WO2022216096A1 - 항암 및 면역증강용 신규 타겟 - Google Patents
항암 및 면역증강용 신규 타겟 Download PDFInfo
- Publication number
- WO2022216096A1 WO2022216096A1 PCT/KR2022/005073 KR2022005073W WO2022216096A1 WO 2022216096 A1 WO2022216096 A1 WO 2022216096A1 KR 2022005073 W KR2022005073 W KR 2022005073W WO 2022216096 A1 WO2022216096 A1 WO 2022216096A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cntn4
- cancer
- antibody
- inhibitor
- pharmaceutical composition
- Prior art date
Links
- 230000001093 anti-cancer Effects 0.000 title description 2
- 230000005904 anticancer immunity Effects 0.000 title 1
- 101000909504 Homo sapiens Contactin-4 Proteins 0.000 claims abstract description 194
- 102100024340 Contactin-4 Human genes 0.000 claims abstract description 178
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 89
- 201000011510 cancer Diseases 0.000 claims abstract description 78
- 238000000034 method Methods 0.000 claims abstract description 51
- 230000000694 effects Effects 0.000 claims abstract description 41
- 239000003112 inhibitor Substances 0.000 claims abstract description 40
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 32
- 230000014509 gene expression Effects 0.000 claims abstract description 30
- 229940125648 antineoplastic drug candidate Drugs 0.000 claims abstract description 16
- 239000002246 antineoplastic agent Substances 0.000 claims abstract description 13
- 238000012216 screening Methods 0.000 claims abstract description 13
- 230000036039 immunity Effects 0.000 claims abstract description 7
- 238000005259 measurement Methods 0.000 claims abstract description 6
- 230000002708 enhancing effect Effects 0.000 claims abstract description 5
- 210000004027 cell Anatomy 0.000 claims description 84
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 40
- 230000027455 binding Effects 0.000 claims description 34
- 101710137189 Amyloid-beta A4 protein Proteins 0.000 claims description 28
- 102100022704 Amyloid-beta precursor protein Human genes 0.000 claims description 28
- 101710151993 Amyloid-beta precursor protein Proteins 0.000 claims description 28
- DZHSAHHDTRWUTF-SIQRNXPUSA-N amyloid-beta polypeptide 42 Chemical compound C([C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)NCC(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(O)=O)[C@@H](C)CC)C(C)C)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC(O)=O)C(C)C)C(C)C)C1=CC=CC=C1 DZHSAHHDTRWUTF-SIQRNXPUSA-N 0.000 claims description 28
- 108090000623 proteins and genes Proteins 0.000 claims description 28
- 239000004055 small Interfering RNA Substances 0.000 claims description 28
- 102000004169 proteins and genes Human genes 0.000 claims description 25
- 108020004459 Small interfering RNA Proteins 0.000 claims description 24
- 239000000427 antigen Substances 0.000 claims description 19
- 108091007433 antigens Proteins 0.000 claims description 19
- 102000036639 antigens Human genes 0.000 claims description 19
- 239000012634 fragment Substances 0.000 claims description 19
- 108020004999 messenger RNA Proteins 0.000 claims description 19
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 18
- 150000007523 nucleic acids Chemical class 0.000 claims description 17
- 150000001413 amino acids Chemical group 0.000 claims description 15
- 238000011282 treatment Methods 0.000 claims description 15
- 102100037362 Fibronectin Human genes 0.000 claims description 13
- 239000000126 substance Substances 0.000 claims description 13
- 229940049595 antibody-drug conjugate Drugs 0.000 claims description 12
- 108020004414 DNA Proteins 0.000 claims description 11
- 230000000692 anti-sense effect Effects 0.000 claims description 11
- 230000005764 inhibitory process Effects 0.000 claims description 11
- 108020004707 nucleic acids Proteins 0.000 claims description 11
- 102000039446 nucleic acids Human genes 0.000 claims description 11
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 9
- 201000005202 lung cancer Diseases 0.000 claims description 9
- 208000020816 lung neoplasm Diseases 0.000 claims description 9
- 108090000994 Catalytic RNA Proteins 0.000 claims description 8
- 102000053642 Catalytic RNA Human genes 0.000 claims description 8
- 206010009944 Colon cancer Diseases 0.000 claims description 8
- 108091027967 Small hairpin RNA Proteins 0.000 claims description 8
- 150000001875 compounds Chemical class 0.000 claims description 8
- 108020001507 fusion proteins Proteins 0.000 claims description 8
- 102000037865 fusion proteins Human genes 0.000 claims description 8
- 230000001965 increasing effect Effects 0.000 claims description 8
- 108091070501 miRNA Proteins 0.000 claims description 8
- 239000002679 microRNA Substances 0.000 claims description 8
- 230000002829 reductive effect Effects 0.000 claims description 8
- 108091092562 ribozyme Proteins 0.000 claims description 8
- 239000000611 antibody drug conjugate Substances 0.000 claims description 7
- 229940041181 antineoplastic drug Drugs 0.000 claims description 7
- 208000029742 colonic neoplasm Diseases 0.000 claims description 7
- 108091023037 Aptamer Proteins 0.000 claims description 6
- 206010006187 Breast cancer Diseases 0.000 claims description 6
- 208000026310 Breast neoplasm Diseases 0.000 claims description 6
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 6
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 6
- 206010017758 gastric cancer Diseases 0.000 claims description 6
- 201000011549 stomach cancer Diseases 0.000 claims description 6
- 108010067306 Fibronectins Proteins 0.000 claims description 5
- 201000010099 disease Diseases 0.000 claims description 5
- 230000002265 prevention Effects 0.000 claims description 5
- 238000007877 drug screening Methods 0.000 claims description 4
- 210000000987 immune system Anatomy 0.000 claims description 4
- 229940125644 antibody drug Drugs 0.000 claims description 3
- 230000001404 mediated effect Effects 0.000 claims description 3
- 206010001233 Adenoma benign Diseases 0.000 claims description 2
- 206010005003 Bladder cancer Diseases 0.000 claims description 2
- 206010005949 Bone cancer Diseases 0.000 claims description 2
- 208000018084 Bone neoplasm Diseases 0.000 claims description 2
- 208000003174 Brain Neoplasms Diseases 0.000 claims description 2
- 206010008342 Cervix carcinoma Diseases 0.000 claims description 2
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims description 2
- 208000000461 Esophageal Neoplasms Diseases 0.000 claims description 2
- 208000007659 Fibroadenoma Diseases 0.000 claims description 2
- 206010061598 Immunodeficiency Diseases 0.000 claims description 2
- 208000029462 Immunodeficiency disease Diseases 0.000 claims description 2
- 206010062016 Immunosuppression Diseases 0.000 claims description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 claims description 2
- 206010025323 Lymphomas Diseases 0.000 claims description 2
- 206010030155 Oesophageal carcinoma Diseases 0.000 claims description 2
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 2
- 208000000821 Parathyroid Neoplasms Diseases 0.000 claims description 2
- 206010060862 Prostate cancer Diseases 0.000 claims description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 2
- 206010038389 Renal cancer Diseases 0.000 claims description 2
- 206010039491 Sarcoma Diseases 0.000 claims description 2
- 208000034189 Sclerosis Diseases 0.000 claims description 2
- 208000024770 Thyroid neoplasm Diseases 0.000 claims description 2
- 206010046431 Urethral cancer Diseases 0.000 claims description 2
- 206010046458 Urethral neoplasms Diseases 0.000 claims description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 claims description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 claims description 2
- 208000002495 Uterine Neoplasms Diseases 0.000 claims description 2
- 201000003149 breast fibroadenoma Diseases 0.000 claims description 2
- 201000010881 cervical cancer Diseases 0.000 claims description 2
- 201000004101 esophageal cancer Diseases 0.000 claims description 2
- 201000010536 head and neck cancer Diseases 0.000 claims description 2
- 208000014829 head and neck neoplasm Diseases 0.000 claims description 2
- 201000005787 hematologic cancer Diseases 0.000 claims description 2
- 230000028993 immune response Effects 0.000 claims description 2
- 230000007813 immunodeficiency Effects 0.000 claims description 2
- 230000001506 immunosuppresive effect Effects 0.000 claims description 2
- 230000006872 improvement Effects 0.000 claims description 2
- 201000010982 kidney cancer Diseases 0.000 claims description 2
- 201000007270 liver cancer Diseases 0.000 claims description 2
- 208000014018 liver neoplasm Diseases 0.000 claims description 2
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 2
- 208000026045 malignant tumor of parathyroid gland Diseases 0.000 claims description 2
- 201000001441 melanoma Diseases 0.000 claims description 2
- 201000002528 pancreatic cancer Diseases 0.000 claims description 2
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 2
- 201000002314 small intestine cancer Diseases 0.000 claims description 2
- 201000002510 thyroid cancer Diseases 0.000 claims description 2
- 201000005112 urinary bladder cancer Diseases 0.000 claims description 2
- 206010046766 uterine cancer Diseases 0.000 claims description 2
- 239000002924 silencing RNA Substances 0.000 claims 4
- 238000004393 prognosis Methods 0.000 abstract description 8
- 238000004458 analytical method Methods 0.000 abstract description 4
- 238000003745 diagnosis Methods 0.000 abstract 1
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 27
- 239000000872 buffer Substances 0.000 description 19
- 239000006228 supernatant Substances 0.000 description 17
- 239000000203 mixture Substances 0.000 description 16
- 239000000523 sample Substances 0.000 description 15
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 12
- 238000005119 centrifugation Methods 0.000 description 12
- 230000006870 function Effects 0.000 description 11
- 239000003001 serine protease inhibitor Substances 0.000 description 11
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 10
- 230000000903 blocking effect Effects 0.000 description 9
- 102000054221 human CNTN4 Human genes 0.000 description 9
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 9
- 230000035755 proliferation Effects 0.000 description 8
- 238000002965 ELISA Methods 0.000 description 7
- 239000012980 RPMI-1640 medium Substances 0.000 description 7
- 231100000135 cytotoxicity Toxicity 0.000 description 7
- 230000003013 cytotoxicity Effects 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 7
- 239000000047 product Substances 0.000 description 7
- 238000007789 sealing Methods 0.000 description 7
- VDABVNMGKGUPEY-UHFFFAOYSA-N 6-carboxyfluorescein succinimidyl ester Chemical compound C=1C(O)=CC=C2C=1OC1=CC(O)=CC=C1C2(C1=C2)OC(=O)C1=CC=C2C(=O)ON1C(=O)CCC1=O VDABVNMGKGUPEY-UHFFFAOYSA-N 0.000 description 6
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 6
- 238000009472 formulation Methods 0.000 description 6
- 239000013612 plasmid Substances 0.000 description 6
- 108091028043 Nucleic acid sequence Proteins 0.000 description 5
- 239000004480 active ingredient Substances 0.000 description 5
- 238000003556 assay Methods 0.000 description 5
- 210000004369 blood Anatomy 0.000 description 5
- 239000008280 blood Substances 0.000 description 5
- 239000000499 gel Substances 0.000 description 5
- 238000001114 immunoprecipitation Methods 0.000 description 5
- 208000032839 leukemia Diseases 0.000 description 5
- 230000003472 neutralizing effect Effects 0.000 description 5
- 238000007911 parenteral administration Methods 0.000 description 5
- 210000001519 tissue Anatomy 0.000 description 5
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- 241000699666 Mus <mouse, genus> Species 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- 108010029485 Protein Isoforms Proteins 0.000 description 4
- 102000001708 Protein Isoforms Human genes 0.000 description 4
- 239000013592 cell lysate Substances 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 230000000295 complement effect Effects 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 230000018109 developmental process Effects 0.000 description 4
- 239000013613 expression plasmid Substances 0.000 description 4
- 238000003197 gene knockdown Methods 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 238000002826 magnetic-activated cell sorting Methods 0.000 description 4
- 238000005406 washing Methods 0.000 description 4
- 238000001262 western blot Methods 0.000 description 4
- YXHLJMWYDTXDHS-IRFLANFNSA-N 7-aminoactinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=C(N)C=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 YXHLJMWYDTXDHS-IRFLANFNSA-N 0.000 description 3
- 108700012813 7-aminoactinomycin D Proteins 0.000 description 3
- 108010032595 Antibody Binding Sites Proteins 0.000 description 3
- 108010074708 B7-H1 Antigen Proteins 0.000 description 3
- 102000008096 B7-H1 Antigen Human genes 0.000 description 3
- 102100034343 Integrase Human genes 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 101100496557 Mus musculus Cntn4 gene Proteins 0.000 description 3
- 108010092799 RNA-directed DNA polymerase Proteins 0.000 description 3
- 229920002472 Starch Chemical class 0.000 description 3
- 238000002835 absorbance Methods 0.000 description 3
- -1 antibody Chemical class 0.000 description 3
- 239000001913 cellulose Chemical class 0.000 description 3
- 229920002678 cellulose Chemical class 0.000 description 3
- 238000012790 confirmation Methods 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- UQLDLKMNUJERMK-UHFFFAOYSA-L di(octadecanoyloxy)lead Chemical compound [Pb+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O UQLDLKMNUJERMK-UHFFFAOYSA-L 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 238000013537 high throughput screening Methods 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 230000002147 killing effect Effects 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 239000012723 sample buffer Substances 0.000 description 3
- 238000013519 translation Methods 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- 101001117317 Homo sapiens Programmed cell death 1 ligand 1 Proteins 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 238000012228 RNA interference-mediated gene silencing Methods 0.000 description 2
- 230000006052 T cell proliferation Effects 0.000 description 2
- 210000005006 adaptive immune system Anatomy 0.000 description 2
- 230000004721 adaptive immunity Effects 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 230000001413 cellular effect Effects 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 239000003638 chemical reducing agent Substances 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- OSASVXMJTNOKOY-UHFFFAOYSA-N chlorobutanol Chemical compound CC(C)(O)C(Cl)(Cl)Cl OSASVXMJTNOKOY-UHFFFAOYSA-N 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 230000034994 death Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 239000012153 distilled water Substances 0.000 description 2
- 239000008298 dragée Substances 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 239000012997 ficoll-paque Substances 0.000 description 2
- 230000009368 gene silencing by RNA Effects 0.000 description 2
- 229960002897 heparin Drugs 0.000 description 2
- 229920000669 heparin Polymers 0.000 description 2
- 102000048776 human CD274 Human genes 0.000 description 2
- 230000000951 immunodiffusion Effects 0.000 description 2
- 238000011532 immunohistochemical staining Methods 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 229930014626 natural product Natural products 0.000 description 2
- LXCFILQKKLGQFO-UHFFFAOYSA-N p-hydroxybenzoic acid methyl ester Natural products COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 238000002823 phage display Methods 0.000 description 2
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 2
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 2
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 238000003127 radioimmunoassay Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- GEHJYWRUCIMESM-UHFFFAOYSA-L sodium sulfite Chemical compound [Na+].[Na+].[O-]S([O-])=O GEHJYWRUCIMESM-UHFFFAOYSA-L 0.000 description 2
- 239000000243 solution Substances 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 239000003826 tablet Substances 0.000 description 2
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- IXPNQXFRVYWDDI-UHFFFAOYSA-N 1-methyl-2,4-dioxo-1,3-diazinane-5-carboximidamide Chemical compound CN1CC(C(N)=N)C(=O)NC1=O IXPNQXFRVYWDDI-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- 229920001817 Agar Polymers 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 241001260012 Bursa Species 0.000 description 1
- 238000011740 C57BL/6 mouse Methods 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 102000016289 Cell Adhesion Molecules Human genes 0.000 description 1
- 108010067225 Cell Adhesion Molecules Proteins 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 101710107714 Contactin-4 Proteins 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 238000000018 DNA microarray Methods 0.000 description 1
- 206010061818 Disease progression Diseases 0.000 description 1
- 206010061819 Disease recurrence Diseases 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 239000004386 Erythritol Substances 0.000 description 1
- UNXHWFMMPAWVPI-UHFFFAOYSA-N Erythritol Natural products OCC(O)C(O)CO UNXHWFMMPAWVPI-UHFFFAOYSA-N 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 1
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 1
- 102000006382 Ribonucleases Human genes 0.000 description 1
- 108010083644 Ribonucleases Proteins 0.000 description 1
- DWAQJAXMDSEUJJ-UHFFFAOYSA-M Sodium bisulfite Chemical compound [Na+].OS([O-])=O DWAQJAXMDSEUJJ-UHFFFAOYSA-M 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- ZTOJFFHGPLIVKC-CLFAGFIQSA-N abts Chemical compound S/1C2=CC(S(O)(=O)=O)=CC=C2N(CC)C\1=N\N=C1/SC2=CC(S(O)(=O)=O)=CC=C2N1CC ZTOJFFHGPLIVKC-CLFAGFIQSA-N 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 239000008272 agar Substances 0.000 description 1
- 229940023476 agar Drugs 0.000 description 1
- 235000010419 agar Nutrition 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000002744 anti-aggregatory effect Effects 0.000 description 1
- 230000001745 anti-biotin effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 238000003149 assay kit Methods 0.000 description 1
- 210000003050 axon Anatomy 0.000 description 1
- OHDRQQURAXLVGJ-HLVWOLMTSA-N azane;(2e)-3-ethyl-2-[(e)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S/1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C\1=N/N=C1/SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-HLVWOLMTSA-N 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- OWMVSZAMULFTJU-UHFFFAOYSA-N bis-tris Chemical compound OCCN(CCO)C(CO)(CO)CO OWMVSZAMULFTJU-UHFFFAOYSA-N 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 230000005880 cancer cell killing Effects 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 229960004926 chlorobutanol Drugs 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 201000010897 colon adenocarcinoma Diseases 0.000 description 1
- 230000009137 competitive binding Effects 0.000 description 1
- 230000002860 competitive effect Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 229940099112 cornstarch Drugs 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 238000002784 cytotoxicity assay Methods 0.000 description 1
- 231100000263 cytotoxicity test Toxicity 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 230000036425 denaturation Effects 0.000 description 1
- 238000004925 denaturation Methods 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- 239000012470 diluted sample Substances 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 230000005750 disease progression Effects 0.000 description 1
- 239000007884 disintegrant Substances 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- UNXHWFMMPAWVPI-ZXZARUISSA-N erythritol Chemical compound OC[C@H](O)[C@H](O)CO UNXHWFMMPAWVPI-ZXZARUISSA-N 0.000 description 1
- 235000019414 erythritol Nutrition 0.000 description 1
- 229940009714 erythritol Drugs 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 229930004094 glycosylphosphatidylinositol Natural products 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 239000008202 granule composition Substances 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000003862 health status Effects 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 1
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 1
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 1
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 1
- 230000005965 immune activity Effects 0.000 description 1
- 238000000760 immunoelectrophoresis Methods 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000007913 intrathecal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 230000009545 invasion Effects 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 239000012516 mab select resin Substances 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 239000000845 maltitol Substances 0.000 description 1
- 235000010449 maltitol Nutrition 0.000 description 1
- VQHSOMBJVWLPSR-WUJBLJFYSA-N maltitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-WUJBLJFYSA-N 0.000 description 1
- 229940035436 maltitol Drugs 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 1
- 230000037353 metabolic pathway Effects 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- 239000011325 microbead Substances 0.000 description 1
- 229940100661 nasal inhalant Drugs 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 108091027963 non-coding RNA Proteins 0.000 description 1
- 102000042567 non-coding RNA Human genes 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 210000004976 peripheral blood cell Anatomy 0.000 description 1
- 150000002978 peroxides Chemical class 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 229920001592 potato starch Polymers 0.000 description 1
- 229940116317 potato starch Drugs 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 102000004196 processed proteins & peptides Human genes 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 230000006916 protein interaction Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 238000003757 reverse transcription PCR Methods 0.000 description 1
- 229940100486 rice starch Drugs 0.000 description 1
- 239000012146 running buffer Substances 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 238000010187 selection method Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 238000003998 size exclusion chromatography high performance liquid chromatography Methods 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 235000010413 sodium alginate Nutrition 0.000 description 1
- 239000000661 sodium alginate Substances 0.000 description 1
- 229940005550 sodium alginate Drugs 0.000 description 1
- 235000019812 sodium carboxymethyl cellulose Nutrition 0.000 description 1
- 229920001027 sodium carboxymethylcellulose Polymers 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 229940079827 sodium hydrogen sulfite Drugs 0.000 description 1
- 235000010267 sodium hydrogen sulphite Nutrition 0.000 description 1
- 229940001482 sodium sulfite Drugs 0.000 description 1
- 235000010265 sodium sulphite Nutrition 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 239000008107 starch Chemical class 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 238000003146 transient transfection Methods 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 229940100445 wheat starch Drugs 0.000 description 1
- 239000000811 xylitol Substances 0.000 description 1
- 235000010447 xylitol Nutrition 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
- 238000001086 yeast two-hybrid system Methods 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/70—Carbohydrates; Sugars; Derivatives thereof
- A61K31/7088—Compounds having three or more nucleosides or nucleotides
- A61K31/713—Double-stranded nucleic acids or oligonucleotides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5011—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing antineoplastic activity
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/14011—Baculoviridae
- C12N2710/14111—Nucleopolyhedrovirus, e.g. autographa californica nucleopolyhedrovirus
- C12N2710/14141—Use of virus, viral particle or viral elements as a vector
- C12N2710/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/16011—Caliciviridae
- C12N2770/16021—Viruses as such, e.g. new isolates, mutants or their genomic sequences
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/16011—Caliciviridae
- C12N2770/16023—Virus like particles [VLP]
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
- C12N2770/00011—Details
- C12N2770/16011—Caliciviridae
- C12N2770/16034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Definitions
- the present invention relates to a pharmaceutical composition for treating or preventing cancer comprising a CNTN4 inhibitor.
- the present invention relates to a pharmaceutical composition for enhancing immunity comprising a CNTN4 inhibitor.
- the present invention relates to a method for screening an anticancer drug using CNTN4, and a method for providing information necessary for cancer prognosis analysis.
- cancer is still the leading cause of death worldwide.
- a number of cancer treatments have been developed but are not effective for all carcinomas and for all patients.
- Most currently used methods for treating cancer are relatively non-selective.
- the diseased tissue is removed by surgery, the size of a solid tumor is reduced by radiation therapy, or cancer cells are rapidly killed by chemotherapy.
- chemotherapy can develop resistance to drugs and, in some cases, limit the administrable dose, resulting in side effects that are severe enough to preclude the use of potentially effective drugs. Therefore, there is an urgent need to develop a target-specific and more effective cancer treatment.
- the human adaptive immune system is a very sophisticated system that can specifically kill cancer cells.
- T cells in the case of T cells, it plays a role in determining cellular adaptive immunity, and when cells are exposed to non-self or abnormal antigens, they recognize and remove antigens.
- T cells In the case of T cells, they express about 20,000-40,000 TCR molecules per cell and specifically recognize several antigens (determined by the peptide sequence) out of 100,000 pMHC molecules of APC to initiate signal transduction.
- TCR molecule should act as a highly sensitive sensor that must transmit a signal by recognizing a very sophisticated and subtle antigenic change.
- This cellular adaptive immunity must work very precisely to effectively eliminate cancer cells. If the antigen-specific adaptive immune system does not function normally, it causes serious problems in the ability to eliminate cancer cells.
- the T cells cannot attack the cancer cells. Therefore, for effective cancer treatment, it is necessary to remove factors that prevent T cells from eliminating cancer cells.
- the present inventors have completed the present invention by confirming that inhibition of CNTN4 activity significantly inhibits cancer development, growth, invasion and metastasis.
- one aspect of the present invention provides a pharmaceutical composition for treating or preventing cancer comprising a CNTN4 inhibitor as an active ingredient.
- CNTN4 Contactin-4
- CNTN4 refers to a protein encoded by the CNTN4 gene, which belongs to the immunoglobulin superfamily, and functions as a cell adhesion molecule (glycosylphosphatidylinositol)-anchored neuronal membrane protein for the development of the nervous system. It is known to play a role in forming axon connections in the process.
- the CNTN4 may be human-derived CNTN4. More specifically, the amino acid sequence of CNTN4 may be or include the sequence of NP_783200.1 disclosed in NCBI. In addition, the CNTN4 amino acid sequence may be or include a sequence having 80%, 85%, 90% or 95% or more homology with the sequence of NCBI Reference Sequence: NP_115920.1, NP_783200.1, AAL51154.1, respectively It is not limited, and any amino acid sequence showing the characteristic or function of CNTN4 is included.
- the gene of CNTN4 may be or include a nucleic acid sequence encoding an amino acid sequence of human CNTN4, or may be or include a nucleic acid sequence of NCBI Reference Sequence: NM_175607.3 disclosed in NCBI.
- the nucleic acid sequence of CNTN4 is a sequence having 80%, 85%, 90% or 95% or more homology with the nucleic acid sequences of NCBI Reference Sequences: NM_032531.4, NM_175607.3, AY063125.1 disclosed in NCBI, respectively. It may include, but is not limited to, any nucleic acid sequence capable of producing an amino acid exhibiting a characteristic or function of CNTN4 is included.
- CNTN4 inhibitor refers to a substance that inhibits the activity or expression of CNTN4.
- the CNTN4 inhibitor may inhibit the cancer cell evasion function of T cells.
- the CNTN4 inhibitor may specifically bind to the CNTN4 protein and interfere with the binding of CNTN4 to T cells, or inhibit a specific metabolic pathway of CNTN4 to reduce protein expression or denaturation to no activity. Therefore, the CNTN4 inhibitor according to the present invention is very effective in treating or preventing cancer.
- the CNTN4 inhibitor may include a compound, protein, fusion protein, antibody, amino acid, peptide, virus, carbohydrate, lipid, nucleic acid, extract, fraction, etc., as long as it is a substance that inhibits the activity or expression of CNTN4. not.
- the CNTN4 inhibitor may decrease the expression of CNTN4 in cancer cells compared to cancer cells not treated with the CNTN4 inhibitor.
- the reduced expression of CNTN4 may mean that the level of mRNA and/or protein generated from the CNTN4 gene is reduced or eliminated.
- the CNTN4 inhibitor may include, for example, an antisense nucleic acid, siRNA, shRNA, miRNA, ribozyme, etc. that complementarily binds to DNA or mRNA of the CNTN4 gene, but is not limited thereto.
- antisense nucleic acid refers to DNA, RNA, or fragments or derivatives thereof that contain a nucleic acid sequence complementary to the sequence of a specific mRNA, and complementarily binds or hybridizes to the sequence of the mRNA to convert the mRNA into a protein. It inhibits translation.
- siRNA small interfering RNA
- siRNA refers to a short double-stranded RNA capable of inducing RNA interference (RNAi) through cleavage of a specific mRNA.
- siRNA includes a sense RNA strand having a sequence homologous to the mRNA of a target gene and an antisense RNA strand having a complementary sequence thereto. Since siRNA can inhibit the expression of a target gene, it is used in a gene knockdown method or a gene therapy method.
- siRNA short hairpin RNA
- micro RNA refers to 21 to 23 non-coding RNAs that post-transcriptionally regulate gene expression by facilitating degradation of target RNAs or inhibiting translation thereof.
- ribozyme refers to an RNA molecule having an enzyme-like function that recognizes a specific nucleotide sequence and cuts it by itself.
- a ribozyme is a complementary nucleotide sequence of a target messenger RNA strand and consists of a region that binds with specificity and a region that cuts the target RNA.
- Antisense nucleic acid, siRNA, shRNA, miRNA, ribozyme, etc. that complementarily bind to the DNA or mRNA of the CNTN4 gene are the translation of CNTN4 mRNA, translocation into the cytoplasm, maturation or any other of CNTN4. It can inhibit essential activity for biological function.
- the CNTN4 inhibitor may inactivate the function or reduce the activity of CNTN4 in cancer cells compared to cancer cells not treated with the CNTN4 inhibitor.
- the CNTN4 inhibitor includes, for example, a compound that specifically binds to a CNTN4 protein, a peptide, a peptide mimetics, a fusion protein, an antibody or an antigen-binding fragment thereof, an antibody drug complex (ADC, Antibody Drug Conjugate), or an aptamer. can, but is not limited thereto.
- the term “specific” refers to the ability to bind only a protein of interest without affecting other proteins in a cell.
- antibody includes monoclonal antibodies, polyclonal antibodies, bispecific antibodies, multispecific antibodies, chimeric antibodies, humanized antibodies, human antibodies, and in addition to novel antibodies, antibodies already known or commercially available in the art are also used. Included.
- the antibody includes functional fragments of antibody molecules as well as full-length forms comprising two heavy chains and two light chains, as long as they specifically bind to CNTN4.
- the functional fragment of the antibody molecule refers to a fragment having at least an antigen-binding function, which may include, but is not limited to, Fab, F(ab'), F(ab')2, Fv, and the like.
- Peptide Minetics is a peptide or non-peptide that inhibits the binding domain of a protein of CNTN4 that induces the activity of CNTN4.
- aptamer refers to a single-stranded nucleic acid (DNA, RNA, or modified nucleic acid) having a stable tertiary structure by itself and having high affinity and specificity to bind to a target molecule.
- Substances that inhibit the activity or expression of CNTN4 included in the pharmaceutical composition of the present invention may inhibit CNTN4 from inhibiting the function of T cells, thus maintaining the ability of T cells to attack cancer cells, or may act as a stimulant.
- the ability of T cells to attack cancer cells may be increased by 5% to 200% compared to the untreated group. Therefore, the pharmaceutical composition of the present invention can be usefully used for the prevention or treatment of cancer.
- Cancers that the pharmaceutical composition of the present invention can treat or prevent include, for example, stomach cancer, lung cancer, liver cancer, colorectal cancer, colon cancer, small intestine cancer, pancreatic cancer, brain cancer, bone cancer, melanoma, breast cancer, sclerosis, uterine cancer, cervical cancer , head and neck cancer, esophageal cancer, thyroid cancer, parathyroid cancer, kidney cancer, sarcoma, prostate cancer, urethral cancer, bladder cancer, blood cancer, leukemia, lymphoma, fibroadenoma, and the like.
- the pharmaceutical composition according to the present invention may contain the active ingredient alone or may further contain one or more pharmaceutically acceptable carriers, excipients, diluents, stabilizers, preservatives, and the like.
- the pharmaceutically acceptable carrier may include, for example, a carrier for oral administration or a carrier for parenteral administration.
- the carrier for oral administration may include lactose, starch, cellulose derivatives, magnesium stearate, stearic acid, and the like.
- the carrier for parenteral administration may include water, a suitable oil, saline, aqueous glucose, glycol, and the like.
- Pharmaceutically acceptable stabilizers include antioxidants such as sodium hydrogen sulfite, sodium sulfite or ascorbic acid.
- Pharmaceutically acceptable preservatives include benzalkonium chloride, methyl- or propyl-paraben, chlorobutanol, and the like.
- the pharmaceutical composition of the present invention may be administered to animals such as humans by any method, for example, orally or parenterally.
- the parenteral administration method may be intravenous, intramuscular, intraarterial, intramedullary, intrathecal, transdermal, subcutaneous, intraperitoneal, intranasal, intestinal, topical, sublingual, or rectal administration, but is not limited thereto.
- the pharmaceutical composition of the present invention may be formulated as a formulation for oral administration or a formulation for parenteral administration according to the administration route as described above.
- the formulation for oral administration is formulated by a method known in the art in the form of powders, granules, tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, etc. it could be
- tablets or dragees for oral administration can be obtained by mixing the active ingredient of the present invention with an excipient, adding a suitable adjuvant, and then processing it into a granule mixture.
- excipient examples include sugars including lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol and maltitol, starches including corn starch, wheat starch, rice starch and potato starch, cellulose, Cellulose, including but not limited to methyl cellulose, sodium carboxymethyl cellulose and hydroxypropylmethyl-cellulose, and fillers such as gelatin, polyvinylpyrrolidone, and the like.
- cross-linked polyvinylpyrrolidone, agar, alginic acid, sodium alginate and the like may be added as a disintegrant.
- the pharmaceutical composition of the present invention may further include an anti-aggregating agent, a lubricant, a wetting agent, a flavoring agent, an emulsifying agent, a preservative, and the like.
- the formulation for parenteral administration may be formulated by a method known in the art in the form of an injection, a gel, an aerosol, or a nasal inhalant.
- the total effective amount of the pharmaceutical composition according to the present invention may be administered to a subject as a single dose, or may be administered as multiple doses by a fractionated treatment protocol.
- an appropriate effective dose or content of the active ingredient of the pharmaceutical composition of the present invention may be determined by considering various factors such as the route of administration, the number of administration, the patient's age, weight, health status, sex, disease severity, diet, and excretion rate. Considering the effective dosage for the patient, one of ordinary skill in the art will be able to determine.
- the total dose of the pharmaceutical composition of the present invention may be about 0.01 ⁇ g to 1,000 mg, or 0.1 ⁇ g to 100 mg per kg of the patient's body weight per day.
- the pharmaceutical composition according to the present invention is not particularly limited in its formulation, administration route, and administration method as long as the effect of the present invention is exhibited.
- one aspect of the present invention provides a pharmaceutical composition for enhancing an individual's immunity, comprising a CNTN4 inhibitor as an active ingredient.
- the level of T-cell-mediated immune response can be increased by reducing the expression or activity of CNTN4 in the individual in whole or in part.
- the pharmaceutical composition of the present invention can be used for immune enhancement.
- it can be used in subjects in need of prevention, treatment or improvement of diseases caused by immunodeficiency, immunosuppression, or immune system damage.
- Another aspect of the present invention provides the use of a CNTN4 inhibitor for treating or preventing cancer.
- Another aspect of the present invention provides a method for treating or preventing cancer, comprising administering a CNTN4 inhibitor to an individual.
- Another aspect of the present invention provides a method for enhancing immunity in an individual, comprising administering a CNTN4 inhibitor to the individual.
- related terms are understood to have the same meanings as those described in the pharmaceutical composition above.
- one aspect of the present invention provides a method for screening an anticancer drug comprising the steps of:
- the anticancer drug screening method is a decrease in the expression level of mRNA or protein of CNTN4 in the group treated with the anticancer drug candidate compared to the group not treated with the anticancer drug candidate, or the level of inhibition of T cell activity by CNTN4 is reduced.
- the method may further include determining that the anticancer drug candidate is an anticancer drug.
- a decrease in the level may mean a significant decrease.
- decreasing or significantly decreasing the level is between 5% and 95% (eg, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50 %, 55%, 60%, 65%, 70%, 75%, 80%, 85% or 90%) may mean a reduced amount.
- the group not treated with the anticancer drug candidate may be cancer cells to which no substance has been added, or cancer cells treated with other substances such as anticancer agents that are not substances that inhibit the activity or expression of CNTN4.
- screening means finding a specific substance having specific properties, such as sensitivity or activity, to substances such as proteins, fusion proteins, antibodies, peptides, antibiotics, enzymes, and compounds.
- anticancer drug candidate may be a nucleic acid, protein, antibody, compound, extract, or natural product that is estimated to be capable of inhibiting the expression or activity of CNTN4 or randomly selected according to a conventional selection method.
- the anticancer drug candidate may preferably be a substance that inhibits the expression and/or activity of CNTN4.
- the measurement of the expression or activity of CNTN4 may be performed by measuring the expression level of mRNA or protein of CNTN4 or measuring the degree of inhibition of T cell activity by CNTN4.
- Methods for measuring the expression level of CNTN4 mRNA may use methods known in the art, for example, reverse transcriptase polymerase reaction, competitive reverse transcriptase polymerase reaction, real-time reverse transcriptase polymerase reaction, RNase protection assay , Northern blot, DNA chip, RNA chip, etc. may be used, but is not limited thereto.
- a method for measuring the expression level of the CNTN4 protein methods known in the art may be used, for example, Western blot, ELISA, radioimmunoassay, radioimmunodiffusion method, Oukteroni immunodiffusion method, rocket immunoelectrolysis Electrophoresis, immunohistochemical staining, immunoprecipitation assay, complement fixation assay, FACS, protein chip, etc. may be used, but are not limited thereto.
- Methods for measuring the degree of inhibition of T cell activity by CNTN4 may use methods known in the art, for example, RT-PCR, Western blot, ELISA, radioimmunoassay, radioimmunodiffusion method, octero Ni immunodiffusion method, rocket immunoelectrophoresis, immunohistochemical staining, immunoprecipitation assay, complement fixation assay, FACS, etc. may be used, but are not limited thereto.
- confirmation of inhibition of CNTN4 activity in the screening method of the present invention is a method of measuring the activity after reacting a CNTN4 protein with a candidate substance, a yeast two-hybrid method, a phage display peptide clone that binds to a CNTN4 protein ( phage-displayed peptide clone) search, high throughput screening (HTS) using natural products and chemical libraries, etc., drug hit HTS, cell-based screening, or DNA array A screening method using (DNA array) may be used.
- the anticancer drug screening method can be both in vitro or in vivo.
- the step of treating the cancer cells with the anticancer drug candidate may be performed by administering the anticancer drug candidate to an individual having cancer cells or a cancer disease.
- the subject may be, for example, an animal such as a human, a mouse, or the like.
- the anticancer drug screening method is based on a new finding in the present invention that inhibiting the activity or expression of CNTN4 can inhibit the T cell evasion function of cancer cells. According to the screening method of the present invention, it is very advantageous because a novel anticancer agent can be easily developed in an inexpensive and simple way.
- one aspect of the present invention provides a method for providing information necessary for cancer prognosis analysis, comprising the step of measuring the expression or activity of CNTN4 in cells or tissues isolated from an individual.
- prognosis refers to prediction in terms of disease progression, disease remission, disease recurrence, metastasis, and likelihood of death.
- the prognosis in the present invention means the possibility that the disease of the cancer patient will be cured or the patient's condition will be improved.
- the cells or tissues isolated from the subject may be cancer cells or tissues in which cancer has occurred or cancer cells exist.
- the method of providing information necessary for the analysis of cancer prognosis is based on the fact that the lower the activity or expression level of CNTN4 in cancer cells, the higher the activity of T cells, thereby increasing the cancer treatment effect.
- one aspect of the present invention provides a pharmaceutical composition for treating or preventing cancer comprising an anti-CNTN4 antibody or antigen-binding fragment thereof that specifically binds to CNTN4.
- the pharmaceutical composition for treating or preventing cancer may include an anti-CNTN4 antibody or an antigen-binding fragment thereof that binds to the fibronectin 2 domain of CNTN4 upon binding to CNTN4.
- the pharmaceutical composition for treating or preventing cancer may be used for anticancer purposes.
- the anti-CNTN4 antibody or antigen-binding fragment thereof upon binding to CNTN4, binds to the fibronectin 2 domain (FN2) of CNTN4.
- the fibronectin 2 domain may include the amino acid sequence of SEQ ID NO: 13.
- CNTN4 consists of a total of 10 domains (ie, Ig1 to Ig6 and FN1 to FN4), and binds to amyloid precursor protein (APP) in the body (Ig; Ig like domain, FN; fibronection). Specifically, the FN1 ⁇ FN2 domains (domain 7 ⁇ domain 8) of CNTN4 strongly bind at the KPI (Kunitz-type protease inhibitor) domain site of APP. The FN1 to FN2 domains (domain 7 to domain 8) of CNTN4 consist of the amino acid sequence of SEQ ID NO: 9, and the KPI domain of APP consists of the amino acid sequence of SEQ ID NO: 10.
- the anti-CNTN4 antibody or antigen-binding fragment thereof binds to CNTN4, binding of CNTN4 to APP is blocked or inhibited. Accordingly, the anti-CNTN4 antibody or antigen-binding fragment thereof may be useful as an antibody that inhibits the interaction between CNTN4 and APP.
- A, B and/or C is used herein to mean A, or B, or C, or A and B, or A and C, or B and C, or A, B and C.
- the present invention is based on the first discovery that CNTN4 can be used as a novel target for cancer treatment.
- cancer can be effectively prevented or treated using an inhibitor of CNTN4.
- an inhibitor of CNTN4 can be used to enhance immunity of an individual.
- new anticancer drug candidates can be effectively selected by measuring the activity or expression of CNTN4, and information necessary for diagnosing and predicting cancer prognosis can be provided.
- 3A to 3D show the cytotoxicity (%) of PBMCs when lung cancer cell lines A549 and PBMCs were treated with a CNTN4 inhibitor.
- 4A to 4D show the cytotoxicity (%) of PBMCs when the colon cancer cell lines HCT-116 and PBMCs were treated with a CNTN4 inhibitor.
- 5A to 5D show the cytotoxicity (%) of PBMCs when the breast cancer cell lines MDA-MB-231 and PBMCs were treated with a CNTN4 inhibitor.
- 6A to 6D show the cytotoxicity (%) of PBMCs when the gastric cancer cell lines MKN-74 and PBMCs were treated with a CNTN4 inhibitor.
- 7A to 7D show the cytotoxicity (%) of PBMCs when the leukemia cell lines U937 and PBMCs were treated with a CNTN4 inhibitor.
- FIG. 9 shows the structures of CNTN4 and APP fabricated according to Example 4.
- FIG. 11 shows the amino acid sequences of the FN1-FN2 domain of CNTN4 and the KPI domain of APP.
- FIG. 13 is a schematic diagram of a Human CNTN4 domain sample prepared according to Example 5.2.1.
- Human blood was placed in a 10 mL tube coated with EDTA (or heparin) and mixed with PBS at a ratio of 1:1. Then, Ficoll-Paque PLUS was placed in a 50 mL tube, and the blood sample was added. After centrifugation, human peripheral blood mononuclear cells (PBMCs) were harvested. The collected product was centrifuged and the supernatant was removed. RBC lysis (1x) was then added, pipetted and stored on ice for 3 minutes. Then, 50 ml of 10% FBS RPMI1640 was added and the mixture was centrifuged to remove the supernatant. Then, FACS buffer was added and the supernatant was removed by centrifugation. Then, 50 ml of MACS buffer (PBS with 0.5% BSA and 2 mM EDTA) was added, the cell number was counted, and the supernatant was removed by centrifugation.
- PBMCs peripheral blood mononuclear cells
- CD4+ T cells and CD8+ T cells were resuspended using 40 ⁇ l MACS buffer based on the number of 1 ⁇ 10 7 cells, and 10 ⁇ l of each anti-CD4 and anti-CD8 biotin antibody was added to a tube and stored in a refrigerator for 5 minutes. Then, 30 ⁇ l of MACS buffer based on the number of 1 ⁇ 10 7 cells was added to the product, and 20 ⁇ l of anti-biotin microbeads were added and mixed. Then, using an LS column, CD4+ T cells and CD8+ T cells were isolated and the number of cells was counted.
- CD4+ T cells and CD8+ T cells were mixed with 1 ⁇ l of CFSE (Carboxyfluorescein succinimidyl ester) based on the number of 2 ⁇ 10 6 cells, and stored at 37° C. for 3 minutes. Then, FBS was added to the tube containing each CD4+ T cell and CD8+ T cell, and stored on ice for 10 minutes. Thereafter, the supernatant was removed by centrifugation. After 30 ml of FACS buffer was added to the product, the supernatant was removed by pipetting and centrifugation. Then, 10% FBS RPMI1640 was added, pipetting, and centrifugation to remove the supernatant. The product was then mixed with 10 ml of 10% FBS RPMI1640 and the number of cells was counted.
- CFSE Carboxyfluorescein succinimidyl ester
- Recombinant human IgG1 Fc protein (Cat. No. 110-HG) and recombinant human PD-L1/B7-H1 Fc chimera protein (Cat. No. 156-B7) were purchased from R&D systems.
- recombinant human CNTN4 His Tag protein (Cat: 2205-CN) was purchased from R&D systems.
- CD4+ T cells and CD8+ T cells prepared in Example 1.1. were added to each well of a 96-well plate and incubated.
- CD4+ T cells and CD8+ T cells were activated for 72 hours by anti-CD3 antibody.
- the proliferation of CD4+ T cells and CD8+ T cells can be confirmed by the degree of CFSE staining, which was analyzed by flow cytometry using FACSDiVa software (BD Biosciences).
- the proliferation rates (%) of CD4+ T cells and CD8+ T cells are shown in FIGS. 1 and 2 , respectively.
- Human blood was placed in a 10 mL tube coated with EDTA (or heparin) and mixed with PBS at a ratio of 1:1. Then, Ficoll-Paque PLUS was placed in a 50 mL tube, and the blood sample was added. After centrifugation, human peripheral blood mononuclear cells (PBMCs) were harvested. The collected product was centrifuged and the supernatant was removed. RBC lysis (1x) was then added, pipetted and stored on ice for 3 minutes. Then, 50 ml of 10% FBS RPMI1640 was added and the mixture was centrifuged to remove the supernatant. Then, FACS buffer was added and the supernatant was removed by centrifugation. Then, 50 ml of MACS buffer (PBS with 0.5% BSA and 2 mM EDTA) was added, the cell number was counted, and the supernatant was removed by centrifugation.
- PBMCs peripheral blood mononuclear cells
- 96-well plates were coated with 1.0 ⁇ g/ml of anti-CD3 antibody (BioLegend, Cat. No. 317325) in PBS at 4°C. Wells of 96-well plates were washed 3 times with PBS before adding PBMCs. The previously obtained PBMCs were mixed with 10% FBS RPMI1640, and 100 ⁇ l of 6 ⁇ 10 5 pieces were added to each well of a 96-well plate. PBMCs were activated by anti-CD3 antibody for 72 hours.
- anti-CD3 antibody BioLegend, Cat. No. 317325
- Lung cancer cell line A549, colon cancer cell line HCT-116, breast cancer cell line MDA-MB-231, gastric cancer cell line MKN-74, and leukemia cell line U937 were each mixed with 1 ⁇ l of CFSE (carboxyfluorescein succinimidyl ester) and stored at 37° C. for 3 minutes. . Then, FBS was added to the tube containing each cell line, and stored on ice for 10 minutes. The supernatant was then removed by centrifugation. 30 ml of FACS buffer was added to the thus obtained product, followed by pipetting and centrifugation to remove the supernatant. Then, 10% FBS RPMI1640 was added, pipetting, and centrifugation to remove the supernatant. The product thus obtained was mixed with 10 ml of 10% FBS RPMI1640, and then the number of cells was counted.
- CFSE carboxyfluorescein succinimidyl ester
- the cancer cells were added to each well of the PBMC-containing 96-well plate prepared in Example 2.1. 3 ⁇ 10 4 of 100 ⁇ l, and incubated.
- a mixture of PBMCs and cancer cell lines was prepared in Example 2.2 above. These mixtures were incubated with 10 ⁇ g/mL of anti-human CNTN4 antibody or 50 nM of CNTN4 siRNA for 24 hours.
- the experimental group and untreated control group using 5 types of neutralizing antibodies to block CNTN4 are shown in Table 1 below, and the experimental group and untreated control group using 3 types of siRNA to knock down CNTN4 are shown in Table 2 below.
- PBMCs and cell lines and antibody or siRNA were incubated together, and cells were stained with 7-aminoactinomycin D (7-AAD; BD Pharmingen, San Diego, CA, USA) to identify lysed cells after 24 hours. did.
- 7-aminoactinomycin D 7-aminoactinomycin D
- FIGS. 3A to 3D The results of treatment with the CNTN4 neutralizing antibody or siRNA against the lung cancer cell line A549 are shown in FIGS. 3A to 3D .
- lung cancer cell lines A549 and PBMC were treated with a CNTN4-neutralizing antibody, it can be confirmed that the killing ability of lung cancer cells was significantly increased compared to the untreated control, although there was a difference depending on the type of antibody. In addition, it was confirmed that the lung cancer cell killing ability was significantly increased even when the lung cancer cell line was treated with CNTN4 siRNA.
- the experimental results for the colon cancer cell line HCT-116 are shown in FIGS. 4A to 4D
- the experimental results for the breast cancer cell line MDA-MB-231 are shown in FIGS. 5A to 5D
- the gastric cancer cell line when treated with CNTN4 neutralizing antibody or siRNA, the experimental results for the colon cancer cell line HCT-116 are shown in FIGS. 4A to 4D, and the experimental results for the breast cancer cell line MDA-MB-231 are shown in FIGS. 5A to 5D, and the gastric cancer cell line.
- the experimental results for MKN-74 are shown in FIGS. 6A to 6D
- the experimental results for the leukemia cell line U937 are shown in FIGS. 7A to 7D.
- the MC38 cell line derived from C57BL6 colon adenocarcinoma cells was resuspended in 50 ⁇ l PBS at a concentration of 2.0 ⁇ 10 5 cells, and injected subcutaneously into the flank of 6-week-old female C57BL6 mice.
- Table 3 below shows the experimental group and the untreated control group using siRNA to knock down CNTN4.
- siRNA targeting mouse CNTN4 was injected into the tumors of mice three times at intervals of 5 days from the 11th day after the injection of the MC38 cell line. Specifically, 10 ⁇ g of siRNA was mixed with 7.5 ⁇ l of oligofectamine (Invitrogen) in PBS according to the manufacturer's instructions, and then directly injected into the mouse-induced tumor tissue at a dose of 0.5 mg/kg.
- oligofectamine Invitrogen
- mice in the untreated control group and the experimental group 9 in which CNTN4 was knocked down are shown in FIG. 8 .
- CNTN4 inhibitors can be usefully used to prevent cancer.
- HEK293FT cells were coated on a culture dish plate at 3 x 10 6 cells. After 24 hours, 200 ⁇ L of jetPRIME transfection buffer; 10 ⁇ g of CNTN4 expression plasmid or 10 ⁇ g of APP expression plasmid; and 20 ⁇ L of RIME transfection reagent, respectively, and incubated at room temperature (RT) for 10 minutes, each mixture was added to the cells to transfect HEK293FT cells with each plasmid.
- RT room temperature
- CNTN4 consists of a total of 10 domains (ie, Ig1 to Ig6 and FN1 to FN4), and each plasmid expresses Ig1 to Ig4, Ig1 to Ig6, Ig1 to FN2, Ig1 to FN4 (Ig; Ig like domain, FN). ; fibronection).
- Ig4, #6, #8, and #10 Ig1 to Ig4 and FN4 expression plasmids.
- a total of three plasmids were prepared and used as APP expression plasmids.
- three isoforms of APP were expressed, respectively, and these were named 770, 751, and 695, respectively.
- 770 and 751 isoforms have a kunitz-type protease inhibitor (KPI) domain
- 695 isoforms do not have a KPI domain (FIG. 9b).
- a total of 7 sets of cells transfected in 4.1. were precipitated by centrifuge at 1,200 rpm, 3 min, and 4°C, the supernatant was removed, the cell pellet was released with 1 x lysis buffer, and the cell pellet was released at 4°C for 10 min. After reacting, centrifuge at 13,000 rpm, 10 min, and 4° C. again to obtain cell lysate.
- CNTN4 #10 and APP 770, 751, and 695 were reacted to check whether the CNTN4-APP protein complex was generated. wanted to check.
- IP Ab anti-CNTN4 antibody or anti-APP antibody
- NuPAGE 4-12% Bis-Tris gel was used in combination with the NuPAGE® electrophoresis system. Gel was fixed in the chamber, and MES running buffer was filled between the gel cassette and the electrode assembly. Marker 5mL and sample (20mL per well) were loaded and electrophoresed according to the manufacturer's manual.
- the membrane was blocked with 3% BSA blocking buffer at RT for 60 min. After blocking, it was washed 3 times with PBST, and the primary antibody was diluted (1:1,000) in 0.3% BSA blocking buffer and then placed in a refrigerator at 4°C overnight. After washing 3 times with PBST, the secondary antibody was diluted (1:5,000) in 0.3% BSA blocking buffer and reacted for 60 min at RT after treatment. It was washed 3 times with PBST.
- Luminol/Enhancer solution and peroxide solution of SuperSignalTM West Pico PLUS Chemiluminescent Substrate were mixed in a 1.5 mL tube with 500 mL each, sprayed on the membrane, and then photographed using LOURMAT CHEMI-DOC.
- CNTN4 #10 full length binds to APP (770 & 751) having a KPI (kunitz-type protease inhibitor) domain (FIG. 10a), and APP 770 (full length) is FN1 ⁇ FN2 domain (domain 7 ⁇ domain) 8) was confirmed to bind to CNTN4 (#8 
) having (Fig. 10b). From this, it was confirmed that the APP site to which CNTN4 binds is the KPI domain, and the corresponding CNTN4 binding site is the FN1 ⁇ FN2 domain (domain 7 ⁇ domain 8). The sequences of each domain are shown in Table 4 and FIG. 11 .
- the binding between the anti-CNTN4 antibody (AB1) and the CNTN4 domain was confirmed to confirm the antibody binding site of CNTN4.
- Antibodies were generated by inoculating 15 chickens with mouse CNTN4 and/or human CNTN4. A total of 4 animals whose antibody production was confirmed through ELISA were selected. After sacrifice, blood, spleen, bone marrow, and bursa fabricius were extracted, total RNA was extracted, cDNA was synthesized, and the light and heavy chain variable regions of the antibody and the scFv fragment linking them with a linker were obtained through PCR. . After that, phage display was performed. A positive clone binding to CNTN4 was selected through phase ELISA screening, and the corresponding scFv sequence was selected (scFv AB1).
- the light and heavy chain regions of the scFv selected in 5.1.1. were cloned into a bicistronic expression vector.
- DNA was transiently transfected into Expi293F cells and cultured up to 50% viability to express IgG, and the culture medium was bound to Kappa select resin (kappa region capture) to elution to IgG and first purified. Thereafter, to remove light chain impurities, it was bound to Mabselect (Fc region capture), and the IgG was elution and secondary purification was performed to prepare an anti-CNTN4 129 chimeric IgG4 antibody (hereinafter referred to as "AB1") with a purity of 72.4% on SEC-HPLC. did.
- CNTN4 consists of a total of 10 domains (ie, Ig1 to Ig6 and FN1 to FN4; in FIG. 13 , respectively indicated as Domains 1 to 10), and Full indicates a sample including all 10 domains.
- D1-9 is a sample in which domain 10 is deleted from Full
- D1-8 is a sample in which domain 9 is deleted in D1-9.
- Domain samples of D1-4 to D1-7 were prepared in the same manner.
- the concentration of the full domain was set at 4 ⁇ g/mL, and in order to apply the same molar concentration, the concentration of each domain was determined according to the molecular weight ratio (Table 6).
- a 96-well plate 50 ⁇ L/well of the CNTN4 domain prepared in 5.2.1. was dispensed. After sealing with sealing tape, it was incubated at 4°C overnight. The next day, the sealing tape was removed and the buffer was removed. 150 ⁇ L of blocking buffer was dispensed into each well, sealed, and incubated at 37° C. for 1 hour.
- each primary antibody (antibody AB1) diluted with the blocking buffer according to Table 13 was dispensed into each well. Sealed with sealing tape and incubated at 37°C for 2 hours. After removing the sealing tape, washing was performed 3 times.
- Anti-CNTN4 antibody AB1 bound only to D1-8, D1-9, and Full out of a total of 7 human CNTN4 domain samples (three graphs overlap each other in FIG. 14), and binds to D1-4 to D1-7 not (four graphs superimposed on each other, except for D1-6 at approximately antibody concentrations of 0.0001 to 0.01 nM).
- D1-7 and D1-8 have a difference in the presence or absence of Domain 8, it can be seen that Domain 8 (ie, FN2) is an important binding site for binding of CNTN4 and anti-CNTN4 antibodies.
- the amino acid sequence of Domain 8 of CNTN4 is shown in Table 9 and FIG. 15 .
- CNTN4 4 mg/mL of CNTN4 was coated on the plate.
- APP his tagged, 0.64 mg/mL
- AB1 4.98 mg/mL; 35 mM
- Diluted APP and AB1 antibodies were treated at 25 mL/well in a 96-well half plate coated with CNTN4, respectively, and reacted at room temperature for 4 hours (in duplicate), followed by washing.
- Anti-his tag was diluted 1:2,000 in ELISA buffer, treated at 50 mL/well, incubated at room temperature for 1 hour, and washed.
- ABTS was treated with 50 mL/well, and absorbance was measured at 405 nm using a plate reader.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Veterinary Medicine (AREA)
- Biochemistry (AREA)
- Epidemiology (AREA)
- Genetics & Genomics (AREA)
- Microbiology (AREA)
- Biomedical Technology (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Mycology (AREA)
- Toxicology (AREA)
- Biotechnology (AREA)
- Gastroenterology & Hepatology (AREA)
- Cell Biology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Physics & Mathematics (AREA)
- Food Science & Technology (AREA)
- Pathology (AREA)
- Zoology (AREA)
- Analytical Chemistry (AREA)
- Physics & Mathematics (AREA)
- Endocrinology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Virology (AREA)
Abstract
Description
human CNTN4 중화 항체 | |
대조군 | 무처리 |
실험군 1 | anti-human CNTN4 항체 (R&D사, MAB2205) |
실험군 2 | anti-human CNTN4 항체 (abcam사, ab137107) |
실험군 3 | anti-human CNTN4 항체 (abcam사, ab131285) |
실험군 4 | anti-human CNTN4 항체 (LSbio사, LS-C119876) |
실험군 5 | anti-human CNTN4 항체 (Abnova사, PAB27653) |
human CNTN4 siRNA | |
대조군 | 무처리 |
실험군 6 | Sense (5'-CAGUAUCUUUGCCAGAAGUtt-3') (서열번호 1) Antisense (5'-ACUUCUGGCAAAGAUACUGtt-3') (서열번호 2) |
실험군 7 | Sense (5'-GAUAAUGAGUCGGAAGUAAtt-3') (서열번호 3) Antisense (5’-UUACUUCCGACUCAUUAUCtt-3') (서열번호 4) |
실험군 8 | Sense (5'-GUGACAAUAGACGAAAUCAtt-3') (서열번호 5) Antisense (5'-UGAUUUCGUCUAUUGUCACtt-3') (서열번호 6) |
mouse CNTN4 siRNA | |
대조군 | 무처리 |
실험군 9 | Sense (5'-GUGUAGACAAACUCUCUGU-3') (서열번호 7) Antisense (5'-ACAGAGAGUUUGUCUACAC-3') (서열번호 8) |
서열번호 9 | FN1 ~ FN2 domain | PPEAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPFSVGWQAVSTVPELIDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTPANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFRPYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVFNNKGEGPFSPTTVVYSAEE |
서열번호 10 | KPI domain | RAMISRWYFDVTEGK |
서열번호 11 | 경쇄 가변 영역(VL) | ALTQPSSVSANLGETVKITCSGSSGSYGWYQQKSPGSAPVTLIYDNTNRPSDIPSRFSGSGSGSTGTLTITGVRAEDEAVYYCGGYDGSTDVFGAGTTLTVL |
서열번호 12 | 중쇄 가변 영역(VH) | AVTLDESEGGLQTPGGALSLVCKASGFTFSSFNMFWVRQAPGKGLEYVAEISGGGGSTWYAPAVKGRATISRDNGQSTVRLQLNNLRAEDTGTYYCAKSADTWSYGAATIDAWGHGTEVIVSS |
Domain Number | Full | 1-4 | 1-5 | 1-6 | 1-7 | 1-8 | 1-9 |
Concentration
(μg/mL) |
4 | 1.6 | 2.0 | 2.3 | 2.8 | 3.2 | 3.6 |
Molecular Weight (kDa) | 111.08 | 44.43 | 54.48 | 64.83 | 76.83 | 87.93 | 99.03 |
Tube Number | 1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 |
Conc. (nM) | 2.5 | 0.625 | 0.156 | 0.0391 | 0.00977 | 0.00244 | 0.00061 | 0.000153 | 0.00004 |
Domain | Full | 1-4 | 1-5 | 1-6 | 1-7 | 1-8 | 1-9 |
Binding | + | - | - | - | - | + | + |
서열번호 13 | Domain 8 (FN2 Domain) |
TPANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFRPYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVFNNKGEGPFSPTTVVYSAEE |
Claims (13)
- CNTN4 억제제를 포함하는 암 치료 또는 예방용 약학적 조성물로서,상기 CNTN4 억제제는 CNTN4 유전자의 DNA 또는 mRNA에 상보적으로 결합하는 안티센스 핵산, siRNA, shRNA, miRNA 또는 리보자임; 또는 CNTN4 단백질에 특이적으로 결합하는 화합물, 펩티드, 펩티드 미메틱스, 융합 단백질, 항체 또는 그의 항원 결합 단편, 항체약물복합체(ADC, Antibody Drug Conjugate) 또는 앱타머인, 약학적 조성물.
- 제1항에 있어서,상기 암은 위암, 폐암, 간암, 대장암, 결장암, 소장암, 췌장암, 뇌암, 뼈암, 흑색종, 유방암, 경화성선증, 자궁암, 자궁경부암, 두경부암, 식도암, 갑상선암, 부갑상선암, 신장암, 육종, 전립선암, 요도암, 방광암, 혈액암, 림프종, 또는 섬유선종인, 약학적 조성물.
- 제1항에 있어서,상기 CNTN4 억제제는 암세포의 T 세포 회피 기능을 억제하는 것인, 약학적 조성물.
- CNTN4 억제제를 포함하는 개체 내 T-세포 매개성 면역반응의 수준 증대에 의한 면역증강용 약학적 조성물로서,상기 CNTN4 억제제는 CNTN4 유전자의 DNA 또는 mRNA에 상보적으로 결합하는 안티센스 핵산, siRNA, shRNA, miRNA 또는 리보자임; 또는 CNTN4 단백질에 특이적으로 결합하는 화합물, 펩티드, 펩티드 미메틱스, 융합 단백질, 항체 또는 그의 항원 결합 단편, 항체약물복합체(ADC, Antibody Drug Conjugate) 또는 앱타머인, 약학적 조성물.
- 제4항에 있어서,면역결핍, 면역저하 또는 면역계 손상으로 인한 질환의 예방, 치료 또는 개선을 필요로 하는 개체에게 사용하는 것인, 약학적 조성물.
- 하기를 포함하는 항암제 스크리닝 방법:a) 항암제 후보 물질과 암세포를 접촉시키는 단계; 및b) 암세포 내 CNTN4의 발현 또는 활성을 측정하는 단계.
- 제6항에 있어서,상기 CNTN4의 발현 또는 활성 측정은 CNTN4의 mRNA 또는 단백질의 발현 수준 또는 CNTN4에 의한 T 세포 활성 억제 수준을 측정하는 것인, 항암제 스크리닝 방법.
- 제6항에 있어서,상기 항암제 후보 물질이 처리되지 않은 대조군에 비해 항암제 후보 물질이 처리된 군에서 CNTN4의 mRNA 또는 단백질의 발현 수준이 유의적으로 감소하거나 CNTN4의 T 세포 활성 억제 수준이 유의적으로 감소하는 경우 상기 항암제 후보 물질을 항암제라고 판단하는 단계를 더 포함하는 것인, 항암제 스크리닝 방법.
- CNTN4의 피브로넥틴 2 도메인에 결합하는, 항-CNTN4 항체 또는 그의 항원 결합 단편을 포함하는 암 치료 또는 예방용 약학적 조성물.
- 제9항에 있어서, 상기 피브로넥틴 2 도메인은 서열번호 13의 아미노산 서열을 포함하는 것인, 항-CNTN4 항체 또는 그의 항원 결합 단편을 포함하는 암 치료 또는 예방용 약학적 조성물.
- 제9항에 있어서, 상기 항체 또는 그의 항원 결합 단편은 APP(amyloid precursor protein)에 대한 CNTN4의 결합을 차단 또는 억제하는 것인, 항-CNTN4 항체 또는 그의 항원 결합 단편을 포함하는 암 치료 또는 예방용 약학적 조성물.
- CNTN4 억제제의 암 치료 또는 예방 용도로서, 상기 CNTN4 억제제는 CNTN4 유전자의 DNA 또는 mRNA에 상보적으로 결합하는 안티센스 핵산, siRNA, shRNA, miRNA 또는 리보자임; 또는 CNTN4 단백질에 특이적으로 결합하는 화합물, 펩티드, 펩티드 미메틱스, 융합 단백질, 항체 또는 그의 항원 결합 단편, 항체약물복합체(ADC, Antibody Drug Conjugate) 또는 앱타머인, 용도.
- CNTN4 억제제를 대상체에게 투여하는 단계를 포함하는 암 치료 또는 예방 방법으로서, 상기 CNTN4 억제제는 CNTN4 유전자의 DNA 또는 mRNA에 상보적으로 결합하는 안티센스 핵산, siRNA, shRNA, miRNA 또는 리보자임; 또는 CNTN4 단백질에 특이적으로 결합하는 화합물, 펩티드, 펩티드 미메틱스, 융합 단백질, 항체 또는 그의 항원 결합 단편, 항체약물복합체(ADC, Antibody Drug Conjugate) 또는 앱타머인, 방법.
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN202280040188.5A CN117794571A (zh) | 2021-04-09 | 2022-04-07 | 抗癌和免疫增强的新靶点 |
EP22785005.4A EP4321174A1 (en) | 2021-04-09 | 2022-04-07 | Novel target for anti-cancer effect and immunity enhancement |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020210046810A KR20220140378A (ko) | 2021-04-09 | 2021-04-09 | 항암 및 면역증강용 신규 타겟 |
KR10-2021-0046810 | 2021-04-09 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2022216096A1 true WO2022216096A1 (ko) | 2022-10-13 |
Family
ID=83546543
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2022/005073 WO2022216096A1 (ko) | 2021-04-09 | 2022-04-07 | 항암 및 면역증강용 신규 타겟 |
Country Status (4)
Country | Link |
---|---|
EP (1) | EP4321174A1 (ko) |
KR (1) | KR20220140378A (ko) |
CN (1) | CN117794571A (ko) |
WO (1) | WO2022216096A1 (ko) |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2013022872A1 (en) * | 2011-08-10 | 2013-02-14 | Celgene Corporation | Gene methylation biomarkers and methods of use thereof |
KR20190116930A (ko) * | 2018-04-05 | 2019-10-15 | 주식회사 지놈앤컴퍼니 | 항암 및 면역증강용 신규 타겟 |
US20200263258A1 (en) * | 2019-02-15 | 2020-08-20 | Mayo Foundation For Medical Education And Research | Assessing and treating mammals having polyps |
US20210230256A1 (en) * | 2018-04-05 | 2021-07-29 | Genome And Company | Novel target for anti-cancer and immune-enhancing |
-
2021
- 2021-04-09 KR KR1020210046810A patent/KR20220140378A/ko unknown
-
2022
- 2022-04-07 WO PCT/KR2022/005073 patent/WO2022216096A1/ko active Application Filing
- 2022-04-07 EP EP22785005.4A patent/EP4321174A1/en active Pending
- 2022-04-07 CN CN202280040188.5A patent/CN117794571A/zh active Pending
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2013022872A1 (en) * | 2011-08-10 | 2013-02-14 | Celgene Corporation | Gene methylation biomarkers and methods of use thereof |
KR20190116930A (ko) * | 2018-04-05 | 2019-10-15 | 주식회사 지놈앤컴퍼니 | 항암 및 면역증강용 신규 타겟 |
US20210230256A1 (en) * | 2018-04-05 | 2021-07-29 | Genome And Company | Novel target for anti-cancer and immune-enhancing |
US20200263258A1 (en) * | 2019-02-15 | 2020-08-20 | Mayo Foundation For Medical Education And Research | Assessing and treating mammals having polyps |
Non-Patent Citations (5)
Title |
---|
"NCBI", Database accession no. NM_175607.3 |
"Remington's Pharmaceutical Science", 1975, MACK PUBLISHING COMPANY, article "Blaug, Seymour" |
"Remington's Pharmaceutical Sciences", 1995, MACK PUBLISHING COMPANY |
KIM, SANGPYO ET AL.: "MedPacto, Genome & Company, NKMAX and AACR Issue", KOSDAQ CORPORATE ANALYSIS REPORT (KIWOOM SECURITIES REPORT), KOREAN FINANCIAL INVESTMENT ASSOCIATION, KOREA, no. 1305, 12 March 2021 (2021-03-12), Korea, pages 1 - 5, XP009541963 * |
LUCIE EVENEPOEL, ET AL.: "Expression of Contactin 4 Is Associated With Malignant Behavior in Pheochromocytomas and Paragangliomas", JOURNAL OF CLINICAL ENDOCRINOLOGY AND METABOLISM, THE ENDOCRINE SOCIETY, US, vol. 103, no. 1, 1 January 2018 (2018-01-01), US , pages 46 - 55, XP055642749, ISSN: 0021-972X, DOI: 10.1210/jc.2017-01314 * |
Also Published As
Publication number | Publication date |
---|---|
CN117794571A (zh) | 2024-03-29 |
EP4321174A1 (en) | 2024-02-14 |
KR20220140378A (ko) | 2022-10-18 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2020076105A1 (ko) | 신규 항-c-kit 항체 | |
WO2015005632A1 (ko) | Dll4와 vegf에 특이적으로 결합하는 신규 이중표적 단백질 및 이의 용도 | |
WO2015076621A1 (ko) | 혈관 신생 억제 활성을 가지는 펩티드 및 이를 포함하는 조성물 | |
WO2017022962A1 (ko) | Ripk 억제제를 유효성분으로 포함하는 면역질환의 예방 또는 치료용 조성물 | |
WO2019194586A1 (en) | Novel target for anti-cancer and immune-enhancing | |
WO2010087594A9 (ko) | 시디93 또는 이의 가용성 단편의 용도 | |
WO2017010744A1 (ko) | 엑소좀 단백질 eif3a 특이반응 오토항체검출용 항원 조성물 및 이를 이용한 간암진단법 | |
WO2020005003A1 (ko) | Lag-3에 특이적으로 결합하는 단클론항체 및 이의 용도 | |
WO2021235696A1 (ko) | Cd22에 특이적인 항체 및 이의 용도 | |
WO2023277361A1 (ko) | 메소텔린 특이적 항체 및 이의 용도 | |
WO2021158091A2 (ko) | 케모카인 억제제, 콜로니 자극 인자 억제제 및 면역항암제를 포함하는 암의 예방 또는 치료용 조성물 및 병용 요법 | |
WO2018186706A1 (ko) | Nk 세포 활성화 융합 단백질, nk 세포 및 이들을 포함하는 약제학적 조성물 | |
WO2022216096A1 (ko) | 항암 및 면역증강용 신규 타겟 | |
WO2017074013A1 (ko) | 인간 및 마우스 sema3a에 교차결합하는 항체 및 그의 용도 | |
US20210230256A1 (en) | Novel target for anti-cancer and immune-enhancing | |
WO2022131889A1 (ko) | Taci 단백질의 용도 | |
WO2014021693A2 (ko) | Tm4sf5 단백질에 특이적으로 결합하는 신규한 단일클론항체 및 이의 용도 | |
WO2023022271A1 (ko) | 항-igsf1 항체 및 이의 용도 | |
WO2020197304A1 (ko) | 테트라스파닌-2 억제제를 유효성분으로 포함하는 췌장암 예방, 개선 또는 치료용 조성물 | |
WO2020117017A1 (ko) | 항 c-met 아고니스트 항체 및 이의 용도 | |
WO2019139429A1 (en) | Novel use of kirrel2 and kirrel2 inhibitor | |
WO2024014619A1 (ko) | 사스-코로나 바이러스 2 중화 항체 | |
WO2021034098A1 (ko) | 사람 표피성장인자수용체 2 양성 암을 치료하기 위한 인터페론-베타 또는 이의 변이체를 포함하는 면역사이토카인의 용도 | |
WO2022124764A1 (ko) | Cd47에 특이적인 항체 및 이의 용도 | |
WO2023277281A1 (ko) | Cd47에 특이적인 인간화 항체 및 이를 포함하는 cd47 관련 질환의 예방 또는 치료용 약학적 조성물 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 22785005 Country of ref document: EP Kind code of ref document: A1 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 2022785005 Country of ref document: EP |
|
NENP | Non-entry into the national phase |
Ref country code: DE |
|
ENP | Entry into the national phase |
Ref document number: 2022785005 Country of ref document: EP Effective date: 20231109 |
|
WWE | Wipo information: entry into national phase |
Ref document number: 202280040188.5 Country of ref document: CN |