WO2022216096A1 - 항암 및 면역증강용 신규 타겟 - Google Patents

항암 및 면역증강용 신규 타겟 Download PDF

Info

Publication number
WO2022216096A1
WO2022216096A1 PCT/KR2022/005073 KR2022005073W WO2022216096A1 WO 2022216096 A1 WO2022216096 A1 WO 2022216096A1 KR 2022005073 W KR2022005073 W KR 2022005073W WO 2022216096 A1 WO2022216096 A1 WO 2022216096A1
Authority
WO
WIPO (PCT)
Prior art keywords
cntn4
cancer
antibody
inhibitor
pharmaceutical composition
Prior art date
Application number
PCT/KR2022/005073
Other languages
English (en)
French (fr)
Inventor
전부남
차미영
Original Assignee
주식회사 지놈앤컴퍼니
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 지놈앤컴퍼니 filed Critical 주식회사 지놈앤컴퍼니
Priority to CN202280040188.5A priority Critical patent/CN117794571A/zh
Priority to EP22785005.4A priority patent/EP4321174A1/en
Publication of WO2022216096A1 publication Critical patent/WO2022216096A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00—Medicinal preparations containing organic active ingredients
    • A61K31/70—Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088—Compounds having three or more nucleosides or nucleotides
    • A61K31/713—Double-stranded nucleic acids or oligonucleotides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/78—Connective tissue peptides, e.g. collagen, elastin, laminin, fibronectin, vitronectin or cold insoluble globulin [CIG]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G—PHYSICS
    • G01—MEASURING; TESTING
    • G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
    • G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
    • G01N33/5011—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing antineoplastic activity
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
    • C12N2710/00011—Details
    • C12N2710/14011—Baculoviridae
    • C12N2710/14111—Nucleopolyhedrovirus, e.g. autographa californica nucleopolyhedrovirus
    • C12N2710/14141—Use of virus, viral particle or viral elements as a vector
    • C12N2710/14143—Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011—Details
    • C12N2770/16011—Caliciviridae
    • C12N2770/16021—Viruses as such, e.g. new isolates, mutants or their genomic sequences
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011—Details
    • C12N2770/16011—Caliciviridae
    • C12N2770/16023—Virus like particles [VLP]
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2770/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA ssRNA viruses positive-sense
    • C12N2770/00011—Details
    • C12N2770/16011—Caliciviridae
    • C12N2770/16034—Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

Definitions

  • the present invention relates to a pharmaceutical composition for treating or preventing cancer comprising a CNTN4 inhibitor.
  • the present invention relates to a pharmaceutical composition for enhancing immunity comprising a CNTN4 inhibitor.
  • the present invention relates to a method for screening an anticancer drug using CNTN4, and a method for providing information necessary for cancer prognosis analysis.
  • cancer is still the leading cause of death worldwide.
  • a number of cancer treatments have been developed but are not effective for all carcinomas and for all patients.
  • Most currently used methods for treating cancer are relatively non-selective.
  • the diseased tissue is removed by surgery, the size of a solid tumor is reduced by radiation therapy, or cancer cells are rapidly killed by chemotherapy.
  • chemotherapy can develop resistance to drugs and, in some cases, limit the administrable dose, resulting in side effects that are severe enough to preclude the use of potentially effective drugs. Therefore, there is an urgent need to develop a target-specific and more effective cancer treatment.
  • the human adaptive immune system is a very sophisticated system that can specifically kill cancer cells.
  • T cells in the case of T cells, it plays a role in determining cellular adaptive immunity, and when cells are exposed to non-self or abnormal antigens, they recognize and remove antigens.
  • T cells In the case of T cells, they express about 20,000-40,000 TCR molecules per cell and specifically recognize several antigens (determined by the peptide sequence) out of 100,000 pMHC molecules of APC to initiate signal transduction.
  • TCR molecule should act as a highly sensitive sensor that must transmit a signal by recognizing a very sophisticated and subtle antigenic change.
  • This cellular adaptive immunity must work very precisely to effectively eliminate cancer cells. If the antigen-specific adaptive immune system does not function normally, it causes serious problems in the ability to eliminate cancer cells.
  • the T cells cannot attack the cancer cells. Therefore, for effective cancer treatment, it is necessary to remove factors that prevent T cells from eliminating cancer cells.
  • the present inventors have completed the present invention by confirming that inhibition of CNTN4 activity significantly inhibits cancer development, growth, invasion and metastasis.
  • one aspect of the present invention provides a pharmaceutical composition for treating or preventing cancer comprising a CNTN4 inhibitor as an active ingredient.
  • CNTN4 Contactin-4
  • CNTN4 refers to a protein encoded by the CNTN4 gene, which belongs to the immunoglobulin superfamily, and functions as a cell adhesion molecule (glycosylphosphatidylinositol)-anchored neuronal membrane protein for the development of the nervous system. It is known to play a role in forming axon connections in the process.
  • the CNTN4 may be human-derived CNTN4. More specifically, the amino acid sequence of CNTN4 may be or include the sequence of NP_783200.1 disclosed in NCBI. In addition, the CNTN4 amino acid sequence may be or include a sequence having 80%, 85%, 90% or 95% or more homology with the sequence of NCBI Reference Sequence: NP_115920.1, NP_783200.1, AAL51154.1, respectively It is not limited, and any amino acid sequence showing the characteristic or function of CNTN4 is included.
  • the gene of CNTN4 may be or include a nucleic acid sequence encoding an amino acid sequence of human CNTN4, or may be or include a nucleic acid sequence of NCBI Reference Sequence: NM_175607.3 disclosed in NCBI.
  • the nucleic acid sequence of CNTN4 is a sequence having 80%, 85%, 90% or 95% or more homology with the nucleic acid sequences of NCBI Reference Sequences: NM_032531.4, NM_175607.3, AY063125.1 disclosed in NCBI, respectively. It may include, but is not limited to, any nucleic acid sequence capable of producing an amino acid exhibiting a characteristic or function of CNTN4 is included.
  • CNTN4 inhibitor refers to a substance that inhibits the activity or expression of CNTN4.
  • the CNTN4 inhibitor may inhibit the cancer cell evasion function of T cells.
  • the CNTN4 inhibitor may specifically bind to the CNTN4 protein and interfere with the binding of CNTN4 to T cells, or inhibit a specific metabolic pathway of CNTN4 to reduce protein expression or denaturation to no activity. Therefore, the CNTN4 inhibitor according to the present invention is very effective in treating or preventing cancer.
  • the CNTN4 inhibitor may include a compound, protein, fusion protein, antibody, amino acid, peptide, virus, carbohydrate, lipid, nucleic acid, extract, fraction, etc., as long as it is a substance that inhibits the activity or expression of CNTN4. not.
  • the CNTN4 inhibitor may decrease the expression of CNTN4 in cancer cells compared to cancer cells not treated with the CNTN4 inhibitor.
  • the reduced expression of CNTN4 may mean that the level of mRNA and/or protein generated from the CNTN4 gene is reduced or eliminated.
  • the CNTN4 inhibitor may include, for example, an antisense nucleic acid, siRNA, shRNA, miRNA, ribozyme, etc. that complementarily binds to DNA or mRNA of the CNTN4 gene, but is not limited thereto.
  • antisense nucleic acid refers to DNA, RNA, or fragments or derivatives thereof that contain a nucleic acid sequence complementary to the sequence of a specific mRNA, and complementarily binds or hybridizes to the sequence of the mRNA to convert the mRNA into a protein. It inhibits translation.
  • siRNA small interfering RNA
  • siRNA refers to a short double-stranded RNA capable of inducing RNA interference (RNAi) through cleavage of a specific mRNA.
  • siRNA includes a sense RNA strand having a sequence homologous to the mRNA of a target gene and an antisense RNA strand having a complementary sequence thereto. Since siRNA can inhibit the expression of a target gene, it is used in a gene knockdown method or a gene therapy method.
  • siRNA short hairpin RNA
  • micro RNA refers to 21 to 23 non-coding RNAs that post-transcriptionally regulate gene expression by facilitating degradation of target RNAs or inhibiting translation thereof.
  • ribozyme refers to an RNA molecule having an enzyme-like function that recognizes a specific nucleotide sequence and cuts it by itself.
  • a ribozyme is a complementary nucleotide sequence of a target messenger RNA strand and consists of a region that binds with specificity and a region that cuts the target RNA.
  • Antisense nucleic acid, siRNA, shRNA, miRNA, ribozyme, etc. that complementarily bind to the DNA or mRNA of the CNTN4 gene are the translation of CNTN4 mRNA, translocation into the cytoplasm, maturation or any other of CNTN4. It can inhibit essential activity for biological function.
  • the CNTN4 inhibitor may inactivate the function or reduce the activity of CNTN4 in cancer cells compared to cancer cells not treated with the CNTN4 inhibitor.
  • the CNTN4 inhibitor includes, for example, a compound that specifically binds to a CNTN4 protein, a peptide, a peptide mimetics, a fusion protein, an antibody or an antigen-binding fragment thereof, an antibody drug complex (ADC, Antibody Drug Conjugate), or an aptamer. can, but is not limited thereto.
  • the term “specific” refers to the ability to bind only a protein of interest without affecting other proteins in a cell.
  • antibody includes monoclonal antibodies, polyclonal antibodies, bispecific antibodies, multispecific antibodies, chimeric antibodies, humanized antibodies, human antibodies, and in addition to novel antibodies, antibodies already known or commercially available in the art are also used. Included.
  • the antibody includes functional fragments of antibody molecules as well as full-length forms comprising two heavy chains and two light chains, as long as they specifically bind to CNTN4.
  • the functional fragment of the antibody molecule refers to a fragment having at least an antigen-binding function, which may include, but is not limited to, Fab, F(ab'), F(ab')2, Fv, and the like.
  • Peptide Minetics is a peptide or non-peptide that inhibits the binding domain of a protein of CNTN4 that induces the activity of CNTN4.
  • aptamer refers to a single-stranded nucleic acid (DNA, RNA, or modified nucleic acid) having a stable tertiary structure by itself and having high affinity and specificity to bind to a target molecule.
  • Substances that inhibit the activity or expression of CNTN4 included in the pharmaceutical composition of the present invention may inhibit CNTN4 from inhibiting the function of T cells, thus maintaining the ability of T cells to attack cancer cells, or may act as a stimulant.
  • the ability of T cells to attack cancer cells may be increased by 5% to 200% compared to the untreated group. Therefore, the pharmaceutical composition of the present invention can be usefully used for the prevention or treatment of cancer.
  • Cancers that the pharmaceutical composition of the present invention can treat or prevent include, for example, stomach cancer, lung cancer, liver cancer, colorectal cancer, colon cancer, small intestine cancer, pancreatic cancer, brain cancer, bone cancer, melanoma, breast cancer, sclerosis, uterine cancer, cervical cancer , head and neck cancer, esophageal cancer, thyroid cancer, parathyroid cancer, kidney cancer, sarcoma, prostate cancer, urethral cancer, bladder cancer, blood cancer, leukemia, lymphoma, fibroadenoma, and the like.
  • the pharmaceutical composition according to the present invention may contain the active ingredient alone or may further contain one or more pharmaceutically acceptable carriers, excipients, diluents, stabilizers, preservatives, and the like.
  • the pharmaceutically acceptable carrier may include, for example, a carrier for oral administration or a carrier for parenteral administration.
  • the carrier for oral administration may include lactose, starch, cellulose derivatives, magnesium stearate, stearic acid, and the like.
  • the carrier for parenteral administration may include water, a suitable oil, saline, aqueous glucose, glycol, and the like.
  • Pharmaceutically acceptable stabilizers include antioxidants such as sodium hydrogen sulfite, sodium sulfite or ascorbic acid.
  • Pharmaceutically acceptable preservatives include benzalkonium chloride, methyl- or propyl-paraben, chlorobutanol, and the like.
  • the pharmaceutical composition of the present invention may be administered to animals such as humans by any method, for example, orally or parenterally.
  • the parenteral administration method may be intravenous, intramuscular, intraarterial, intramedullary, intrathecal, transdermal, subcutaneous, intraperitoneal, intranasal, intestinal, topical, sublingual, or rectal administration, but is not limited thereto.
  • the pharmaceutical composition of the present invention may be formulated as a formulation for oral administration or a formulation for parenteral administration according to the administration route as described above.
  • the formulation for oral administration is formulated by a method known in the art in the form of powders, granules, tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, etc. it could be
  • tablets or dragees for oral administration can be obtained by mixing the active ingredient of the present invention with an excipient, adding a suitable adjuvant, and then processing it into a granule mixture.
  • excipient examples include sugars including lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol and maltitol, starches including corn starch, wheat starch, rice starch and potato starch, cellulose, Cellulose, including but not limited to methyl cellulose, sodium carboxymethyl cellulose and hydroxypropylmethyl-cellulose, and fillers such as gelatin, polyvinylpyrrolidone, and the like.
  • cross-linked polyvinylpyrrolidone, agar, alginic acid, sodium alginate and the like may be added as a disintegrant.
  • the pharmaceutical composition of the present invention may further include an anti-aggregating agent, a lubricant, a wetting agent, a flavoring agent, an emulsifying agent, a preservative, and the like.
  • the formulation for parenteral administration may be formulated by a method known in the art in the form of an injection, a gel, an aerosol, or a nasal inhalant.
  • the total effective amount of the pharmaceutical composition according to the present invention may be administered to a subject as a single dose, or may be administered as multiple doses by a fractionated treatment protocol.
  • an appropriate effective dose or content of the active ingredient of the pharmaceutical composition of the present invention may be determined by considering various factors such as the route of administration, the number of administration, the patient's age, weight, health status, sex, disease severity, diet, and excretion rate. Considering the effective dosage for the patient, one of ordinary skill in the art will be able to determine.
  • the total dose of the pharmaceutical composition of the present invention may be about 0.01 ⁇ g to 1,000 mg, or 0.1 ⁇ g to 100 mg per kg of the patient's body weight per day.
  • the pharmaceutical composition according to the present invention is not particularly limited in its formulation, administration route, and administration method as long as the effect of the present invention is exhibited.
  • one aspect of the present invention provides a pharmaceutical composition for enhancing an individual's immunity, comprising a CNTN4 inhibitor as an active ingredient.
  • the level of T-cell-mediated immune response can be increased by reducing the expression or activity of CNTN4 in the individual in whole or in part.
  • the pharmaceutical composition of the present invention can be used for immune enhancement.
  • it can be used in subjects in need of prevention, treatment or improvement of diseases caused by immunodeficiency, immunosuppression, or immune system damage.
  • Another aspect of the present invention provides the use of a CNTN4 inhibitor for treating or preventing cancer.
  • Another aspect of the present invention provides a method for treating or preventing cancer, comprising administering a CNTN4 inhibitor to an individual.
  • Another aspect of the present invention provides a method for enhancing immunity in an individual, comprising administering a CNTN4 inhibitor to the individual.
  • related terms are understood to have the same meanings as those described in the pharmaceutical composition above.
  • one aspect of the present invention provides a method for screening an anticancer drug comprising the steps of:
  • the anticancer drug screening method is a decrease in the expression level of mRNA or protein of CNTN4 in the group treated with the anticancer drug candidate compared to the group not treated with the anticancer drug candidate, or the level of inhibition of T cell activity by CNTN4 is reduced.
  • the method may further include determining that the anticancer drug candidate is an anticancer drug.
  • a decrease in the level may mean a significant decrease.
  • decreasing or significantly decreasing the level is between 5% and 95% (eg, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50 %, 55%, 60%, 65%, 70%, 75%, 80%, 85% or 90%) may mean a reduced amount.
  • the group not treated with the anticancer drug candidate may be cancer cells to which no substance has been added, or cancer cells treated with other substances such as anticancer agents that are not substances that inhibit the activity or expression of CNTN4.
  • screening means finding a specific substance having specific properties, such as sensitivity or activity, to substances such as proteins, fusion proteins, antibodies, peptides, antibiotics, enzymes, and compounds.
  • anticancer drug candidate may be a nucleic acid, protein, antibody, compound, extract, or natural product that is estimated to be capable of inhibiting the expression or activity of CNTN4 or randomly selected according to a conventional selection method.
  • the anticancer drug candidate may preferably be a substance that inhibits the expression and/or activity of CNTN4.
  • the measurement of the expression or activity of CNTN4 may be performed by measuring the expression level of mRNA or protein of CNTN4 or measuring the degree of inhibition of T cell activity by CNTN4.
  • Methods for measuring the expression level of CNTN4 mRNA may use methods known in the art, for example, reverse transcriptase polymerase reaction, competitive reverse transcriptase polymerase reaction, real-time reverse transcriptase polymerase reaction, RNase protection assay , Northern blot, DNA chip, RNA chip, etc. may be used, but is not limited thereto.
  • a method for measuring the expression level of the CNTN4 protein methods known in the art may be used, for example, Western blot, ELISA, radioimmunoassay, radioimmunodiffusion method, Oukteroni immunodiffusion method, rocket immunoelectrolysis Electrophoresis, immunohistochemical staining, immunoprecipitation assay, complement fixation assay, FACS, protein chip, etc. may be used, but are not limited thereto.
  • Methods for measuring the degree of inhibition of T cell activity by CNTN4 may use methods known in the art, for example, RT-PCR, Western blot, ELISA, radioimmunoassay, radioimmunodiffusion method, octero Ni immunodiffusion method, rocket immunoelectrophoresis, immunohistochemical staining, immunoprecipitation assay, complement fixation assay, FACS, etc. may be used, but are not limited thereto.
  • confirmation of inhibition of CNTN4 activity in the screening method of the present invention is a method of measuring the activity after reacting a CNTN4 protein with a candidate substance, a yeast two-hybrid method, a phage display peptide clone that binds to a CNTN4 protein ( phage-displayed peptide clone) search, high throughput screening (HTS) using natural products and chemical libraries, etc., drug hit HTS, cell-based screening, or DNA array A screening method using (DNA array) may be used.
  • the anticancer drug screening method can be both in vitro or in vivo.
  • the step of treating the cancer cells with the anticancer drug candidate may be performed by administering the anticancer drug candidate to an individual having cancer cells or a cancer disease.
  • the subject may be, for example, an animal such as a human, a mouse, or the like.
  • the anticancer drug screening method is based on a new finding in the present invention that inhibiting the activity or expression of CNTN4 can inhibit the T cell evasion function of cancer cells. According to the screening method of the present invention, it is very advantageous because a novel anticancer agent can be easily developed in an inexpensive and simple way.
  • one aspect of the present invention provides a method for providing information necessary for cancer prognosis analysis, comprising the step of measuring the expression or activity of CNTN4 in cells or tissues isolated from an individual.
  • prognosis refers to prediction in terms of disease progression, disease remission, disease recurrence, metastasis, and likelihood of death.
  • the prognosis in the present invention means the possibility that the disease of the cancer patient will be cured or the patient's condition will be improved.
  • the cells or tissues isolated from the subject may be cancer cells or tissues in which cancer has occurred or cancer cells exist.
  • the method of providing information necessary for the analysis of cancer prognosis is based on the fact that the lower the activity or expression level of CNTN4 in cancer cells, the higher the activity of T cells, thereby increasing the cancer treatment effect.
  • one aspect of the present invention provides a pharmaceutical composition for treating or preventing cancer comprising an anti-CNTN4 antibody or antigen-binding fragment thereof that specifically binds to CNTN4.
  • the pharmaceutical composition for treating or preventing cancer may include an anti-CNTN4 antibody or an antigen-binding fragment thereof that binds to the fibronectin 2 domain of CNTN4 upon binding to CNTN4.
  • the pharmaceutical composition for treating or preventing cancer may be used for anticancer purposes.
  • the anti-CNTN4 antibody or antigen-binding fragment thereof upon binding to CNTN4, binds to the fibronectin 2 domain (FN2) of CNTN4.
  • the fibronectin 2 domain may include the amino acid sequence of SEQ ID NO: 13.
  • CNTN4 consists of a total of 10 domains (ie, Ig1 to Ig6 and FN1 to FN4), and binds to amyloid precursor protein (APP) in the body (Ig; Ig like domain, FN; fibronection). Specifically, the FN1 ⁇ FN2 domains (domain 7 ⁇ domain 8) of CNTN4 strongly bind at the KPI (Kunitz-type protease inhibitor) domain site of APP. The FN1 to FN2 domains (domain 7 to domain 8) of CNTN4 consist of the amino acid sequence of SEQ ID NO: 9, and the KPI domain of APP consists of the amino acid sequence of SEQ ID NO: 10.
  • the anti-CNTN4 antibody or antigen-binding fragment thereof binds to CNTN4, binding of CNTN4 to APP is blocked or inhibited. Accordingly, the anti-CNTN4 antibody or antigen-binding fragment thereof may be useful as an antibody that inhibits the interaction between CNTN4 and APP.
  • A, B and/or C is used herein to mean A, or B, or C, or A and B, or A and C, or B and C, or A, B and C.
  • the present invention is based on the first discovery that CNTN4 can be used as a novel target for cancer treatment.
  • cancer can be effectively prevented or treated using an inhibitor of CNTN4.
  • an inhibitor of CNTN4 can be used to enhance immunity of an individual.
  • new anticancer drug candidates can be effectively selected by measuring the activity or expression of CNTN4, and information necessary for diagnosing and predicting cancer prognosis can be provided.
  • 3A to 3D show the cytotoxicity (%) of PBMCs when lung cancer cell lines A549 and PBMCs were treated with a CNTN4 inhibitor.
  • 4A to 4D show the cytotoxicity (%) of PBMCs when the colon cancer cell lines HCT-116 and PBMCs were treated with a CNTN4 inhibitor.
  • 5A to 5D show the cytotoxicity (%) of PBMCs when the breast cancer cell lines MDA-MB-231 and PBMCs were treated with a CNTN4 inhibitor.
  • 6A to 6D show the cytotoxicity (%) of PBMCs when the gastric cancer cell lines MKN-74 and PBMCs were treated with a CNTN4 inhibitor.
  • 7A to 7D show the cytotoxicity (%) of PBMCs when the leukemia cell lines U937 and PBMCs were treated with a CNTN4 inhibitor.
  • FIG. 9 shows the structures of CNTN4 and APP fabricated according to Example 4.
  • FIG. 11 shows the amino acid sequences of the FN1-FN2 domain of CNTN4 and the KPI domain of APP.
  • FIG. 13 is a schematic diagram of a Human CNTN4 domain sample prepared according to Example 5.2.1.
  • Human blood was placed in a 10 mL tube coated with EDTA (or heparin) and mixed with PBS at a ratio of 1:1. Then, Ficoll-Paque PLUS was placed in a 50 mL tube, and the blood sample was added. After centrifugation, human peripheral blood mononuclear cells (PBMCs) were harvested. The collected product was centrifuged and the supernatant was removed. RBC lysis (1x) was then added, pipetted and stored on ice for 3 minutes. Then, 50 ml of 10% FBS RPMI1640 was added and the mixture was centrifuged to remove the supernatant. Then, FACS buffer was added and the supernatant was removed by centrifugation. Then, 50 ml of MACS buffer (PBS with 0.5% BSA and 2 mM EDTA) was added, the cell number was counted, and the supernatant was removed by centrifugation.
  • PBMCs peripheral blood mononuclear cells
  • CD4+ T cells and CD8+ T cells were resuspended using 40 ⁇ l MACS buffer based on the number of 1 ⁇ 10 7 cells, and 10 ⁇ l of each anti-CD4 and anti-CD8 biotin antibody was added to a tube and stored in a refrigerator for 5 minutes. Then, 30 ⁇ l of MACS buffer based on the number of 1 ⁇ 10 7 cells was added to the product, and 20 ⁇ l of anti-biotin microbeads were added and mixed. Then, using an LS column, CD4+ T cells and CD8+ T cells were isolated and the number of cells was counted.
  • CD4+ T cells and CD8+ T cells were mixed with 1 ⁇ l of CFSE (Carboxyfluorescein succinimidyl ester) based on the number of 2 ⁇ 10 6 cells, and stored at 37° C. for 3 minutes. Then, FBS was added to the tube containing each CD4+ T cell and CD8+ T cell, and stored on ice for 10 minutes. Thereafter, the supernatant was removed by centrifugation. After 30 ml of FACS buffer was added to the product, the supernatant was removed by pipetting and centrifugation. Then, 10% FBS RPMI1640 was added, pipetting, and centrifugation to remove the supernatant. The product was then mixed with 10 ml of 10% FBS RPMI1640 and the number of cells was counted.
  • CFSE Carboxyfluorescein succinimidyl ester
  • Recombinant human IgG1 Fc protein (Cat. No. 110-HG) and recombinant human PD-L1/B7-H1 Fc chimera protein (Cat. No. 156-B7) were purchased from R&D systems.
  • recombinant human CNTN4 His Tag protein (Cat: 2205-CN) was purchased from R&D systems.
  • CD4+ T cells and CD8+ T cells prepared in Example 1.1. were added to each well of a 96-well plate and incubated.
  • CD4+ T cells and CD8+ T cells were activated for 72 hours by anti-CD3 antibody.
  • the proliferation of CD4+ T cells and CD8+ T cells can be confirmed by the degree of CFSE staining, which was analyzed by flow cytometry using FACSDiVa software (BD Biosciences).
  • the proliferation rates (%) of CD4+ T cells and CD8+ T cells are shown in FIGS. 1 and 2 , respectively.
  • Human blood was placed in a 10 mL tube coated with EDTA (or heparin) and mixed with PBS at a ratio of 1:1. Then, Ficoll-Paque PLUS was placed in a 50 mL tube, and the blood sample was added. After centrifugation, human peripheral blood mononuclear cells (PBMCs) were harvested. The collected product was centrifuged and the supernatant was removed. RBC lysis (1x) was then added, pipetted and stored on ice for 3 minutes. Then, 50 ml of 10% FBS RPMI1640 was added and the mixture was centrifuged to remove the supernatant. Then, FACS buffer was added and the supernatant was removed by centrifugation. Then, 50 ml of MACS buffer (PBS with 0.5% BSA and 2 mM EDTA) was added, the cell number was counted, and the supernatant was removed by centrifugation.
  • PBMCs peripheral blood mononuclear cells
  • 96-well plates were coated with 1.0 ⁇ g/ml of anti-CD3 antibody (BioLegend, Cat. No. 317325) in PBS at 4°C. Wells of 96-well plates were washed 3 times with PBS before adding PBMCs. The previously obtained PBMCs were mixed with 10% FBS RPMI1640, and 100 ⁇ l of 6 ⁇ 10 5 pieces were added to each well of a 96-well plate. PBMCs were activated by anti-CD3 antibody for 72 hours.
  • anti-CD3 antibody BioLegend, Cat. No. 317325
  • Lung cancer cell line A549, colon cancer cell line HCT-116, breast cancer cell line MDA-MB-231, gastric cancer cell line MKN-74, and leukemia cell line U937 were each mixed with 1 ⁇ l of CFSE (carboxyfluorescein succinimidyl ester) and stored at 37° C. for 3 minutes. . Then, FBS was added to the tube containing each cell line, and stored on ice for 10 minutes. The supernatant was then removed by centrifugation. 30 ml of FACS buffer was added to the thus obtained product, followed by pipetting and centrifugation to remove the supernatant. Then, 10% FBS RPMI1640 was added, pipetting, and centrifugation to remove the supernatant. The product thus obtained was mixed with 10 ml of 10% FBS RPMI1640, and then the number of cells was counted.
  • CFSE carboxyfluorescein succinimidyl ester
  • the cancer cells were added to each well of the PBMC-containing 96-well plate prepared in Example 2.1. 3 ⁇ 10 4 of 100 ⁇ l, and incubated.
  • a mixture of PBMCs and cancer cell lines was prepared in Example 2.2 above. These mixtures were incubated with 10 ⁇ g/mL of anti-human CNTN4 antibody or 50 nM of CNTN4 siRNA for 24 hours.
  • the experimental group and untreated control group using 5 types of neutralizing antibodies to block CNTN4 are shown in Table 1 below, and the experimental group and untreated control group using 3 types of siRNA to knock down CNTN4 are shown in Table 2 below.
  • PBMCs and cell lines and antibody or siRNA were incubated together, and cells were stained with 7-aminoactinomycin D (7-AAD; BD Pharmingen, San Diego, CA, USA) to identify lysed cells after 24 hours. did.
  • 7-aminoactinomycin D 7-aminoactinomycin D
  • FIGS. 3A to 3D The results of treatment with the CNTN4 neutralizing antibody or siRNA against the lung cancer cell line A549 are shown in FIGS. 3A to 3D .
  • lung cancer cell lines A549 and PBMC were treated with a CNTN4-neutralizing antibody, it can be confirmed that the killing ability of lung cancer cells was significantly increased compared to the untreated control, although there was a difference depending on the type of antibody. In addition, it was confirmed that the lung cancer cell killing ability was significantly increased even when the lung cancer cell line was treated with CNTN4 siRNA.
  • the experimental results for the colon cancer cell line HCT-116 are shown in FIGS. 4A to 4D
  • the experimental results for the breast cancer cell line MDA-MB-231 are shown in FIGS. 5A to 5D
  • the gastric cancer cell line when treated with CNTN4 neutralizing antibody or siRNA, the experimental results for the colon cancer cell line HCT-116 are shown in FIGS. 4A to 4D, and the experimental results for the breast cancer cell line MDA-MB-231 are shown in FIGS. 5A to 5D, and the gastric cancer cell line.
  • the experimental results for MKN-74 are shown in FIGS. 6A to 6D
  • the experimental results for the leukemia cell line U937 are shown in FIGS. 7A to 7D.
  • the MC38 cell line derived from C57BL6 colon adenocarcinoma cells was resuspended in 50 ⁇ l PBS at a concentration of 2.0 ⁇ 10 5 cells, and injected subcutaneously into the flank of 6-week-old female C57BL6 mice.
  • Table 3 below shows the experimental group and the untreated control group using siRNA to knock down CNTN4.
  • siRNA targeting mouse CNTN4 was injected into the tumors of mice three times at intervals of 5 days from the 11th day after the injection of the MC38 cell line. Specifically, 10 ⁇ g of siRNA was mixed with 7.5 ⁇ l of oligofectamine (Invitrogen) in PBS according to the manufacturer's instructions, and then directly injected into the mouse-induced tumor tissue at a dose of 0.5 mg/kg.
  • oligofectamine Invitrogen
  • mice in the untreated control group and the experimental group 9 in which CNTN4 was knocked down are shown in FIG. 8 .
  • CNTN4 inhibitors can be usefully used to prevent cancer.
  • HEK293FT cells were coated on a culture dish plate at 3 x 10 6 cells. After 24 hours, 200 ⁇ L of jetPRIME transfection buffer; 10 ⁇ g of CNTN4 expression plasmid or 10 ⁇ g of APP expression plasmid; and 20 ⁇ L of RIME transfection reagent, respectively, and incubated at room temperature (RT) for 10 minutes, each mixture was added to the cells to transfect HEK293FT cells with each plasmid.
  • RT room temperature
  • CNTN4 consists of a total of 10 domains (ie, Ig1 to Ig6 and FN1 to FN4), and each plasmid expresses Ig1 to Ig4, Ig1 to Ig6, Ig1 to FN2, Ig1 to FN4 (Ig; Ig like domain, FN). ; fibronection).
  • Ig4, #6, #8, and #10 Ig1 to Ig4 and FN4 expression plasmids.
  • a total of three plasmids were prepared and used as APP expression plasmids.
  • three isoforms of APP were expressed, respectively, and these were named 770, 751, and 695, respectively.
  • 770 and 751 isoforms have a kunitz-type protease inhibitor (KPI) domain
  • 695 isoforms do not have a KPI domain (FIG. 9b).
  • a total of 7 sets of cells transfected in 4.1. were precipitated by centrifuge at 1,200 rpm, 3 min, and 4°C, the supernatant was removed, the cell pellet was released with 1 x lysis buffer, and the cell pellet was released at 4°C for 10 min. After reacting, centrifuge at 13,000 rpm, 10 min, and 4° C. again to obtain cell lysate.
  • CNTN4 #10 and APP 770, 751, and 695 were reacted to check whether the CNTN4-APP protein complex was generated. wanted to check.
  • IP Ab anti-CNTN4 antibody or anti-APP antibody
  • NuPAGE 4-12% Bis-Tris gel was used in combination with the NuPAGE® electrophoresis system. Gel was fixed in the chamber, and MES running buffer was filled between the gel cassette and the electrode assembly. Marker 5mL and sample (20mL per well) were loaded and electrophoresed according to the manufacturer's manual.
  • the membrane was blocked with 3% BSA blocking buffer at RT for 60 min. After blocking, it was washed 3 times with PBST, and the primary antibody was diluted (1:1,000) in 0.3% BSA blocking buffer and then placed in a refrigerator at 4°C overnight. After washing 3 times with PBST, the secondary antibody was diluted (1:5,000) in 0.3% BSA blocking buffer and reacted for 60 min at RT after treatment. It was washed 3 times with PBST.
  • Luminol/Enhancer solution and peroxide solution of SuperSignalTM West Pico PLUS Chemiluminescent Substrate were mixed in a 1.5 mL tube with 500 mL each, sprayed on the membrane, and then photographed using LOURMAT CHEMI-DOC.
  • CNTN4 #10 full length binds to APP (770 & 751) having a KPI (kunitz-type protease inhibitor) domain (FIG. 10a), and APP 770 (full length) is FN1 ⁇ FN2 domain (domain 7 ⁇ domain) 8) was confirmed to bind to CNTN4 (#8 &#10) having (Fig. 10b). From this, it was confirmed that the APP site to which CNTN4 binds is the KPI domain, and the corresponding CNTN4 binding site is the FN1 ⁇ FN2 domain (domain 7 ⁇ domain 8). The sequences of each domain are shown in Table 4 and FIG. 11 .
  • the binding between the anti-CNTN4 antibody (AB1) and the CNTN4 domain was confirmed to confirm the antibody binding site of CNTN4.
  • Antibodies were generated by inoculating 15 chickens with mouse CNTN4 and/or human CNTN4. A total of 4 animals whose antibody production was confirmed through ELISA were selected. After sacrifice, blood, spleen, bone marrow, and bursa fabricius were extracted, total RNA was extracted, cDNA was synthesized, and the light and heavy chain variable regions of the antibody and the scFv fragment linking them with a linker were obtained through PCR. . After that, phage display was performed. A positive clone binding to CNTN4 was selected through phase ELISA screening, and the corresponding scFv sequence was selected (scFv AB1).
  • the light and heavy chain regions of the scFv selected in 5.1.1. were cloned into a bicistronic expression vector.
  • DNA was transiently transfected into Expi293F cells and cultured up to 50% viability to express IgG, and the culture medium was bound to Kappa select resin (kappa region capture) to elution to IgG and first purified. Thereafter, to remove light chain impurities, it was bound to Mabselect (Fc region capture), and the IgG was elution and secondary purification was performed to prepare an anti-CNTN4 129 chimeric IgG4 antibody (hereinafter referred to as "AB1") with a purity of 72.4% on SEC-HPLC. did.
  • CNTN4 consists of a total of 10 domains (ie, Ig1 to Ig6 and FN1 to FN4; in FIG. 13 , respectively indicated as Domains 1 to 10), and Full indicates a sample including all 10 domains.
  • D1-9 is a sample in which domain 10 is deleted from Full
  • D1-8 is a sample in which domain 9 is deleted in D1-9.
  • Domain samples of D1-4 to D1-7 were prepared in the same manner.
  • the concentration of the full domain was set at 4 ⁇ g/mL, and in order to apply the same molar concentration, the concentration of each domain was determined according to the molecular weight ratio (Table 6).
  • a 96-well plate 50 ⁇ L/well of the CNTN4 domain prepared in 5.2.1. was dispensed. After sealing with sealing tape, it was incubated at 4°C overnight. The next day, the sealing tape was removed and the buffer was removed. 150 ⁇ L of blocking buffer was dispensed into each well, sealed, and incubated at 37° C. for 1 hour.
  • each primary antibody (antibody AB1) diluted with the blocking buffer according to Table 13 was dispensed into each well. Sealed with sealing tape and incubated at 37°C for 2 hours. After removing the sealing tape, washing was performed 3 times.
  • Anti-CNTN4 antibody AB1 bound only to D1-8, D1-9, and Full out of a total of 7 human CNTN4 domain samples (three graphs overlap each other in FIG. 14), and binds to D1-4 to D1-7 not (four graphs superimposed on each other, except for D1-6 at approximately antibody concentrations of 0.0001 to 0.01 nM).
  • D1-7 and D1-8 have a difference in the presence or absence of Domain 8, it can be seen that Domain 8 (ie, FN2) is an important binding site for binding of CNTN4 and anti-CNTN4 antibodies.
  • the amino acid sequence of Domain 8 of CNTN4 is shown in Table 9 and FIG. 15 .
  • CNTN4 4 mg/mL of CNTN4 was coated on the plate.
  • APP his tagged, 0.64 mg/mL
  • AB1 4.98 mg/mL; 35 mM
  • Diluted APP and AB1 antibodies were treated at 25 mL/well in a 96-well half plate coated with CNTN4, respectively, and reacted at room temperature for 4 hours (in duplicate), followed by washing.
  • Anti-his tag was diluted 1:2,000 in ELISA buffer, treated at 50 mL/well, incubated at room temperature for 1 hour, and washed.
  • ABTS was treated with 50 mL/well, and absorbance was measured at 405 nm using a plate reader.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Molecular Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Biochemistry (AREA)
  • Epidemiology (AREA)
  • Genetics & Genomics (AREA)
  • Microbiology (AREA)
  • Biomedical Technology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Urology & Nephrology (AREA)
  • Hematology (AREA)
  • Mycology (AREA)
  • Toxicology (AREA)
  • Biotechnology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Cell Biology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Physics & Mathematics (AREA)
  • Food Science & Technology (AREA)
  • Pathology (AREA)
  • Zoology (AREA)
  • Analytical Chemistry (AREA)
  • Physics & Mathematics (AREA)
  • Endocrinology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Virology (AREA)

Abstract

본 발명은 암 치료 또는 예방용 약학적 조성물, 면역증강용 약학적 조성물, 항암제 스크리닝 방법, 및 암 예후 분석에 필요한 정보를 제공하는 방법에 관한 것이다. 본 발명에 따르면, CNTN4 억제제를 사용하여 암을 효과적으로 예방 또는 치료할 수 있으며, 개체의 면역력을 증강시킬 수 있다. 또한, 본 발명은 CNTN4의 활성 또는 발현 측정을 통해 새로운 항암제 후보물질을 효과적으로 선별할 수 있으며, 암 예후 진단 및 예측에 필요한 정보를 제공할 수 있어 매우 유용하다.

Description

항암 및 면역증강용 신규 타겟
본 발명은 CNTN4 억제제를 포함하는 암 치료 또는 예방용 약학적 조성물에 관한 것이다. 또한, 본 발명은 CNTN4 억제제를 포함하는 면역증강용 약학적 조성물에 관한 것이다. 또한, 본 발명은 CNTN4를 이용한 항암제 스크리닝 방법, 및 암 예후 분석에 필요한 정보를 제공하는 방법에 관한 것이다.
지난 수년간 암에 대한 집중적인 연구가 이루어졌음에도 불구하고 여전히 암은 전세계적으로 주요한 사망 원인이다. 다수의 암 치료법이 개발되었으나 모든 암종에 대해 그리고 모든 환자에 대해 효과적이지 않다. 암을 치료하기 위해 현재 대부분 사용되고 있는 방법은 상대적으로 비선택적이다. 수술에 의해 질병을 갖는 조직을 제거하거나, 방사선 치료에 의해 고형 종양의 크기를 감소시키거나, 화학치료에 의해 암세포를 빠르게 사멸시킨다. 특히, 화학치료는 약물에 대한 내성을 발달시킬 수 있으며, 일부 경우에는 투여가능한 용량을 제한하여 결국 잠재적으로 유효한 약물의 사용을 배제시킬 정도로 심각한 부작용을 야기시킨다. 따라서, 타겟 특이적이고 보다 효과적인 암 치료의 개발이 시급하다.
인체 적응 면역 체계는 암세포를 특이적으로 제거할 수 있는 매우 정교한 시스템이다. 특히 T 세포의 경우, 세포성 적응 면역을 결정하는 역할을 하며, 세포가 비자아 또는 비정상적인 항원에 노출되는 경우 항원을 인지하여 제거한다. T 세포의 경우, 세포당 약 20,000-40,000 TCR 분자를 발현하고 APC의 100,000 pMHC 분자 중 몇 개의 항원 (펩타이드 서열에 의해 결정)을 특이적으로 인지하여 신호 전달을 시작하게 된다. 이와 같은 TCR 분자는 매우 정교하고, 미묘한 항원 변화를 인지하여 신호를 전달해야 하는 고감도 센서로서의 역할을 하여야 한다. 이러한 세포성 적응 면역은 매우 정교하게 작동되어 암세포를 효과적으로 제거할 수 있어야 한다. 만약 항원 특이적 적응 면역 체계가 정상적으로 작동하지 않게 되면, 암세포 제거 기능에 심각한 문제를 초래한다. 예를 들어, 암세포의 표면에 있는 단백질 PD-L1 또는 PD-L2가 T 세포의 표면에 있는 단백질 PD-1과 결합하면, T 세포는 암세포를 공격하지 못한다. 따라서, 효과적인 암 치료를 위해, T 세포가 암세포를 제거하는 데 방해가 되는 요소를 제거하는 것이 필요하다.
본 발명자들은 인체 면역 체계를 이용한 암 치료 방법을 발굴하기 위하여 연구를 진행한 결과, CNTN4 활성 저해가 암의 발달, 성장, 침윤 및 전이를 현저하게 억제하는 것을 확인함으로써 본 발명을 완성하기에 이르렀다.
상기 목적을 달성하기 위해, 본 발명의 일 양태는 CNTN4 억제제를 유효성분으로 포함하는, 암 치료 또는 예방용 약학적 조성물을 제공한다.
용어 "CNTN4(Contactin-4)"는 CNTN4 유전자에 의해 코딩되는 단백질로, 면역글로불린 상과(immunoglobulin superfamily)에 속하며, 세포접착분자로서 기능하는 GPI(glycosylphosphatidylinositol)-anchored 신경세포 막단백질로서 신경계의 발달과정에서 axon 커넥션을 형성하는 역할을 하는 것으로 알려져 있다.
상기 CNTN4는 인간 유래 CNTN4일 수 있다. 보다 구체적으로, 상기 CNTN4의 아미노산 서열은 NCBI에 개시된 NP_783200.1의 서열이거나 이를 포함할 수 있다. 또한, 상기 CNTN4 아미노산 서열은 각각 NCBI Reference Sequence: NP_115920.1, NP_783200.1, AAL51154.1의 서열과 80%, 85%, 90% 또는 95% 이상의 상동성을 갖는 서열이거나 이를 포함할 수 있지만 이에 한정되는 것은 아니며, CNTN4의 특성 또는 기능을 나타내는 아미노산 서열이라면 모두 포함된다.
상기 CNTN4의 유전자는 인간 유래 CNTN4의 아미노산 서열을 코딩하는 핵산 서열이거나 이를 포함하거나, 또는 NCBI에 개시된 NCBI Reference Sequence: NM_175607.3의 핵산 서열이거나 이를 포함할 수 있다. 또한, 상기 CNTN4의 핵산 서열은 각각 NCBI에 개시된 NCBI Reference Sequence: NM_032531.4, NM_175607.3, AY063125.1의 핵산 서열과 80%, 85%, 90% 또는 95% 이상의 상동성을 갖는 서열이거나 이를 포함할 수 있지만 이에 한정되는 것은 아니며, CNTN4의 특성 또는 기능을 나타내는 아미노산을 생산할 수 있는 핵산 서열이라면 모두 포함된다.
용어 "CNTN4 억제제"는 CNTN4의 활성 또는 발현을 저해하는 물질을 의미한다.
상기 CNTN4 억제제는 바람직하게는 T 세포의 암세포 회피기능을 저해할 수 있다. CNTN4 억제제가 CNTN4의 활성을 차단함으로써, CNTN4에 의해 T 세포가 암세포를 공격하지 못하게 되는 작용기전을 억제하고, 또한 T 세포의 암세포에 대한 면역 활성을 유지시킬 수 있다. 또는, CNTN4 억제제는 CNTN4 단백질에 특이적으로 결합하여 CNTN4와 T 세포의 결합을 방해하거나, 또는 CNTN4의 특정 대사 경로를 저해하여 단백질 발현을 감소시키거나 활성을 갖지 못하도록 변성시킬 수 있다. 따라서, 본 발명에 따른 CNTN4 억제제는 암 치료 또는 예방에 매우 효과적이다.
상기 CNTN4 억제제는 CNTN4의 활성 또는 발현을 저해하는 물질이라면, 화합물, 단백질, 융합 단백질, 항체, 아미노산, 펩티드, 바이러스, 탄수화물, 지질, 핵산, 추출물, 분획물 등을 포함할 수 있으며, 이에 한정되는 것은 아니다.
일 구현예에서, 상기 CNTN4 억제제는 CNTN4 억제제로 처리되지 않은 암세포에 대비하여 암세포 내 CNTN4의 발현을 감소시키는 것일 수 있다. 상기 CNTN4의 발현 감소는 CNTN4의 유전자로부터 생성되는 mRNA 및/또는 단백질의 수준이 감소되거나 제거된 것을 의미할 수 있다. 상기 CNTN4 억제제는 예를 들면, CNTN4 유전자의 DNA 또는 mRNA에 상보적으로 결합하는 안티센스 핵산, siRNA, shRNA, miRNA, 리보자임 등을 포함할 수 있으며, 이에 한정되는 것은 아니다.
용어 "안티센스 핵산"은 특정 mRNA의 서열에 대해 상보적인 핵산 서열을 함유하고 있는 DNA, RNA, 또는 이들의 단편 또는 유도체를 의미하며, mRNA의 서열에 상보적으로 결합 또는 혼성화하여 mRNA의 단백질로의 번역을 저해하는 작용을 한다.
용어 "siRNA(small interfering RNA)"는 특정 mRNA의 절단(cleavage)을 통해 RNAi(RNA interference)를 유도할 수 있는 짧은 이중사슬 RNA를 의미한다. siRNA는 표적 유전자의 mRNA와 상동인 서열을 갖는 센스 RNA 가닥과 이와 상보적인 서열을 갖는 안티센스 RNA 가닥을 포함한다. siRNA는 표적 유전자의 발현을 억제할 수 있으므로, 유전자 넉다운 방법 또는 유전자치료 방법 등에 사용된다.
용어 "shRNA(short hairpin RNA)"는 단일가닥 RNA로서 수소결합에 의해 이중가닥 부분을 형성하는 줄기(stem) 부분과 고리 형태를 띄는 루프(loop) 부분으로 구분되며, Dicer 등의 단백질에 의해 프로세싱되어 siRNA로 변환되고 siRNA와 동일한 기능을 수행할 수 있다.
용어 "miRNA(micro RNA)"는 표적 RNA의 분해를 촉진시키거나 또는 이들의 번역을 억제시킴으로써 유전자 발현을 전사 후에 조절하는 21 내지 23개의 비코딩 RNA를 말한다.
용어 "리보자임(ribozyme)"은 특정 염기 서열을 인식하여 자체적으로 이를 절단하는 효소와 같은 기능을 가진 RNA 분자를 의미한다. 리보자임은 타겟 전령 RNA 가닥의 상보적인 염기서열로 특이성을 가지고 결합하는 영역과 타겟 RNA를 절단하는 영역으로 구성된다.
상기 CNTN4 유전자의 DNA 또는 mRNA에 상보적으로 결합하는 안티센스 핵산, siRNA, shRNA, miRNA, 리보자임 등은 CNTN4의 mRNA의 번역, 세포질 내로의 전위(translocation), 성숙(maturation) 또는 다른 임의의 CNTN4의 생물학적 기능에 대한 필수적인 활성을 저해할 수 있다.
일 구현예에서, 상기 CNTN4 억제제는 CNTN4 억제제로 처리되지 않은 암세포와 비교하여 암세포 내 CNTN4의 기능을 불활성화시키거나 활성을 감소시키는 것일 수 있다. 상기 CNTN4 억제제는 예를 들면 CNTN4 단백질에 특이적으로 결합하는 화합물, 펩티드, 펩티드 미메틱스, 융합 단백질, 항체 또는 그의 항원 결합 단편, 항체약물복합체(ADC, Antibody Drug Conjugate) 또는 앱타머 등을 포함할 수 있으며, 이에 한정되는 것은 아니다.
용어 "특이적"은 세포 내에서 다른 단백질에 영향을 미치지 않고 목적 단백질에만 결합하는 능력을 의미한다.
용어 "항체"는 단일클론 항체, 다클론 항체, 이중특이적 항체, 다중특이적 항체, 키메라 항체, 인간화 항체, 인간 항체를 포함하며, 신규 항체 외에 이미 당해 기술분야에서 공지되거나 시판되는 항체들도 포함된다. 상기 항체는 CNTN4에 특이적으로 결합하는 한, 2개의 중쇄와 2개의 경쇄를 포함하는 전체 길이의 형태 뿐만 아니라, 항체 분자의 기능적인 단편을 포함한다. 상기 항체 분자의 기능적인 단편은 적어도 항원 결합 기능을 보유하고 있는 단편을 의미하며, 여기에는 Fab, F(ab'), F(ab')2, Fv 등이 포함될 수 있지만 이에 한정되는 것은 아니다.
용어 "펩티드 미메틱스(Peptide Minetics)"는 CNTN4의 활성을 유도하는 CNTN4의 단백질의 결합 도메인을 억제하는 펩티드 또는 비펩티드이다.
용어 "앱타머(Aptamer)"는 그 자체로 안정된 삼차구조를 가지면서 표적분자에 높은 친화성과 특이성으로 결합할 수 있는 특징을 가진 단일가닥 핵산(DNA, RNA 또는 변형핵산)을 의미한다.
본 발명의 약학적 조성물에 포함되는 CNTN4의 활성 또는 발현을 저해하는 물질은 CNTN4가 T 세포의 기능을 억제하는 것을 저해할 수 있으며, 이에 따라 T 세포가 암세포를 공격할 수 있는 기능을 유지시키거나 촉진시키는 작용을 할 수 있다. 여기서, CNTN4의 활성 또는 발현을 저해하는 물질로 처리한 군에서 T 세포의 암세포 공격 능력은 비처리군에 비해 5% 내지 200% 증가될 수 있다. 따라서, 본 발명의 약학적 조성물은 암의 예방 또는 치료에 유용하게 사용될 수 있다.
본 발명의 약학적 조성물이 치료 또는 예방할 수 있는 암에는 예를 들면, 위암, 폐암, 간암, 대장암, 결장암, 소장암, 췌장암, 뇌암, 뼈암, 흑색종, 유방암, 경화성선증, 자궁암, 자궁경부암, 두경부암, 식도암, 갑상선암, 부갑상선암, 신장암, 육종, 전립선암, 요도암, 방광암, 혈액암, 백혈병, 림프종, 섬유선종 등이 포함되며, 이에 한정되는 것은 아니다.
본 발명에 따른 약학적 조성물은 상기 유효성분을 단독으로 함유하거나 또는 하나 이상의 약학적으로 허용되는 담체, 부형제, 희석제, 안정화제, 보존제 등을 추가로 함유할 수 있다.
약학적으로 허용되는 담체는 예컨대, 경구 투여용 담체 또는 비경구 투여용 담체를 포함할 수 있다. 상기 경구 투여용 담체는 락토스, 전분, 셀룰로스 유도체, 마그네슘 스테아레이트, 스테아르산 등을 포함할 수 있다. 상기 비경구 투여용 담체는 물, 적합한 오일, 식염수, 수성 글루코스, 글리콜 등을 포함할 수 있다. 약학적으로 허용되는 안정화제는 아황산수소나트륨, 아황산나트륨 또는 아스코르브산과 같은 항산화제 등이 있다. 약학적으로 허용되는 보존제는 벤즈알코늄 클로라이드, 메틸- 또는 프로필-파라벤, 클로로부탄올 등이 있다. 그 밖의 약학적으로 허용되는 담체로는 문헌 Remington's Pharmaceutical Sciences, 19th ed., Mack Publishing Company, Easton, PA, 1995에 기재되어 있는 것을 참고할 수 있다.
본 발명의 약학적 조성물은 인간 등 동물에게 임의의 방법으로, 예를 들어 경구 또는 비경구적으로 투여할 수 있다. 상기 비경구적 투여방법으로는 정맥내, 근육내, 동맥내, 골수내, 경막내, 경피, 피하, 복강내, 비강내, 장관, 국소, 설하, 직장내 투여 등일 수 있으며, 이에 한정되지 않는다.
본 발명의 약학적 조성물은 상술한 바와 같은 투여 경로에 따라 경구 투여용 제제 또는 비경구 투여용 제제로 제형화 할 수 있다.
상기 경구 투여용 제제는 분말, 과립, 정제, 환제, 당의정제, 캡슐제, 액제, 겔제, 시럽제, 슬러리제, 현탁액 등의 형태로 당업계에 공지된 방법에 의해 본 발명의 조성물을 제형화한 것일 수 있다. 예를 들어, 본 발명의 유효성분을 부형제와 배합하고 적합한 보조제를 첨가한 후 과립 혼합물로 가공함으로써, 경구 투여를 위한 정제 또는 당의정제를 수득할 수 있다. 상기 부형제의 예에는 락토즈, 덱스트로즈, 수크로즈, 솔비톨, 만니톨, 자일리톨, 에리스리톨 및 말티톨 등을 포함하는 당류와 옥수수 전분, 밀 전분, 쌀 전분 및 감자 전분 등을 포함하는 전분류, 셀룰로즈, 메틸 셀룰로즈, 나트륨 카르복시메틸셀룰로오즈 및 하이드록시프로필메틸-셀룰로즈 등을 포함하는 셀룰로즈류, 젤라틴, 폴리비닐피롤리돈 등과 같은 충전제가 포함될 수 있으나 이에 한정되는 것은 아니다. 선택적으로, 가교결합 폴리비닐피롤리돈, 한천, 알긴산, 나트륨 알기네이트 등을 붕해제로 첨가할 수 있다. 또한, 본 발명의 약학적 조성물은 항응집제, 윤활제, 습윤제, 향료, 유화제, 방부제 등을 추가로 포함할 수 있다.
상기 비경구 투여용 제제는 주사제, 겔제, 에어로졸, 비강 흡입제의 형태로 당업계에 공지된 방법에 의해 본 발명의 조성물을 제형화한 것일 수 있다.
이들 제형은 문헌 Remington's Pharmaceutical Science, 15th Edition, 1975. Mack Publishing Company, Easton, Pennsylvania 18042, Chapter 87: Blaug, Seymour의 기재 내용을 참고할 수 있다.
본 발명에 따른 약학적 조성물의 총 유효량은 단일 투여량(single dose)으로 개체에게 투여될 수 있으며, 또는 다중 투여량(multiple dose)으로 분할 치료 방법(fractionated treatment protocol)에 의해 투여될 수 있다.
본 발명의 약학적 조성물의 적절한 유효 투여량 또는 유효성분의 함량은 투여 경로, 투여 횟수, 환자의 연령, 체중, 건강 상태, 성별, 질환의 중증도, 식이, 배설율 등 다양한 요인들을 고려하여 환자에 대한 유효 투여량을 고려하여, 당해 분야의 통상적인 지식을 가진 자가 결정할 수 있을 것이다. 예를 들어, 본 발명의 약학적 조성물의 전체 용량은 1일당 환자 체중 1 ㎏당 약 0.01 μg 내지 1,000 mg, 또는 0.1 μg 내지 100 mg일 수 있다. 본 발명에 따른 약학적 조성물은 본 발명의 효과를 나타내는 한 그 제형, 투여 경로, 투여 방법에 특별히 제한되지 아니한다.
또한 본 발명의 일 양태는 CNTN4 억제제를 유효성분으로 포함하는, 개체의 면역증강용 약학적 조성물을 제공한다.
본 발명의 약학적 조성물을 면역 증강을 필요로 하는 개체에게 투여되는 경우, 개체 내 CNTN4의 발현 또는 활성을 전체 또는 부분적으로 감소시켜 T-세포 매개성 면역반응의 수준을 증대시킬 수 있다.
이에 따라, 본 발명의 약학적 조성물은 면역증강 용도로 사용할 수 있다. 예를 들어, 면역결핍, 면역저하 또는 면역계 손상으로 인한 질환의 예방, 치료 또는 개선을 필요로 하는 개체에게 사용할 수 있다.
또한 본 발명의 일 양태는 CNTN4 억제제의 암 치료 또는 예방 용도를 제공한다. 또한 본 발명의 일 양태는 CNTN4 억제제를 개체에게 투여하는 단계를 포함하는, 암 치료 또는 예방 방법을 제공한다. 또한 본 발명의 일 양태는 CNTN4 억제제를 개체에게 투여하는 단계를 포함하는, 개체의 면역 증강 방법을 제공한다. 이들 방법에 있어서 특별히 달리 언급되지 않는 한, 관련 용어들은 앞서 약학적 조성물에서 설명된 용어들과 동일한 의미를 갖는 것으로 이해된다.
또한 본 발명의 일 양태는 하기 단계를 포함하는 항암제 스크리닝 방법을 제공한다:
(a) 항암제 후보 물질로 암세포를 처리하는 단계; 및
(b) 상기 암세포 내 CNTN4의 발현 또는 활성을 측정하는 단계.
선택적으로, 상기 항암제 스크리닝 방법은 항암제 후보 물질로 처리하지 않은 군에 비해 항암제 후보 물질로 처리한 군에서 CNTN4의 mRNA 또는 단백질의 발현 수준이 감소하거나 또는 CNTN4에 의한 T 세포의 활성 억제 수준이 감소하는 경우 상기 항암제 후보 물질을 항암제인 것으로 판단하는 단계를 더 포함할 수 있다. 여기서, 상기 수준이 감소한다는 것은 유의적으로 감소하는 것을 의미할 수 있다. 예를 들어, 상기 수준이 감소하는 것 또는 유의적으로 감소하는 것은 5% 내지 95% (예컨대, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85% 또는 90%) 감소된 양을 의미하는 것일 수 있다. 상기 항암제 후보 물질로 처리하지 않은 군은 아무런 물질도 첨가되지 않은 암세포이거나, 또는 CNTN4의 활성 또는 발현 억제 물질이 아닌 항암제 등의 다른 물질로 처리된 암세포일 수 있다.
용어 "스크리닝"은 단백질, 융합 단백질, 항체, 펩티드, 항생물질, 효소, 화합물 등의 물질에 대하여 감수성 또는 활성 등의 특정 성질을 갖고 있는 특정 물질을 찾아내는 것을 의미한다.
용어 "항암제 후보 물질"은 통상적인 선정방식에 따라 CNTN4의 발현 또는 활성을 억제할 수 있는 것으로 추정되거나 또는 무작위적으로 선정된 핵산, 단백질, 항체, 화합물, 추출물 또는 천연물 등일 수 있다. 상기 항암제 후보 물질은 바람직하게는 CNTN4의 발현 및/또는 활성을 저해하는 물질일 수 있다.
상기 CNTN4의 발현 또는 활성의 측정은 CNTN4의 mRNA 또는 단백질의 발현 수준을 측정하거나 또는 CNTN4에 의한 T 세포의 활성 억제 정도를 측정하는 것에 의해 수행될 수 있다.
상기 CNTN4의 mRNA의 발현 수준을 측정하는 방법은 당해 기술분야에서 공지된 방법을 이용할 수 있으며, 예를 들면 역전사효소 중합효소반응, 경쟁적 역전사효소 중합효소반응, 실시간 역전사효소 중합효소반응, RNase 보호 분석법, 노던블롯, DNA칩, RNA칩 등을 이용할 수 있으나, 이에 제한되지 않는다.
상기 CNTN4의 단백질의 발현 수준을 측정하는 방법은 당해 기술분야에서 공지된 방법을 이용할 수 있으며, 예를 들면 웨스턴블롯, ELISA, 방사선면역분석법, 방사면역확산법, 오우크테로니 면역확산법, 로케트 면역전기영동, 면역조직화학염색, 면역침전분석법, 보체 고정 분석법, FACS, 단백질 칩 등을 이용할 수 있으나, 이에 제한되지 않는다.
상기 CNTN4에 의한 T 세포의 활성 억제 정도를 측정하는 방법은 당해 기술분야에서 공지된 방법을 이용할 수 있으며, 예를 들면 RT-PCR, 웨스턴블롯, ELISA, 방사선면역분석, 방사 면역 확산법, 오우크테로니 면역확산법, 로케트 면역전기영동, 면역조직화학염색, 면역침전분석법, 보체 고정 분석법, FACS 등을 이용할 수 있으나, 이에 제한되지 않는다.
또한 본 발명의 스크리닝 방법에서 CNTN4의 활성 억제 확인은 CNTN4 단백질과 후보물질을 반응시킨 후 활성을 측정하는 방법, 효모 이중 혼성법(yeast two-hybrid), CNTN4의 단백질에 결합하는 파지 디스플레이 펩티드 클론(phage-displayed peptide clone)의 검색, 천연물 및 화학물질 라이브러리(chemical library) 등을 이용한 HTS(high throughput screening), 드럭 히트 HTS(drug hit HTS), 세포 기반 스크리닝(cell-based screening), 또는 DNA 어레이(DNA array)를 이용하는 스크리닝법 등을 사용할 수 있다.
상기 항암제 스크리닝 방법은, 인 비트로 또는 인 비보에서 모두 가능하다. 인 비보의 경우, 상기 항암제 후보 물질로 암세포를 처리하는 단계는 항암제 후보 물질을 암세포를 갖는 개체 또는 암 질환을 갖고 있는 개체에게 투여함으로써 수행될 수 있다. 상기 개체는 예를 들면 인간, 마우스 등과 같은 동물일 수 있다.
상기 항암제 스크리닝 방법은 CNTN4의 활성 또는 발현을 억제하면 암세포의 T 세포 회피 기능을 저해할 수 있다는 본 발명에서 신규로 밝혀낸 점에 기반한다. 본 발명의 스크리닝 방법에 따르면 신규 항암제를 저렴하고 간단한 방법으로 용이하게 개발할 수 있으므로 매우 유리하다.
또한 본 발명의 일 양태는 개체에서 분리한 세포 또는 조직에서 CNTN4의 발현 또는 활성을 측정하는 단계를 포함하는 암 예후 분석에 필요한 정보를 제공하는 방법을 제공한다.
상기 방법에서 CNTN4의 발현 또는 활성 및 이의 측정과 관련된 용어는 특별한 언급이 없는 한 상기 조성물 및 상기 스크리닝 방법에서 설명한 바와 동일하다.
용어 "예후"는 질병의 진행, 질병의 차도, 질병의 재발, 전이 및 죽음 가능성 측면에서의 예측을 가리킨다. 예를 들어, 본 발명에서의 예후는 암 환자의 질병이 완치되거나 환자의 상태가 개선될 가능성을 의미한다.
상기 개체에서 분리한 세포 또는 조직은 암세포이거나 또는 암이 발생하거나 암세포가 존재하는 조직일 수 있다.
상기 암 예후 분석에 필요한 정보를 제공하는 방법은 암세포의 CNTN4의 활성 또는 발현 수준이 낮을수록 T 세포의 활성이 높아져 이로 인해 암 치료 효과가 높아질 수 있다는 점에 기반한다.
또한 본 발명의 일 양태는 CNTN4에 특이적으로 결합하는 항-CNTN4 항체 또는 그의 항원 결합 단편을 포함하는 암 치료 또는 예방용 약학적 조성물을 제공한다. 구체적으로, 상기 암 치료 또는 예방용 약학적 조성물은 CNTN4에 결합 시, CNTN4의 피브로넥틴 2 도메인에 결합하는, 항-CNTN4 항체 또는 그의 항원 결합 단편을 포함하는 것일 수 있다. 또한 상기 암 치료 또는 예방용 약학적 조성물은 항암 용도로 사용될 수 있다.
상기 항-CNTN4 항체 또는 그의 항원 결합 단편은, CNTN4에 결합 시, CNTN4의 피브로넥틴 2 도메인(FN2)에 결합한다. 상기 피브로넥틴 2 도메인은 서열번호 13의 아미노산 서열을 포함하는 것일 수 있다.
CNTN4는 총 10개의 도메인(즉, Ig1 내지 Ig6 및 FN1 내지 FN4)로 이루어져 있으며, 체내에서 amyloid precursor protein (APP)에 결합한다(Ig; Ig like domain, FN; fibronection). 구체적으로, CNTN4의 FN1 ~ FN2 domain (domain 7 ~ domain 8)가 APP의 KPI (Kunitz-type protease inhibitor) 도메인 부위에서 강하게 결합한다. CNTN4의 FN1 ~ FN2 domain (domain 7 ~ domain 8)은 서열번호 9의 아미노산 서열로 이루어져 있으며, APP의 KPI 도메인은 서열번호 10의 아미노산 서열로 이루어져 있다.
상기 항-CNTN4 항체 또는 그의 항원 결합 단편이 CNTN4에 결합하는 경우, APP에 대한 CNTN4의 결합이 차단 또는 억제된다. 이에 따라, 상기 항-CNTN4 항체 또는 그의 항원 결합 단편은 CNTN4와 APP의 상호작용을 억제하는 항체로서 유용할 수 있다.
본 명세서에서 "A, B 및/또는 C"는 A, 또는 B, 또는 C, 또는 A 및 B, 또는 A 및 C, 또는 B 및 C, 또는 A, B 및 C를 의미하는 것으로서 사용된다.
본 발명은 암 치료를 위한 새로운 타겟으로 CNTN4가 이용될 수 있음을 최초로 밝혀낸 것에 기초한다.
본 발명에 따르면, CNTN4의 억제제를 사용하여 암을 효과적으로 예방 또는 치료할 수 있다. 또한, CNTN4의 억제제를 사용하여 개체의 면역을 증강시킬 수 있다. 또한, CNTN4의 활성 또는 발현 측정을 통해 새로운 항암제 후보물질을 효과적으로 선별할 수 있으며, 암 예후 진단 및 예측에 필요한 정보를 제공할 수 있다.
도 1은 CNTN4에 의해 저해되는 CD4+ T 세포의 증식율(%)을 나타낸다.
도 2는 CNTN4에 의해 저해되는 CD8+ T 세포의 증식율(%)을 나타낸다.
도 3a 내지 3d는 폐암세포주 A549와 PBMC를 CNTN4 억제제로 처리하였을 때 PBMC의 세포독성(%)을 나타낸 것이다.
도 4a 내지 4d는 결장암세포주 HCT-116과 PBMC를 CNTN4 억제제로 처리하였을 때 PBMC의 세포독성(%)을 나타낸 것이다.
도 5a 내지 5d는 유방암세포주 MDA-MB-231과 PBMC를 CNTN4 억제제로 처리하였을 때 PBMC의 세포독성(%)을 나타낸 것이다.
도 6a 내지 6d는 위암세포주 MKN-74와 PBMC를 CNTN4 억제제로 처리하였을 때 PBMC의 세포독성(%)을 나타낸 것이다.
도 7a 내지 7d는 백혈병세포주 U937과 PBMC를 CNTN4 억제제로 처리하였을 때 PBMC의 세포독성(%)을 나타낸 것이다.
도 8은 CNTN4 억제제로 처리한 마우스에서 종양 크기의 변화를 나타낸 것이다.
도 9는 실시예 4에 따라 제작된 CNTN4 및 APP의 구조를 나타낸다. (a) CNTN4의 4가지 결실 구조 (#10: full length). (b) APP의 3가지 isoform 구조 (APP770: full length).
도 10은 실시예 4에 따라 SDS-Page 및 Western blotting한 이미지를 나타낸다.
도 11은 CNTN4의 FN1-FN2 domain과 APP의 KPI domain의 아미노산 서열을 나타낸다.
도 12는 항-CNTN4 항체 AB1의 경쇄가변영역 및 중쇄가변영역의 아미노산 서열을 나타낸다.
도 13은 실시예 5.2.1에 따라 제조되는 Human CNTN4 domain sample의 모식도이다.
도 14는 실시예 5.2.2에 따라 항-CNTN4 항체 AB1과 CNTN4 domain sample 간의 결합능을 확인한 결과를 나타낸다.
도 15는 CNTN4의 Domain 8 (FN2 domain)의 아미노산 서열을 나타낸다.
도 16은 CNTN4에 대해 항-CNTN4 항체 AB1이 APP와 경쟁적으로 결합함을 나타낸다.
이하 본 발명을 실시예에 의해 보다 상세하게 설명한다. 그러나 이들 실시예는 본 발명을 예시적으로 설명하기 위한 것으로, 본 발명의 범위가 이들 실시예에 의해 제한되는 것은 아니다.
실시예 1. T 세포의 증식 및 활성 억제능
본 실시예에서는 CNTN4가 T 세포의 증식 및 활성을 저해하여 암세포로 하여금 T-세포 매개 면역시스템을 회피하도록 하는지 여부를 확인하고자 하였다.
1.1. CD4+ T 세포 및 CD8+ T 세포 준비
인간 혈액을 EDTA(또는 헤파린)로 코팅된 10mL 튜브에 넣고 1:1의 비율로 PBS와 혼합하였다. 그리고 나서 50mL 튜브에 Ficoll-Paque PLUS를 넣고, 상기 혈액 시료를 첨가하였다. 원심분리한 후, 인간 PBMC(peripheral blood mononuclear cell)를 수거하였다. 수거된 결과물을 원심분리하고 상층액을 제거하였다. 이어서, RBC lysis (1x)을 첨가하고, 피펫팅한 후 아이스에서 3분 동안 보관하였다. 이어서, 10% FBS RPMI1640 50ml를 첨가하고, 혼합물을 원심분리하여 상층액을 제거하였다. 그리고 나서, FACS 버퍼를 첨가하고 상층액을 원심분리에 의해 제거하였다. 그 후, 50ml의 MACS 버퍼(0.5% BSA 및 2mM EDTA 포함 PBS)를 첨가하고, 세포 수를 카운팅하고, 원심분리에 의해 상층액을 제거하였다.
CD4+ T 세포 및 CD8+ T 세포를 1x107 세포 수 기준 40μl MACS 버퍼를 이용하여 재현탁시키고, 튜브에 항 CD4 및 항 CD8 바이오틴 항체를 각각 10μl 넣은 후 5분 동안 냉장고에 보관하였다. 그 후, 1x107 세포 수 기준 MACS 버퍼 30μl를 상기 생성물에 첨가하고, 항-바이오틴 마이크로비드 20μl를 첨가하여 혼합하였다. 이어서, LS 컬럼을 이용하여 CD4+ T 세포 및 CD8+ T 세포를 분리하고 세포 수를 카운팅하였다.
이와 같이 준비된 CD4+ T 세포 및 CD8+ T 세포를 2x106 세포 수 기준 CFSE(Carboxyfluorescein succinimidyl ester) 1μl와 혼합하고, 37℃에서 3분 동안 보관하였다. 그리고 나서 CD4+ T 세포와 CD8+ T 세포를 각각 함유하고 있는 튜브에 FBS를 첨가하고, 10분 동안 아이스에서 보관하였다. 그 후, 원심분리에 의해 상층액을 제거하였다. 생성물에 FACS 버퍼 30ml를 첨가한 후 피펫팅하고, 원심분리하여 상층액을 제거하였다. 그리고 나서 10% FBS RPMI1640을 첨가한 후 피펫팅하고, 원심분리하여 상층을 제거하였다. 그 후, 생성물을 10% FBS RPMI1640 10ml와 혼합한 후, 세포 수를 카운팅하였다.
1.2. CNTN4에 의한 T 세포의 활성 저해 측정
재조합 인간 IgG1 Fc protein (Cat. No. 110-HG) 및 재조합 인간 PD-L1/B7-H1 Fc chimera protein (Cat. No. 156-B7)을 R&D systems에서 구입하였다. 또한, 재조합 인간 CNTN4 His Tag protein (Cat: 2205-CN)을 R&D systems에서 구입하였다.
이들 protein 각각 7.5μg/ml 또는 10μg/ml를 PBS 중 anti-CD3 항체 (BioLegend, Cat. No. 317325) 2.5μg/ml와 혼합하였다. 생성된 혼합물로 96-웰 플레이트를 4℃에서 코팅하고 PBS로 3회 세척하였다.
앞서 실시예 1.1.에서 준비한 CD4+ T 세포와 CD8+ T 세포를 96-웰 플레이트의 웰마다 200μl씩 2x106개 첨가하고 인큐베이션하였다.
CD4+ T 세포 및 CD8+ T 세포는 anti-CD3 항체에 의해 72시간 동안 활성화시켰다. CD4+ T 세포 및 CD8+ T 세포의 증식은 CFSE 염색의 정도에 의해 확인할 수 있으며, 이는 FACSDiVa 소프트웨어 (BD Biosciences)를 이용하여 플로우 사이토메트리에 의해 분석하였다.
1.3. CNTN4에 의한 T 세포의 활성 저해 결과
CD4+ T 세포 및 CD8+ T 세포의 증식율(%)을 각각 도 1 및 2에 나타내었다.
PD-L1로 처리한 대조군은 IgG1로 처리한 대조군에 비해 CD4+ T 세포 및 CD8+ T 세포의 증식이 모두 억제되었다.
CNTN4로 처리한 군은 IgG1로 처리한 대조군에 대비하여 CD4+ T 세포 및 CD8+ T 세포의 증식이 현저하게 억제되었으며, PD-L1로 처리한 대조군에 대비하여 CD4+ T 세포 및 CD8+ T 세포의 증식 억제 수준이 유사하였다.
이는 CNTN4를 블로킹하거나 넉다운시킴으로써 중화시킨다면 CNTN4의 T 세포 증식 억제능을 저하시킬 수 있다는 것을 의미한다. 그 결과, 효율적인 암 치료가 가능해진다.
실시예 2. PBMC 세포독성 어세이
본 실시예에서는 CNTN4를 CNTN4 억제제를 이용하여 중화시켰을 때 PBMC의 암세포에 대한 세포독성, 즉 살상능을 증가시킬 수 있는지 여부를 확인하고자 하였다.
2.1. PBMC 준비
인간 혈액을 EDTA(또는 헤파린)로 코팅된 10mL 튜브에 넣고 1:1의 비율로 PBS와 혼합하였다. 그리고 나서 50mL 튜브에 Ficoll-Paque PLUS를 넣고, 상기 혈액 시료를 첨가하였다. 원심분리한 후, 인간 PBMC(peripheral blood mononuclear cell)를 수거하였다. 수거된 결과물을 원심분리하고 상층액을 제거하였다. 이어서, RBC lysis (1x)을 첨가하고, 피펫팅한 후 아이스에서 3분 동안 보관하였다. 이어서, 10% FBS RPMI1640 50ml를 첨가하고, 혼합물을 원심분리하여 상층액을 제거하였다. 그리고나서, FACS 버퍼를 첨가하고 상층액을 원심분리에 의해 제거하였다. 그 후, 50ml의 MACS 버퍼(0.5% BSA 및 2mM EDTA 포함 PBS)를 첨가하고, 세포 수를 카운팅하고, 원심분리에 의해 상층액을 제거하였다.
96-웰 플레이트를 4℃에서 PBS 중 anti-CD3 항체(BioLegend, Cat. No. 317325) 1.0μg/ml으로 코팅하였다. 96-웰 플레이트의 웰은 PBMC를 첨가하기 전에 PBS로 3회 세척하였다. 앞서 수득한 PBMC를 10% FBS RPMI1640과 혼합하고, 96-웰 플레이트의 각 웰마다 6x105 개를 100μl씩 첨가하였다. PBMC는 72시간 동안 anti-CD3 항체에 의해 활성화시켰다.
2.2. 암세포 준비
폐암세포주 A549, 결장암세포주 HCT-116, 유방암세포주 MDA-MB-231, 위암세포주 MKN-74, 및 백혈병세포주 U937을 각각 1μl의 CFSE (carboxyfluorescein succinimidyl ester)와 혼합하고, 37℃에서 3분 동안 보관하였다. 그 후, 각각의 세포주를 함유한 튜브에 FBS를 첨가하고, 10분 동안 ice에서 보관하였다. 이어서, 상층액을 원심분리에 의해 제거하였다. 이에 따라 수득된 생성물에 FACS 버퍼 30ml를 첨가한 후 피펫팅하고, 원심분리하여 상층액을 제거하였다. 그리고 나서 10% FBS RPMI1640을 첨가한 후 피펫팅하고, 원심분리하여 상층액을 제거하였다. 이에 따라 수득된 생성물을 10% FBS RPMI1640 10ml와 혼합한 후, 세포 수를 카운팅하였다.
상기 암세포를 앞서 실시예 2.1.에서 준비한 96-웰 플레이트의 PBMC 함유 웰마다 100μl씩 3x104개 첨가하고 인큐베이션하였다.
2.3. 암세포주에 대한 PBMC의 세포독성 측정
앞서 실시예 2.2에서 PBMC 및 암세포주의 혼합물이 준비되었다. 이들 혼합물을 10μg/mL의 anti-human CNTN4 항체 또는 또는 50nM의 CNTN4 siRNA와 함께 24시간 동안 인큐베이션하였다.
CNTN4를 블로킹하기 위해 5종의 중화 항체를 사용한 실험군과 무처리 대조군은 하기 표 1에 나타내었으며, CNTN4를 넉다운하기 위해 3종의 siRNA를 사용한 실험군과 무처리 대조군은 하기 표 2에 나타내었다.
human CNTN4 중화 항체
대조군 무처리
실험군 1 anti-human CNTN4 항체 (R&D사, MAB2205)
실험군 2 anti-human CNTN4 항체 (abcam사, ab137107)
실험군 3 anti-human CNTN4 항체 (abcam사, ab131285)
실험군 4 anti-human CNTN4 항체 (LSbio사, LS-C119876)
실험군 5 anti-human CNTN4 항체 (Abnova사, PAB27653)
human CNTN4 siRNA
대조군 무처리
실험군 6 Sense (5'-CAGUAUCUUUGCCAGAAGUtt-3') (서열번호 1)
Antisense (5'-ACUUCUGGCAAAGAUACUGtt-3') (서열번호 2)
실험군 7 Sense (5'-GAUAAUGAGUCGGAAGUAAtt-3') (서열번호 3)
Antisense (5’-UUACUUCCGACUCAUUAUCtt-3') (서열번호 4)
실험군 8 Sense (5'-GUGACAAUAGACGAAAUCAtt-3') (서열번호 5)
Antisense (5'-UGAUUUCGUCUAUUGUCACtt-3') (서열번호 6)
PBMC 및 세포주의 혼합물과 항체 또는 siRNA를 함께 인큐베이션하고, 24시간 후에 용균된 세포를 확인하기 위하여 7-아미노액티노마이신 D(7-AAD; BD Pharmingen, San Diego, CA, USA)로 세포를 염색하였다. FACSDiVa 소프트웨어(BD Biosciences)를 이용하여 FL-1(CFSE) 및 FL-3(7-AAD)에 대한 염색을 측정함으로써 암세포주에 대한 PBMC의 세포용해능을 확인하였다.
2.4. 결과
폐암세포주 A549에 대해 CNTN4 중화 항체 또는 siRNA로 처리하였을 때의 결과를 도 3a 내지 3d에 나타내었다.
폐암세포주 A549와 PBMC를 CNTN4 중화 항체로 처리하였을 때, 항체의 종류에 따라 정도의 차이는 있으나 무처리 대조군에 비해 폐암세포 살상능이 유의적으로 증가되었음을 확인할 수 있다. 또한, 폐암세포주를 CNTN4 siRNA로 처리한 경우에도 폐암세포 살상능이 유의적으로 증가되었음이 확인되었다.
또한, CNTN4 중화 항체 또는 siRNA로 처리하였을 때, 결장암세포주 HCT-116에 대한 실험결과를 도 4a 내지 4d에 나타내고, 유방암세포주 MDA-MB-231에 대한 실험결과를 도 5a 내지 5d에 나타내고, 위암세포주 MKN-74에 대한 실험결과를 도 6a 내지 6d에 나타내고, 백혈병세포주 U937에 대한 실험결과를 도 7a 내지 7d에 나타내었다.
항체 또는 siRNA를 이용하여 CNTN4를 중화시켰을 때 PBMC의 살상능이 증가되는 결과는 도 3a 내지 7d에서 볼 수 있듯이 결장암, 유방암, 위암, 백혈병에서도 마찬가지로 확인되었다.
실시예 3. 종양 마우스 모델 실험
본 실시예에서는 CNTN4를 CNTN4 억제제를 이용하여 중화시켰을 때 마우스 종양의 성장이 억제되는지 여부를 인비보에서 확인하고자 하였다.
3.1. 종양 마우스 모델 구축
C57BL6 결장 선암종 세포에서 유래된 MC38 세포주를 50μl PBS 중에 2.0x105 세포수 농도로 재현탁시키고, 6주령 암컷 C57BL6 마우스의 옆구리에 피하 주사하였다.
하기 표 3에 CNTN4를 넉다운하기 위해 siRNA를 사용한 실험군과 무처리 대조군을 나타내었다.
mouse CNTN4 siRNA
대조군 무처리
실험군 9 Sense (5'-GUGUAGACAAACUCUCUGU-3') (서열번호 7)
Antisense (5'-ACAGAGAGUUUGUCUACAC-3') (서열번호 8)
모든 실험군은 MC38 세포주를 주사한지 11일째 되는 날부터 마우스 CNTN4를 타겟하는 siRNA를 5일 간격으로 총 3회 마우스의 종양에 주사하였다. 구체적으로, siRNA 10 μg을 PBS 중 올리고펙타민(Invitrogen사) 7.5 μl 와 제조사 지시에 따라 혼합한 후, 마우스에 유도한 종양 조직에 직접 0.5 mg/kg의 투여량으로 주사하였다.
3.2. 결과
무처리 대조군과 CNTN4가 넉다운된 실험군 9에서 마우스의 종양 크기를 측정한 결과를 도 8에 나타내었다.
무처리 대조군은 마우스에서 종양이 생성된 이후 지속적으로 성장하는 것을 확인할 수 있었다. 반면, CNTN4가 넉다운된 마우스의 종양은 무처리 대조군에 비해 그 성장속도가 현저하게 억제됨을 알 수 있다. 이는 CNTN4를 블로킹 또는 넉다운시켜 그 활성 또는 발현을 억제할 경우 암의 발달이 지연 또는 중지되고 암의 발생이 억제된다는 것을 보여주는 것이다. 따라서, CNTN4 억제제는 암을 예방하기 위하여 유용하게 사용될 수 있다.
실시예 4. CNTN4와 APP의 결합 부위 확인
본 실시예에서는 CNTN4와 그의 수용체인 APP의 결합 부위를 확인하고자 하였다.
4.1. Overexpression cell 준비 (Transient transfection)
Culture dish plate에 HEK293FT cell을 3 x 106 cell로 도포하였다. 24시간 뒤, jetPRIME transfection buffer 200 μL; CNTN4 발현 플라스미드 10μg 또는 APP 발현 플라스미드 10μg; 및 RIME transfection reagent 20μL을 각각 혼합시키고 10분간 room temperature (RT)에서 인큐베이션한 뒤, 각 혼합물을 상기 세포에 첨가하여 HEK293FT 세포를 각 플라스미드로 형질감염시켰다.
이 때 CNTN4 발현 플라스미드로는 총 4개의 플라스미드를 제작하여 사용하였다. CNTN4는 총 10개의 도메인(즉, Ig1 내지 Ig6 및 FN1 내지 FN4)로 이루어져 있는데, 각 플라스미드에서는 Ig1~Ig4, Ig1~Ig6, Ig1~FN2, Ig1~FN4를 발현시켰다(Ig; Ig like domain, FN; fibronection). 그리고 각 플라스미드로 발현된 결실구조를 #4, #6, #8, #10으로 명명하였다(도 9a).
APP 발현 플라스미드로는 총 3개의 플라스미드를 제작하여 사용하였다. 각 플라스미드에서는 APP의 3가지 isoform을 각각 발현시켰고, 이를 각각 770, 751, 695로 명명하였다. 그 중 770 및 751 isoform은 KPI (kunitz-type protease inhibitor) domain을 보유하고 있으며, 695 isoform은 KPI domain을 보유하고 있지 않다(도 9b).
4.2. Immunoprecipitation (IP)
4.2.1. Protein to protein interaction
위 4.1.에서 형질감염된 총 7개 세트의 세포 각각을 1,200 rpm, 3 min, 4℃ centrifuge를 진행하여 침전시키고 상층액을 제거하고 1 x lysis buffer로 cell pellet을 풀어준 뒤, 4℃에서 10 min 반응시키고 13,000 rpm, 10 min, 4℃ centrifuge를 다시 진행하여 cell lysate를 얻었다.
새로운 1.5 mL tube에 cell lysate sample 6μL와 UltraPure distilled water 24μL를 혼합시켜 sample을 1/5로 희석하고, 별도로 2 mg/mL standard BSA를 UltraPure distilled water로 1/2씩 serial dilution하여 준비하였다(즉, 2, 1, 0.5, 0.25, 0.125, 0.0625, 0.031, 0 mg/mL). Non-coated 96 well plate에 희석된 각 sample과 standard BSA를 각각 10μL씩 duplication으로 넣고, BCA assay kit에 들어있는 reagent A와 reagent B를 50:1 비율로 섞어서 각 well에 200μL씩 처리하고 37℃에서 30 min 동안 반응시켰다. SpectraMax M2 Microplate Readers 기기를 이용하여 단백질의 농도를 구하였다.
이어서 CNTN4 #10과 APP 770, 751, 695를 반응시켜 CNTN4-APP 단백질 복합체의 생성 여부를 확인하고자 하였고, APP 770과, CNTN4 #4, #6, #8, #10을 반응시켜 단백질 복합체 생성 여부를 확인하고자 하였다.
각 total cell lysate의 100μg protein, 500μL PBS, 및 2mg IP Ab (anti-CNTN4 항체 또는 anti-APP 항체)를 혼합시킨 후 4℃에서 밤새(O/N) rotation시켰다.
이어서 50% protein A/G agarose bead를 30 mL 첨가한 뒤 실온(RT)에서 2h동안 rotation시켰다. 이어서 4,000 rpm, 4 min, 4℃ centrifuge후 상층액을 제거하고 PBS 1mL 추가한 뒤 RT에서 10 min 동안 rotation시켰고, 이 과정은 총 3번 반복하였다. 4,000 rpm, 4 min, 4℃ centrifuge 후 상층액을 제거하고 sample buffer와 reducing agent를 미리 섞어 1x sample buffer를 만든 것을 20mL 넣어주고 95℃ heat block에서 10 min 동안 반응시켰다. Ice에서 5 min 동안 반응시키고 spin down하였다(IP sample).
Total 20 mg의 cell lysate에 sample buffer와 reducing agent를 넣어 20 mL로 만들어 주고, 95℃ heat block에서 10 min 동안 반응시켰다. Ice에서 5 min 반응시키고 spin down하였다(Input sample).
4.2.2. SDS-PAGE 및 western blotting
NuPAGE 4-12% Bis-Tris gel을, NuPAGE® 전기영동 시스템과 조합하여 사용하였다. Gel을 챔버에 고정시키고, gel cassette와 electrode assembly 사이에 MES running buffer을 충전시켰다. 마커 5mL와 sample (각 well당 20mL)을 loading하고 제조사 매뉴얼에 따라 전기영동시켰다.
Transfer가 끝난 membrane을 3% BSA blocking buffer로 RT에서 60 min 동안blocking하였다. Blocking후 PBST로 3번 washing하고 1차 항체를 0.3% BSA blocking buffer에 희석 (1:1,000)하여 처리 후, 4℃ 냉장고에서 밤새 두었다. PBST로 3번 washing하고 2차 항체를 0.3% BSA blocking buffer에 희석 (1:5,000)하고 처리 후 RT에서 60 min 동안 반응시켰다. PBST로 3번 washing하였다.
SuperSignal™ West Pico PLUS Chemiluminescent Substrate 제품의 Luminol/Enhancer solution과 peroxide solution을 각각 500mL씩 1.5mL 튜브에 섞어주고 membrane에 뿌려준 뒤 LOURMAT CHEMI-DOC을 이용하여 촬영하였다.
그 결과를 도 10에 나타내었다.
CNTN4 #10 (full length)은 KPI (kunitz-type protease inhibitor) domain을 가지고 있는 APP (770 & 751)과 결합하고(도 10a), APP 770 (full length)는 FN1 ~ FN2 domain (domain 7 ~ domain 8)을 가지고 있는 CNTN4 (#8 & #10)와 결합함을 확인할 수 있었다(도 10b). 이로부터 CNTN4가 결합하는 APP 부위는 KPI 도메인이며, 이에 상응하는 CNTN4 결합 부위는 FN1 ~ FN2 domain (domain 7 ~ domain 8)임을 확인하였다. 각 도메인의 서열을 표 4 및 도 11에 나타내었다.
서열번호 9 FN1 ~ FN2 domain PPEAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPFSVGWQAVSTVPELIDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTPANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFRPYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVFNNKGEGPFSPTTVVYSAEE
서열번호 10 KPI domain RAMISRWYFDVTEGK
실시예 5. 항-CNTN4 항체(AB1)을 이용한 CNTN4의 항체결합 부위 확인
본 실시예에서는 항-CNTN4 항체(AB1)과 CNTN4 domain간의 결합을 확인하여 CNTN4의 항체결합 부위를 확인하고자 하였다.
5.1. 항-CNTN4 항체 AB1의 제조
5.1.1. scFv 항체 라이브러리 제작 및 선별
Chicken 15마리에 mouse CNTN4 및/또는 human CNTN4를 접종하여 항체를 생성시켰다. ELISA를 통해 항체 생성이 확인된 총 4마리를 선정하였다. 이들을 sacrifice후 blood, spleen, bone marrow, bursa fabricius를 적출하고, total RNA를 추출하고, cDNA를 합성하고, PCR을 통해 항체의 경쇄 및 중쇄의 가변영역 부분과 이를 linker로 연결한 scFv fragment를 확보하였다. 그 후 phage display를 진행하였다. Phase ELISA screening을 통해 CNTN4에 결합하는 positive clone을 selection 하고, 이에 해당하는 scFv sequence를 선별하였다(scFv AB1). 이를 fusion protein형태인 constant human kappa (hCk)로 표지된 scFv로 제조하고 발현시켜, CNTN4에 대한 결합능을 확인하였다. 위 선별된 scFv AB1의 경쇄 및 중쇄 가변 영역의 아미노산 서열을 표 5 및 도 12에 나타내었다.
서열번호 11 경쇄 가변 영역(VL) ALTQPSSVSANLGETVKITCSGSSGSYGWYQQKSPGSAPVTLIYDNTNRPSDIPSRFSGSGSGSTGTLTITGVRAEDEAVYYCGGYDGSTDVFGAGTTLTVL
서열번호 12 중쇄 가변 영역(VH) AVTLDESEGGLQTPGGALSLVCKASGFTFSSFNMFWVRQAPGKGLEYVAEISGGGGSTWYAPAVKGRATISRDNGQSTVRLQLNNLRAEDTGTYYCAKSADTWSYGAATIDAWGHGTEVIVSS
5.1.2. anti-CNTN4 chicken-human chimeric IgG4 항체 AB1 제조
5.1.1.에서 선별된 scFv의 경쇄와 중쇄 영역을 bicistronic expression vector에 cloning하였다. DNA를 Expi293F cell에 transient transfection하여 viability 50%까지 배양하여 IgG 발현을 진행하였고, 배양액을 Kappa select resin (kappa region capture)에 결합시켜 IgG를 elution하여 1차 정제하였다. 이 후 경쇄 불순물 제거를 위하여 Mabselect (Fc region capture)에 결합시키고 IgG를 elution하여 2차 정제를 하여 SEC-HPLC상 순도 72.4%의 anti-CNTN4 129 chimeric IgG4 항체(이하 "AB1"로 지칭함)를 제조하였다.
5.2 CNTN4의 항체결합부위 확인
5.2.1. Human CNTN4 domain sample 제조
도 13에 따라 Human CNTN4 domain sample을 제조하였다. CNTN4는 총 10개의 도메인(즉, Ig1 내지 Ig6 및 FN1 내지 FN4; 도 13에서는 각각 Domain 1 내지 10으로 나타냄)으로 이루어지며, Full은 총 10개의 도메인이 모두 포함된 sample을 나타낸다. D1-9는 Full에서 10번 도메인이 삭제된 sample이며, D1-8은 D1-9에서 9번 도메인이 삭제된 sample이다. 동일한 방식으로 D1-4 내지 D1-7의 domain sample을 제조하였다.
Full domain의 농도 4μg/mL을 기준으로 설정하였고, 이와 동일한 몰농도를 적용하기 위해 분자량 비율에 따라 각 domain의 concentration을 결정하였다(표 6).
Domain Number Full 1-4 1-5 1-6 1-7 1-8 1-9
Concentration
(μg/mL) 		4 1.6 2.0 2.3 2.8 3.2 3.6
Molecular Weight (kDa) 111.08 44.43 54.48 64.83 76.83 87.93 99.03
5.2.2. 항체 AB1와 CNTN4 domain sample의 결합
96-well plate에 5.2.1.에서 제조한 CNTN4 domain을 50μL/well씩 분주하였다. Sealing tape로 sealing 후 4℃에서 overnight incubation하였다. 다음날 sealing tape 제거하고 buffer를 제거하였다. Blocking buffer를 각 well에 150μL씩 분주하고 sealing한 뒤, 37℃에서 1시간 동안 incubation 하였다.
그 후 blocking buffer를 제거하고 표 13에 따라 Blocking buffer로 희석된 각 primary antibody (항체 AB1)를 각 well에 50μL 분주하였다. Sealing tape로 sealing하고 37℃에서 2시간 동안 incubation하였다. Sealing tape 제거 후 3번 wash를 진행하였다.
Tube Number 1 2 3 4 5 6 7 8 9
Conc. (nM) 2.5 0.625 0.156 0.0391 0.00977 0.00244 0.00061 0.000153 0.00004
희석된 secondary antibody(Anti-human IgG Fc-HRP)를 각 well에 50μL씩 분주하였다. Sealing tape로 sealing하고, 37℃에서 1시간 incubation 하였다. Sealing tape 제거 후 3번 wash를 진행하였다. ABTs를 각 well에 50μL 분주하고, 상온에서 30분 incubation한 후, Microplate reader를 이용하여 405nm에서의 absorbance를 측정하였다. 그 결과를 표 8 및 도 14에 나타내었다.
Domain Full 1-4 1-5 1-6 1-7 1-8 1-9
Binding + - - - - + +
항-CNTN4 항체 AB1은 총 7개의 Human CNTN4 domain sample 중 D1-8, D1-9, Full에 대해서만 결합하였고(도 14에서 3개의 그래프가 서로 중첩됨), D1-4 내지 D1-7에 대해서는 결합하지 않았다(약 항체 농도 0.0001 내지 0.01nM에서의 D1-6을 제외하고는, 4개의 그래프가 서로 중첩됨). D1-7과 D1-8은 Domain 8의 유무에 차이가 있음을 고려할 때, Domain 8(즉, FN2)가 CNTN4와 항-CNTN4 항체의 결합에 중요한 binding site임을 알 수 있다. CNTN4의 Domain 8의 아미노산 서열은 표 9 및 도 15에 나타내었다.
서열번호 13 Domain 8
(FN2 Domain)		 TPANVSGGGGSKSELVITWETVPEELQNGRGFGYVVAFRPYGKMIWMLTVLASADASRYVFRNESVHPFSPFEVKVGVFNNKGEGPFSPTTVVYSAEE
실시예 6. CNTN4에 대한 APP와 항체 AB1간의 경쟁적 결합 확인
본 실시예에서는 항-CNTN4 항체 AB1에 의해 APP와 CNTN4의 결합이 차단되는지 여부를 확인하고자 하였다.
우선 CNTN4를 4mg/mL을 플레이트에 코팅하였다. APP (his tagged, 0.64mg/mL)를 ELISA buffer를 이용하여 40mg/mL로 희석하였다. 별도로, 항-CNTN4 항체 AB1 (4.98mg/mL; 35mM)을 ELISA buffer를 이용하여 1 내지 0mM로 1/10씩 serial dilution하였다. 희석된 APP 및 AB1 항체를 각각 CNTN4로 코팅된 96-well half plate에 25mL/well로 처리하고 4시간 동안 상온에서 반응시킨 뒤(duplicate로 진행), washing하였다. Anti-his tag을 ELISA buffer에 1:2,000으로 희석하고 50mL/well로 처리하고 1시간 동안 상온에서 incubation한 뒤, washing하였다. 이어서 ABTS를 50mL/well 처리한 후, plate reader를 이용하여 405 nm에서 흡광도를 측정하였다.
그 결과를 도 16에 나타내었다.
CNTN4를 4mg/mL로 plate를 coating한 조건에서 APP 40mg/mL과 항체 AB1를 다양한 농도로 처리를 했을 경우에 AB1의 농도 증가에 의해 흡광도가 감소하는 것을 확인하였다. 이는 CNTN4에 대해 항체 AB1이 APP와 경쟁적으로 결합하여 APP의 CNTN4에 대한 결합을 차단함을 나타내는 것이다.

Claims (13)

  1. CNTN4 억제제를 포함하는 암 치료 또는 예방용 약학적 조성물로서,
    상기 CNTN4 억제제는 CNTN4 유전자의 DNA 또는 mRNA에 상보적으로 결합하는 안티센스 핵산, siRNA, shRNA, miRNA 또는 리보자임; 또는 CNTN4 단백질에 특이적으로 결합하는 화합물, 펩티드, 펩티드 미메틱스, 융합 단백질, 항체 또는 그의 항원 결합 단편, 항체약물복합체(ADC, Antibody Drug Conjugate) 또는 앱타머인, 약학적 조성물.
  2. 제1항에 있어서,
    상기 암은 위암, 폐암, 간암, 대장암, 결장암, 소장암, 췌장암, 뇌암, 뼈암, 흑색종, 유방암, 경화성선증, 자궁암, 자궁경부암, 두경부암, 식도암, 갑상선암, 부갑상선암, 신장암, 육종, 전립선암, 요도암, 방광암, 혈액암, 림프종, 또는 섬유선종인, 약학적 조성물.
  3. 제1항에 있어서,
    상기 CNTN4 억제제는 암세포의 T 세포 회피 기능을 억제하는 것인, 약학적 조성물.
  4. CNTN4 억제제를 포함하는 개체 내 T-세포 매개성 면역반응의 수준 증대에 의한 면역증강용 약학적 조성물로서,
    상기 CNTN4 억제제는 CNTN4 유전자의 DNA 또는 mRNA에 상보적으로 결합하는 안티센스 핵산, siRNA, shRNA, miRNA 또는 리보자임; 또는 CNTN4 단백질에 특이적으로 결합하는 화합물, 펩티드, 펩티드 미메틱스, 융합 단백질, 항체 또는 그의 항원 결합 단편, 항체약물복합체(ADC, Antibody Drug Conjugate) 또는 앱타머인, 약학적 조성물.
  5. 제4항에 있어서,
    면역결핍, 면역저하 또는 면역계 손상으로 인한 질환의 예방, 치료 또는 개선을 필요로 하는 개체에게 사용하는 것인, 약학적 조성물.
  6. 하기를 포함하는 항암제 스크리닝 방법:
    a) 항암제 후보 물질과 암세포를 접촉시키는 단계; 및
    b) 암세포 내 CNTN4의 발현 또는 활성을 측정하는 단계.
  7. 제6항에 있어서,
    상기 CNTN4의 발현 또는 활성 측정은 CNTN4의 mRNA 또는 단백질의 발현 수준 또는 CNTN4에 의한 T 세포 활성 억제 수준을 측정하는 것인, 항암제 스크리닝 방법.
  8. 제6항에 있어서,
    상기 항암제 후보 물질이 처리되지 않은 대조군에 비해 항암제 후보 물질이 처리된 군에서 CNTN4의 mRNA 또는 단백질의 발현 수준이 유의적으로 감소하거나 CNTN4의 T 세포 활성 억제 수준이 유의적으로 감소하는 경우 상기 항암제 후보 물질을 항암제라고 판단하는 단계를 더 포함하는 것인, 항암제 스크리닝 방법.
  9. CNTN4의 피브로넥틴 2 도메인에 결합하는, 항-CNTN4 항체 또는 그의 항원 결합 단편을 포함하는 암 치료 또는 예방용 약학적 조성물.
  10. 제9항에 있어서, 상기 피브로넥틴 2 도메인은 서열번호 13의 아미노산 서열을 포함하는 것인, 항-CNTN4 항체 또는 그의 항원 결합 단편을 포함하는 암 치료 또는 예방용 약학적 조성물.
  11. 제9항에 있어서, 상기 항체 또는 그의 항원 결합 단편은 APP(amyloid precursor protein)에 대한 CNTN4의 결합을 차단 또는 억제하는 것인, 항-CNTN4 항체 또는 그의 항원 결합 단편을 포함하는 암 치료 또는 예방용 약학적 조성물.
  12. CNTN4 억제제의 암 치료 또는 예방 용도로서, 상기 CNTN4 억제제는 CNTN4 유전자의 DNA 또는 mRNA에 상보적으로 결합하는 안티센스 핵산, siRNA, shRNA, miRNA 또는 리보자임; 또는 CNTN4 단백질에 특이적으로 결합하는 화합물, 펩티드, 펩티드 미메틱스, 융합 단백질, 항체 또는 그의 항원 결합 단편, 항체약물복합체(ADC, Antibody Drug Conjugate) 또는 앱타머인, 용도.
  13. CNTN4 억제제를 대상체에게 투여하는 단계를 포함하는 암 치료 또는 예방 방법으로서, 상기 CNTN4 억제제는 CNTN4 유전자의 DNA 또는 mRNA에 상보적으로 결합하는 안티센스 핵산, siRNA, shRNA, miRNA 또는 리보자임; 또는 CNTN4 단백질에 특이적으로 결합하는 화합물, 펩티드, 펩티드 미메틱스, 융합 단백질, 항체 또는 그의 항원 결합 단편, 항체약물복합체(ADC, Antibody Drug Conjugate) 또는 앱타머인, 방법.
PCT/KR2022/005073 2021-04-09 2022-04-07 항암 및 면역증강용 신규 타겟 WO2022216096A1 (ko)

Priority Applications (2)

Application Number Priority Date Filing Date Title
CN202280040188.5A CN117794571A (zh) 2021-04-09 2022-04-07 抗癌和免疫增强的新靶点
EP22785005.4A EP4321174A1 (en) 2021-04-09 2022-04-07 Novel target for anti-cancer effect and immunity enhancement

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR1020210046810A KR20220140378A (ko) 2021-04-09 2021-04-09 항암 및 면역증강용 신규 타겟
KR10-2021-0046810 2021-04-09

Publications (1)

Publication Number Publication Date
WO2022216096A1 true WO2022216096A1 (ko) 2022-10-13

Family

ID=83546543

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/005073 WO2022216096A1 (ko) 2021-04-09 2022-04-07 항암 및 면역증강용 신규 타겟

Country Status (4)

Country Link
EP (1) EP4321174A1 (ko)
KR (1) KR20220140378A (ko)
CN (1) CN117794571A (ko)
WO (1) WO2022216096A1 (ko)

Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013022872A1 (en) * 2011-08-10 2013-02-14 Celgene Corporation Gene methylation biomarkers and methods of use thereof
KR20190116930A (ko) * 2018-04-05 2019-10-15 주식회사 지놈앤컴퍼니 항암 및 면역증강용 신규 타겟
US20200263258A1 (en) * 2019-02-15 2020-08-20 Mayo Foundation For Medical Education And Research Assessing and treating mammals having polyps
US20210230256A1 (en) * 2018-04-05 2021-07-29 Genome And Company Novel target for anti-cancer and immune-enhancing

Patent Citations (4)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2013022872A1 (en) * 2011-08-10 2013-02-14 Celgene Corporation Gene methylation biomarkers and methods of use thereof
KR20190116930A (ko) * 2018-04-05 2019-10-15 주식회사 지놈앤컴퍼니 항암 및 면역증강용 신규 타겟
US20210230256A1 (en) * 2018-04-05 2021-07-29 Genome And Company Novel target for anti-cancer and immune-enhancing
US20200263258A1 (en) * 2019-02-15 2020-08-20 Mayo Foundation For Medical Education And Research Assessing and treating mammals having polyps

Non-Patent Citations (5)

* Cited by examiner, † Cited by third party
Title
"NCBI", Database accession no. NM_175607.3
"Remington's Pharmaceutical Science", 1975, MACK PUBLISHING COMPANY, article "Blaug, Seymour"
"Remington's Pharmaceutical Sciences", 1995, MACK PUBLISHING COMPANY
KIM, SANGPYO ET AL.: "MedPacto, Genome & Company, NKMAX and AACR Issue", KOSDAQ CORPORATE ANALYSIS REPORT (KIWOOM SECURITIES REPORT), KOREAN FINANCIAL INVESTMENT ASSOCIATION, KOREA, no. 1305, 12 March 2021 (2021-03-12), Korea, pages 1 - 5, XP009541963 *
LUCIE EVENEPOEL, ET AL.: "Expression of Contactin 4 Is Associated With Malignant Behavior in Pheochromocytomas and Paragangliomas", JOURNAL OF CLINICAL ENDOCRINOLOGY AND METABOLISM, THE ENDOCRINE SOCIETY, US, vol. 103, no. 1, 1 January 2018 (2018-01-01), US , pages 46 - 55, XP055642749, ISSN: 0021-972X, DOI: 10.1210/jc.2017-01314 *

Also Published As

Publication number Publication date
CN117794571A (zh) 2024-03-29
EP4321174A1 (en) 2024-02-14
KR20220140378A (ko) 2022-10-18

Similar Documents

Publication Publication Date Title
WO2020076105A1 (ko) 신규 항-c-kit 항체
WO2015005632A1 (ko) Dll4와 vegf에 특이적으로 결합하는 신규 이중표적 단백질 및 이의 용도
WO2015076621A1 (ko) 혈관 신생 억제 활성을 가지는 펩티드 및 이를 포함하는 조성물
WO2017022962A1 (ko) Ripk 억제제를 유효성분으로 포함하는 면역질환의 예방 또는 치료용 조성물
WO2019194586A1 (en) Novel target for anti-cancer and immune-enhancing
WO2010087594A9 (ko) 시디９３ 또는 이의 가용성 단편의 용도
WO2017010744A1 (ko) 엑소좀 단백질 ｅｉｆ3ａ 특이반응 오토항체검출용 항원 조성물 및 이를 이용한 간암진단법
WO2020005003A1 (ko) Lag-3에 특이적으로 결합하는 단클론항체 및 이의 용도
WO2021235696A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2023277361A1 (ko) 메소텔린 특이적 항체 및 이의 용도
WO2021158091A2 (ko) 케모카인 억제제, 콜로니 자극 인자 억제제 및 면역항암제를 포함하는 암의 예방 또는 치료용 조성물 및 병용 요법
WO2018186706A1 (ko) Nk 세포 활성화 융합 단백질, nk 세포 및 이들을 포함하는 약제학적 조성물
WO2022216096A1 (ko) 항암 및 면역증강용 신규 타겟
WO2017074013A1 (ko) 인간 및 마우스 sema3a에 교차결합하는 항체 및 그의 용도
US20210230256A1 (en) Novel target for anti-cancer and immune-enhancing
WO2022131889A1 (ko) Taci 단백질의 용도
WO2014021693A2 (ko) Tm4sf5 단백질에 특이적으로 결합하는 신규한 단일클론항체 및 이의 용도
WO2023022271A1 (ko) 항-igsf1 항체 및 이의 용도
WO2020197304A1 (ko) 테트라스파닌-2 억제제를 유효성분으로 포함하는 췌장암 예방, 개선 또는 치료용 조성물
WO2020117017A1 (ko) 항 c-met 아고니스트 항체 및 이의 용도
WO2019139429A1 (en) Novel use of kirrel2 and kirrel2 inhibitor
WO2024014619A1 (ko) 사스-코로나 바이러스 2 중화 항체
WO2021034098A1 (ko) 사람 표피성장인자수용체 2 양성 암을 치료하기 위한 인터페론-베타 또는 이의 변이체를 포함하는 면역사이토카인의 용도
WO2022124764A1 (ko) Cd47에 특이적인 항체 및 이의 용도
WO2023277281A1 (ko) Cd47에 특이적인 인간화 항체 및 이를 포함하는 cd47 관련 질환의 예방 또는 치료용 약학적 조성물

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22785005

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2022785005

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022785005

Country of ref document: EP

Effective date: 20231109

WWE Wipo information: entry into national phase

Ref document number: 202280040188.5

Country of ref document: CN