WO2021261906A1 - 항 pcsk9 항체 및 이의 용도 - Google Patents

항 pcsk9 항체 및 이의 용도 Download PDF

Info

Publication number
WO2021261906A1
WO2021261906A1 PCT/KR2021/007876 KR2021007876W WO2021261906A1 WO 2021261906 A1 WO2021261906 A1 WO 2021261906A1 KR 2021007876 W KR2021007876 W KR 2021007876W WO 2021261906 A1 WO2021261906 A1 WO 2021261906A1
Authority
WO
WIPO (PCT)
Prior art keywords
pcsk9
antibody
seq
cholesterol
cells
Prior art date
Application number
PCT/KR2021/007876
Other languages
English (en)
French (fr)
Inventor
이현호
박주웅
강태욱
Original Assignee
바이오스트림테크놀러지스(주)
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 바이오스트림테크놀러지스(주) filed Critical 바이오스트림테크놀러지스(주)
Priority to US18/003,121 priority Critical patent/US20230242673A1/en
Publication of WO2021261906A1 publication Critical patent/WO2021261906A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/40—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against enzymes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/06—Antihyperlipidemics
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the present invention relates to the field of antibody pharmaceuticals, and more particularly, to an antibody that specifically binds to proprotein convertase subtilisin/kexin type 9 (PCSK9), uses thereof, and methods for producing the same.
  • PCSK9 proprotein convertase subtilisin/kexin type 9
  • Hyperlipidaemia refers to a condition in which more than necessary fat constituents, such as low-density lipoprotein cholesterol (LDL), high-density lipoprotein cholesterol (HDL), ultra-low-density lipoprotein cholesterol (VLDL), and triglycerides, exist in the blood and cause inflammation.
  • LDL low-density lipoprotein cholesterol
  • HDL high-density lipoprotein cholesterol
  • VLDL ultra-low-density lipoprotein cholesterol
  • triglycerides triglycerides
  • ADH autosomal dominant hypercholesterolemia
  • a PCSK9 inhibitor in patients with atherosclerotic cardiovascular disease (ASCVD) may increase the LDL cholesterol circulation rate. It has been reported that it can increase the number of LDLR.
  • ASCVD atherosclerotic cardiovascular disease
  • ACS acute coronary syndrome
  • unplanned coronary intervention recurrence of ischemic stroke within 5 years
  • hypercholesterolemia it has been reported that hypertension may be involved.
  • PCSK9 inhibitors can be administered to patients without ASCVD, familial hypercholesterolemia, and statin intolerance.
  • a monoclonal antibody that is a PCSK9 inhibitor is required, and in particular, an antibody having safety and effectiveness can be widely applied industrially.
  • the present invention relates to an anti-PCSK9 antibody that specifically binds to PCSK9.
  • the PCSK9 protein in which amino acids at a specific site within the range that do not affect the function were removed was expressed and purified using prokaryotic cells and used as an immunogen.
  • an anti-PCSK9 antibody specifically binding to PCSK9 was prepared.
  • the prepared antibody can increase LDL uptake into cells by inhibiting the binding of LDLR and PCSK9.
  • one aspect of the present invention provides a pharmaceutical composition for treating or preventing cholesterol-related diseases comprising an antibody that specifically binds to amino acids 209 to 218 of human PCSK9 as an active ingredient.
  • Another aspect of the present invention is a light chain variable region comprising LCDR1 of SEQ ID NO: 1, LCDR2 of SEQ ID NO: 2, and LCDR3 of SEQ ID NO: 3; And HCDR1 of SEQ ID NO: 4, HCDR2 of SEQ ID NO: 5, and a heavy chain variable region comprising HCDR3 of SEQ ID NO: 6 It provides an antibody specific to PCSK9 and a pharmaceutical composition thereof.
  • Another aspect of the present invention provides a polynucleotide encoding an antibody specific for PCSK9.
  • Another aspect of the present invention provides a vector comprising a polynucleotide encoding an antibody specific for PCSK9.
  • Another aspect of the present invention provides a transformed cell into which the vector is introduced.
  • Another aspect of the present invention comprises the steps of culturing the transformed cells into which the vector is introduced; It provides a method for producing an antibody specific to PCSK9, comprising the step of obtaining an antibody specific to PCSK9 from the culture medium.
  • compositions comprising an antibody that specifically binds to amino acids 209 to 218 of human PCSK9 as an active ingredient for treating or preventing cholesterol-related diseases.
  • a method for treating or preventing a cholesterol-related disease comprising administering to an individual a pharmaceutical composition comprising an antibody that specifically binds to amino acids 209 to 218 of human PCSK9 as an active ingredient provides
  • the anti-PCSK9 antibody of the present invention specifically binds to PCSK9, but binds to an epitope different from the previously known epitope.
  • the binding force with PCSK9 is very good. Therefore, the anti-PCSK9 antibody can block the binding of LDLR to plasma PCSK9, thereby preventing absorption and degradation of LDLR.
  • it can increase the level and amount of LDLR expression on the cell surface and increase LDL reuptake by LDLR. Therefore, the anti-PCSK9 antibody can be usefully used to treat or prevent hypercholesterolemia, hyperlipidemia, atherosclerotic cardiovascular disease (ACVD), acute coronary syndrome (ACS) and hypertension.
  • ACVD atherosclerotic cardiovascular disease
  • ACS acute coronary syndrome
  • Figure 1a shows the DNA sequence of BST PM1 bound to the pGEX 4T-1 vector (SEQ ID NO: 58).
  • Figure 1b shows the amino acid sequence of BST PM1 bound to the pGEX 4T-1 vector (SEQ ID NO: 57).
  • Figure 2 shows the Western blot results of BST PM1 Ag and PCSK9 polyclonal antibody: M: size marker, Lane 1: PCSK9 original antigen, coomassie staining, Lane 2: BST PM1 Ag, coomasie staining, Lane 3: PCSK9 original antigen and western blot band using PCSK9 Pab (polyclonal antibody), Lane 4: Western blot band using BST PM1 Ag and PCSK9 Pab (polyclonal antibody).
  • Figure 3a shows the ELISA results of the primary screening for monoclonal antibody selection.
  • Figure 3b shows the ELISA result of the secondary screening for monoclonal antibody selection.
  • Figure 4a shows the FACS results of the selected 8 kinds of anti-PCSK9 antibodies.
  • Figure 4b confirms the isotypes of the selected eight anti-PCSK9 antibodies.
  • 11 shows the humanization variable region sequence information of the 7D1 anti-PCSK9 antibody.
  • 14A to 14D show the results of Octet analysis for the antigen PCSK9 Ag after purification of ch7D1 and two types of hz7D1 IgG.
  • One aspect of the present invention provides a pharmaceutical composition for treating or preventing cholesterol-related diseases comprising an antibody that specifically binds to amino acids 209 to 218 of human PCSK9 as an active ingredient.
  • PCSK9 or “subtilisin/kexin type 9” refers to an enzyme encoded by the human PCSK9 gene on chromosome 1.
  • PCSK9 is the ninth member of the proprotein converting enzyme family of proteins that activate other proteins. The enzyme consists of 692 amino acid residues. It is mainly present in the liver, kidney, and small intestine, and is expressed in stromal cells, mesenchymal cells, and colonic epithelial cells, and is present in the blood.
  • the PCSK9 may have the amino acid sequence of SEQ ID NO: 49.
  • the 209th to 218th amino acid sequence of human PCSK9 may be the amino acid sequence of SEQ ID NO: 27.
  • PCSK9 can mediate the degradation of LDLR (LDL receptor) present on the surface of the plasma membrane of hepatocytes.
  • PCSK9 can bind to growth factor-like repeat homology domain-A (EGF-A) in the LDLR structure.
  • EGF-A growth factor-like repeat homology domain-A
  • the LDLR/PCSK9 complex is taken up by hepatocytes.
  • the absorbed LDLR/PCSK9 complex inhibits conformational change of LDLR in endosomes of hepatocytes, thereby preventing dissociation and recycling of LDLR.
  • the LDLR/PCSK9 complex is transported to ribosomes that degrade the protein.
  • the cholesterol-related disease is one selected from the group consisting of hypercholesterolemia, hyperlipidemia, atherosclerotic cardiovascular disease (ACVD), acute coronary syndrome (ACS), hypertension, diabetes, stroke, Alzheimer's disease and dyslipidemia.
  • ACVD atherosclerotic cardiovascular disease
  • ACS acute coronary syndrome
  • hypertension diabetes, stroke, Alzheimer's disease and dyslipidemia.
  • BST PM1 Ag from which a part of PCSK9 has been removed can be used as an antigen for obtaining the antibody.
  • BST PM1 Ag refers to a PCSK9 protein fragment used for immunization. This antigen is also referred to as “BST PM1”.
  • BST PM1 Ag is a variant of PCSK9 in which amino acids in the region corresponding to the binding site of the Amgen patent (Korean Patent No. 10-1494932) have been removed within the range that does not affect the antigen activity in the PCSK9 protein. to be.
  • the "BST PM1 Ag” refers to a form in which the amino acids of SEQ ID NOs: 28, 29, 30, 31, 32, 33, 34, 35, 36, 37 and 38 have been removed from the human PCSK9 protein. This is a form in which the anti-PCSK9 antibody of Amgen's anti-PCSK9 antibody patent has removed the site binding to the epitope in the PCSK9 fragment. Sequence comparison of Human PCSK9 and BST PM1 Ag was compared with Multiple sequence alignment by Florence Corpet to compare the positions of deleted amino acids (FIG. 1c).
  • Another aspect of the present invention is a light chain variable region comprising LCDR1 of SEQ ID NO: 1, LCDR2 of SEQ ID NO: 2, and LCDR3 of SEQ ID NO: 3; And it provides an antibody or fragment thereof specific for PCSK9 comprising a heavy chain variable region comprising HCDR1 of SEQ ID NO: 4, HCDR2 of SEQ ID NO: 5, and HCDR3 of SEQ ID NO: 6.
  • the antibody may be a humanized antibody or a human antibody.
  • the antibody may specifically bind to a polypeptide or protein having the amino acid sequence of SEQ ID NO: 27, SEQ ID NO: 49, and/or SEQ ID NO: 50 of PCSK9.
  • it can specifically bind to an antigen having the amino acid sequence of SEQ ID NO: 50.
  • the heavy chain region of the antibody may have the amino acid sequence of SEQ ID NO: 19 or SEQ ID NO: 23.
  • the heavy chain region of the antibody has 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to the amino acid sequence of SEQ ID NO: 19 or SEQ ID NO: 23 may comprise or consist of an amino acid sequence having 100% identity.
  • the light chain region of the antibody may have the amino acid sequence of SEQ ID NO: 21 or SEQ ID NO: 25.
  • the light chain region of the antibody has 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity to the amino acid sequence of SEQ ID NO: 21 or SEQ ID NO: 25 may comprise or consist of an amino acid sequence having 100% identity.
  • antibody fragment refers to a Fab fragment, Fab' fragment, F(ab')2 fragment having antigen-binding activity, as well as an scFv fragment, which is an Fv fragment that binds to human PCSK9; one or more CDR regions of an antibody described herein, selected from the group consisting of SEQ ID NO: 1 to SEQ ID NO: 6.
  • An Fv fragment is the smallest antibody fragment that contains a heavy chain variable region and a light chain variable region, without a constant region, and retains all antigen-binding sites.
  • antibody refers to an immunoglobulin, a structure of four peptide chains linked to each other by disulfide bonds between two identical heavy chains and two identical light chains. Different immunoglobulin heavy chain constant regions exhibit different amino acid compositions and sequences and thus possess different types of antigenicity. Thus, immunoglobulins can be classified into five categories, or can be referred to as immunoglobulin isotypes, i.e., IgM, IgD, IgG, IgA and IgE, and the corresponding heavy chains each have a ⁇ chain, a ⁇ chain, a ⁇ chain, ⁇ chain and ⁇ chain.
  • immunoglobulin isotypes i.e., IgM, IgD, IgG, IgA and IgE
  • IgG can be classified as IgG1, IgG2, IgG3, and IgG4.
  • Light chains can be classified as ⁇ or ⁇ chains according to different constant regions.
  • Each of the five types of IgG can have either a ⁇ or a ⁇ chain.
  • the antibody may have a ⁇ chain.
  • the anti-PCSK9 antibody or antigen-binding fragment thereof of the present invention comprises a light chain variable region (LCVR), wherein the LCVR comprises complementarity determining regions (CDRs) LCRD1, LCDR2 and LCDR3, LCRD1, LCDR2 and LCDR3 comprise at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of an amino acid sequence selected from the group consisting of SEQ ID NOs: 1, 2 and 3, respectively. may comprise or consist of an amino acid sequence having identity or 100% identity.
  • the LCRD1, LCDR2 and LCDR3 may have the amino acid sequences of SEQ ID NOs: 1, 2 and 3, respectively.
  • the anti-PCSK9 antibody or antigen-binding fragment thereof of the present invention comprises a heavy chain variable region (HCVR), wherein the HCVR comprises complementarity determining regions (CDRs) HCRD1, HCDR2 and HCDR3, HCRD1, HCDR2 and HCDR3 comprise at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% of an amino acid sequence selected from the group consisting of SEQ ID NOs: 4, 5 and 6, respectively. may comprise or consist of an amino acid sequence having identity or 100% identity.
  • the HCRD1, HCDR2 and HCDR3 may have the amino acid sequences of SEQ ID NOs: 4, 5 and 6, respectively.
  • humanized antibody refers to a chimeric antibody comprising amino acid residues from a non-human hypervariable region (HVR) and amino acid residues from a human framework (FR).
  • a humanized antibody comprises substantially all of at least one, typically two, variable domains, wherein substantially all of the hypervariable regions (eg, CDRs) correspond to those of a non-human antibody, and All framework regions (FRs) correspond to those of human antibodies.
  • a humanized antibody may optionally comprise at least a portion of an antibody constant region derived from a human antibody.
  • a “humanized form” of a non-human antibody refers to an antibody that has undergone humanization.
  • Another aspect of the present invention is to provide a pharmaceutical composition for the treatment or prevention of cholesterol-related diseases comprising the antibody as an active ingredient.
  • the cholesterol-related disease is one selected from the group consisting of hypercholesterolemia, hyperlipidemia, atherosclerotic cardiovascular disease (ACVD), acute coronary syndrome (ACS), hypertension, diabetes, stroke, Alzheimer's disease and dyslipidemia.
  • ACVD atherosclerotic cardiovascular disease
  • ACS acute coronary syndrome
  • hypertension diabetes, stroke, Alzheimer's disease and dyslipidemia.
  • the pharmaceutical composition of the present invention contains the antibody as an active ingredient in an amount of from about 0.01% to about 95% by weight, or from about 0.1% to about 90% by weight, specifically from about 0.5% to about 75% by weight, based on the total weight of the composition. %, more specifically, from about 1% to about 50% by weight.
  • the pharmaceutical composition of the present invention may include conventional and non-toxic pharmaceutically acceptable additives formulated into a formulation according to a conventional method.
  • the pharmaceutical composition may further include a pharmaceutically acceptable carrier, diluent or excipient.
  • additives used in the composition of the present invention may include sweetening agents, binders, solvents, solubilizing agents, wetting agents, emulsifying agents, isotonic agents, absorbents, disintegrating agents, antioxidants, preservatives, lubricants, glidants, fillers, and the like.
  • composition of the present invention may be formulated in various formulations for parenteral administration (eg, intramuscular, intravenous or subcutaneous injection).
  • parenteral administration eg, intramuscular, intravenous or subcutaneous injection.
  • preparations for parenteral administration include sterile aqueous solutions, non-aqueous solutions, suspensions, emulsions, lyophilized preparations and suppositories.
  • Non-aqueous solvents and suspending agents include propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable esters such as ethyl oleate.
  • the suppositories are Witepsol, Macrogol, and Twin61. Cacao butter, laurin fat, glycerogelatin, etc. may be used.
  • the injection may contain conventional additives such as solubilizers, isotonic agents, suspending agents, emulsifiers, stabilizers, preservatives, and the like.
  • the antibody or composition of the present invention may be administered to a patient in a therapeutically effective amount or in a pharmaceutically effective amount.
  • terapéuticaally effective amount refers to an amount of an antibody or composition effective for preventing or treating a target disease, which is sufficient to treat the disease with a reasonable benefit/risk ratio applicable to medical treatment, and It means an amount that does not cause side effects.
  • the level of the effective amount may be determined by the patient's health condition, disease type, severity, drug activity, drug sensitivity, administration method, administration time, administration route and excretion rate, treatment period, factors including the combination or concurrently used drugs; It may be determined according to factors well known in the medical field.
  • the term “administration” refers to introducing a predetermined substance to an individual by an appropriate method, and the administration route of the composition may be administered through any general route as long as it can reach a target tissue.
  • Intraperitoneal administration, intravenous administration, intramuscular administration, subcutaneous administration, intradermal administration, topical administration, intranasal administration, intrapulmonary administration may be administered intrarectally, but is not limited thereto.
  • the antibody or composition of the present invention may be administered as an individual therapeutic agent or in combination with other therapeutic agents, may be administered sequentially or simultaneously with conventional therapeutic agents, or may be administered singly or multiple times. Taking all of the above factors into consideration, it is important to administer an amount that can obtain the maximum effect with the minimum amount of side effects or without side effects, which can be easily determined by those skilled in the art.
  • the effective amount of the antibody in the composition of the present invention may vary depending on the age, sex, and weight of the patient, and in general, from about 0.1 mg to about 1,000 mg, or from about 5 mg to about 200 mg per kg of body weight daily or It can be administered every other day or divided into 1 to 3 times a day.
  • the scope of the present invention is not limited thereto since it may increase or decrease depending on the route of administration, disease severity, sex, weight, age, etc.
  • compositions comprising an antibody that specifically binds to amino acids 209 to 218 of human PCSK9 as an active ingredient for treating or preventing cholesterol-related diseases.
  • composition and cholesterol-related diseases are as described above.
  • a method for treating or preventing a cholesterol-related disease comprising administering to an individual a pharmaceutical composition comprising an antibody that specifically binds to amino acids 209 to 218 of human PCSK9 as an active ingredient provides
  • the individual By administering the composition of the present invention to an individual having a cholesterol-related disease, the individual can be effectively treated or prevented.
  • the subject may be a mammal, preferably a human.
  • the composition and types of cholesterol-related diseases are the same as described above.
  • the composition may be administered to a subject in various ways and amounts depending on the patient's condition and side effects depending on the route of administration, dosage, and frequency of administration, and the optimal administration method, dosage, and frequency of administration may be within an appropriate range by those skilled in the art. can be selected as
  • Another aspect of the present invention provides a polynucleotide encoding an antibody specific for PCSK9.
  • the anti-PCSK9 antibody is the same as described above.
  • the heavy chain region of the polynucleotide may be SEQ ID NO: 20 or SEQ ID NO: 24, and the light chain region may be SEQ ID NO: 22 or SEQ ID NO: 26.
  • the polynucleotide may additionally include a signal sequence or a leader sequence.
  • signal sequence refers to a nucleic acid encoding a signal peptide that directs secretion of a target protein. The signal peptide is cleaved after translation in the host cell.
  • the signal sequence of the present invention is a nucleotide encoding an amino acid sequence that initiates the movement of a protein through the ER (endoplasmic reticulum) membrane.
  • Another aspect of the present invention provides a vector comprising a polynucleotide encoding an antibody specific for PCSK9.
  • the heavy chain region of the polynucleotide may include SEQ ID NO: 20 or SEQ ID NO: 24, and the light chain region may include SEQ ID NO: 22 or SEQ ID NO: 26.
  • it may be a polynucleotide comprising SEQ ID NO: 20 and SEQ ID NO: 22.
  • it may be a polynucleotide comprising SEQ ID NO: 24 and SEQ ID NO: 26.
  • the polynucleotide may additionally include a signal sequence or a leader sequence.
  • the signal sequence is the same as described above.
  • the vector may be two vectors each including a combination of the polynucleotides of the heavy chain and the light chain, or a bicistronic vector including all of the polynucleotides of the combination.
  • the term “vector” may be introduced into a host cell, recombine and inserted into the host cell genome. or said vector is understood as a nucleic acid means comprising a nucleotide sequence capable of spontaneous replication as an episome.
  • the vector may be operably linked to an appropriate promoter so that the polynucleotide can be expressed in a host cell, and linear nucleic acids, plasmids, phagemids, cosmids, RNA vectors, viral vectors, mini-chromosomes and analogs thereof include Examples of viral vectors include, but are not limited to, retroviruses, adenoviruses, and adeno-associated viruses.
  • the plasmid may contain a selectable marker such as an antibiotic resistance gene, and host cells maintaining the plasmid may be cultured under selective conditions.
  • gene expression or "expression” of a protein of interest is understood to mean transcription of a DNA sequence, translation of an mRNA transcript, and secretion of a fusion protein product or fragment thereof.
  • Another aspect of the present invention provides a transformed cell into which the vector is introduced.
  • transformed cell refers to prokaryotic and eukaryotic cells into which a recombinant expression vector can be introduced.
  • the transformed cell may be prepared by introducing a vector into a host cell and transforming it.
  • the fusion protein of the present invention can be produced by expressing the polynucleotide contained in the vector.
  • the transformation can be performed by various methods. As long as it can produce the fusion protein of the present invention, it is not particularly limited thereto. Specifically, the transformation method is CaCl 2 precipitation method, CaCl 2 Hanahan increased efficiency by using a reducing material called DMSO (dimethyl sulfoxide) in the precipitation method Method, electroporation (electroporation), calcium phosphate precipitation method, protoplast fusion method, agitation method using silicon carbide fiber, agrobacterium mediated transformation method, transformation method using PEG, dextran sulfate, lipofectamine and drying /inhibition mediated transformation methods and the like can be used.
  • the infection infection
  • a target object can be delivered into a cell using virus particles.
  • the vector can be introduced into the host cell by gene bombardment or the like.
  • the host cell used for the production of the transformed cell can also produce the fusion protein of the present invention, it is not particularly limited thereto.
  • the host cell may include, but is not limited to, a cell of prokaryotic, eukaryotic, mammalian, plant, insect, fungal or cellular origin.
  • E. coli may be used as an example of the prokaryotic cell.
  • yeast may be used as an example of the eukaryotic cell.
  • the mammalian cells include CHO cells, F2N cells, COS cells, BHK cells, Bowes melanoma cells, HeLa cells, 911 cells, AT1080 cells, A549 cells, SP2/0 cells, and human lymphoblastoid cells.
  • NSO cells HT-1080 cells, PERC.6 cells, HEK 293 cells or HEK293T cells may be used, but is not limited thereto, and any cell usable as a mammalian host cell known to those skilled in the art may be used.
  • Another aspect of the present invention comprises the steps of culturing the transformed cells into which the vector is introduced; It provides a method for producing an antibody specific to PCSK9, comprising the step of obtaining an antibody specific to PCSK9 from the culture medium.
  • culture refers to a method of growing microorganisms in an artificially and appropriately controlled environmental condition.
  • the method of culturing the transformed cells can be performed using a method well known in the art.
  • the culture is not particularly limited as long as it can be produced by expressing the fusion protein of the present invention.
  • the culture may be continuously cultured in a batch process or in a fed batch or repeated fed batch process.
  • the step of recovering the fusion protein from the culture may be performed by a method known in the art.
  • the recovery method is not particularly limited as long as it can recover the produced fusion protein of the present invention.
  • the recovery method is centrifugation, filtration, extraction, spraying, drying, evaporation, precipitation, crystallization, electrophoresis, fractional dissolution (eg ammonium sulfate precipitation), chromatography (eg ion exchange, affinity , hydrophobicity and size exclusion) and the like.
  • the antigen of the present invention was prepared by cloning the expression vector pGEX 4T1 after synthesizing DNA encoding BST PM1 Ag.
  • IPTG was added to induce the expression of BST PM1 Ag.
  • BST PM1 Ag expressed in a fused form with GST tag was first purified by GST affinity chromatography. Thereafter, the target protein was eluted by secondary ion chromatography (Diethylaminoethyl cellulose, DEAE). Finally, size exclusion chromatography (SEC) was performed to prepare a protein to be used for final immunization.
  • hybridoma of the present invention immunization was performed using mouse immunized animals. Thereafter, hybridoma cells were prepared by combining with cells obtained from the animal and NS0 cells. By ELISA screening using Human PCSK9, BST PM1 Ag, and GST proteins, hybridoma cells that bind well to Human PCSK9 and BST PM1 Ag but do not bind to GST protein were selectively sorted. After that, the selected three types of hybridoma cells were adapted to the serum-free medium condition, and the appropriate cells were added to complete the culture. Antibody purification was carried out using Protein G column, eluted with an acidic elution solution, and then dialyzed against PBS to complete antibody preparation. In order to prove the functional effect of the prepared antibody, the anti-PCSK9 antibody was selected through an experiment in which cells increase LDL uptake by inhibiting the binding of LDLR and PCSK9.
  • the monoclonal antibody specifically binding to PCSK9 includes a heavy chain variable region of HCDR1, HCDR2 and HCDR3 sequences and a light chain variable region containing LCDR1, LCDR2 and LCDR3 sequences, and the LCDR1 sequence of the light chain variable region is KSSQSLLDSDGKTYLN (sequence No. 1), the LCDR2 sequence has an amino acid sequence of LVSKLDS (SEQ ID NO: 2), and the LCDR3 sequence is WQGTHFPQT (SEQ ID NO: 3).
  • the HCDR1 sequence of the heavy chain variable region is DYYMH (SEQ ID NO: 4)
  • the HCDR2 sequence is YIDPENGDTEYAPKFQG (SEQ ID NO: 5)
  • the HCDR3 sequence has the amino acid sequence of SPFTY (SEQ ID NO: 6) (Table 1).
  • PCSK9 Ag epitope sequence position amino acid sequence SEQ ID NO: 27 209 - 218 PEEDGTRFHR
  • SEQ ID NO: 57 GST-PCSK9 amino acid sequence
  • SEQ ID NO: 58 GST-PCSK9 DNA sequence
  • Example 1.1 pGEX4T-1 vector cloning of PCR product of BST PM1 gene
  • E. coli DH5 ⁇ was transformed, and colonies were selected by plating on Luria-Bertani (LB) agar medium containing Ampicillin (100 ug/ml). Then, in order to check whether the gene was properly inserted, colonies were inoculated into LB medium, cultured, and then cells were harvested using a centrifuge. Recombinant plasmid was isolated using HiGene plasmid MiniPrpep kit (Biofact, Korea), and as a result of treatment with restriction enzymes (BamH1/EcoR1), the DNA band of the BST PM1 gene and the pGEX4T-1 vector band were identified. PCSK9 original antigen and BST PM1 antigen had a difference in sequence, and the difference was compared by sequence alignment, and the results are shown in FIG. 1c.
  • E. coli BL21 (DE3) cells were transformed and then plated on Luria-Bertani (LB) agar medium containing Ampicillin (100 ug/ml) to generate colonies. Thereafter, cells were obtained from colonies and inoculated in 50 ml Luria-Bertani (LB) medium, and then cultured at 37° C. for 12 hours.
  • LB Luria-Bertani
  • aqueous cell lysate 50 ml was filtered with a 0.45 um syringe filter, and then loaded into a 5 ml GST Trap FF affinity column (GE Healthcare) equilibrated with a lysis buffer at a rate of 1 ml/min.
  • the lysis buffer of 10 CV (column volume) of the column volume was performed at 2 ml/min and washed sufficiently, and then the protein sample was washed with an elution buffer (PBS, 10 mM Glutathione, pH 7.4). ) was used to elute with a linear gradient of 1 ml/min.
  • PBS 10 mM Glutathione, pH 7.4
  • 1 ml HighTrap DEAE FF column GE Healthcare
  • the target protein was identified in DEAE flow-through and re-isolated through size exclusion chromatography (SEC). 0.5 in Hiprep 26/60 Sephacryl S-200 HR (GE Healthcare) equilibrated with Buffered Phosphate Buffered Saline (PBS), pH 7.4, 137 mM NaCl, 2.7 mM KCl, 10 mM Na 2 HPO 4 , 1.8 mM KH 2 PO 4 loaded at ml/min. Three-step column work was performed, and FPLC chromatography and BST PM1 Ag during the separation process were confirmed using 12% SDS PAGE gel.
  • SEC size exclusion chromatography
  • BST PM1 antigen was mixed with Adjuvant (Sigma, Cat No: T2684) into mice (BALB/c) and injected, and blood was collected from the mice to confirm antibody production by ELISA.
  • Adjuvant Sigma, Cat No: T2684
  • the antibody titer (1:5,000) increased appropriately, and the spleen was removed from the immunized mice to isolate B lymphocytes.
  • the fused cells are cultured in a medium containing hypoxanthin, aminopterine and thymidine (HAT medium) to fusion only myeloma and B lymphocytes.
  • HAT medium hypoxanthin, aminopterine and thymidine
  • B lymphocytes are normal cells, they die during long-term culture, but myeloma cells are transformed cells, so hybridomas are selectively selected by HAT.
  • HAT human immunoglobulin-associated antigen-reactive antibodies
  • Clones that bind to BST PM1 Ag used for immunization in numerous generated monoclonal hybridoma cells and do not bind to GST tag were first selected through ELISA analysis using the following protocol. 100 ng/well of BST PM1 Ag and GST tag diluted in 0.2 M sodium carbonate pH 9.5 were added to a 96-well plate (Corning Life Sciences), followed by incubation at 4°C overnight for coating. Then, the plate was washed three times using the washing solution PBS (pH 7.4), and the plate was incubated at room temperature for 1 hour with 200 ul of PBST (pH 7.4) containing 5% skim milk.
  • BST PM1 Ag 2) BST PM1 GST tag removed, 3 monoclonal hybridoma cells first selected through ELISA screening were diluted in 0.2 M sodium carbonate, pH 9.5 in a 96-well plate (Corning Life Sciences) ) PCSK9 original, 4) 100 ng/well of GST tag was added, and then incubated at 4° C. overnight for coating. Then, the plate was washed three times using a washing solution PBS (pH 7.4), and the plate was incubated with 200 ul of 5% skim milk dissolved in PBST (pH 7.4) for 1 hour at room temperature.
  • PBS pH 7.4
  • HepG2 cells were FACS-analyzed using 20 hybridoma cell cultures selected for secondary screening. HepG2 cells cultured in Flask were treated with Tripsin-EDTA and removed, and then centrifuged at 1,000 rpm for 3 minutes to obtain cells. After removing the media, cells were washed with PBS (3% FBS/PBS) containing 3% FBS, and centrifuged at 1,000 rpm for 3 minutes to obtain cells. 1x10 5 cells were treated with 1 ml of BST-PM1 hybridoma cell culture medium, and then incubated on ice for 1 hour.
  • PBS 3% FBS/PBS
  • Cells were obtained by centrifugation at 1,000 rpm for 3 minutes, then treated with 3% FBS/PBS to wash the cells, and then centrifuged at 1,000 rpm for 3 minutes to obtain cells.
  • Anti-mouse IgG FITC (Invitrogen, F2761) was diluted 1:100 in 3% FBS/PBS and 1 ml of the obtained cells were treated and then incubated on ice for 1 hour. After centrifugation at 1,000 rpm for 3 minutes to obtain cells, the cells were resuspended by treatment with 3% FBS/PBS, and then subjected to FACS analysis using a Beckman Coulter equipment (CYTOMICS FC 500).
  • HepG2 cells and Mouse 2nd control were similarly observed with an MFI of 1.0 or less, but it was confirmed that 8 clones were bound in the analysis result using 20 hybridoma cultures. It was measured and had the highest binding force, and FACS results and MFI values are shown in FIG. 4a. In addition, the isotypes of 8 types of anti-PCSK9 antibodies were confirmed, and each type is shown in FIG. 4b.
  • Three selected hybridoma cells (9G8, 4B10, 7D1) were cultured in the presence of 10% FBS.
  • FBS FBS-free medium
  • SFM Serum free media
  • Thermo fisher Cat No: 12045076 was used, and the FBS concentration was gradually lowered and the cells were cultured to adapt.
  • 2x10 6 9G8, 4B10, 7D1 hybridoma cells were cultured in 10 ml of a serum-free medium in a 75T flask to proliferate the cells. After removing the cultured cells by pipetting, collect the cells by centrifugation at 1,200 rpm, 3 minutes, and room temperature, measure the number of cells, put them in an Erlenmeyer flask to contain 1x10 5 cells/ml, and add 100 ml serum-free medium. The given cells were cultured (1x10 7 ). 37° C., 5% CO 2 , and incubated at 100 rpm for 8 days.
  • PCSK9 Ag Human PCSK9 protein, Acro's Cat No: PC9-H5223
  • PBST washing solution
  • PCSK9 original PCSK9 (human) recombinant protein, Abnova Cat No: H00255738-P01
  • PCSK9 original PCSK9 (human) recombinant protein, Abnova Cat No: H00255738-P01
  • a washing solution PBS pH 7.4
  • ELISA was performed to confirm the efficacy of the anti-PCSK9 antibody to block LDLR and PCSK9 binding.
  • Goat anti-LDLR antibody (R&D, Cat No:AF2148) was diluted to 2 ug/ml in 0.2 M sodium carbonate pH 9.5 in a 96-well plate (Corning Life Sciences), and then 50 ul/well was added. Coating was carried out by incubation at 4° C. overnight. Then, the plate was washed three times using a washing solution PBS (pH 7.4), and the plate was incubated in 200 ul of PBS (pH 7.4) containing 2% skim milk for 1 hour at room temperature.
  • LDLR (R&D, Cat No: 2148LD/CF) was diluted to 0.4 ug/ml in PBS (pH 7.4), and then 50 ul/well was added. Incubated for 2 hours at room temperature, Biotinylated PCSK9 original diluted to 100 ng/ml in PBS (pH 7.4), purified 9G8, 4B10, 7D1 Mab, control Mab, and mouse IgG were diluted to 1 ug/ml in PBS (pH 7.4) did Then, after dilution by half, 50 ul/well was added. After mixing, it was incubated at room temperature for 2 hours. After washing 3 times using the washing solution PBS (pH 7.4), the mixture (100 ul/well) was added and incubated for 1 hour at room temperature.
  • Streptavidin-HRP diluted to 500 ng/ml in PBS (pH 7.4) containing 1% skim milk was added to 50 ul/well, and incubated for 1 hour at room temperature. After washing the plate 3 times, 100 ul/well of TMB solution was added and reacted at room temperature for 20 minutes. 100 ul/well of 1 N hydrochloric acid was added, followed by 10 minutes at room temperature. Read immediately at 450 nm using a TECAN plate reader.
  • the 7D1 Mab inhibited the binding affinity of LDLR and PCSK9 the most, not proportional to the binding avidity of PCSK9 and anti-PCSK9 antibody.
  • the anti-PCSK9 antibody is functionally effective, as the amount of antibody increases, the amount of Biotinylated-PCSK9 that binds to PCSK9 and binds to LDLR decreases, resulting in a decrease in absorbance value. It showed similar results to the control Mab (Amgen Repatha) compared to the control group, and it was confirmed that the inhibition was compared to that in which Mab was not added (FIG. 8).
  • ELISA was performed to confirm that the anti-PCSK9 antibody binds to PCSK9 Ag and inhibits the decrease in LDLR to increase LDL uptake into HepG2 cells.
  • a 96-well plate (Costa, 3603), 1x10 5 /well of HepG2 cells using 10% FBS and DMEM medium was put, and incubated at 37° C., 5% CO 2 overnight. The next day, after replacing with DMEM medium, incubated at 37 °C, 5% CO 2 overnight.
  • LDLR expressed in HepG2 cells was not affected by PCSK9 and the fluorescence value of LDL absorbed by binding to LDL was about 260, and the fluorescence value of only PCSK9 without anti-PCSK9 antibody was added was about 80 to be.
  • the 7D1 Mab showed the highest degree of inhibition of PCSK9 and LDLR binding, and showed similar results to the control Mab ( FIG. 9 ).
  • PCSK9 Ag consisting of 695 amino acids was cut 15 each to make a linear peptide, and the peptide and peptide were coated with Duplicate so that 14 amino acids overlap each other with one amino acid spaced apart.
  • the 7D1 hybridoma cell culture solution was diluted 1:100, 1:1,000 on the coated plate, and then incubated at 4°C for 16 hours at 140 rpm.
  • RNA extraction from the 7D1 Hybridoma cell line
  • cDNA synthesis was followed by PCR amplification of variable region genes of light and heavy chains.
  • Light chain and heavy chain variable genes amplified by PCR were cloned into T-vector.
  • One sequence of each light chain and heavy chain was identified through sequence analysis, and the CDRs were indicated by the Kabat numbering method.
  • Fab construction cloning was performed to confirm whether the sequence-confirmed 7D1 clone was antigen-binding.
  • the Fab was prepared by linking the Variable region gene and the Reference constant region gene of 7D1 confirmed by sequence analysis by overlapping, and then cloning the expression vector (Expression vector).
  • ELISA was performed using the periplasmic extract of the 7D1 Fab construct.
  • the 7D1 hybridoma culture medium and the Fab have different secondary antibodies, so there is a difference in signal.
  • 7D1 hybridoma culture medium (secondary antibody is anti-mouse HRP) was used.
  • Fab that binds to another antigen was used.
  • a humanized variable region sequence was obtained from the mouse-derived variable region sequence of the m7D1 anti-PCSK9 antibody.
  • ch7D1 was designed by replacing the CDR regions in the selected human antibody sequence with the mouse 7D1 sequence. Humanization was carried out by back mutation of the sequence corresponding to the framework part of the designed ch7D1 sequence to the mouse antibody sequence.
  • two types of heavy chains hz7D1.11 VH and hz7D1.22 VH
  • two types of light chains hz7D1.11 VL and hz7D1.22 VL
  • the 22nd version is a more human-like version, and the designed ch7D1 and two types of hz7D1 antibodies have a heavy chain of IgG1 and a light chain of kappa constant. proceeded.
  • the heavy and light chains of each antibody were cloned into pcDNA3.1(+) expression vector, respectively, and IgG production was carried out to analyze the affinity of the IgG form to confirm the binding force of the two humanized antibodies.
  • Plasmids for the heavy chain or light chain of each antibody cloned into pcDNA3.1(+) vector were confirmed through nucleotide sequence analysis. After transient transfection of the identified plasmid into HEK293F cells, IgG was purified from cell culture through Protein A chromatography. The purity of the purified antibody was confirmed by Coomassie Blue staining after SDS PAGE (FIG. 12). As a result, it was confirmed that all three types of antibodies were purified with high purity.
  • Example 14 ELISA for confirming binding of PCSK9 Ag to humanized 7D1 antibody

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Biochemistry (AREA)
  • Veterinary Medicine (AREA)
  • Immunology (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Wood Science & Technology (AREA)
  • Microbiology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Diabetes (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)

Abstract

본 발명의 항 PCSK9 항체는 종래의 항 PCSK9 항체와 상이한 에피토프에 결합함에도 PCSK9과 특이적으로 결합한다. 특히, PCSK9과의 결합력이 매우 우수하다. 따라서, 상기 항 PCSK9 항체는 LDLR과 혈장 PCSK9의 결합을 효과적으로 차단할 수 있다. 그러므로, 이에 의해 LDLR의 흡수 및 분해를 방지할 수 있다. 따라서, 상기 항 PCSK 항체는 고콜레스테롤혈증, 고지혈증, 죽상경화성 심혈관질환(ACVD), 급성관상동맥증후군(ACS), 고혈압, 당뇨병, 뇌졸중, 알츠하이머 및 이상지질혈증을 치료 또는 예방하는데 유용하게 사용될 수 있다.

Description

항 PCSK9 항체 및 이의 용도
본 발명은 항체 의약품 분야에 관한 것이며, 구체적으로는 전구단백질 전환효소 서브틸리신/켁신 타입 9(PCSK9)에 특이적으로 결합하는 항체, 이의 용도 및 이의 제조 방법에 관한 것이다.
고지혈증(Hyperlipidaemia)은 필요 이상의 지방성분 물질인 저밀도 지단백질 콜레스테롤(LDL), 고밀도 지단백질 콜레스테롤(HDL), 초저밀도 지단백질 콜레스테롤(VLDL), 중성지방(Triglyceride)이 혈액에 존재하여 염증을 일으키는 상태를 말한다. 또한, 고지혈증은 그 자체로 특별한 증상이 나타나지는 않지만, 고혈압, 동맥경화, 뇌졸중 등의 위험요인으로서 심혈관계 질환에 의한 사망률을 유의하게 증가시킨다. 지질의 농도가 관리되지 않는 환자들은 스타틴을 비롯한 약을 이용하여 혈중 지질을 조절하여 심혈관계 질환의 위험성을 낮출 필요가 있다.
1990년대부터 사용된 스타틴은 혈중 LDL 콜레스테롤의 조절과 심혈관질환 발생 및 사망률 저하에 효력이 있지만 간 독성과 근육독성과 같은 부작용이 있다. 또한, 스타틴을 복용했는데도 LDL 콜레스테롤 수준이 충분히 조절되지 않는 유전성 콜레스테롤 과다증에 해당하는 환자들이 존재한다. 전구단백질 전환효소 서브틸리신/켁신 타입 9(이하, PCSK9)가 LDL 콜레스테롤을 조절하는 핵심적인 역할을 한다는 것이 2003년 전후에 보고되었다(Maxwell, K.N, et.al. Novel putative SREP and LXR target genes identified by microarray analysis in liver of cholesterol-fed mice. J. Lipid Res. 44, 2109-2119, 2003).
2006년에 유전자 돌연변이 때문에 생기는 상염색체 우성 고콜레스테롤증(Autosomal dominant hypercholesterolemia, ADH)이 보고되었다. 구체적으로, LDLR, APOB, PCSK9, LDLRAP1 유전자에 이상이 있는 경우에 혈중 LDL 콜레스테롤이 심하게 증가한다고 보고되었다. 높은 농도의 LDL 콜레스테롤이 혈중에서 오랜 시간 지속되면 관상동맥질환이 발생한다. 주로 유럽, 미국에서 연구가 되었으며, heterozygous ADH는 500명 중에 한명 꼴로, homozygous ADH는 백만 중에 한명 정도 있을 것으로 예상된다. ADH 환자들은 관상동맥질환 발생의 교차비(Odds ratio)가 10배 가까이 된다고 알려져 있다. ADH는 가족력에 있는 유전질환이며, 상염색체 우성 유전방식을 따른다. 이는 부모 중에서 한 명만 ADH이면 50%의 확률로 자식도 같은 질환일 가능성이 있다는 것을 의미한다.
2013년 발표된 미국심장학회(ACC) 및 심장협회(AHA)의 지질 가이드라인에 따르면, 죽상동맥경화성 심혈관질환(ASCVD) 환자에 PCSK9 억제제인 단일클론항체를 사용할 경우, LDL 콜레스테롤 순환율을 높일 수 있으며, LDLR의 수를 증가시킬 수 있다는 점이 보고되었다. 그리고 PCSK9 억제제 처방이 필요한 환자군으로 우선 LDL 콜레스테롤이 목표치에 도달하지 못하는 죽상동맥경화성 심혈관질환(ASCVD), 급성관상동맥증후군(ACS), 계획되지 않은 관상동맥중재술, 5년내 허혈성 뇌졸중 재발, 고콜레스테롤혈증, 고혈압이 포함될 수 있다는 점이 보고되었다. 또한 ASCVD가 없는 가족성 고콜레스테롤혈증, 스타틴 내인성이 없는 환자에게도 PCSK9 억제제를 투여할 수 있다고 권고했다.
따라서, PCSK9 억제제인 모노클로날 항체가 요구되는 상황이며, 특히 안전성과 유효성을 갖는 항체는 산업적으로 널리 응용될 수 있다.
본 발명은 PCSK9과 특이적으로 결합하는 항 PCSK9 항체에 관한 것이다. Human PCSK9 단백질 서열을 기반으로 기능에 영향을 주지 않는 범위 내의 특정 부위의 아미노산을 제거한 PCSK9 단백질을 원핵세포를 사용하여 발현 정제하여 면역원으로 사용하였다. 이를 이용하여 PCSK9과 특이적으로 결합하는 항 PCSK9 항체를 제조하였다. 제조된 항체는 LDLR과 PCSK9의 결합을 억제시켜 세포안으로 LDL의 흡수를 증가시킬 수 있다.
상기 목적을 달성하기 위해, 본 발명의 일 측면은, 인간 PCSK9의 209번째 내지 218번째 아미노산에 특이적으로 결합하는 항체를 유효성분으로 포함하는 콜레스테롤 관련 질환 치료 또는 예방용 약학 조성물을 제공한다.
본 발명의 또 다른 측면은, 서열번호 1의 LCDR1, 서열번호 2의 LCDR2, 및 서열번호 3의 LCDR3을 포함하는 경쇄가변영역; 및 서열번호 4의 HCDR1, 서열번호 5의 HCDR2, 및 서열번호 6의 HCDR3을 포함하는 중쇄가변영역을 포함하는 PCSK9에 특이적인 항체 및 이의 약학적 조성물을 제공한다.
본 발명의 또 다른 측면은, PCSK9에 특이적인 항체를 암호화하는 폴리뉴클레오티드를 제공한다.
본 발명의 또 다른 측면은, PCSK9에 특이적인 항체를 암호화하는 폴리뉴클레오티드를 포함하는 벡터를 제공한다.
본 발명의 또 다른 측면은, 상기 벡터가 도입된 형질전환 세포를 제공한다.
본 발명의 또 다른 측면은, 상기 벡터가 도입된 형질전환 세포를 배양하는 단계; 상기 배양액으로부터 PCSK9에 특이적인 항체를 수득하는 단계를 포함하는 PCSK9에 특이적인 항체를 제조하는 방법을 제공한다.
본 발명의 또 다른 측면은, 인간 PCSK9의 209번째 내지 218번째 아미노산에 특이적으로 결합하는 항체를 유효성분으로 포함하는 조성물의 콜레스테롤 관련 질환을 치료하거나 예방하기 위한 용도를 제공한다.
본 발명의 또 다른 측면은, 인간 PCSK9의 209번째 내지 218번째 아미노산에 특이적으로 결합하는 항체를 유효성분으로 포함하는 약학 조성물을 개체에 투여하는 단계를 포함하는 콜레스테롤 관련 질환을 치료하거나 예방하는 방법을 제공한다.
본 발명인 항 PCSK9 항체는 PCSK9과 특이적으로 결합하나, 종래 알려진 에피토프와 상이한 에피토프에 결합한다. 또한, PCSK9과의 결합력이 매우 우수하다. 따라서, 상기 항 PCSK9 항체는 LDLR과 혈장 PCSK9의 결합을 차단할 수 있고, 이에 의해 LDLR의 흡수 및 분해를 방지할 수 있다. 뿐만 아니라, 세포 표면 상에서 LDLR 발현 수준 및 양을 증가시키고, LDLR에 의한 LDL 재흡수를 증가시킬 수 있다. 따라서, 상기 항 PCSK9 항체는 고콜레스테롤혈증, 고지혈증, 죽상경화성 심혈관질환(ACVD), 급성관상동맥증후군(ACS) 및 고혈압을 치료 또는 예방하는데 유용하게 사용될 수 있다.
도 1a는 pGEX 4T-1 벡터와 결합된 BST PM1의 DNA 서열을 나타낸 것이다(서열번호 58).
도 1b는 pGEX 4T-1 벡터와 결합된 BST PM1의 아미노산 서열을 나타낸 것이다(서열번호 57).
도 1c는 PCSK9 original과 BST PM1 sequence alignment를 수행한 것이다.
도 2는 BST PM1 Ag과 PCSK9 다클론항체의 웨스턴블롯 결과를 나타낸 것이다: M: 사이즈 마커, Lane 1: PCSK9 original antigen, coomassie staining, Lane 2: BST PM1 Ag, coomasie staining, Lane 3: PCSK9 original antigen과 PCSK9 Pab(다클론항체)를 이용한 웨스턴블롯 밴드, Lane 4: BST PM1 Ag과 PCSK9 Pab(다클론항체)를 이용한 웨스턴블롯 밴드.
도 3a는 단일클론항체 선별을 위한 1차 스크리닝의 ELISA 결과값을 나타낸 것이다.
도 3b는 단일클론항체 선별을 위한 2차 스크리닝의 ELISA 결과값을 나타낸 것이다.
도 4a는 선별된 8종의 항 PCSK9 항체의 FACS 결과값을 나타낸 것이다.
도 4b는 선별된 8종의 항 PCSK9 항체의 Isotype을 확인한 것이다.
도 5는 9G8, 4B10, 7D1 Mab 정제 후 SDS PAGE 결과를 나타낸다: M: 사이즈 마커, Lane 1: 9G8 Mab(단일클론항체), Lane 2: 4B10 Mab, Lane 3: 7D1 Mab.
도 6은 정제된 9G8, 4B10, 7D1 Mab와 PCSK9 Ag의 웨스턴 블롯 결과를 나타낸 것이다.
도 7은 정제된 9G8, 4B10, 7D1 Mab와 PCSK9 Ag의 ELISA 결과를 나타낸 것이다.
도 8은 PCSK9 Ag과 LDLR 결합을 억제하기 위한 항 PCSK9 항체의 효능 ELISA 결과를 나타낸다.
도 9는 항 PCSK9 항체의 HepG2 세포의 LDL 흡수 영향을 나타낸 것이다.
도 10은 m7D1 항 PCSK9 항체의 에피토프 매핑 결과를 나타낸 것이다.
도 11은 7D1 항 PCSK9 항체의 Humanization 가변 영역 서열 정보를 나타낸 것이다.
도 12는 ch7D1, hz7D1.11 및 hz7D1.22 3종의 IgG를 생산 및 정제 후, SDS-PAGE로 확인한 결과를 나타낸 것이다.
도 13은 ch7D1과 2 종의 hz7D1 IgG 생산 정제 후, 항원 PCSK9 Ag에 대한 EC50 분석 결과를 나타낸 것이다.
도 14a 내지 도 14d는 ch7D1과 2종의 hz7D1 IgG 생산 정제 후, 항원 PCSK9 Ag에 대한 Octet 분석 결과를 나타낸 것이다.
PCSK9의 209번째 내지 218번째 아미노산에 특이적으로 결합하는 항체
본 발명의 일 측면은, 인간 PCSK9의 209번째 내지 218번째 아미노산에 특이적으로 결합하는 항체를 유효성분으로 포함하는 콜레스테롤 관련 질환 치료 또는 예방용 약학 조성물을 제공한다.
본 명세서에서 사용하는 용어, "PCSK9" 또는 "서브틸리신/켁신 타입 9"은 염색체 1에서 인간의 PCSK9 유전자에 의해 암호화된 효소를 의미한다. PCSK9은 다른 단백질을 활성화시키는 단백질의 프로 단백질 전환 효소 패밀리의 9번째 구성원이다. 상기 효소는 692개의 아미노산 잔기로 구성되어 있다. 주로 간장, 신장, 및 소장 등에 존재하며, 간질세포, 간엽세포 및 결장표피세포 등에서 발현되어 혈액 중에 존재한다. 이때, 상기 PCSK9은 서열번호 49의 아미노산 서열을 가질 수 있다. 또한, 인간 PCSK9의 209번째 내지 218번째 아미노산 서열은 서열번호 27의 아미노산 서열일 수 있다.
PCSK9은 간세포의 원형질막의 표면에 존재하는 LDLR(LDL receptor)의 분해를 매개할 수 있다. PCSK9은 LDLR 구조에서 성장인자-유사 반복 상동성 도메인-A(EGF-A)에 결합할 수 있다. 한편, LDLR/PCSK9 복합체는 간세포에 흡수된다. 흡수된 LDLR/PCSK9 복합체는 간세포의 엔도좀에서 LDLR의 형태 변화를 저해하여, LDLR의 해리 및 재순환을 방지한다. 또한, LDLR/PCSK9 복합체가 형성될 경우, 상기 복합체는 단백질을 분해하는 리보솜으로 수송되게 된다.
또한, 상기 콜레스테롤 관련 질환은 고콜레스테롤혈증, 고지혈증, 죽상경화성 심혈관질환(ACVD), 급성관상동맥증후군(ACS), 고혈압, 당뇨병, 뇌졸중, 알츠하이머 및 이상지질혈증으로 이루어진 군에서 선택되는 어느 하나인 것일 수 있다.
또한, 상기 항체를 수득하기 위한 항원으로 PCSK9의 일부가 제거된 "BST PM1 Ag"을 사용할 수 있다. 본 명세서에서 사용하는 용어, "BST PM1 Ag"은 면역에 사용한 PCSK9 단백질 단편을 지칭한다. 또한, 상기 항원은 "BST PM1"으로 지칭되기도 한다. 이때, "BST PM1 Ag"은 상기 PCSK9 단백질에서 항원의 활성에 영향을 주지 않는 범위 내에서 암젠 특허(대한민국 등록특허 제10-1494932호)의 결합 부위에 대응하는 영역의 아미노산이 제거된 PCSK9의 변이체이다.
구체적으로, 상기 "BST PM1 Ag"은 Human PCSK9 단백질에서 서열번호 28, 29, 30, 31, 32, 33, 34, 35, 36, 37 및 38의 아미노산이 제거된 형태를 의미한다. 이는 암젠의 항 PCSK9 항체 특허의 항 PCSK9 항체가 PCSK9의 단편 내의 에피토프에 결합하는 부위를 제거한 형태이다. Human PCSK9과 BST PM1 Ag의 서열 비교는 Multiple sequence alignment by Florence Corpet로 비교하여 결실된 아미노산의 위치를 비교하였다(도 1c).
항 PCSK9 항체
본 발명의 또 다른 측면은, 서열번호 1의 LCDR1, 서열번호 2의 LCDR2, 및 서열번호 3의 LCDR3을 포함하는 경쇄가변영역; 및 서열번호 4의 HCDR1, 서열번호 5의 HCDR2, 및 서열번호 6의 HCDR3을 포함하는 중쇄가변영역을 포함하는 PCSK9에 특이적인 항체 또는 이의 단편을 제공한다. 이때, 상기 항체는 인간화 항체 또는 인간 항체 일 수 있다.
구체적으로, 상기 항체는 PCSK9의 서열번호 27, 서열번호 49, 및/또는 서열번호 50의 아미노산 서열을 갖는 폴리펩티드 또는 단백질에 특이적으로 결합할 수 있다. 바람직하게, 서열번호 50의 아미노산 서열을 가지는 항원에 특이적으로 결합할 수 있다.
또한, 상기 항체의 중쇄영역은 서열번호 19 또는 서열번호 23의 아미노산 서열을 가지는 것일 수 있다. 또한, 상기 항체의 중쇄영역은 서열번호 19 또는 서열번호 23의 아미노산 서열과 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% 또는 99% 동일성 또는 100% 동일성을 갖는 아미노산 서열을 포함하거나 이들로 이루어질 수 있다.
또한, 상기 항체의 경쇄영역은 서열번호 21 또는 서열번호 25의 아미노산 서열을 가지는 것일 수 있다. 또한, 상기 항체의 경쇄영역은 서열번호 21 또는 서열번호 25의 아미노산 서열과 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% 또는 99% 동일성 또는 100% 동일성을 갖는 아미노산 서열을 포함하거나 이들로 이루어질 수 있다.
본 명세서에서 사용하는 용어, "항체 단편"은 항원-결합 활성을 갖는 Fab 단편, Fab' 단편, F(ab')2 단편뿐만 아니라, Human PCSK9에 결합하는 Fv 단편인 scFv 단편을 지칭하며; 서열번호 1 내지 서열번호 6으로 이루어지는 군으로부터 선택된, 본 발명에 기술된 항체의 하나 이상의 CDR 영역을 포함한다. Fv 단편은 불변 영역 없이, 중쇄가변영역 및 경쇄가변영역을 포함하며, 모든 항원-결합 자리를 보유하는 최소 항체 단편이다.
본 명세서에서 사용하는 용어, "항체"는 두 개의 동일한 중쇄와 두 개의 동일한 경쇄 사이의 이황화 결합에 의해 서로 연결된 네 개의 펩티드 사슬 구조인 면역글로불린을 지칭한다. 상이한 면역글로불린 중쇄 불변 영역은 상이한 아미노산 조성 및 순서를 나타내므로, 상이한 유형의 항원성을 보유한다. 따라서, 면역글로불린은 다섯 가지 카테고리로 분류될 수 있거나, 면역글로불린 이소형, 즉, IgM, IgD, IgG, IgA 및 IgE로 지칭될 수 있고, 상응하는 중쇄는 각각 μ 사슬, δ 사슬, γ 사슬, α 사슬 및 ε 사슬이다. 힌지 영역의 아미노산 조성 및 중쇄 이황화 결합의 수와 위치에 따라, 동일한 유형의 Ig는 상이한 하위 유형으로 분류될 수 있다. 예를 들어, IgG는 IgG1, IgG2, IgG3, 및 IgG4로 분류될 수 있다. 경쇄는 상이한 불변 영역에 따라 κ 또는 λ 사슬로 분류될 수 있다. 다섯 가지 유형의 IgG 각각은 κ 또는 λ 사슬을 가질 수 있다. 바람직하게는, 상기 항체는 κ 사슬을 가질 수 있다.
일 실시예에 따르면, 본 발명의 항 PCSK9 항체 또는 이의 항원-결합 단편은 경쇄가변영역(LCVR)을 포함하고, 여기서 상기 LCVR는 상보성 결정 영역(CDR) LCRD1, LCDR2 및 LCDR3을 포함하고, LCRD1, LCDR2 및 LCDR3은 각각 서열번호 1, 2 및 3로 이루어진 그룹으로부터 선택된 아미노산 서열과 적어도 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% 또는 99% 동일성 또는 100% 동일성을 갖는 아미노산 서열을 포함하거나 이들로 이루어질 수 있다. 바람직하게, 상기 LCRD1, LCDR2 및 LCDR3은 각각 서열번호 1, 2 및 3의 아미노산 서열을 가질 수 있다.
일 실시예에 따르면, 본 발명의 항 PCSK9 항체 또는 이의 항원-결합 단편은 중쇄가변영역(HCVR)을 포함하고, 여기서 상기 HCVR는 상보성 결정 영역(CDR) HCRD1, HCDR2 및 HCDR3을 포함하고, HCRD1, HCDR2 및 HCDR3은 각각 서열번호 4, 5 및 6으로 이루어진 그룹으로부터 선택된 아미노산 서열과 적어도 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% 또는 99% 동일성 또는 100% 동일성을 갖는 아미노산 서열을 포함하거나 이들로 이루어질 수 있다. 바람직하게, 상기 HCRD1, HCDR2 및 HCDR3은 각각 서열번호 4, 5 및 6의 아미노산 서열을 가질 수 있다.
본 발명에서 사용하는 용어, "인간화 항체"는 비-인간 초가변영역(HVR)로부터의 아미노산 잔기 및 인간 프레임워크(FR)로부터의 아미노산 잔기를 포함하는 키메라 항체를 지칭한다. 특정 실시양태에서, 인간화 항체는 적어도 1개, 전형적으로 2개의 가변 도메인을 실질적으로 모두 포함하고, 여기서 실질적으로 모든 초가변영역(예를 들어, CDR)은 비-인간 항체의 것에 상응하고, 실질적으로 모든 프레임 워크 영역(FR)은 인간 항체의 것에 상응한다. 인간화 항체는 임의로 인간 항체로부터 유래된 항체 불변 영역의 적어도 일부를 포함할 수 있다. 예를 들어 비-인간 항체의 "인간화 형태"는 인간화를 겪은 항체를 지칭한다.
항 PCSK9 항체의 용도
본 발명의 또 다른 측면은, 상기 항체를 유효성분으로 포함하는 콜레스테롤 관련 질환 치료 또는 예방용 약학 조성물을 제공하는 것이다.
이때, 상기 콜레스테롤 관련 질환은 고콜레스테롤혈증, 고지혈증, 죽상경화성 심혈관질환(ACVD), 급성관상동맥증후군(ACS), 고혈압, 당뇨병, 뇌졸중, 알츠하이머 및 이상지질혈증으로 이루어진 군에서 선택되는 어느 하나인 것일 수 있다.
본 발명의 약학 조성물은 유효성분으로서 상기 항체를 조성물의 총 중량을 기준으로 약 0.01 중량% 내지 약 95 중량%, 또는 약 0.1 중량% 내지 약 90 중량%, 구체적으로 약 0.5 중량% 내지 약 75 중량%, 보다 구체적으로 약 1 중량% 내지 약 50 중량%로 함유할 수 있다.
본 발명의 약학 조성물은, 통상적인 방법에 따라 제제로 배합되는 통상적이고 무독성인 약학적으로 허용가능한 첨가제를 포함할 수 있다. 예를 들어, 상기 약학 조성물은 약학적으로 허용되는 담체, 희석제 또는 부형제를 추가로 포함할 수 있다.
본 발명의 조성물에 사용되는 첨가제의 예는 감미제, 결합제, 용매, 용해 보조제, 습윤제, 유화제, 등장화제, 흡수제, 붕해제, 산화방지제, 보존제, 윤활제, 활택제, 충전제 등을 포함할 수 있다.
본 발명의 조성물은 비경구 투여(예컨대, 근육내, 정맥내 또는 피하 주사)를 위한 다양한 제제 형태로 배합될 수 있다.
또한, 비경구 투여를 위한 제제에는 멸균된 수용액제, 비수성용제, 현탁제, 유제, 동결건조 제제 및 좌제가 포함된다. 비수성용제, 현탁제로는 프로필렌글리콜, 폴리에틸렌글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔, 마크로골, 트윈61. 카카오지, 라우린지, 글리세로제라틴 등이 사용될 수 있다. 한편, 주사제에는 용해제, 등장화제, 현탁화제, 유화제, 안정화제, 방부제 등과 같은 종래의 첨가제가 포함될 수 있다.
본 발명의 항체 또는 조성물은 치료학적으로 유효한 양 또는 약학적으로 유효한 양으로 환자에 투여될 수 있다.
여기서 "치료학적으로 유효한 양" 또는 "약학적으로 유효한 양"이란 대상 질환을 예방 또는 치료하는데 유효한 항체 또는 조성물의 양으로서, 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분하며 부작용을 일으키지 않을 정도의 양을 의미한다. 상기 유효량의 수준은 환자의 건강상태, 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 방법, 투여 시간, 투여 경로 및 배출 비율, 치료 기간, 배합 또는 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다.
본 명세서에서 사용하는 용어 "투여"란, 적절한 방법으로 개체에게 소정의 물질을 도입하는 것을 의미하며, 상기 조성물의 투여 경로는 목적 조직에 도달할 수 있는 한 어떠한 일반적인 경로를 통하여 투여될 수 있다. 복강내 투여, 정맥내 투여, 근육내 투여, 피하 투여, 피내 투여, 국소 투여, 비내 투여, 폐내 투여, 직장내 투여될 수 있으나, 이에 한정되지는 않는다.
본 발명의 항체 또는 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고, 종래의 치료제와 순차적으로 또는 동시에 투여될 수 있으며, 단일 또는 다중 투여될 수 있다. 상기한 요소들을 모두 고려하여 최소한의 부작용으로 또는 부작용 없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여하는 것이 중요하며, 이는 당업자에 의해 용이하게 결정될 수 있다.
구체적으로, 본 발명의 조성물에서 항체의 유효량은 환자의 나이, 성별, 체중에 따라 달라질 수 있으며, 일반적으로는 체중 kg 당 약 0.1 mg 내지 약 1,000 mg, 또는 약 5 mg 내지 약 200 mg을 매일 또는 격일 투여하거나 1일 1회 내지 3회로 나누어 투여할 수 있다. 그러나, 투여 경로, 질병의 중증도, 성별, 체중, 연령 등에 따라서 증감될 수 있으므로, 본 발명의 범위는 이에 한정되지 않는다.
항 PCSK9 항체를 포함하는 조성물의 용도
본 발명의 또 다른 측면은, 인간 PCSK9의 209번째 내지 218번째 아미노산에 특이적으로 결합하는 항체를 유효성분으로 포함하는 조성물의 콜레스테롤 관련 질환을 치료하거나 예방하기 위한 용도를 제공한다. 이때, 상기 조성물 및 콜레스테롤 관련 질환은 상술한 바와 같다.
본 발명의 또 다른 측면은, 인간 PCSK9의 209번째 내지 218번째 아미노산에 특이적으로 결합하는 항체를 유효성분으로 포함하는 약학 조성물을 개체에 투여하는 단계를 포함하는 콜레스테롤 관련 질환을 치료하거나 예방하는 방법을 제공한다.
본 발명의 조성물을 콜레스테롤 관련 질환을 가진 개체에 투여함으로써, 개체를 효율적으로 치료 또는 예방할 수 있다. 이때, 상기 개체는 포유동물일 수 있으며, 바람직하게는 인간일 수 있다. 또한, 상기 조성물 및 콜레스테롤 관련 질환의 종류는 상술한 바와 같다. 상기 조성물은 투여경로, 투여량 및 투여횟수는 환자의 상태 및 부작용의 유무에 따라 다양한 방법 및 양으로 대상에게 투여될 수 있고, 최적의 투여방법, 투여량 및 투여횟수는 통상의 기술자가 적절한 범위로 선택할 수 있다.
본 발명의 또 다른 측면은, PCSK9에 특이적인 항체를 암호화하는 폴리뉴클레오티드를 제공한다. 상기 항 PCSK9 항체는 전술한 바와 같다. 이때, 상기 폴리뉴클레오티드의 중쇄영역은 서열번호 20번 또는 서열번호 24일 수 있고, 경쇄영역은 서열번호 22 또는 및 서열번호 26일 수 있다.
또한, 상기 폴리뉴클레오티드는 신호서열(signal sequence) 또는 리더 서열(leader sequence)을 추가적으로 포함할 수 있다. 여기에서 사용된 용어 "신호서열"은 목적 단백질의 분비를 지시하는 신호펩타이드를 코딩하는 핵산을 의미한다. 상기 신호펩타이드는 숙주 세포에서 번역된 후에 절단된다. 구체적으로, 본원 발명의 신호서열은 ER(endoplasmic reticulum) 막을 관통하는 단백질의 이동을 개시하는 아미노산 서열을 코딩하는 뉴클레오티드이다.
본 발명의 또 다른 측면은, PCSK9에 특이적인 항체를 암호화하는 폴리뉴클레오티드를 포함하는 벡터를 제공한다. 상기 폴리뉴클레오티드의 중쇄영역은 서열번호 20 또는 서열번호 24를 포함할 수 있고, 경쇄영역은 서열번호 22 또는 서열번호 26을 포함할 수 있다. 일 구체예로 서열번호 20 및 서열번호 22를 포함하는 폴리뉴클레오티드일 수 있다. 일 구체예로 서열번호 24 및 서열번호 26을 포함하는 폴리뉴클레오티드일 수 있다. 또한, 상기 폴리뉴클레오티드는 신호서열(signal sequence) 또는 리더 서열(leader sequence)을 추가적으로 포함할 수 있다. 여기서 신호서열은 전술한 바와 같다.
이때, 상기 벡터는 상기 중쇄 및 경쇄의 폴리뉴클레오티드 조합을 각각 포함하는 2개의 벡터, 또는 상기 조합의 폴리뉴클레오티드를 모두 포함하는 바이시스트로닉 벡터일 수 있다.
본 명세서에서 사용하는 용어, "벡터"는 숙주 세포에 도입되어 숙주 세포 유전체 내로 재조합 및 삽입될 수 있다. 또는 상기 벡터는 에피좀으로서 자발적으로 복제될 수 있는 뉴클레오티드 서열을 포함하는 핵산 수단으로 이해된다. 이때, 벡터는 숙주세포에서 상기 폴리뉴클레오티드가 발현될 수 있도록 적절한 프로모터에 작동가능하도록 연결된 것일 수 있으며, 선형 핵산, 플라스미드, 파지미드, 코스미드, RNA 벡터, 바이러스 벡터, 미니-염색체 및 이의 유사체들을 포함한다. 바이러스 벡터의 예로는 레트로바이러스, 아데노바이러스 및 아데노-관련 바이러스를 포함하나 이에 제한되지 않는다. 또한, 상기 플라스미드는 항생제 내성 유전자와 같은 선별 마커를 포함할 수 있고, 플라스미드를 유지하는 숙주 세포는 선택적인 조건하에서 배양될 수 있다.
본 명세서에서 사용하는 용어, 목적 단백질의 "유전자 발현" 또는 "발현"은 DNA 서열의 전사, mRNA 전사체의 번역 및 융합 단백질 생산물 또는 이의 단편의 분비를 의미하는 것으로 이해된다.
본 발명의 또 다른 측면은, 상기 벡터가 도입된 형질전환 세포를 제공한다.
본 명세서에서 사용하는 용어, "형질전환 세포"는 재조합 발현 벡터가 도입될 수 있는 원핵 세포 및 진핵 세포를 나타낸다. 상기 형질전환 세포는 벡터를 숙주 세포에 도입하여 형질전환시켜서 제작될 수 있다. 또한, 상기 벡터에 포함된 폴리뉴클레오티드를 발현시켜 본 발명의 융합단백질을 생산할 수 있다.
상기 형질전환은 다양한 방법에 의하여 수행될 수 있다. 본 발명의 융합단백질을 생산할 수 있는 한, 특별히 이에 제한되지 않는다, 구체적으로, 상기 형질전환 방법은 CaCl2 침전법, CaCl2 침전법에 DMSO(dimethyl sulfoxide)라는 환원물질을 사용함으로써 효율을 높인 Hanahan 방법, 전기천공법(electroporation), 인산칼슘 침전법, 원형질 융합법, 실리콘 카바이드 섬유를 이용한 교반법, 아그로박테리아 매개된 형질전환법, PEG를 이용한 형질전환법, 덱스트란 설페이트, 리포펙타민 및 건조/억제 매개된 형질전환 방법 등이 사용될 수 있다. 또한, 감염(infection)을 수단으로 하여 바이러스 입자를 사용하여 목적물을 세포 내로 전달시킬 수 있다. 또한, 유전자 밤바드먼트 등에 의해 벡터를 숙주세포 내로 도입할 수 있다.
또한, 상기 형질전환 세포의 제작에 사용되는 숙주 세포 역시 본 발명의 융합단백질을 생산할 수 있는 한, 특별히 이에 제한되지 않는다. 구체적으로 상기 숙주 세포는 원핵 세포, 진핵 세포, 포유동물, 식물, 곤충, 균류 또는 세포성 기원의 세포를 포함할 수 있지만 이에 한정되지 않는다. 상기 원핵 세포의 일 예로는 대장균을 사용할 수 있다. 또한, 진핵 세포의 일 예로는 효모를 사용할 수 있다. 또한, 상기 포유동물 세포로 CHO 세포, F2N 세포, COS 세포, BHK 세포, 바우스(Bowes) 흑색종 세포, HeLa 세포, 911 세포, AT1080 세포, A549 세포, SP2/0 세포, 인간 림프아구(human lymphoblastoid), NSO 세포, HT-1080 세포, PERC.6 세포, HEK 293 세포 또는 HEK293T 세포 등을 사용할 수 있으나, 이에 한정되지 않으며, 당업자에게 알려진 포유동물 숙주 세포로 사용 가능한 세포는 모두 이용 가능하다.
본 발명의 또 다른 측면은, 상기 벡터가 도입된 형질전환 세포를 배양하는 단계; 상기 배양액으로부터 PCSK9에 특이적인 항체를 수득하는 단계를 포함하는 PCSK9에 특이적인 항체를 제조하는 방법을 제공한다.
본 명세서에서 사용하는 용어, "배양"이란, 미생물을 인공적으로 적당히 조절한 환경조건에서 생육시키는 방법을 의미한다.
상기 형질전환 세포를 배양하는 방법은 당업계에 널리 알려져 있는 방법을 이용하여 수행할 수 있다. 구체적으로, 상기 배양은 본 발명의 융합단백질을 발현시켜서 생산할 수 있는 한 특별히 이에 제한되지 않는다. 구체적으로, 상기 배양은 배치 공정 또는 주입 배치 또는 반복 주입 배치 공정(fed batch or repeated fed batch process)에서 연속식으로 배양할 수 있다.
또한, 배양물로부터 상기 융합단백질을 회수하는 단계는 당업계에 공지된 방법에 의해 수행될 수 있다. 구체적으로, 상기 회수 방법은 생산된 본 발명의 융합단백질을 회수할 수 있는 한, 특별히 이에 제한되지 않는다. 바람직하게는, 상기 회수 방법은 원심분리, 여과, 추출, 분무, 건조, 증발, 침전, 결정화, 전기영동, 분별용해(예를 들면 암모늄설페이트 침전), 크로마토그래피(예를 들면 이온 교환, 친화성, 소수성 및 크기배제) 등의 방법일 수 있다.
본 발명의 항원은 BST PM1 Ag을 코딩하는 DNA를 합성한 후 발현 벡터 pGEX 4T1에 클로닝하여 제작하였다. 또한, 상기 벡터를 대장균에 형질전환 한 후, IPTG를 넣어주어 BST PM1 Ag의 발현을 유도하였다. GST tag이 같이 융합된 형태로 발현된 BST PM1 Ag을 GST affinity chromatography로 일차로 정제하였다. 그 후, 2차적으로 이온 크로마토그래피(Ion chromatography)(Diethylaminoethyl cellulose, DEAE)에서 목적 단백질을 용출하였다. 마지막으로 크기 배제 크로마토그래피(Size exclusion chromatography, SEC)를 진행하여 최종적으로 면역에 사용할 단백질을 준비하였다.
본 발명의 하이브리도마 생산을 위해, 마우스 면역 동물을 이용하여 면역을 실시하였다. 그 후, 상기 동물에서 얻은 세포 및 NS0 세포와 결합시켜 하이브리도마 세포를 제조하였다. Human PCSK9, BST PM1 Ag, GST 단백질을 사용하여 ELISA 스크리닝으로 Human PCSK9, BST PM1 Ag에는 잘 결합하지만 GST 단백질에 결합하지 않는 하이브리도마 세포를 선택적으로 분류하였다. 그 후, 선택된 3종의 하이브리도마 세포를 무혈청 배지 조건으로 적응시킨 후 적정 세포를 넣어주어 배양을 완료하였다. 항체 정제는 Protein G column을 사용하였고 산성의 용출 용액으로 용출 후 PBS로 투석하여 항체 준비를 완료하였다. 준비된 항체의 기능적인 효과를 입증하고자 LDLR와 PCSK9의 결합을 억제시켜 세포가 LDL의 흡수를 증가시키는 실험을 통해 항 PCSK9 항체를 선별하였다.
본 발명은 최종후보 항 PCSK9 항체 3종 9G8, 4B10, 7D1 Mab를 사용하여 실험을 진행하였다. Human PCSK9, BST PM1 Ag으로 결합력을 측정 결과 4B10이 가장 높았으며, 9G8 및 7D1 순서로 나타났다. 하지만 항체의 기능적인 효과 실험을 진행한 결과 7D1 Mab이 LDLR과 PCSK9의 결합을 억제하는 정도가 가장 높아 최종적으로 선택하였다. 선택된 항 PCSK9 항체인 7D1 Mab이 PCSK9의 단편 내의 에피토프에 결합하는 부위를 Linear Epitope Mapping 방법을 사용하여 7D1 Mab와 Human PCSK9 항원의 결합부위를 확인하였다.
또한, 스크리닝을 통해 7D1 Mab의 경쇄/중쇄 상보 결정 영역을 확인하였고, 인간화가 완료된 가변영역서열을 확인하였다. 상기 특이적으로 PCSK9에 결합하는 단일클론 항체는 HCDR1, HCDR2 및 HCDR3 시퀀스의 중쇄가변영역 및 LCDR1, LCDR2 및 LCDR3 시퀀스를 함유한 경쇄가변영역을 포함하고, 상기 경쇄가변영역의 LCDR1 시퀀스는 KSSQSLLDSDGKTYLN(서열번호 1), LCDR2 시퀀스는 LVSKLDS(서열번호 2), LCDR3 시퀀스는 WQGTHFPQT(서열번호 3)의 아미노산 서열을 가진다. 또한, 상기 중쇄가변영역의 HCDR1 시퀀스는 DYYMH(서열번호 4), HCDR2 시퀀스는 YIDPENGDTEYAPKFQG(서열번호 5), HCDR3 시퀀스는 SPFTY(서열번호 6)의 아미노산 서열을 가진다(표 1).
LCDR1 LCDR2 LCDR3
서열번호 1 서열번호 2 서열번호 3
KSSQSLLDSDGKTYLN LVSKLDS WQGTHFPQT
HCDR1 HCDR1 HCDR1
서열번호 4 서열번호 5 서열번호 6
DYYMH YIDPENGDTEYAPKFQG SPFTY
PCSK9 Ag 에피토프 서열 위치 아미노산 서열
서열번호 27 209 - 218 PEEDGTRFHR
PCSK9 아미노산 서열 위치 아미노산 서열
1 서열번호 28 68 - 82 AKDPWRLPGTYVVVL
2 서열번호 29 150 - 152 FAQ
3 서열번호 30 255 - 258 CQGK
4 서열번호 31 317 - 318 NF
5 서열번호 32 348 - 353 LGTLGT
6 서열번호 33 380 - 384 VSQSG
7 서열번호 59 336 - 337 ED
8 서열번호 34 431 - 440 EDQRVLTPNL
9 서열번호 35 457 - 463 CRTVWSA
10 서열번호 36 477 - 480 CAPD
11 서열번호 37 574 - 582 HKPPVLRPR
12 서열번호 38 662 - 673 STTGSTSEGAVT
서열번호 49: PCSK9 아미노산 서열
MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRC AKDPWRLPGTYVVVL KEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSV FAQ SIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLN CQGK GTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAG NF RDDACLYSPASAPEVITVGATNAQDQPVT LGTLGT NFGRCVDLFAPG ED IIGASSDCSTCF VSQSG TSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFP EDQRVLTPNL VAALPPSTHGAGWQLF CRTVWSA HSGPTRMATAVARCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGT HKPPVLRPR GQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDV STTGSTSEGAVT AVAICCRSRHLAQASQELQA
서열번호 50: PCSK9 단편
MGTVSSRRSWWPLPLLLLLLLLLGPAGARAQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGRDDACLYSPASAPEVITVGATNAQDQPVTNFGRCVDLFAPGIIGASSDCSTCFTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPVAALPPSTHGAGWQLFHSGPTRMATAVAREELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVAVAICCRSRHLAQASQELQA
서열번호 57: GST-PCSK9 amino acid sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSQEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGRDDACLYSPASAPEVITVGATNAQDQPVTNFGRCVDLFAPGIIGASSDCSTCFTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPVAALPPSTHGAGWQLFHSGPTRMATAIAREELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVAVAICCRSRHLAQASQELQ
GST-PCSK9 -> pI/Mw: 5.94 / 90 kDa　
PCSK9 -> pI/Mw: 5.89 / 62.6kDa
서열번호 58: GST-PCSK9 DNA sequence
ggcgagcatgggcacccgtgtgcactgccaccagcaaggccacgttctgaccggttgcagcagccactgggaagtggaagatctgggcaccggccagccgaaccaatgcgttggtcaccgtgaagcgagcattcatgcgagctgctgccatgcgccgggcctggagtgcaaggttaaagaacacggtattccggcgccgcaggagcaagtgaccgttgcgtgcgaggaaggctggaccctgaccggttgcagcgcgctgccgggcaccagccacgtgctgggtgcgtatgcggttgacaacacctgcgtggttcgtagccgtgatgtggcggtggcgatctgctgccgtagccgtcatctggcgcaagcgagccaagaactgcaa
Amino acid sequence
IGHV1-2*02/IGHJ4*03 QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARYFDYWGQGTLVTVSS
(서열번호 39)
IGKV2-30*01/IGKJ4*2 DVVMTQSPLSLPVTLGQPASISCRSSQSLVYSDGNTYLNWFQQRPGQSPRRLIYKVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGTHWPLTFGGGTKVEIK
(서열번호 40)
구분 Amino acid sequence
ch7D1 VH
(서열번호 15)		 EVKLVESGAELVRSGASVKLSCTASGFNIKDYYMHWVKQRPEQGLEWIGYIDPENGDTEYAPKFQGKATMTADTSSNTAYLQLSSLTSEDTAVYYCRSSPFTYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
ch7D1 VL
(서열번호 17)		 DVLMTQTPLTLSVTIGQPASISCKSSQSLLDSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGVYYCWQGTHFPQTFGGGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
hz7D1.11 VH
(서열번호 19)		 QVQLVQSGAEVKKPGASVKVSCKASGFNIKDYYMHWVRQAPGQGLEWIGYIDPENGDTEYAPKFQGRATMTADTSISTAYMELSRLRSDDTAVYYCRSSPFTYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
hz7D11.11 VL
(서열번호 21)		 DVVMTQSPLSLPVTLGQPASISCKSSQSLLDSDGKTYLNWLQQRPGQSPRRLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCWQGTHFPQTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
hz7D1.22 VH
(서열번호 23)		 QVQLVQSGAEVKKPGASVKVSCKASGYTFKDYYMHWVRQAPGQGLEWMGYIDPENGDTEYAPKFQGRVTMTADTSISTAYMELSRLRSDDTAVYYCRSSPFTYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
hz7D11.22 VL
(서열번호 25)		 DVVMTQSPLSLPVTLGQPASISCKSSQSLLDSDGKTYLNWFQQRPGQSPRRLIYLVSKLDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCWQGTHFPQTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
* Under bar: CDRs defined by Kabat numbering
이하, 본원 발명을 하기 실시예에 의하여 더욱 상세하게 설명한다. 단, 하기 실시예는 본원 발명을 예시하기 위한 것일 뿐, 본원 발명의 범위가 이들만으로 한정되는 것은 아니다.
실시예 1. 원핵세포를 이용한 BST PM1 Ag의 클로닝 및 단백질 정제
실시예 1.1. BST PM1 유전자의 PCR 산물의 pGEX4T-1 벡터 클로닝
Genescript에서 합성한 BST PM1 유전자와 pGEX4T-1 벡터를 절단(Ligation) 하기 위해 동일한 2가지 제한 효소(BamH1 및 EcoR1)로 각각 37℃, 14시간 절단을 진행하였다. 1% 아가로스 젤(Agarose gel)에 제한 효소로 절단된 벡터(Vector)와 절단된 BST PM1 유전자를 로딩하여 밴드를 확인한 후 Gel extraction을 진행하여 제한 효소 처리 완료된 벡터와 절단된 BST PM1 유전자를 준비하였다. pGEX4T-1 벡터 2 ul, BST PM1 6 ul, 10X buffer 1 ul, T4 DNA ligase(Biofact, korea) 1 ul를 혼합하여 4℃에서 12시간 동안 라이게이션(Ligation)을 실시하였다.
라이게이션 후 대장균 DH5α에 형질 전환하였고 Ampicillin(100 ug/ml)이 포함된 Luria-Bertani(LB) agar배지에 도말하여 콜로니를 선별하였다. 그 후, 유전자가 제대로 삽입되었는지 확인하기 위해 콜로니를 LB 배지에 접종하여 배양 후 원심분리기를 사용하여 셀을 수확하였다. HiGene plasmid MiniPrpep 키트(Biofact, korea)를 이용하여 재조합 플라스미드를 분리하였고, 제한 효소(BamH1/EcoR1)로 처리한 결과 BST PM1 유전자의 DNA 밴드와 pGEX4T-1 벡터 밴드가 확인되었다. PCSK9 original antigen과 BST PM1 antigen은 서열의 차이가 있고 그 차이를 Sequence alignment로 비교하였으며, 그 결과를 도 1c에 나타내었다.
실시예 1.2. 재조합 단백질 발현 및 정제
BST PM1의 발현을 확인하기 위해서 E.coli BL21(DE3) 세포에 형질전환 후 Ampicillin(100 ug/ml) 포함된 Luria-Bertani(LB) agar 배지에 도말하여 콜로니를 생성하였다. 그 후, 콜로니에서 세포를 수득하여 50 ml Luria-Bertani(LB) 배지에 접종한 후, 37℃, 12시간 배양하였다. Ampicillin(100 ug/ml)이 포함된 LB 배지 5 L에 접종한 셀 배양액 50 ml를 넣고 OD600 값이 0.5 ~ 0.6 사이가 될 때까지 배양한 후 IPTG(Isopropyl-β-D-thio-galactoside)를 0.5 mM 농도로 배지에 첨가한 후, 18℃에서 16시간 추가로 배양하였다.
발현된 세포를 원심분리(6,000 rpm, 30분, 4℃)하여 세포를 수확한 후, 용해 완충액 lysis buffer(PBS(Phosphate Buffered Saline), 0.2 mM PMSF, 0.1% Triton X-100 pH 7.4) 50 ml에 풀어준 후 초음파 분쇄를 15회(60초/1회) 실시하였다. 파쇄한 세포는 원심분리(13,000 rpm, 30분, 4℃)를 실시하여 수용성 세포 용해액과 불용성 세포 펠렛으로 분리하였다. 그 후, 수용성 세포 용해액(50 ml)을 0.45 um syringe 필터기로 필터를 진행 후, lysis buffer로 평형화를 마친 5 ml GST Trap FF affinity column(GE Healthcare)에 1 ml/min이 되도록 로딩하였다.
비특이적으로 결합한 단백질을 제거하기 위해 컬럼 부피의 10 CV(column volume)의 lysis buffer를 2 ml/min으로 수행하여 충분히 세척한 후 단백질 샘플은 용출(Elution buffer) 버퍼(PBS, 10 mM Glutathione, pH 7.4)를 사용하여 선형 구배(linear gradient) 1 ml/min으로 용출 시켰다. DEAE column을 진행하기 위해 Lysis buffer(20 mM sodium phosphate, pH 7.4)로 dialysis 후 1 ml HighTrap DEAE FF column(GE Healthcare)에 1 ml/min로 로딩하였다.
목적 단백질은 DEAE flow-through에서 확인되었고 SEC(Size exclusion chromatography)를 통해 다시 분리하였다. 완충액 PBS(Phosphate Buffered Saline), pH 7.4, 137 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4로 평형화된 Hiprep 26/60 Sephacryl S-200 HR(GE Healthcare)에 0.5 ml/min으로 로딩하였다. 3단계의 column work을 진행하였고 분리 과정 동안의 FPLC chromatography와 BST PM1 Ag은 12% SDS PAGE gel을 사용하여 확인하였다.
실시예 2. BST PM1 Ag 및 PCSK9 다클론항체을 이용한 웨스턴 블롯
정제된 BST PM1 Ag이 PCSK9 다클론항체와 결합하는지 확인하기 위해, BST PM1 Ag 1 ug과 control Ag(PCSK9(Human) recombinant protein, abnova사 Cat No: H00255738-P01) 1 ug을 10% SDS PAGE에 로딩 후 0.45 um PVDF membrane에 transfer를 진행하였다. 5% skim milk가 포함된 PBST(pH 7.4)에 옮긴 후 2시간 동안 실온에서 차단시킨 후, 세척 용액(PBST)으로 3회 세척 진행하였고, PCSK9 polyclonal antibody(Abnova사, Cat No: PAB17045)를 1:1,000으로 희석 후 1시간 동안 실온에서 웨스턴 블롯을 진행하였다.
세척 용액으로 3회 세척 후 염소 항-래빗 IgG HRP(산타 크루즈 바이오테크놀러지, sc-2005)를 1:2,500 희석 후, 실온에서 1시간 인큐베이션 하고, 세척 용액으로 3회 세척 후 ECL 플러스 키트를 사용하여 BST PM1 Ag, PCSK9 control antigen의 밴드를 확인하였다(도 2).
실시예 3. 항 PCSK9 마우스 항체 및 하이브리도마 생성
BST PM1 항원을 마우스(BALB/c)에 Adjuvant(Sigma, Cat No: T2684)와 혼합하여 주사하고 생쥐의 혈액을 채취하여 항체 생성 여부를 ELISA로 확인하였다. 2회 면역 후 항체의 역가(1:5,000)가 적정하게 증가하여 면역된 생쥐에서 비장을 떼어내어 B 림프구를 분리하였다. 그 후, 배양한 골수종(Myeloma) 세포(sp2/0)와 융합시킨 후 융합된 세포를 hypoxanthin, Aminopterine 및 Thymidine이 첨가되어 있는 배지(HAT medium)에서 배양하여 골수종(Myeloma)과 B 림프구만이 융합된 세포(Hybridoma)를 선택적으로 선별하여 배양하였다.
B 림프구는 정상세포이므로 장기간 배양시 죽어나가나, 골수종(Myeloma) 세포는 형질 전환된 세포이므로, 하이브리도마는 HAT에서 선택적으로 선별된다. 수득된 Hybridoma 세포 중에서 항원과 반응하는 항체를 생산하는 세포를 ELISA법을 이용하여 확인하였다. ELISA 양성반응인 세포를 한계희석법(Limiting dilution method)을 이용하였다. 양성세포와 음성세포를 분리하는 과정을 반복하여 항원에 반응하는 항체를 생산하는 단일클론세포를 생산하였다.
실시예 4. 항 PCSK9 항체의 스크리닝
실시예 4.1. 1차 스크리닝
생성된 수많은 단일클론하이브리도마 세포에서 면역에 사용한 BST PM1 Ag과 결합하고 GST tag과 결합하지 않는 클론을 아래의 프로토콜을 사용하여 ELISA 분석을 통해 1차 선별하였다. 96웰 플레이트(코닝 라이프 사이언시스)에 0.2 M sodium carbonate pH 9.5에 희석한 BST PM1 Ag과 GST tag를 100 ng/웰 넣은 후 4℃에서 밤새 인큐베이팅 하여 코팅하였다. 이어서, 플레이트를 세척 용액 PBS(pH 7.4)를 사용하여 3회 세척 후 플레이트를 5% skim milk가 포함된 PBST(pH 7.4) 200 ul로 1시간 동안 실온에서 인큐베이션 하였다.
플레이트를 3회 세척 후 단일클론하이브리도마 세포 배양액을 50 ul/웰 넣어준 후 1시간 실온에서 인큐베이션 후 3회 세척을 진행하였다. 1:10,000 농도의 염소 항-마우스 IgG-HRP(산타 크루즈 바이오테크놀러지)를 100 ul/웰 플레이트에 첨가하고, 1시간 동안 실온에서 인큐베이션 하였다. 플레이트를 3회 세척 후 TMB 용액을 100 ul/웰 첨가하여 20분 실온에서 반응시키고 1 N 염산을 100 ul/웰 넣고 10분동안 실온에서 반응시켰다. Perkinelmer Victor X3 플레이트 판독기를 사용하여 450 nm에서 즉시 판독하였다. GST tag에는 결합하지 않고 BST PM1 Ag과 ELISA 결과값을 토대로 69개의 클론을 확인하였고 도 3a에 도식하였다.
실시예 4.2. 2차 스크리닝
ELISA 스크리닝을 통해 1차 선별된 단일클론하이브리도마 세포를 96웰 플레이트(코닝 라이프 사이언시스)에 0.2 M sodium carbonate, pH 9.5에 희석한 1) BST PM1 Ag, 2) BST PM1 GST tag 제거, 3) PCSK9 original, 4) GST tag을 100 ng/웰을 넣어준 후 4℃에서 밤새 인큐베이션 하여 코팅하였다. 이어서, 플레이트를 세척 용액 PBS(pH 7.4)를 사용하여 3회 세척 후 플레이트를 PBST(pH 7.4)에 녹인 5% skim milk 200 ul로 1시간 동안 실온에서 인큐베이션 하였다.
플레이트를 3회 세척 후 단일클론하이브리도마 배양액을 50 ul/웰에 넣어준 후, 1시간 실온에서 인큐베이션 후 3회 세척을 진행하였다. 1:10,000 농도의 염소 항-마우스 IgG-HRP 100 ul/웰을 플레이트에 첨가하고, 1시간 동안 실온에서 인큐베이션 하였다. 플레이트를 3회 세척 후, TMB 용액을 100 ul/웰에 첨가하여 20분 실온에서 반응시켰다. 그 후, 웰당 1 N 염산 100 ul을 웰에 넣어주어 10분 후에 실온에서 수행하였다. Perkinelmer Victor X3 플레이트 판독기를 사용하여 450 nm에서 즉시 판독하였다. 1차 선별된 69개의 클론에서 GST tag에 결합하지 않고 나머지 단백질에 모두 결합하는 20개의 클론을 선별한 결과를 도 3b에 도식하였다.
실시예 4.3. 유동세포계측법(FACS)을 이용한 선별된 8개 클론의 결합 확인
2차 스크리닝으로 선별된 20개의 하이브리도마 세포 배양액을 사용하여 HepG2 세포를 FACS 분석하였다. Flask에서 배양한 HepG2 세포를 Tripsin-EDTA를 처리하여 떼어낸 다음 1,000 rpm, 3분간 원심분리하여 세포를 수득하였다. 미디어를 제거한 다음 3% FBS가 들어 있는 PBS(3% FBS/PBS)를 처리하여 세포를 세척한 후, 1,000 rpm, 3분간 원심분리하여 세포를 수득하였다. 1x105 세포에 BST-PM1 하이브리도마 세포 배양액 1 ml을 처리한 후 얼음에서 1시간 동안 인큐베이션 하였다.
1,000 rpm, 3분간 원심분리하여 세포를 수득한 다음 3% FBS/PBS를 처리하여 세포를 세척한 후, 1,000 rpm, 3분간 원심분리하여 세포를 수득하였다. 항-마우스 IgG FITC(Invitrogen, F2761)를 3% FBS/PBS에 1:100으로 희석한 후 1 ml을 수득한 세포에 처리한 다음 얼음에서 1시간 동안 인큐베이션하였다. 1,000 rpm, 3분간 원심분리하여 세포를 수득한 다음 3% FBS/PBS를 처리하여 세포를 재현탁한 다음 Beckman Coulter 장비(CYTOMICS FC 500)를 이용하여 FACS 분석을 하였다.
HepG2 세포와 Mouse 2nd control은 MFI 1.0 이하로 유사하게 관찰되었으나 20개의 하이브리도마 배양액을 이용한 분석 결과에서 8개의 클론이 결합한 것을 확인하였고, MFI 값을 비교한 결과 9G8, 4B10의 MFI 값이 1.8까지 측정되어 가장 결합력이 높았고 도 4a에 FACS 결과와 MFI 값을 나타내었다. 또한, 8종의 항 PCSK9 항체의 Isotype을 확인하였고 각 Type을 도 4b에 나타내었다.
실시예 5. 9G8, 4B10, 7D1 하이브리도마로부터 항체 제조
실시예 5.1. Serum free media에서 적응 배양
선택된 3가지 하이브리도마 세포(9G8, 4B10, 7D1)는 10% FBS가 있는 상태에서 배양되었다. FBS가 없는, 혹은 적은 상태의 배지에서 세포를 성장시키기 위해 배지 적응을 단계적으로 진행하였다. 무혈청 배지(SFM, Serum free media), Thermo fisher Cat No: 12045076)를 사용하였고, 단계적으로 FBS 농도를 낮춰주며 세포가 적응할 수 있도록 배양하였다. 1) DMEM 10% FBS 배지 75% + SFM 25%, 2) DMEM 10% FBS 배지 50% + SFM 50%, 3) DMEM 10% FBS 배지 25% + SFM 75%, 4) DMEM 10% FBS 배지 90% + SFM 10%, 4) SFM 100% 각 단계를 진행할 때 세포의 증식을 3회 진행하여 성장을 확인한 후 다음 단계로 넘어가 무혈청 배지로의 세포 적응을 완료하였다.
실시예 5.2. 하이브리도마로부터 9G8, 4B10, 7D1 항체 정제
무혈청 배지로 적응이 완료된 3종의 하이브리도마 세포주로부터 정제하는 방법을 설명한다. 9G8, 4B10, 7D1 하이브리도마 세포 2x106 개를 75T 플라스크 10 ml의 무혈청 배지에서 배양시켜 세포를 증식시킨다. 배양된 세포를 파이펫팅으로 잘 떼어낸 후 1,200 rpm, 3분, 상온에서 원심분리하여 세포를 모아준 후 세포수를 측정하여 1x105 세포/ml 들어가도록 삼각플라스크에 넣고 100 ml 무혈청 배지를 넣어주어 세포를 배양(1x107) 하였다. 37℃, 5% CO2, 100 rpm으로 인큐베이션 하여 8일 동안 배양하였다.
8일간 세포 배양 후, 3,000 rpm, 15분, 상온에서 원심분리하여 세포 및 파쇄물을 제거하고 상등액을 0.22 um 필터로 여과하였다. 평형화 용액(PBS pH 7.4)으로 Hitrap protein G HP 5 ml(GE healthcare)를 충분히 흘려준 후 여과된 배양액을 Hitrap protein G HP 5 ml(GE healthcare) 컬럼에 로딩하였다. 비특이적 결합은 PBS로 충분히 세척하여 제거한 후 결합된 항체 단백질은 항체 용출 용액(0.1 M Glycine, pH 2.8)을 사용하여 회수하였다. 회수 후 즉시 1.5 M, Tris pH 9.0를 전체 볼륨의 1/10 만큼 넣어주어 pH를 중성화하였다. 마지막으로 10 kDa 투석막을 사용하여 PBS(pH 7.4) 용액으로 투석을 진행하였고, 정제 과정 동안의 Protein G chromatography 및 항체 확인은 12% SDS PAGE gel을 사용하였다. 그 결과를 도 5에 나타내었다.
실시예 6. PCSK9 Ag과 9G8, 4B10, 7D1 Mab의 결합 확인: 웨스턴블랏
정제된 3종의 9G8, 4B10, 7D1 Mab(단일클론항체)가 PCSK9 Ag과 결합하는지 확인하기 위해 웨스턴블랏으로 확인하였다. PCSK9 Ag(Human PCSK9 protein, Acro사 Cat No: PC9-H5223) 1 ug을 10% SDS PAGE에 로딩 후 0.45 um PVDF membrane에 Transfer을 진행하였다. 5% skim milk가 포함된 PBST(pH 7.4)에 옮긴 후, 2시간 동안 실온에서 차단시켰다. 세척 용액(PBST)로 3회 세척 진행하였다. 3종의 9G8, 4B10, 7D1 Mab를 정량하여 1 ug을 1:1,000으로 PBST에 희석 후 1시간 동안 실온에서 인큐베이션하였다.
세척 용액으로 3회 세척 후 염소 항-마우스 IgG HRP(산타 크루즈 바이오테크놀러지)를 5% skim milk가 포함된 PBST(pH 7.4)에 1:2,500으로 희석하였다. 실온에서 1시간 인큐베이션을 한 후, 세척 용액으로 3회 세척하고 ECL 플러스 키트를 사용하여 도 6에 도시된 바와 같이 정제된 정제된 3종의 9G8, 4B10, 7D1 Mab와 PCSK9 Ag의 결합된 밴드를 확인하였다. 결합력의 세기는 4B10이 가장 높았으며, 다음으로 9G8이었고, 7D1이 낮았다(도 6).
실시예 7. PCSK9 Ag과 9G8, 4B10, 7D1 Mab 결합 확인: ELISA
정제된 3종의 9G8, 4B10, 7D1 Mab가 PCSK9 Ag과 결합하는지 확인하기 위해 ELISA로 확인하였다. 96웰 플레이트(코닝 라이프 사이언시스)에 0.2 M sodium carbonate pH 9.5에 PCSK9 original(PCSK9(human) recombinant protein, abnova사 Cat No: H00255738-P01)을 2 ug/ml로 희석하였다. 그 후, 절반씩 희석시킨 후, 100 ul/웰로 넣은 후, 4℃에서 밤새 인큐베이션하여 코팅하였다. 이어서, 플레이트를 세척 용액 PBS(pH 7.4)를 사용하여 3회 세척 후 플레이트를 5% skim milk가 포함된 PBS(pH 7.4) 200 ul, 1시간 실온에서 인큐베이션 하였다.
플레이트를 3회 세척 후 정제된 9G8, 4B10, 7D1 Mab를 정량하여 PBS(pH 7.4)에 1 ug/ml로 희석 후 각 웰에 100 ul/웰 넣어주었다. 1시간 실온에서 인큐베이션 후, 세척 용액 PBS(pH 7.4)를 사용하여 3회 세척을 진행하였다. 1:5,000 농도의 염소 항-마우스 IgG-HRP를 100 ul/웰 플레이트에 첨가하고, 1시간 동안 실온에서 인큐베이션 하였다. 플레이트를 3회 세척 후 TMB 용액을 100 ul/웰 첨가하여 20분 실온에서 반응시켰다. 1 N 염산 100 ul/웰을 첨가하고 10분 후에 실온에서 수행하였다. TECAN 플레이트 판독기를 사용하여 450 nm에서 즉시 판독하였다. 실시예 6의 웨스턴 블롯 결과와 동일하게 결합력의 세기는 4B10이 가장 높았으며 다음으로 9G8이였고, 7D1이 낮았다. 그 결과를 도 7에 나타내었다.
실시예 8. PCSK9과 LDLR 결합을 억제하기 위한 항 PCSK9 항체의 효능 실험
LDLR과 PCSK9 결합을 차단하는 항 PCSK9 항체의 효능을 확인하기 위해 ELISA를 진행하였다. 96웰 플레이트(코닝 라이프 사이언시스)에 0.2 M sodium carbonate pH 9.5에 염소 항-LDLR 항체(R&D, Cat No:AF2148)를 2 ug/ml로 희석한 후 50 ul/웰 첨가하였다. 4℃에서 밤새 인큐베이션 진행하여 코팅하였다. 이어서, 플레이트를 세척 용액 PBS(pH 7.4)를 사용하여 3회 세척 후, 플레이트를 2% skim milk가 포함된 PBS(pH7.4) 200 ul에, 1시간 실온에서 인큐베이션 하였다.
플레이트를 3회 세척 후 LDLR(R&D, Cat No: 2148LD/CF)를 PBS(pH 7.4)에 0.4 ug/ml로 희석 후, 50 ul/웰 첨가하였다. 2시간 실온에서 인큐베이션하고 PBS(pH 7.4)에 100 ng/ml로 희석한 Biotinylated PCSK9 original과 정제된 9G8, 4B10, 7D1 Mab와 대조 Mab, 마우스 IgG를 PBS(pH 7.4)에 1 ug/ml로 희석하였다. 그 후, 절반씩 희석시킨 후, 50 ul/웰 첨가하였다. 섞어준 후 2시간 실온에서 인큐베이션 하였다. 세척 용액 PBS(pH 7.4)를 사용하여 3회 세척 진행 후 혼합물(100 ul/웰)을 넣어주고 1시간 실온에서 인큐베이션 하였다.
LDLR과 결합된 Biotinylated-PCSK9를 검출하기 위해 1% skim milk가 포함된 PBS(pH 7.4)에 500 ng/ml로 희석한 Streptavidin-HRP를 50 ul/웰 넣어주고, 1시간 실온에서 인큐베이션 하였다. 플레이트를 3회 세척 후 TMB 용액을 100 ul/웰 첨가하여 20분 실온에서 반응시켰다. 1 N 염산 100 ul/웰를 넣어준 후, 10분 후에 실온에서 수행하였다. TECAN 플레이트 판독기를 사용하여 450 nm에서 즉시 판독하였다.
도 8에서 나타낸 바와 같이 PCSK9과 항 PCSK9 항체의 결합력에 비례하지 않고 7D1 Mab가 LDLR와 PCSK9의 결합력을 가장 많이 억제하는 결과를 확인하였다. 항 PCSK9 항체가 기능적으로 효과가 좋다면 항체의 양이 증가할 수록 PCSK9와 결합하여 LDLR에 결합하는 Biotinylated-PCSK9의 양이 줄어들어 흡광도(Absorbance) 값이 줄어드는 결과를 나타낼 것이다. 대조군으로 비교한 대조 Mab(암젠 레파타)와 비슷한 결과값을 나타내었고, Mab를 넣지 않은 것에 비해 억제가 되었음을 확인하였다(도 8)
실시예 9. 항 PCSK9 항체의 HepG2 세포 LDL 흡수 영향
항 PCSK9 항체가 PCSK9 Ag과 결합하여 LDLR의 감소를 억제하여 HepG2 세포로 LDL 흡수를 증가시키는지 확인하기 위해 ELISA 진행하였다. 96웰 플레이트(코스타, 3603)에 HepG2 세포를 10% FBS, DMEM 배지를 사용하여 1x105/웰을 넣어주고, 37℃, 5% CO2에서 밤새 인큐베이션 하였다. 다음날 DMEM 배지로 교체한 후 37℃, 5% CO2에서 밤새 인큐베이팅 하였다.
DMEM 배지에 2 ug/ml로 희석한 PCSK9 Ag을 50 ul/웰 만들고 항 PCSK9 항체(9G8, 4B10, 7D1 Mab)를 다양한 농도로 희석하여 50 ul/웰를 첨가하였다. PCSK9 Ag과 항 PCSK9 항체의 복합체를 만들기 위해 1시간 동안 실온에서 인큐베이팅 하였다. 플레이트를 세척 용액 PBS(pH 7.4)를 사용하여 3회 세척하였다. PCSK9 Ag/항 PCSK9 항체 혼합물을 세포에 첨가하고, 바로 DMEM에 6 ug/ml의 최종 농도로 희석한 LDL BODIPY(인비트로젠, Cat No: L3483)을 50 ul/웰 첨가하였다. 37℃, 5% CO2에서 밤새 인큐베이션 하였다. 플레이트를 3회 세척 후, 세포 형광 신호를 485(Ex)/535(Em)에서 TECAN SafireTM을 사용하여 검출하였다.
도 9에서 나타낸 바와 같이 HepG2 세포에서 발현된 LDLR가 PCSK9에 영향을 받지 않고 LDL과 결합하여 흡수된 LDL의 형광값은 약 260정도이고 항 PCSK9 항체를 넣어주지 않은 PCSK9만 넣어준 형광값은 80정도이다. 항 PCSK9 항체 9G8, 4B10, 7D1, 대조군 Mab(암젠 레파타)으로 비교한 결과 7D1 Mab의 PCSK9과 LDLR 결합 억제 정도가 가장 높았으며 대조군 Mab와 비슷한 결과값을 나타내었다(도 9).
실시예 10. m7D1 항 PCSK9 항체의 에피토프 매핑
최종적으로 선택된 7D1 항 PCSK9 항체와 결합하는 PCSK9 Ag의 결합부위를 확인하기 위해 PEPperMAP® Epitope Substitution Scans로 에피토프 매핑을 확인하였다. 695개 아미노산으로 구성된 PCSK9 Ag을 15개씩 잘라 선형의 펩타이드를 만들어 펩타이드와 펩타이드가 14개의 아미노산이 겹치도록 한 개의 아미노산 간격을 두고 겹치도록 Duplicate로 코팅하였다. 코팅된 플레이트에 7D1 하이브리도마 세포 배양액을 1:100, 1:1,000으로 희석한 후 4℃, 16시간, 140 rpm 인큐베이션 하였다.
염소 항-마우스 IgG (H+L) DyLight680 항체(Invitrogen)를 0.2 ug/ml 희석 후 플레이트에 첨가하고, 대조군 항체(Control antibody) 확인을 위해 마우스 단일클론 항-HA DyLight800 항체를 0.5 ug/ml 희석 후 45분간, 실온에서 인큐베이션 하였다. LI-COR Odyssey Imaging System을 사용하여 red=700 nm/green=800 nm로 검출하였다. 코팅된 PCSK9 Ag의 선형의 펩타이드와 결합한 7D1 항 PCSK9 항체를 확인함으로서, PCSK9 Ag의 에피토프 아미노산 서열을 확인하였고, 실험 결과를 도 10에 나타내었다(도 10).
실시예 11. m7D1 항 PCSK9 항체의 가변영역 서열 확인
7D1 Hybridoma cell line으로 부터 RNA 추출(RNA prep)을 진행한 다음, cDNA 합성 후에 경쇄(Light chain)와 중쇄(Heavy chain)의 Variable region gene을 PCR로 증폭하였다. PCR 증폭된 Light chain과 Heavy chain variable gene을 T-벡터로 cloning 하였다. 서열 분석을 통해 경쇄와 중쇄 각각 1종류의 서열을 확인하였고 Kabat numbering 방법으로 CDR을 표시하였다.
서열이 확인된 7D1 클론의 항원 결합 여부를 확인하기 위하여 Fab construction cloning을 진행하였다. Fab은 서열 분석으로 확인된 7D1의 Variable region gene과 Reference constant region gene을 overlapping으로 연결한 다음 발현 벡터(Expression vector)에 클로닝하여 제작하였다. 7D1 Fab construct의 Periplasmic extract를 이용하여 ELISA를 진행하였다. 7D1 hybridoma 배양액과 Fab은 2차 항체가 다르므로 Signal의 차이가 있으며 Positive control은 7D1 hybridoma 배양액(2차 항체는 항-마우스 HRP)을 사용하였다. Negative control은 다른 항원에 결합하는 Fab(2차 항체는 항-Fab HRP)을 사용하였다.
2종 항원(1.PCSK9 original, 2.BST PM1 Ag, 3.GST)을 이용하여 ELISA 실험을 진행한 결과, PCSK9 original과 BST PM1 Ag에 대해서는 7D1 Fab과 Positive control의 결합을 확인하였다. Background인 BSA 값 대비 PCSK9의 결합이 명확하여 Hybridoma sequencing 결과로 제작된 7D1 Fab은 PCSK9에 특이적인 항체로 판단하였다(도 11).
실시예 12. m7D1의 chimeric 항체 디자인
인간화(Humanization)에 필요한 인간 항체를 서열을 확보하기 위해 항체 서열 데이터베이스인 IMGT(www.imgt.org)에서 서열 검색을 진행하였고, 검색 결과 m7D1 항체와 가장 유사한 인간항체 서열로 heavy chain은 IGHV1-2*02(75.69%)와 IGKJ4*3(79.17%)를 선정하였으며, light chain은 IGKV2-30*01(82.99%)과 IGHJ4*02(80.56%)을 선정하였고(표 4), Homology는 nucleotide sequence를 기반으로 계산하였다.
실시예 13. m7D1 항 PCSK9 항체의 가변영역 서열 인간화 및 항체 생산
마우스 유래에서 수득한 m7D1 항 PCSK9 항체의 가변영역 서열로부터 인간화된 가변영역 서열을 수득하였다. 선별된 인간 항체 서열에서 CDR 부위를 마우스 7D1 서열로 치환하여 ch7D1을 디자인하였다. 디자인된 ch7D1 서열에서 frame work 부분에 해당하는 서열을 마우스 항체 서열로 back mutation 하는 방식으로 인간화를 진행하였다. 또한, hz7D1 서열로 heavy chain 2종(hz7D1.11 VH 및 hz7D1.22 VH) 과 light chain 2종(hz7D1.11 VL 및 hz7D1.22 VL)을 디자인하였다(표 5).
중쇄 및 경쇄의 인간화 버전 중에서 22번째 버전이 보다 인간에 가까운 버전이고, 디자인된 ch7D1과 2종의 hz7D1 항체는 중쇄가 IgG1이고, 경쇄가 kappa constant인 whole IgG 형태가 되도록 유전자 합성을 GenScript사를 통해 진행하였다. 각 항체의 중쇄 및 경쇄는 각각 pcDNA3.1(+) 발현 벡터에 클로닝하였고, 인간화된 2종의 항체의 결합력을 확인하기 위해 IgG 형태의 affinity를 분석하기 위해서 IgG 생산을 진행하였다.
pcDNA3.1(+) 벡터에 클로닝된 각 항체의 중쇄 또는 경쇄에 대한 플라스미드는 염기서열 분석을 통하여 확인하였다. 확인된 plasmid를 HEK293F 세포에 transient transfection 한 후 세포배양액에서 Protein A chromatography를 통해서 IgG를 정제하였다. 정제된 항체의 순도는 SDS PAGE 후 Coomassie Blue staining을 통하여 확인하였다(도 12). 그 결과 3종의 항체 모두 높은 순도로 정제되었음을 확인하였다.
실시예 14. PCSK9 Ag과 인간화 7D1 항체의 결합 확인 ELISA
정제된 3종의 chimeric 7D1, hz7D1.11, hz7D1.22 Mab가 PCSK9 Ag과 결합하는지 확인하기 위해 ELISA로 확인하였다. 96웰 플레이트(코닝 라이프 사이언시스)에 0.2 M sodium carbonate pH 9.5에 PCSK9 original(PCSK9(human) recombinant protein-abnova사 Cat No: H00255738-P01)을 1 ug/ml로 희석한 후 30 ul/웰로 넣어 후 4℃에서 밤새 인큐베이션 하여 코팅 하였다. 이어서, 플레이트를 세척 용액 PBS(pH 7.4)를 사용하여 3회 세척 후, 플레이트를 5% skim milk가 포함된 PBS(pH 7.4) 200 ul에서, 1시간 실온에서 인큐베이션 하였다.
플레이트를 3회 세척 후 정제된 chimeric 7D1, hz7D1.11, hz7D1.22 Mab를 정량하여 10 ug/ml 시작으로 1/3씩 희석하여 30 ul/웰 넣어준 후 1시간 실온에서 인큐베이션 후 세척 용액 PBS(pH 7.4)를 사용하여 3회 세척 진행하였다. 1:3,000 농도의 항-인간 IgG-HRP 30 ul/웰을 플레이트에 첨가하고, 1시간 동안 실온에서 인큐베이션 하였다. 플레이트를 3회 세척 후 TMB 용액을 100 ul/웰 첨가하여 5분 실온에서 반응시키고, 1 N 염산 100 ul/웰 넣어주어 10분 후에 실온에서 수행하였다. 두 번의 독립적인 시험을 수행하였으며, 얻어진 결과는 Prism의 four parameter analysis를 통해서 분석하였고 EC50 값을 기준으로 2종의 hz7D1 항체 모두 parental clone인 ch7D1 대비 PCSK9 original 항원에 대해 높은 결합력을 보였다(도 13).
실시예 15. PCSK9 Ag과 인간화 7D1 항체의 결합 확인
정제된 3종의 chimeric 7D1, hz7D1.11, hz7D1.22 Mab가 PCSK9 Ag과 결합하는지 확인하기 위해 Octet 방법으로 확인하였다. Octet 시험은 IgG 항체를 sensor chip에 immobilization 한 후 다양한 농도의 항원을 analyte으로 사용하는 방식으로 진행하였다. Immobilization는 CM5 chip & AR2G buffer 사용하여 purified whole IgG 1 mg/ml loading 하였다. 또한, Analyte는 PCSK9 original antigen 200 nM을 시작으로 1/2씩 희석하여 5 point loading 하여 Affinity를 장비 내 1:1 interaction model을 통하여 분석하였다. 그 결과, PCSK9 original을 사용하였을 경우 2종의 hz7D1 항체는 모두 ch7D1과 동등한 수준의 결합력을 나타내었다(도 14a 내지 도 14d).

Claims (18)

  1. 인간 PCSK9의 209번째 내지 218번째 아미노산에 특이적으로 결합하는 항체를 유효성분으로 포함하는 콜레스테롤 관련 질환 치료 또는 예방용 약학 조성물.
  2. 제1항에 있어서,
    상기 PCSK9은 서열번호 49의 아미노산 서열을 가지는 것인, 콜레스테롤 관련 질환 치료 또는 예방용 약학 조성물.
  3. 제1항에 있어서,
    인간 PCSK9의 209번째 내지 218번째 아미노산 서열은 서열번호 27인 것인, 콜레스테롤 관련 질환 치료 또는 예방용 약학 조성물.
  4. 제1항 내지 제3항 중 어느 한 항에 있어서,
    상기 콜레스테롤 관련 질환은 고콜레스테롤혈증, 고지혈증, 죽상경화성 심혈관질환(ACVD), 급성관상동맥증후군(ACS), 고혈압, 당뇨병, 뇌졸중, 알츠하이머 및 이상지질혈증으로 이루어진 군에서 선택되는 어느 하나인 것인, 콜레스테롤 관련 질환 치료 또는 예방용 약학 조성물.
  5. 서열번호 1의 LCDR1, 서열번호 2의 LCDR2, 및 서열번호 3의 LCDR3을 포함하는 경쇄가변영역; 및
    서열번호 4의 HCDR1, 서열번호 5의 HCDR2, 및 서열번호 6의 HCDR3을 포함하는 중쇄가변영역을 포함하는 PCSK9에 특이적인 항체.
  6. 제5항에 있어서,
    상기 항체는 PCSK9의 서열번호 27 및/또는 서열번호 50의 아미노산 서열을 갖는 항원에 특이적으로 결합하는 것인, PCSK9에 특이적인 항체.
  7. 제5항에 있어서,
    상기 중쇄영역은 서열번호 19 또는 서열번호 23의 아미노산 서열을 가지는 것인, PCSK9에 특이적인 항체.
  8. 제5항에 있어서,
    상기 경쇄영역은 서열번호 21 또는 서열번호 25의 아미노산 서열을 가지는 것인, PCSK9에 특이적인 항체.
  9. 제5항에 있어서,
    상기 항체가 인간화 항체인, PCSK9에 특이적인 항체.
  10. 제5항의 항체를 유효성분으로 포함하는 콜레스테롤 관련 질환 치료 또는 예방용 약학 조성물.
  11. 제10항에 있어서,
    상기 약학 조성물이 약제학적으로 허용가능한 담체를 더 포함하는 것인, 콜레스테롤 관련 질환 치료 또는 예방용 약학 조성물.
  12. 제10항에 있어서,
    상기 콜레스테롤 관련 질환은 고콜레스테롤혈증, 고지혈증, 죽상경화성 심혈관질환(ACVD), 급성관상동맥증후군(ACS), 고혈압, 당뇨병, 뇌졸중, 알츠하이머 및 이상지질혈증으로 이루어진 군에서 선택되는 어느 하나인 것인, 약학 조성물.
  13. 제5항 내지 제9항 중 어느 한 항의 PCSK9에 특이적인 항체를 암호화하는 폴리뉴클레오티드.
  14. 제13항의 폴리뉴클레오티드를 포함하는 벡터.
  15. 제14항의 벡터가 도입된 형질전환 세포.
  16. 제15항의 형질전환 세포를 배양하는 단계;
    상기 배양액으로부터 제5항의 항체를 수득하는 단계를 포함하는
    PCSK9에 특이적인 항체를 제조하는 방법.
  17. 인간 PCSK9의 209번째 내지 218번째 아미노산에 특이적으로 결합하는 항체를 유효성분으로 포함하는 조성물의 콜레스테롤 관련 질환 치료 또는 예방 용도.
  18. 인간 PCSK9의 209번째 내지 218번째 아미노산에 특이적으로 결합하는 항체를 유효성분으로 포함하는 약학 조성물을 개체에 투여하는 단계를 포함하는 콜레스테롤 관련 질환 치료 또는 예방 방법.
PCT/KR2021/007876 2020-06-24 2021-06-23 항 pcsk9 항체 및 이의 용도 WO2021261906A1 (ko)

Priority Applications (1)

Application Number Priority Date Filing Date Title
US18/003,121 US20230242673A1 (en) 2020-06-24 2021-06-23 Anti-pcsk9 antibody and use thereof

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR1020200077370A KR20210158693A (ko) 2020-06-24 2020-06-24 항 ｐｃｓｋ９ 항체 및 이의 용도
KR10-2020-0077370 2020-06-24

Publications (1)

Publication Number Publication Date
WO2021261906A1 true WO2021261906A1 (ko) 2021-12-30

Family

ID=79177862

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/007876 WO2021261906A1 (ko) 2020-06-24 2021-06-23 항 pcsk9 항체 및 이의 용도

Country Status (3)

Country Link
US (1) US20230242673A1 (ko)
KR (1) KR20210158693A (ko)
WO (1) WO2021261906A1 (ko)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20100091191A (ko) * 2007-10-26 2010-08-18 쉐링 코포레이션 항-ｐｃｓｋ9, 및 지질 및 콜레스테롤 질환의 치료 방법
US8080243B2 (en) * 2008-09-12 2011-12-20 Rinat Neuroscience Corp. Isolated antibody which specifically binds to PCSK9
WO2013148284A1 (en) * 2012-03-29 2013-10-03 Genentech, Inc. Antibodies that bind to a pcsk9 cleavage site and methods of use
US20150071951A1 (en) * 2011-09-13 2015-03-12 Affiris Ag Vaccine
US20190389968A1 (en) * 2012-05-08 2019-12-26 Alderibio Holdings Llc Anti-pcsk9 antibodies and use thereof

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20100091191A (ko) * 2007-10-26 2010-08-18 쉐링 코포레이션 항-ｐｃｓｋ9, 및 지질 및 콜레스테롤 질환의 치료 방법
US8080243B2 (en) * 2008-09-12 2011-12-20 Rinat Neuroscience Corp. Isolated antibody which specifically binds to PCSK9
US20150071951A1 (en) * 2011-09-13 2015-03-12 Affiris Ag Vaccine
WO2013148284A1 (en) * 2012-03-29 2013-10-03 Genentech, Inc. Antibodies that bind to a pcsk9 cleavage site and methods of use
US20190389968A1 (en) * 2012-05-08 2019-12-26 Alderibio Holdings Llc Anti-pcsk9 antibodies and use thereof

Also Published As

Publication number Publication date
US20230242673A1 (en) 2023-08-03
KR20210158693A (ko) 2021-12-31

Similar Documents

Publication Publication Date Title
AU2019229076B2 (en) Anti-TIGIT antibodies and uses thereof
WO2020076105A1 (ko) 신규 항-c-kit 항체
WO2014119969A1 (ko) 보체 관련 질환의 예방 및 치료를 위한 c5 항체 및 방법
JP6696899B2 (ja) プラスミノーゲン活性化因子阻害剤−１（ｐａｉ−１）に対する抗体及びその使用
AU2011208719B2 (en) Anticoagulant antidotes
AU2011208719C1 (en) Anticoagulant antidotes
WO2019098682A1 (ko) 항-her2 항체 또는 그의 항원 결합 단편, 및 이를 포함하는 키메라 항원 수용체
WO2014084607A1 (ko) 항체 중쇄불변부위의 이종이중체 고효율 형성을 유도하는 ch3 도메인 변이체 쌍, 이의 제조방법, 및 용도
WO2015167293A1 (en) Antibody binding to fcrn for treating autoimmune diseases
EP1625166A1 (en) Antibodies to masp-2
WO2016085289A1 (ko) B형 간염 바이러스의 pres1에 특이적으로 결합하는 항체 및 이의 용도
WO2016137108A1 (en) Novel antibody binding to tfpi and composition comprising the same
WO2021261906A1 (ko) 항 pcsk9 항체 및 이의 용도
WO2017074013A1 (ko) 인간 및 마우스 sema3a에 교차결합하는 항체 및 그의 용도
WO2022154288A1 (ko) 단백질 키나아제 a의 촉매 서브 유닛 알파에 특이적으로 결합하는 단일클론항체 및 이를 활용한 암 진단 용도
WO2019235856A1 (ko) Tie2에 결합하는 항체 및 이의 용도
WO2020004934A1 (ko) 항-bcma 항체 및 그 용도
WO2019216675A1 (ko) 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체
WO2016084993A1 (ko) 신규 EGFRvIII 항체 및 이를 포함하는 조성물
WO2014021693A2 (ko) Tm4sf5 단백질에 특이적으로 결합하는 신규한 단일클론항체 및 이의 용도
WO2020246760A1 (ko) 퇴행성관절염 예방 또는 치료용 항-oscar 항체
WO2019088658A1 (ko) Scf 및 갈렉틴-1을 표적으로 하는 이중표적항체 및 그 용도
WO2010093214A2 (en) Monoclonal antibody recognizing scye1 and use thereof
WO2022039507A1 (ko) 변형 항체 및 이의 제조방법
WO2023287238A1 (ko) 뇌혈관장벽 통과 효율이 향상된 항 인간 트랜스페린 수용체 항체, 및 이를 이용한 다중특이적 항체 및 약학 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21829691

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 21829691

Country of ref document: EP

Kind code of ref document: A1