
도 5는 선별된 항체의 중화능검증을 위한 슈도바이러스 시스템 제작방법에 대한 모식도이다.
도 6은 슈도바이러스를 이용한 중화항체 후보군의 중화능 검증 결과를 나타낸다.
도 7은 3종의 항체 후보군의 슈도바이러스에서의 농도별 중화효능 검증 (EC50 및 EC90) 결과를 나타낸다.
도 8은 바이러스 변이에 따른 중화항체 별 EC50 및 EC90 농도를 나타낸다.
도 9는 SARS-CoV2 surrogate virus neutralization test kit를 이용한 중화효능 검증 및 Antibody-dependent-enhancement(ADE) 검증 결과를 나타낸다.
도 10은 Surface plasmon response 분석을 통한 SKAI-DS84번 항체의 affinity 검증 결과를 나타낸다.
이하, 실시 예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시 예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시 예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예
1. 바이오패닝을 이용한 항체후보군 선별
코로나바이러스-19 변이바이러스를 저해하는 중화항체의 개발은 phage-display 기술을 이용하였고 이화여자대학교에서 제공받은 1 X 1010 scFv에 HA tag 이 결합된 형태의 OPAL항체 라이브러리를 사용해 바이오패닝을 진행하였다. 상기 라이브러리를 ER2537(New England Biolabs)에 형질전환시키고 50 ㎍/ml 카르베니실린 및 helper phage를 함유하는 SB배지(Difcotm)에서 37℃, 14시간 동안 배양하였다. SARS-CoV-2-B.1.617.2(델타변이) RBD에 결합하는 scFv를 스크리닝하기 위해 바이오패닝을 수행하였다. SARS-CoV-2 델타변이 RBD는 에폭시 자석 비드와 결합시키고 scFv가 발현된 phage와 배양하였다. 이후 SARS-CoV-2 델타변이 RBD 와 결합된 phage를 용리(elution)후 새로운 ER2537 세포로 감염시켰다. 같은 과정을 통해 바이오패닝 5회 반복하여 진행했으며 ELISA를 통해 항체 후보물질을 선별하였다(도 1).
2. ELISA분석법을 통한 SARS-CoV2 변이바이러스 중화항체 후보군 선별
다섯 번의 바이오패닝 결과 4~5라운드에서 SARS-CoV2 및 델타변이의 S단백질, RBD 단백질(Genscript)에서 모두 scFv가 결합하고 항체 diversity 가 recovery 되는 것을 확인하였다. 4~5라운드에서 recovery된 400개의 개별의 콜로니를 취하여 scFv를 각각 발현하고 SARS-CoV2 RBD, 델타변이 RBD 및 오미크론변이 RBD 항원을 이용해 400개의 개별의 scFv의 결합 정도를 ELISA 분석법으로 확인하였다. 최종적으로 후보항체 선별은 delta RBD O.D값 (빨강)/ SARS-CoV2 RBD O.D450 (파랑) 값으로 환산하여 O.D값 15이상의 개별 콜로니만 선별 하였다 (도 2). 결과적으로 16개의 중화항체 후보가 선별되었고 유전자 분석을 통해 light chain 및 heavy chain의 CDR1, CDR2 그리고 CDR3 항체서열을 확인하였다(표 1 및 2).
light chain variable region
Serial FR1: CDR1: FR2: CDR2: FR3: CDR3: FR4:
SKAI-DS1 QSVLTQPPSASGTPGRRVTISC
(SEQ ID NO: 1)		 TGSSSNIGSNYVS
(SEQ ID NO: 9)		 WYQQLPGTAPKLLIY
(SEQ ID NO: 2)		 SDSN
(SEQ ID NO: 20)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC
(SEQ ID NO: 3)		 GTWDASLSG
(SEQ ID NO: 28)		 YVFGGGTKLTVL
(SEQ ID NO: 4)
SKAI-DS3 QSVLTQPPSASGTPGQRVTISC TGSSSNIGSNDVT(SEQ ID NO: 10) WYQQLPGTAPKLLIY ADSK
(SEQ ID NO: 21)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC GAWDYSLSA
(SEQ ID NO: 29)		 YVFGGGTKLTVL
SKAI-DS7 QSVLTQPPSASGTPGQRVTISC SGSSSNIGSNAVS(SEQ ID NO: 11) WYQQLPGTAPKLLIY DNNH
(SEQ ID NO: 22)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC GSWDDSLNA
(SEQ ID NO: 30)		 YVFGGGTKLTVL
SKAI-DS10 QSVLTQPPSASGTPGQRVTISC SGSSSNIGSNAVS(SEQ ID NO: 11) WYQQLPGTAPKLLIY DNNH
(SEQ ID NO: 22)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC GSWDDSLNA
(SEQ ID NO: 30)		 YVFGGGTKLTVL
SKAI-DS14 QSVLTQPPSASGTPGQRVTISC SGSSSNIGSTNVY(SEQ ID NO: 12) WYQQLPGTAPKLLIY SDNK
(SEQ ID NO: 23)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC ASWDASLNG
(SEQ ID NO: 31)		 YVFGGGTKLTVL
SKAI-DS15 QSVLTQPPSASGTPGQRVTISC SGSSSNIGSNDVN(SEQ ID NO: 13) WYQQLPGTAPKLLIY DDSN
(SEQ ID NO: 24)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC GAWDDSLSG
(SEQ ID NO: 32)		 YVFGGGTKLTVL
SKAI-DS16 QSVLTQPPSASGTPGQRVTISC SGSSSNIGSNYVY(SEQ ID NO: 14) WYQQLPGTAPKLLIY DDSN
(SEQ ID NO: 24)		 RPSGVPGRFSGSKSGTSASLAISGLRSEDEADYYC GTWDYSLNG
(SEQ ID NO: 33)		 YVFGGGTKLTVL
SKAI-DS17 QSVLTQPPSASGTPGQRVTISC SGSSSNIGSNAVS(SEQ ID NO: 11) WYQQLPGTAPKLLIY DNNH
(SEQ ID NO: 22)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC GSWDDSLNA
(SEQ ID NO: 34)		 YVFGGGTKLTVL
SKAI-DS42 QSVLTQPPSASGTPGQRVTISC SGSSSNIGSNAVS(SEQ ID NO: 11) WYQQLPGTAPKLLIY DNNH
(SEQ ID NO: 22)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC GSWDDSLNG
(SEQ ID NO: 35)		 YVFGGGTKLTVL
SKAI-DS63 QSVLTQPPSASGTPGQRVTISC SGSSSNIGSNTVS(SEQ ID NO: 15) WYQQLPGTAPKLLIY ADNN
(SEQ ID NO: 25)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC AAWDDSLSA
(SEQ ID NO: 36)		 YVFGGGTKLTVL
SKAI-DS64 QSVLTQPPSASGTPGQRVTISC SGSSSNIGSNAVS(SEQ ID NO: 11) WYQQLPGTAPKLLIY DNNH
(SEQ ID NO: 22)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC GSWDDSLNA
(SEQ ID NO: 30)		 YVFGGGTKLTVL
SKAI-DS66 QSVLTQPPSASGTPGQRVTISC TGSSSNIGSNAVY(SEQ ID NO: 16) WYQQLPGTAPKLLIY DDSN
(SEQ ID NO: 24)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC GSWDDSLSA
(SEQ ID NO: 37)		 YVFGGGTKLTVL
SKAI-DS77 QSVLTQPPSASGTPGQRVTISC SGSSSNIGSNAVS(SEQ ID NO: 11) WYQQLPGTAPKLLIY DNNH
(SEQ ID NO: 22)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC GSWDDSLNA
(SEQ ID NO: 30)		 YVFGGGTKLTVL
SKAI-DS84 QSVLTQPPSASGTPGQRVTISC TGSSSNIGNNSVT(SEQ ID NO: 17) WYQQLPGTAPKLLIY ADSH
(SEQ ID NO: 26)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC GAWDDSLSG
(SEQ ID NO: 38)		 YVFGGGTKLTVL
SKAI-DS95 QSVLTQPPSASGTPGQRVTISC TGSSSNIGSNSVT(SEQ ID NO: 18) WYQQLPGTAPKLLIY DDNQ
(SEQ ID NO: 27)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC AAWDDSLSG
(SEQ ID NO: 39)		 YVFGGGTKLTVL
SKAI-DS104 QSVLTQPPSASGTPGQRVTISC TGSSSNIGNNTVN(SEQ ID NO: 19) WYQQLPGTAPKLLIY SDNK
(SEQ ID NO: 23)		 RPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYC AAWDASLSA
(SEQ ID NO: 40)		 YVFGGGTKLTVL
SARS-CoV2 변이바이러스 중화항체의 light chain variable region
heavy chain variable region
Serial FR1: CDR1: FR2: CDR2: FR3: CDR3: FR4:
SKAI-DS1 EVQLLESGGGLVQTGGSLRLSCAASGFTFS(SEQ ID NO: 5) DYAMS
(SEQ ID NO: 41)		 WVRQAPGKGLEWVS
(SEQ ID NO: 6)		 WIYSNDGNK
(SEQ ID NO: 48)		 YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA
(SEQ ID NO: 7)		 RFPVPSWRNTWSSYDAMDV
(SEQ ID NO: 64)		 WGQGTLVTV
(SEQ ID NO: 8)
SKAI-DS3 EVQLLESGGGLVQPGGSLRLSCAASGFTFS DYSMS(SEQ ID NO: 42) WVRQAPGKGLEWVS AISSDSSST
(SEQ ID NO: 49)		 YYADSVKGRFTISRDNSENTLYLQMNSLRAEDTAVYYCA KAILRCIPLGCYYADAMDV
(SEQ ID NO: 65)		 WGQGTLVTV
SKAI-DS7 EVQLLESGGGLVQTGGSLRLSCAASGFTFS DYAMS(SEQ ID NO: 41) WVRQAPGKGLEWVS GIYHSGGNT
(SEQ ID NO: 50)		 YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA RDAGPFDY
(SEQ ID NO: 66)		 WGQGTLVAV
SKAI-DS10 EVQLLESGGGLVQPGGSLRLSCAASGFTFS DYAMS(SEQ ID NO: 41) WVRQAPGRGLEWVS EIYYHDSNT
(SEQ ID NO: 51)		 YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA RGTGPFDY
(SEQ ID NO: 67)		 WGQGTLVTV
SKAI-DS14 EVQLLESGGGLVQPGGSLRLSCAASGFTFS DYDMS(SEQ ID NO: 43) WVRLAPGKGLEWVS VISYNGGSI
(SEQ ID NO: 52)		 YYADSVKGRFTISRDNSKNTLYLQMNGLRAEDTAVYYCA KGVPEIAPPRFDY
(SEQ ID NO: 68)		 WGQGTLVTV
SKAI-DS15 EVQLLESGGGLVQPGGSLRLSCAASGFTFS DYDMS(SEQ ID NO: 43) WVRQAPGKGLEWVS MIYSGSSSK
(SEQ ID NO: 53)		 YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA RVTGTCHSGSCYYSDAMDV
(SEQ ID NO: 69)		 WGQGTLVTV
SKAI-DS16 EVQLLESGGGLVQPGGSLRLSCAASGFTFS DYSMS(SEQ ID NO: 42) WVRQAPGKGLEWVS WIYPDNGNT
(SEQ ID NO: 54)		 YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA KPKTSFDY
(SEQ ID NO: 70)		 WGQGTLVTV
SKAI-DS17 EVQLLESGGGLVQPGGSLRLSCAASGFTFS DYAMS(SEQ ID NO: 41) WVRQAPGKGLEWVS VIYYDGSSK
(SEQ ID NO: 55)		 YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA RDFGPFDY
(SEQ ID NO: 71)		 WGQGTLVTV
SKAI-DS42 EVQLLESGGGLVQPGGSLRLSCAASGFTFS NYSMS(SEQ ID NO: 44) WVRQAPGKGLEWVS AISYDNGNK
(SEQ ID NO: 56)		 YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA RDGNTFDY
(SEQ ID NO: 72)		 WGQGTLVTV
SKAI-DS63 EVQLLESGGGLVQPGGSLRLSCAASGFTFS NYAMS(SEQ ID NO: 45) WVRQAPGKGLEWVS GIYPNSGSNT
(SEQ ID NO: 57)		 YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA KYQWDFDY
(SEQ ID NO: 73)		 WGQGTLVTV
SKAI-DS64 EVQLLESGGGLVQPGGSLRLSCAASGFTFS DYSMS(SEQ ID NO: 42) WVRQAPGKGLEWVS GIYHSDGSK
(SEQ ID NO: 58)		 YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA RFDPVFDY
(SEQ ID NO: 74)		 WGQGTLVTV
SKAI-DS66 EVQLLESGGGLVQPGGSLRLSCAASGFTFS DYAMS(SEQ ID NO: 41) WVRQAPGKGLEWVS AIYPGGGST
(SEQ ID NO: 59)		 YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA RNLFGFDY
(SEQ ID NO: 75)		 WGQGTLVTV
SKAI-DS77 EVQLLESGGGLVQTGGSLRLSCAASGFTFS DYYMS(SEQ ID NO: 46) WVRLAPGRGLEWVS AISYDDGNI
(SEQ ID NO: 60)		 YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA RSHPTFDY
(SEQ ID NO: 76)		 WGQGTLVTV
SKAI-DS84 EVQLLESGGGLVQPGGSLRLSCAASGFTFS DYYMS(SEQ ID NO: 46) WVRQAPGKGLEWVS LISHGGSSK
(SEQ ID NO: 61)		 YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA RDPFPGRSSNFDY
(SEQ ID NO: 77)		 WGQGTLVTV
SKAI-DS95 EVQLLESGGGLVQPGGSLRLSCAASGFTFS GYDMS(SEQ ID NO: 47) WVRQAPGKGLEWVS GISYNNGST
(SEQ ID NO: 62)		 YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCA KDAWTLHPFSFDY
(SEQ ID NO: 78)		 WGQGTLVTV
SKAI-DS104 EVQLLESGGGLVQPGGSLRLSCAASGFTFS DYAMS(SEQ ID NO: 41) WVRQAPGKGLEWVS WIYPDDGNT
(SEQ ID NO: 63)		 YYADSVKGRFTISRDNSKNTLHLQMNSLRAEDTAVYYCA KPPTWFDY
(SEQ ID NO: 79)		 WGQGTLVTV
SARS-CoV2 변이바이러스 중화항체의 heavy chain variable region
3. SARS-CoV2 변이바이러스 중화항체 제작
인간 IgG 중화항체로 변환을 위해 확인된 16개의 SARS-CoV2 변이바이러스 RBD와 결합을 하는 scFv 서열을 human IgG two vector 시스템 (Antibody design Labs)에 삽입하였다. IgG변환 방법은 제한효소 부위를 포함하는 정방향 및 역방향 프라이머를 사용하여 항체유전자 결합부위를 증폭했다. VH 프라이머는 5' 말단에서 BspE1 및 3' 말단에서 Bsa1에 대한 제한 부위를 갖도록 설계되었고, VL의 경우, BssH11 및 BsmB1 제한 부위가 각각 5' 및 3' 말단에 설계되었다. 증폭된 VH 단편은 two vector 시스템 중 하나인 TGEC-HC 벡터(Antibody design Labs)의 클로닝 부위에 삽입하고, VL 도메인의 경우 TGEX-LC 벡터(Antibody design Labs)의 클로닝 사이트에 삽입하였다. 모든 제한효소는 new england biolabs사의 제품을 사용하였다. 플라스미드 증폭은 Escherichia coli DH5α-competent cell을 사용하였고 모든 단일클론항체 후보군은 제한효소 맵핑과 DNA 시퀀싱(Macrogen, Korea)통해 확인하였다. 클로닝된 두 개의 중쇄 및 경쇄 IgG 플라스미드를 ExpiCHO 세포로 동시에 형질감염(Transfection)시켰다. 각각 15 ug의 중쇄 및 경쇄 인간 IgG 플라스미드를 ExpifectamineTM CHO (thermofisher)과 혼합하여 준비하고 6 x 106 cells/ml로 준비된 세포에 복합체를 공동 형질감염시켰다. 다음날 ExpifectamineTM CHO enhancer와 ExpiCHOTM media (Thermofisher)를 추가하였다. 세포 생존율이 약 75%(형질감염 후 약 7일째)일 때 세포를 수확하였다. 생성된 항체를 정제하기위해 protein A resin (Amicogen)에 사용하여 단일클론항체를 정제하였다. 인간 IgG 정제를 위해 단백질 A agarose 수지와 친화성 크로마토그래피 컬럼(Bio-rad)을 사용하였다. 생성된 항체와 protein A resin 1 ml를 혼합하여 4℃에서 6시간 동안 배양하고 이 혼합물을 친화성 크로마토그래피 컬럼에 넣은 뒤 0.1 M 글리신 HCl 완충액(pH 2.7)을 이용해 용출시켰다. 마지막으로 100 Kda cutoff amicon (Merckmillipore)을 이용하여 정제된 항체를 농축하였다.
16개의 scFv 항체 후보군 중 인간IgG 중화항체는 13개가 생산되었다. 13개의 중화항체 후보군(1 μg/ml)은 SARS-CoV2 RBD, delta RBD 그리고 omicron변이(22년 1월 우세종)의 RBD 항원(Genscript)을 이용해 ELISA 방식을 통해 항체의 결합능력을 확인해보았다. 그 결과 SARS-CoV2 RBD에 결합하는 항체는 10종, delta변이 RBD에 결합하는 항체 9종, 오미크론에 결합하는 항체 3종이 확인되었으며 3종류의 항원 모두 결합하는 항체는 SKAI-DS63, SKAI-DS84, SKAI-DS95으로 확인 확인되었다(도 3). SARS-CoV2 및 delta변이 2종의 항원에서 결합능이 가장 좋은 SKAI-DS10과 3종의 항원에 모두 결합력이 평균이상인 SKAI-DS63 및 SKAI-DS84를 실험군으로, 양성대조군으로는 일라이릴리의 밤라니비맙 (Research only, ProteoGenix)과 R&D system의 MAB10540을 사용하였고 음성대조군은 인간IgG를 사용하여 추가 실험을 수행하였다.
4. antibody-antigen protein thermal shift analysis (PTS)
선별된 SKAI-DS10, DS63 및 DS84 항체는 Delta 변이 및 omicron 변이의 RBD 항원을 이용해 antibody-antigen protein thermal shift analysis (PTS)를 통해 항체 결합능력을 재검증 하였다. protein thermal shift의 원리는 항원-항체 결합에서 시간별로 온도를 증가시켰을 때 항원-항체가 해리되는 온도(Tm)값을 측정하여 항원과 항체의 결합능력을 확인하는 검증법이다. 그 결과 Delta RBD 항원과의 3종의 항체 모두 잘 결합하는 것으로 확인하였지만, omicron 변이 RBD와 3종의 항체 결합능력에서는 DS10<DS63<DS83 순으로 높은 온도에서 항원-항체가 해리되는 것을 확인하였다. 결과적으로 DS84의 경우 현재 우세종인 omicron 변이 바이러스의 RBD와 강력한 결합력을 갖는 것을 확인하였다(도 4).
5. 슈도바이러스 시스템을 이용한 중화능 검증
선별된 중화항체 후보군의 중화능 검증을 위해 슈도바이러스 시스템을 구축하였다(도 5). 팩키징플라스미드 (psPAX2), Transgene 플라스미드 (pLenti-sffv-NanoLuc-PGK-RFP-T2A-PURO) 및 SARS-CoV2 S 단백질을 발현하는 플라스미드를 HEK293T 세포의 동시 형질감염(co-transfection) 하여 72시간뒤 바이러스를 수확 후 Takara사의 lentivirus concentrator를 이용해 30~50배 농축하였다. 이후 후보항체와 슈도바이러스를 37도에서 1시간동안 배양 후 ACE2-Huh7.5 세포에 감염시켰다. 24시간 뒤 바이러스가 포함된 배지는 제거하고 10% FBS가 함유된 새로운 배지를 넣고 72시간동안 37도에서 배양하였다. 72시간 뒤 항체의 세포독성평가를 위해 WST 분석을 하고 같은 세포에서 프로메가사의 nanoluc-glo를 통해 nano-루시퍼라제의 활성을 평가하였다(중화능 효과가 높을수록 루시퍼라제 활성도가 낮음).
앞선 ELISA 결과에서 1 μg/ml 농도의 13종 후보항체가 항원에 결합하는 능력을 확인했다(도 6). 본 데이터에서는 ELISA 결과와 비례하여 항원-항체 결합능에 따른 중화능 효능을 보이는지 확인하기 위해 1 μg/ml 농도에서 13종 후보항체를 검증하였다. 그 결과, 도 3에서와 마찬가지로 84번 항체가 가장 좋은 오미크론변이에 대한 중화능을 보였으며 다음 63번 및 10번은 SARS-CoV2 및 델타 변이에서만 중화능을 보였다. 따라서, 본 발명자들은 WT(우한종)와 델타변이에서 가장 강력한 중화능을 보이는 10번 항체, WT, 델타변이 및 오미크론변이 모두 중화하는 64번 및 84번 항체를 실험군으로 선정하였다. 3종의 항체 모두 슈도바이러스에서 중화능을 농도별로(dose-dependent) 검증하였다.
우한종, 델타변이 및 오미크론변이의 슈도바이러스에 10, 63 그리고 84 항체를 각각 농도별로 처리한 뒤 72시간 배양 후 나노루시퍼레이즈 측정을 통해 중화능을 검증하였다(도 7). 그 결과 오미크론 중화능이 가장 좋은 항체는 84번 및 63번 항체 순서로 결과가 나왔으며 10번 항체의 경우 오미크론 변이에 중화능이 존재 하지 않았다. 84번 항체의 오미크론변이 저해정도는 EC50 = 0.16 μg/ml 및 EC90 = 8 μg/ml으로 나타났으며, 63번의 항체의 경우 EC50 = 7.2 μg/ml 및 EC90 = 112 μg/m 수준으로 확인되었다. 또 우한종 중화 효능은 10번과 63번 항체가 EC50 = 0.0004 μg/ml 및 EC90 = 0.0012~0.0015 μg/ml 수준으로 확인되었으며, 84번 항체는 우한종에서 중화능 수준인 EC50 = 0.002 μg/ml 및 EC90=0.3μg/ml으로 보다 낮은 중화능을 보였다. 마지막으로 델타변이에서는 10번 항체의 경우 EC50 = 0.003 μg/ml 및 EC90 = 7.3 μg/m, 63번 항체는 EC50 = 0.007 μg/ml 및 EC90 = 5.2μ g/ml 그리고 84번 항체는 EC50 = 0.09 g/ml 및 EC90 = 1.5 μg/ml 수준의 중화능을 확인하였다(도 8). 대조군으로는 밤라니비맙을 사용하였다. 밤라니비맙의 경우 우한종에서만 중화능을 보였다(도 8).
6. neutralization test kit를 이용한 중화능 검증
슈도바이러스에서 검증한 중화능 효능을 재차 검증하기 위해 genscript사의 SARS-CoV2 surrogate virus neutralization test kit를 이용해 중화능을 추가 검증하였다. 그 결과 84항체와 63번항체 순서로 강력한 중화 효능을 보였으며 10번항체와 대조군인 밤라니비맙의 경우 오미크론변이 중화능을 보이지 않는 것으로 확인하였다. 결과적으로 슈도바이러스 중화능 검증과 비슷한 결과가 도출되어 84번 항체의 오미크론변이 중화능 검증을 뒷받침하였다(도 9).
7. Antibody-dependent-enhancement(ADE) 검증
항체에 FcγRII-dependent에 의한 Antibody-dependent-enhancement(ADE) 영향을 확인하기 위해 RAJI 세포(ATCC, CCL-86)에서 3종의 항체 모두 ADE를 확인한 결과 항체의 농도를 증가시켜도 슈도바이러스의 감염을 확인하지 못했으며, 더 나아가 항체 농도가 증가함에 따라 RAJI 세포에서의 바이러스 감염 또한 줄어드는 것으로 확인하였다. 따라서 3종의 항체 모두 ADE 효과는 나타나지 않았다.
8. 항체의 affinity 검증
본 발명자들은 오미크론변이에 중화도가 가장 높은 SKAI-DS84번 항체를 후보항체로 선정하였고 항체의 결합력(affinity)를 측정하였다. SKAI-DS84 항체와 invivogen에서 구입한 omicron RBD BA.1 그리고 BA.2 (스텔스오미크론) 항원과의 항원-항체의 affinity는 biacore T200 장비를 이용하여 확인하였다. Omicron RBD BA.1 및 BA.2는 RBD site에서 4개의 유전자 서열이 다름을 확인하였다. Affinity 측정 결과 SKAI-DS84 항체와 omicron RBD BA.1 항원사이에 affinity 값(Kd)는 5.12 X 10-9 M값을 확인하였고, 더 나아가 omicron BA.2에서의 affinity 값을 확인한 결과 8.63 X 10-9 M이 확인되었다(도 10). 따라서 SKAI-DS84 항체의 경우 omicron RBD에 강력한 결합력을 보이는 것으로 확인하였다 (BA.1 과 BA.2의 RBD mutation sequence: S371F, T376A, D405N, R408S).
이상, 본 발명의 실시예들에 대하여 설명하였으나, 해당 기술 분야에서 통상의 지식을 가진 자라면 특허청구범위에 기재된 본 발명의 사상으로부터 벗어나지 않는 범위 내에서, 구성 요소의 부가, 변경, 삭제 또는 추가 등에 의해 본 발명을 다양하게 수정 및 변경시킬 수 있을 것이며, 이 또한 본 발명의 권리범위 내에 포함된다고 할 것이다.

Claims (19)

  1. 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스에 대한 중화 항체 또는 이의 항원 결합 단편으로서,
    상기 항체 또는 이의 항원 결합 단편은 경쇄 CDR1, CDR2 및 CDR3과 중쇄 CDR1, CDR2 및 CDR3를 포함하며,
    상기 경쇄 CDR1은 하기 일반식 1; 경쇄 CDR2는 하기 일반식 2; 경쇄 CDR3은 하기 일반식 3; 중쇄 CDR1은 하기 일반식 4; 중쇄 CDR2는 하기 일반식 5; 및 중쇄 CDR3은 하기 일반식 6, 일반식 7 또는 일반식 8의 아미노산 서열로 표시되는 것을 특징으로 하는, 항체 또는 이의 항원 결합 단편:
    일반식 1
    X11-G-S-S-S-N-I-G-X12-X13-X14-V-X15
    (상기 일반식 1에서, X11은 S 또는 T이며; X12는 S 또는 N이며; X13은 N 또는 T이며; X14는 Y, D, A, N, T 또는 S이며; X15는 S, T, Y 또는 N이다.);
    일반식 2
    X21-X22-X23-X24
    (상기 일반식 2에서, X21은 S, A 또는 D이며; X22는 D 또는 N이며; X23은 N 또는 S이며; X24는 N, K, H 또는 Q이다.);
    일반식 3
    X31-X32-W-D-X33-S-L-X34-X35
    (상기 일반식 3에서, X31은 A 또는 G이며; X32는 T, A, 또는 S이며; X33은 A, Y 또는 D이며; X34는 S 또는 N이며; X35는 A 또는 G이다.);
    일반식 4
    X41-Y-X42-M-S
    (상기 일반식 4에서, X41은 N, D 또는 G이며; X42는 A, S, Y 또는 D이다.);
    일반식 5
    X51-I-X52-X53-X54-X55-X56-X57-X58-X59
    (상기 일반식 5에서, X51은 W, A, G, E, V, M 또는 L이며; X52는 Y 또는 S이며; X53은 S, H, Y 또는 P이며; X54는 N, D, S, H 또는 G이며; X55는 D, S, G 또는 N이며; X56은 G 또는 S이며; X57은 N 또는 S이며; X58은 N, K, T 또는 I이며; X59는 존재하지 않거나 T이다.);
    일반식 6
    X601-X602-X603-X604-X605-X606-X607-X608-X609-X610-X611-X612-X613-X614-D-A-M-D-V
    (상기 일반식 6에서, X601은 R 또는 K이며; X602는 F, V 또는 A이며; X603은 P, T 또는 I이며; X604는 V, G 또는 L이며; X605는 P, T 또는 R이며; X606은 S 또는 C이며; X607은 W, H 또는 I이며; X608은 R, S 또는 P이며; X609는 N, G 또는 L이며; X610은 T, S 또는 G이며; X611은 W 또는 C이며; X612는 S 또는 Y이며; X613은 S 또는 Y이며; X614는 Y, S 또는 A이다.);
    일반식 7
    X701-X702-X703-X704-X705-X706-X707-X708-X709-X710-F-D-V
    (상기 일반식 7에서, X701은 R 또는 K이며; X702는 D 또는 G이며; X703은 P, A 또는 V이며, X704는 F, W 또는 P이며; X705는 P, T 또는 E이며; X706은 G, L 또는 I이며; X707은 R, H 또는 A이며; X708은 S 또는 P이며; X709는 S, F 또는 P이며; X710은 N, S 또는 R이다.);
    일반식 8
    X81-X82-X83-X84-X85-F-D-Y
    (상기 일반식 8에서, X81은 R 또는 K이며; X82는 P, D, Y, F, N, S 또는 G이며; X83은 K, F, G, Q, D, L, H, P, A 또는 T이며; X84는 T, G, N, W, P 또는 F이며; X85는 S, P, T, D, V, G 또는 W이다.).
  2. 제 1 항에 있어서, 상기 변이 바이러스는 델타변이 또는 오미크론변이 바이러스인 것을 특징으로 하는, 항체 또는 이의 항원 결합 단편.
  3. 제 2 항에 있어서, 상기 변이 바이러스는 오미크론변이 바이러스인 것을 특징으로 하는, 항체 또는 이의 항원 결합 단편.
  4. 제 3 항에 있어서, 상기 항체 또는 이의 항원 결합 단편의 경쇄 CDR1은 X14 및 X15가 S 또는 T인 것을 특징으로 하는, 항체 또는 이의 항원 결합 단편.
  5. 제 3 항에 있어서, 상기 항체 또는 이의 항원 결합 단편의 경쇄 CDR2는 X21이 A 또는 D이며; X22가 D이며; X24가 N, H 또는 Q인 것을 특징으로 하는, 항체 또는 이의 항원 결합 단편.
  6. 제 3 항에 있어서, 상기 항체 또는 이의 항원 결합 단편의 경쇄 CDR3은 X32가 A이며; X33은 D이며; X34는 S인 것을 특징으로 하는, 항체 또는 이의 항원 결합 단편.
  7. 제 3 항에 있어서, 상기 항체 또는 이의 항원 결합 단편의 중쇄 CDR1은 X42가 A, Y 또는 D인 것을 특징으로 하는, 항체 또는 이의 항원 결합 단편.
  8. 제 3 항에 있어서, 상기 항체 또는 이의 항원 결합 단편의 중쇄 CDR2는 X51이 G 또는 L이며; X53이 H, Y 또는 P이며; X54가 N 또는 G이며; X55가 S, G 또는 N이며; X58이 K, T 또는 N인 것을 특징으로 하는, 항체 또는 이의 항원 결합 단편.
  9. 제 3 항에 있어서, 상기 항체 또는 이의 항원 결합 단편의 중쇄 CDR3은 상기 일반식 7의 아미노산 서열로 표시되며, X702는 D이며; X703은 P 또는 A이며, X704는 F 또는 W이며; X705는 P 또는 T이며; X706은 G 또는 L이며; X707은 R 또는 H이며; X709는 S 또는 F이며; X710은 N 또는 S인 것을 특징으로 하는, 항체 또는 이의 항원 결합 단편.
  10. 제 3 항에 있어서, 상기 항체 또는 이의 항원 결합 단편의 중쇄 CDR3은 상기 일반식 8의 아미노산 서열로 표시되며, X81은 K이며; X82는 Y이며; X83은 Q 이며; X84는 W이며; X85는 D인 것을 특징으로 하는, 항체 또는 이의 항원 결합 단편.
  11. 제 1 항에 있어서, 상기 항체 또는 이의 항원 결합 단편은 경쇄 CDR1, CDR2 및 CDR3과 중쇄 CDR1, CDR2 및 CDR3를 포함하며, 하기의 아미노산 서열로 표시되는 것을 특징으로 하는, 항체 또는 이의 항원 결합 단편:
    (1) 상기 경쇄 CDR1은 서열번호 9, 경쇄 CDR2는 서열번호 20, 경쇄 CDR3은 서열번호 28, 중쇄 CDR1은 서열번호 41, 중쇄 CDR2는 서열번호 48 및 중쇄 CDR3은 서열번호 64;
    (2) 상기 경쇄 CDR1은 서열번호 10, 경쇄 CDR2는 서열번호 21, 경쇄 CDR3은 서열번호 29, 중쇄 CDR1은 서열번호 42, 중쇄 CDR2는 서열번호 49 및 중쇄 CDR3은 서열번호 65;
    (3) 상기 경쇄 CDR1은 서열번호 11, 경쇄 CDR2는 서열번호 22, 경쇄 CDR3은 서열번호 30, 중쇄 CDR1은 서열번호 41, 중쇄 CDR2는 서열번호 50 및 중쇄 CDR3은 서열번호 66;
    (4) 상기 경쇄 CDR1은 서열번호 11, 경쇄 CDR2는 서열번호 22, 경쇄 CDR3은 서열번호 30, 중쇄 CDR1은 서열번호 41, 중쇄 CDR2는 서열번호 51 및 중쇄 CDR3은 서열번호 67;
    (5) 상기 경쇄 CDR1은 서열번호 12, 경쇄 CDR2는 서열번호 23, 경쇄 CDR3은 서열번호 31, 중쇄 CDR1은 서열번호 43, 중쇄 CDR2는 서열번호 52 및 중쇄 CDR3은 서열번호 68;
    (6) 상기 경쇄 CDR1은 서열번호 13, 경쇄 CDR2는 서열번호 24, 경쇄 CDR3은 서열번호 32, 중쇄 CDR1은 서열번호 43, 중쇄 CDR2는 서열번호 53 및 중쇄 CDR3은 서열번호 69;
    (7) 상기 경쇄 CDR1은 서열번호 14, 경쇄 CDR2는 서열번호 24, 경쇄 CDR3은 서열번호 33, 중쇄 CDR1은 서열번호 42, 중쇄 CDR2는 서열번호 54 및 중쇄 CDR3은 서열번호 70;
    (8) 상기 경쇄 CDR1은 서열번호 11, 경쇄 CDR2는 서열번호 22, 경쇄 CDR3은 서열번호 34, 중쇄 CDR1은 서열번호 41, 중쇄 CDR2는 서열번호 55 및 중쇄 CDR3은 서열번호 71;
    (9) 상기 경쇄 CDR1은 서열번호 11, 경쇄 CDR2는 서열번호 22, 경쇄 CDR3은 서열번호 35, 중쇄 CDR1은 서열번호 44, 중쇄 CDR2는 서열번호 56 및 중쇄 CDR3은 서열번호 72;
    (10) 상기 경쇄 CDR1은 서열번호 15, 경쇄 CDR2는 서열번호 25, 경쇄 CDR3은 서열번호 36, 중쇄 CDR1은 서열번호 45, 중쇄 CDR2는 서열번호 57 및 중쇄 CDR3은 서열번호 73;
    (11) 상기 경쇄 CDR1은 서열번호 11, 경쇄 CDR2는 서열번호 22, 경쇄 CDR3은 서열번호 30, 중쇄 CDR1은 서열번호 42, 중쇄 CDR2는 서열번호 58 및 중쇄 CDR3은 서열번호 74;
    (12) 상기 경쇄 CDR1은 서열번호 16, 경쇄 CDR2는 서열번호 24, 경쇄 CDR3은 서열번호 37, 중쇄 CDR1은 서열번호 41, 중쇄 CDR2는 서열번호 59 및 중쇄 CDR3은 서열번호 75;
    (13) 상기 경쇄 CDR1은 서열번호 11, 경쇄 CDR2는 서열번호 22, 경쇄 CDR3은 서열번호 30, 중쇄 CDR1은 서열번호 46, 중쇄 CDR2는 서열번호 60 및 중쇄 CDR3은 서열번호 76;
    (14) 상기 경쇄 CDR1은 서열번호 17, 경쇄 CDR2는 서열번호 26, 경쇄 CDR3은 서열번호 38, 중쇄 CDR1은 서열번호 46, 중쇄 CDR2는 서열번호 61 및 중쇄 CDR3은 서열번호 77;
    (15) 상기 경쇄 CDR1은 서열번호 18, 경쇄 CDR2는 서열번호 27, 경쇄 CDR3은 서열번호 39, 중쇄 CDR1은 서열번호 47, 중쇄 CDR2는 서열번호 62 및 중쇄 CDR3은 서열번호 78; 또는
    (16) 상기 경쇄 CDR1은 서열번호 19, 경쇄 CDR2는 서열번호 23, 경쇄 CDR3은 서열번호 40, 중쇄 CDR1은 서열번호 41, 중쇄 CDR2는 서열번호 63 및 중쇄 CDR3은 서열번호 79.
  12. 제 1 항에 있어서, 상기 항체 또는 이의 항원 결합 단편은 경쇄 FR1, FR2, FR3 및 FR4와 중쇄 FR1, FR2, FR3 및 FR4를 포함하며, 상기 경쇄 FR1은 서열번호 1, 경쇄 FR2는 서열번호 2, 경쇄 FR3은 서열번호 3, 경쇄 FR4는 서열번호 4, 중쇄 FR1은 서열번호 5, 중쇄 FR2는 서열번호 6, 중쇄 FR3은 서열번호 7 및 중쇄 FR4는 서열번호 8의 아미노산 서열로 표시되는 것을 특징으로 하는, 항체 또는 이의 항원 결합 단편.
  13. 제 1 항의 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자.
  14. 제 13 항의 핵산분자를 포함하는 벡터.
  15. 제 14 항의 벡터를 포함하는 세포.
  16. 제 1 항의 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자, 또는 상기 핵산분자를 포함하는 벡터를 유효성분으로 포함하는 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스 감염의 예방 또는 치료용 약제학적 조성물.
  17. 제 1 항의 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자, 또는 상기 핵산분자를 포함하는 벡터의 약제학적 유효량을 대상체에게 투여하는 단계를 포함하는 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스 감염의 예방 또는 치료방법.
  18. 제 1 항의 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자, 또는 상기 핵산분자를 포함하는 벡터의 치료용도(for use in therapy).
  19. 제 1 항의 항체 또는 이의 항원 결합 단편, 상기 항체 또는 이의 항원 결합 단편을 코딩하는 핵산분자, 또는 상기 핵산분자를 포함하는 벡터를 유효성분으로 포함하는 사스-코로나 바이러스 2(SARS-CoV2) 또는 이의 변이 바이러스 감염의 진단용 조성물.
PCT/KR2022/014794 2022-07-12 2022-09-30 사스-코로나 바이러스 2 중화 항체 WO2024014619A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2022-0085495 2022-07-12
KR1020220085495A KR20240008997A (ko) 2022-07-12 2022-07-12 사스-코로나 바이러스 2 중화 항체

Publications (1)

Publication Number Publication Date
WO2024014619A1 true WO2024014619A1 (ko) 2024-01-18

Family

ID=89536998

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/014794 WO2024014619A1 (ko) 2022-07-12 2022-09-30 사스-코로나 바이러스 2 중화 항체

Country Status (2)

Country Link
KR (1) KR20240008997A (ko)
WO (1) WO2024014619A1 (ko)

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102233689B1 (ko) * 2020-11-26 2021-03-30 재단법인 오송첨단의료산업진흥재단 SARS-CoV-2 스파이크 단백질의 수용체-결합 도메인에 특이적으로 결합하는 항체 및 이의 이용
US20210261650A1 (en) * 2020-02-26 2021-08-26 Vir Biotechnology, Inc. Antibodies against sars-cov-2 and methods of using the same
WO2021226249A1 (en) * 2020-05-06 2021-11-11 Sorrento Therapeutics, Inc. Neutralizing antibodies that bind the sars-cov-2 s protein
KR20220054080A (ko) * 2020-10-23 2022-05-02 주식회사 와이바이오로직스 SARS-CoV-2 스파이크 단백질에 특이적으로 결합하는 항체 및 이의 용도

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20210261650A1 (en) * 2020-02-26 2021-08-26 Vir Biotechnology, Inc. Antibodies against sars-cov-2 and methods of using the same
WO2021226249A1 (en) * 2020-05-06 2021-11-11 Sorrento Therapeutics, Inc. Neutralizing antibodies that bind the sars-cov-2 s protein
KR20220054080A (ko) * 2020-10-23 2022-05-02 주식회사 와이바이오로직스 SARS-CoV-2 스파이크 단백질에 특이적으로 결합하는 항체 및 이의 용도
KR102233689B1 (ko) * 2020-11-26 2021-03-30 재단법인 오송첨단의료산업진흥재단 SARS-CoV-2 스파이크 단백질의 수용체-결합 도메인에 특이적으로 결합하는 항체 및 이의 이용

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
CAMERONI ELISABETTA; BOWEN JOHN E.; ROSEN LAURA E.; SALIBA CHRISTIAN; ZEPEDA SAMANTHA K.; CULAP KATJA; PINTO DORA; VANBLARGAN LAUR: "Broadly neutralizing antibodies overcome SARS-CoV-2 Omicron antigenic shift", NATURE, vol. 602, no. 7898, 23 December 2021 (2021-12-23), pages 664 - 670, XP037700797, DOI: 10.1038/s41586-021-04386-2 *
KIM JI WOONG, MIN SUNG WON, LEE JICHUL, SHIN HA GYEONG, CHOI HYE LIM, YANG HA RIM, LEE JI HYUN, CHO YEA BIN, SHIM HYUNBO, LEE SUKM: "Development and Characterization of Phage-Display-Derived Novel Human Monoclonal Antibodies against the Receptor Binding Domain of SARS-CoV-2", BIOMEDICINES, MDPI, BASEL, vol. 10, no. 12, 17 December 2022 (2022-12-17), Basel , pages 3274, XP093127761, ISSN: 2227-9059, DOI: 10.3390/biomedicines10123274 *

Also Published As

Publication number Publication date
KR20240008997A (ko) 2024-01-22

Similar Documents

Publication Publication Date Title
WO2022022445A1 (zh) 一种特异性结合冠状病毒的抗体或其抗原结合片段
AU2019229076B2 (en) Anti-TIGIT antibodies and uses thereof
WO2014119969A1 (ko) 보체 관련 질환의 예방 및 치료를 위한 c5 항체 및 방법
WO2011111966A2 (en) Human monoclonal antibodies derived from human b cells and having neutralizing activity against influenza a viruses
WO2017164678A2 (ko) 중증열성혈소판감소증후군 바이러스의 외막 당단백질에 결합하는 항체 및 이의 용도
WO2017074074A1 (en) Novel anti-glypican 3 antibody and pharmaceutical composition containing the same
WO2016085289A1 (ko) B형 간염 바이러스의 pres1에 특이적으로 결합하는 항체 및 이의 용도
WO2017074013A1 (ko) 인간 및 마우스 sema3a에 교차결합하는 항체 및 그의 용도
WO2016085284A1 (ko) B형 간염 바이러스 표면 항원의 에피토프 및 이에 특이적으로 결합하는 b형 간염 바이러스 중화 결합 분자
WO2020004934A1 (ko) 항-bcma 항체 및 그 용도
WO2024014619A1 (ko) 사스-코로나 바이러스 2 중화 항체
WO2022220603A1 (ko) 코로나-19 바이러스 표적 인간 항체
WO2022216014A1 (ko) 항-cntn4 항체 및 그의 용도
WO2015147611A1 (en) Influenza a virus-specific monoclonal antibody and method for treating and diagnosing influenza infection using the same
WO2022025585A1 (ko) 항-lilrb1 항체 및 그의 용도
WO2019151632A1 (ko) 중동호흡기증후군 코로나바이러스에 중화활성을 갖는 결합 분자
WO2014021693A2 (ko) Tm4sf5 단백질에 특이적으로 결합하는 신규한 단일클론항체 및 이의 용도
WO2023022271A1 (ko) 항-igsf1 항체 및 이의 용도
WO2017142294A1 (ko) EGFRvIII에 대한 항체 및 이의 용도
WO2022098173A1 (ko) 코로나바이러스 스파이크 단백질에 특이적인 항체 및 이의 용도
WO2017209553A2 (ko) 환자 유래 세포를 이용한 항체 스크리닝 방법
WO2022092644A1 (ko) Wars 중화항체 및 이의 용도
WO2023132719A1 (ko) Cd40l에 특이적으로 결합하는 항체 및 그의 용도
WO2022216096A1 (ko) 항암 및 면역증강용 신규 타겟
WO2021261906A1 (ko) 항 pcsk9 항체 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22951274

Country of ref document: EP

Kind code of ref document: A1