WO2023022271A1 - 항-igsf1 항체 및 이의 용도 - Google Patents

항-igsf1 항체 및 이의 용도 Download PDF

Info

Publication number
WO2023022271A1
WO2023022271A1 PCT/KR2021/011139 KR2021011139W WO2023022271A1 WO 2023022271 A1 WO2023022271 A1 WO 2023022271A1 KR 2021011139 W KR2021011139 W KR 2021011139W WO 2023022271 A1 WO2023022271 A1 WO 2023022271A1
Authority
WO
WIPO (PCT)
Prior art keywords
igsf1
cancer
antibody
seq
cells
Prior art date
Application number
PCT/KR2021/011139
Other languages
English (en)
French (fr)
Inventor
김성락
손혜진
이미소
김하나
이준형
신원화
Original Assignee
웰마커바이오 주식회사
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 웰마커바이오 주식회사 filed Critical 웰마커바이오 주식회사
Priority to CA3177927A priority Critical patent/CA3177927A1/en
Priority to CN202180048750.4A priority patent/CN116635418A/zh
Priority to AU2021437023A priority patent/AU2021437023A1/en
Priority to BR112022021592A priority patent/BR112022021592A2/pt
Priority to PCT/KR2021/011139 priority patent/WO2023022271A1/ko
Priority to KR1020237005825A priority patent/KR20240046103A/ko
Publication of WO2023022271A1 publication Critical patent/WO2023022271A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants

Definitions

  • the present invention relates to a "novel” antibody that specifically binds to "IGSF1" and a “pharmaceutical” composition for "prevention” or “treatment of cancer” containing the same as an active ingredient.
  • Chemotherapy methods such as anticancer drugs in the treatment of cancer have been effective to some extent, but many studies are required due to various pathogenesis of cancer and resistance to anticancer drugs. Although the cancer cure rate has improved with the development of diagnosis and treatment technology in recent decades, the 5-year survival rate for many advanced cancers remains at 5 to 50%. In addition, for some cancers, despite various studies and treatments, survival rates for the past 20 years have not changed significantly.
  • Korean Publication No. 2016-0014564 discloses that the immunoglobulin superfamily member 1 (IGSF1) gene can be used as a biomarker for predicting sensitivity to mesenchymal-epithelial transition factor (MET) inhibitors.
  • IGSF1 immunoglobulin superfamily member 1
  • MET mesenchymal-epithelial transition factor
  • the present inventors have developed an antibody that specifically binds to the C-terminus of IGSF1 as a result of research to develop an anticancer agent with high therapeutic effect, in particular, a therapeutic agent for effectively treating cancer in which IGSF1 is overexpressed. It was confirmed that the antibody effectively prevents or treats cancer.
  • one aspect of the present invention provides an anti-cancer agent comprising an anti-IGSF1 antibody that specifically binds to the C-terminus of IGSF1 as an active ingredient.
  • a heavy chain variable region comprising H-CDR1 of SEQ ID NO: 1, H-CDR2 of SEQ ID NO: 2 and H-CDR3 of SEQ ID NO: 3; and L-CDR1 of SEQ ID NO: 4, L-CDR2 of SEQ ID NO: 5, and L-CDR3 of SEQ ID NO: 6, and an antibody or fragment thereof specific to IGSF1 comprising a light chain variable region.
  • Another aspect of the present invention provides a polynucleotide encoding the IGSF1-specific antibody or fragment thereof, an expression vector containing the polynucleotide, and a transformed cell into which the expression vector is introduced.
  • Another aspect of the present invention culturing the transformed cells; And it provides a method for producing an antibody or fragment thereof specific to IGSF1 comprising recovering the anti-IGSF1 antibody or fragment thereof.
  • Another aspect of the present invention provides a pharmaceutical composition for preventing or treating cancer comprising the IGSF1-specific antibody or fragment thereof as an active ingredient.
  • Another aspect of the present invention provides a method for preventing or treating cancer comprising administering the IGSF1-specific antibody or fragment thereof to a subject.
  • the anti-IGSF1 antibody according to the present invention showed high specificity and high binding ability to IGSF1.
  • the anti-IGSF1 antibody according to the present invention increased the infiltration of immune cells into the spheroids when IGSF1-overexpressing lung cancer cell spheroids and human peripheral mononuclear cells were co-cultured.
  • the anti-IGSF1 antibody according to the present invention inhibited tumor growth in humanized mice transplanted with IGSF1-overexpressing human lung cancer cells.
  • the antibody increased the expression of cytokines in cytotoxic T lymphocytes present in tumor tissues.
  • the anti-IGSF1 antibody can inhibit tumor growth by increasing the infiltration and immune response of immune cells into the tumor tissue in which IGSF1 expression is increased. Therefore, the anti-IGSF1 antibody can be used as an anticancer agent that effectively treats cancer in which IGSF1 is overexpressed.
  • FIG. 1 is a diagram confirming the expression level of IGSF1 in IGSF1 overexpressing human lung cancer cells (NCI-H292 IGSF1 O/E) and a control group (NCI-H292 MOCK) through Western blotting and RT-PCR.
  • Figure 2 is co-culture of IGSF1 overexpressing human lung cancer cells (NCI-H292 IGSF1 O / E) and control (NCI-H292 MOCK) spheroids and human peripheral mononuclear cells (PBMC), tumor infiltrating lymphocytes (TIL) present in spheroids ) is a confirmed drawing.
  • NCI-H292 IGSF1 O / E human lung cancer cells
  • NCI-H292 MOCK human peripheral mononuclear cells
  • TIL tumor infiltrating lymphocytes
  • Figure 3 shows the degree of distribution of hCD45+ cells by flow cytometry to confirm the presence of tumor-infiltrating lymphocytes in the tumor tissues of mice transplanted with IGSF1 overexpressing human lung cancer cells (NCI-H292 IGSF1 O/E) or a control group (NCI-H292 MOCK). It is a graph showing the result of analysis through analysis.
  • Figure 4 shows the expression of IGSF1 and the presence of tumor-infiltrating lymphocytes in tumor tissues of mice transplanted with IGSF1 overexpressing human lung cancer cells (NCI-H292 IGSF1 O/E) or control (NCI-H292 MOCK) immunohistochemical staining (immunohistochemistry) It is a drawing showing the result confirmed by .
  • Figure 5 is a graph showing the results of analyzing the binding affinity of the WM-A1-3389 antibody to the IGSF1 antigen using ELISA.
  • Figure 6 is a graph showing the results of analyzing the binding affinity of the WM-A1-3389 antibody to the intracellular IGSF1 antigen using FACS analysis.
  • Figure 7 is a result of analyzing the binding force of the WM-A1-3389 antibody to IGSF1 expressed in cells in IGSF-overexpressing human lung cancer cells (NCI-H292 IGSF1 O/E) and a control group (NCI-H292 MOCK) using FACS analysis. is a graph showing
  • Figure 8 shows two types of IGSF1 overexpressing human lung cancer cells (NCI-H292 IGSF1 O/E and HEK293E IGSF1 O/E) and control groups (NCI-H292 MOCK and HEK293E MOCK) treated with shIGSF1 in IGSF1 knockdown (K/D) cell lines. It is a graph showing the results of analyzing the binding specificity of the WM-A1-3389 antibody.
  • TIL tumor-infiltrating lymphocytes present in spheroids after treatment with IgG or WM-A1-3389 antibody when IGSF1 overexpressing human lung cancer cell (NCI-H292 IGSF1 O/E) spheroids and human peripheral mononuclear cells (PBMC) are co-cultured (TIL) is a drawing confirmed through a microscope image.
  • IGSF1 overexpressing human lung cancer cell NCI-H292 IGSF1 O/E
  • PBMC peripheral mononuclear cells
  • Figure 10 shows the co-culture of IGSF1 overexpressing human lung cancer cells (NCI-H292 IGSF1 O/E) and control (NCI-H292 MOCK) spheroids and human peripheral mononuclear cells (PBMC), after treatment with IgG or WM-A1-3389 antibody. It is a graph showing the expression of HMGB1 and Hsp90 in spheroids.
  • 11 is a graph showing the measurement of tumor size in the IgG or WM-A1-3389 antibody-administered group in a mouse model transplanted with IGSF1 overexpressing human lung cancer cells (NCI-H292 IGSF1 O/E).
  • FIG. 12 is a graph showing the individual tumor sizes of mice administered with IgG or WM-A1-3389 antibody in a mouse model implanted with IGSF1 overexpressing human lung cancer cells (NCI-H292 IGSF1 O/E).
  • FIG. 13 is a view showing the results of analyzing the expression level of IGSF1 in tissues of Caucasian lung cancer patients.
  • One aspect of the present invention provides an anti-cancer agent comprising an anti-IGSF1 antibody that specifically binds to the C-terminus of IGSF1 as an active ingredient.
  • IGSF1 is a membrane protein encoded by the IGSF1 gene found on the X chromosome of humans and other mammalian species. Although the function of IGSF1 in normal cells is not well known, IGSF1 mutations are known to cause diseases such as IGSF1 deficiency syndrome or central hypothyroidism.
  • the IGSF1 may include any mammalian IGSF1 without limitation, but may preferably refer to human IGSF1.
  • the IGSF1 protein includes all native or mutant IGSF1 proteins, but is not limited thereto.
  • the native IGSF1 protein generally refers to a polypeptide comprising the amino acid sequence of the native IGSF1 protein, and the amino acid sequence of the native IGSF1 protein generally refers to the amino acid sequence found in naturally occurring IGSF1.
  • the information on IGSF1 can be obtained from a known database such as GenBank of the National Institutes of Health, and may have, for example, the amino acid sequence of Genebank accession number NP_001164433.1 or the amino acid sequence of SEQ ID NO: 19, but is not limited thereto.
  • anti-IGSF1 antibody refers to an antibody capable of binding to IGSF1, and may be used interchangeably with “IGSF1-specific antibody” in the present invention.
  • the anti-IGSF1 antibody can specifically bind to the C-terminus of IGSF1.
  • the form of the antibody may include both whole antibodies and antibody fragments.
  • anti-cancer agent may include any composition or drug that exhibits a preventive or therapeutic effect on cancer.
  • the anti-IGSF1 antibody binding to the C-terminus of IGSF1 can effectively kill cancer in which IGSF1 is overexpressed.
  • the cancer is gastric cancer, liver cancer, lung cancer, non-small cell lung cancer, colorectal cancer, bladder cancer, bone cancer, blood cancer, breast cancer, melanoma, thyroid cancer, parathyroid cancer, bone marrow cancer, rectal cancer, throat cancer, laryngeal cancer, esophageal cancer, pancreatic cancer, tongue cancer , skin cancer, sinus tumor, cervical cancer, head or neck cancer, gallbladder cancer, oral cancer, perianal cancer, colon cancer, and central nervous system tumors.
  • a heavy chain variable region comprising H-CDR1 of SEQ ID NO: 1, H-CDR2 of SEQ ID NO: 2 and H-CDR3 of SEQ ID NO: 3; and L-CDR1 of SEQ ID NO: 4, L-CDR2 of SEQ ID NO: 5, and L-CDR3 of SEQ ID NO: 6, and an antibody or fragment thereof specific to IGSF1 comprising a light chain variable region.
  • the term "antibody” refers to an immunoglobulin molecule that reacts immunologically with a specific antigen, and refers to a protein molecule that specifically recognizes an antigen.
  • the antibody may be whole antibody, monoclonal antibody, polyclonal antibody, single domain antibody, single chain antibody, multispecific antibody, human antibody, humanized antibody, chimeric antibody, intrabody, scFv, Fab fragment, F (ab') fragments, Fvs linked by disulfide bonds (sdFv), and epitope binding fragments of any of the above.
  • the heavy chain and light chain of immunoglobulin may include a constant region and a variable region, respectively.
  • Light chain and heavy chain variable regions of immunoglobulin include three variable regions called complementarity determining regions (CDRs) and four framework regions (FRs).
  • the CDR mainly serves to bind to an epitope of an antigen.
  • the CDRs of each chain are typically called CDR1, CDR2, CDR3 sequentially starting from the N-terminus, and are identified by the chain on which the particular CDR is located.
  • Antibodies and fragments thereof specific to IGSF1 of the present invention may include a heavy chain variable region (VH) including H-CDR1 of SEQ ID NO: 1, H-CDR2 of SEQ ID NO: 2, and H-CDR3 of SEQ ID NO: 3.
  • the IGSF1-specific antibody and fragment thereof of the present invention may include a light chain variable region (VL) comprising L-CDR1 of SEQ ID NO: 4, L-CDR2 of SEQ ID NO: 5, and L-CDR3 of SEQ ID NO: 6 there is.
  • VL light chain variable region
  • the heavy chain variable region may have an amino acid sequence of SEQ ID NO: 7
  • the light chain variable region may have an amino acid sequence of SEQ ID NO: 8.
  • the antibody may be referred to as WM-A1-3389.
  • the heavy chain variable region of the antibody is about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% of the amino acid sequence of SEQ ID NO: 7, It may comprise or consist of an amino acid sequence that has about 99%, or about 100% identity.
  • the light chain variable region of the antibody is about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% of the amino acid sequence of SEQ ID NO: 8 It may comprise or consist of an amino acid sequence that has %, about 99% or about 100% identity.
  • Immunoglobulin heavy chain constant regions exhibit different amino acid composition and order and therefore possess different types of antigenicity.
  • immunoglobulins can be classified into five categories and referred to as immunoglobulin isotypes: IgM, IgD, IgG, IgA and IgE.
  • Corresponding heavy chains are ⁇ chain, ⁇ chain, ⁇ chain, ⁇ chain and ⁇ chain, respectively.
  • Igs of the same type can be classified into different subtypes. For example, IgG can be classified as IgG1, IgG2, IgG3 and IgG4.
  • Light chains can be classified as ⁇ or ⁇ chains according to the different constant regions.
  • Each of the five types of IgG can have ⁇ or ⁇ chains.
  • the IGSF1-specific antibody of the present invention may include a constant region derived from IgG, IgA, IgD, IgE, or IgM, or a partial hybrid thereof.
  • hybrid means that sequences corresponding to immunoglobulin heavy chain constant regions of two or more different origins exist within a single chain immunoglobulin heavy chain constant region. For example, a hybrid of one to four domains selected from the group consisting of CH1, CH2 and CH3 of IgG, IgA, IgD, IgE and IgM is possible.
  • the IGSF1-specific antibody of the present invention includes a light chain constant region (LC)
  • the light chain constant region may be derived from a ⁇ or ⁇ light chain.
  • antibody fragment refers to a scFv fragment, which is an Fv fragment that binds to IGSF1, as well as a Fab fragment, Fab' fragment, F(ab')2 fragment having antigen-binding activity, and refers to the scFv fragment of the present invention. It includes the CDR regions of the antibodies described in.
  • An Fv fragment is the smallest antibody fragment that contains a heavy chain variable region and a light chain variable region, without a constant region, and retains all antigen-binding sites.
  • Another aspect of the present invention provides a polynucleotide encoding an antibody or fragment thereof specific for IGSF1.
  • the anti-IGSF1 antibodies and fragments thereof are as described above.
  • the heavy chain region of the polynucleotide may include the nucleotide sequence of SEQ ID NO: 9, and the light chain region may include the nucleotide sequence of SEQ ID NO: 10.
  • one or more bases may be mutated by substitution, deletion, insertion, or a combination thereof.
  • a synthesis method well known in the art for example, the method described in the literature (Engels and Uhlmann, Angew Chem IntEd Engl., 37:73-127, 1988) can be used. and triester, phosphite, phosphoramidite and H-phosphate methods, PCR and other auto-primer methods, oligonucleotide synthesis methods on solid supports, and the like.
  • the polynucleotide is at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 86%, at least about 87% of each nucleotide sequence of SEQ ID NO: 9 or SEQ ID NO: 10 %, at least about 88%, at least about 89%, at least about 90%, at least about 91%, at least about 92%, at least about 93%, at least about 94%, at least about 95%, at least about 96%, at least about 97% %, at least about 98%, at least about 99% or at least about 100% identity.
  • the polynucleotide may additionally include a signal sequence or a leader sequence.
  • signal sequence refers to a nucleic acid encoding a signal peptide that directs the secretion of a target protein.
  • the signal peptide is cleaved after translation in the host cell.
  • the signal sequence of the present invention is a nucleotide encoding an amino acid sequence that initiates movement of a protein through an endoplasmic reticulum (ER) membrane.
  • ER endoplasmic reticulum
  • the signal sequence is well known in the art and usually includes 16 to 30 amino acid residues, but may include more or less amino acid residues.
  • a typical signal peptide consists of three domains: a basic N-terminal domain, a central hydrophobic domain, and a more polar C-terminal domain.
  • the central hydrophobic region contains 4 to 12 hydrophobic residues that anchor the signal sequence throughout the membrane lipid bilayer during migration of the immature polypeptide.
  • the signal sequence is cleaved within the lumen of the ER by cellular enzymes commonly known as signal peptidases.
  • the signal sequence may be tPa (tissue plasminogen activation), HSV gDs (signal sequence of herpes simplex virus glycoprotein D), IgG signal sequence, or growth hormone secretion signal sequence.
  • secretion signal sequences used in higher eukaryotic cells including mammals and the like can be used.
  • Signal sequences useful in the present invention include antibody light chain signal sequences, such as antibody 14.18 (Gillies et al., J. Immunol. Meth 1989. 125:191-202), antibody heavy chain signal sequences, such as MOPC141 antibody heavy chain signals. sequence (Sakano et al., Nature, 1980. 286: 676-683) and other signal sequences known in the art (see, eg, Watson et al., Nucleic Acid Research, 1984. 12:5145-5164). .
  • Another aspect of the present invention provides a vector comprising a polynucleotide encoding the IGSF1-specific antibody or fragment thereof.
  • the heavy chain region of the polynucleotide may include the nucleotide sequence of SEQ ID NO: 9, and the light chain region may include the nucleotide sequence of SEQ ID NO: 10.
  • the polynucleotide may additionally include a signal sequence or a leader sequence.
  • the IGSF1-specific antibody and its fragments and signal sequences are as described above.
  • the vector may be two vectors each including the polynucleotides of the heavy chain and the light chain, or a bicistronic vector including both the polynucleotides.
  • a “vector” is capable of being introduced into a host cell and then recombination and integration into the host cell genome.
  • the vector is understood to be a nucleic acid means comprising a nucleotide sequence capable of autonomous replication as an episome.
  • Such vectors include linear nucleic acids, plasmids, phagemids, cosmids, RNA vectors, viral vectors, minichromosomes, and analogues thereof.
  • viral vectors include, but are not limited to, retroviruses, adenoviruses, and adeno-associated viruses.
  • the vector may be plasmid DNA, phage DNA, etc., commercially developed plasmids (pUC18, pBAD, pIDTSAMRT-AMP, etc.), Escherichia coli-derived plasmids (pYG601BR322, pBR325, pUC118, pUC119, etc.), Bacillus subtilis plasmids derived from spp.
  • pUB110, pTP5, etc. yeast-derived plasmids (YEp13, YEp24, YCp50, etc.), phage DNA (Charon4A, Charon21A, EMBL3, EMBL4, ⁇ gt10, ⁇ gt11, ⁇ ZAP, etc.), animal viral vectors (retrovirus ), adenovirus, vaccinia virus, etc.), insect virus vectors (baculovirus, etc.), and the like. Since the expression level and modification of the protein of the vector appear differently depending on the host cell, it is preferable to select and use the host cell most suitable for the purpose.
  • the plasmid may contain a selectable marker such as an antibiotic resistance gene, and host cells containing the plasmid may be cultured under selective conditions.
  • the term "gene expression” or “expression” of a protein of interest is understood to mean transcription of DNA sequences, translation of mRNA transcripts and secretion of fusion protein products or fragments thereof.
  • a useful expression vector can be RcCMV (Invitrogen, Carlsbad) or variants thereof.
  • the expression vector may include a human cytomegalovirus (CMV) promoter for promoting continuous transcription of a target gene in mammalian cells and a bovine growth hormone polyadenylation signal sequence for increasing the steady-state level of RNA after transcription.
  • CMV human cytomegalovirus
  • bovine growth hormone polyadenylation signal sequence for increasing the steady-state level of RNA after transcription.
  • Another aspect of the present invention provides a transformed cell into which an expression vector containing a polynucleotide encoding the IGSF1-specific antibody or fragment thereof is introduced.
  • Antibodies and fragments thereof specific to IGSF1 are as described above.
  • transformed cell refers to prokaryotic and eukaryotic cells into which a recombinant expression vector may be introduced.
  • the transformed cell may be prepared by introducing a vector into a host cell and transforming the cell.
  • the fusion protein of the present invention can be produced by expressing the polynucleotide contained in the vector.
  • the transformation may be performed by various methods. As long as the fusion protein of the present invention can be produced, it is not particularly limited thereto. Specifically, the transformation method is a CaCl 2 precipitation method, and a CaCl 2 precipitation method using a reducing material called DMSO (dimethyl sulfoxide) Hanahan method, electroporation, calcium phosphate precipitation, protoplast fusion, agitation using silicon carbide fibers, agrobacteria mediated transformation, transformation using PEG, dextran sulfate, lipofectamine and drying / Suppression mediated transformation methods and the like can be used.
  • a target may be delivered into a cell using virus particles as a means of infection.
  • vectors can be introduced into host cells by gene bombardment or the like.
  • the host cell used for preparing the transformed cell can also produce the fusion protein of the present invention, it is not particularly limited thereto.
  • the host cell may include, but is not limited to, cells of prokaryotic, eukaryotic, mammalian, plant, insect, fungal or cellular origin.
  • prokaryotic cell Escherichia coli may be used.
  • yeast may be used as an example of a eukaryotic cell.
  • the mammalian cells include CHO cells, F2N cells, COS cells, BHK cells, Bowes melanoma cells, HeLa cells, 911 cells, AT1080 cells, A549 cells, SP2/0 cells, human lymphoblastoid ), NSO cells, HT-1080 cells, PERC.6 cells, HEK293 cells or HEK293T cells, etc. may be used, but are not limited thereto, and any cell that can be used as a mammalian host cell known to those skilled in the art can be used.
  • glycosylation-related genes possessed by host cells are manipulated through a method known to those skilled in the art to sugar chains of fusion proteins.
  • the pattern eg sialic acid, fucosylation, glycosylation
  • the pattern can be tailored.
  • Another aspect of the present invention provides a method for producing the IGSF1-specific antibody or fragment thereof.
  • IGSF1-specific antibodies and fragments thereof are as described above.
  • the method for producing the fusion protein includes i) culturing the transformed cell; and ii) recovering the anti-IGSF1 antibody or fragment thereof of the present invention.
  • cultivation refers to a method of growing microorganisms under appropriately artificially controlled environmental conditions.
  • the method of culturing the transformed cells may be performed using a method widely known in the art.
  • the culture is not particularly limited thereto as long as it can be produced by expressing the fusion protein of the present invention.
  • the culture may be cultured continuously in a batch process or fed batch or repeated fed batch process.
  • the step of recovering the fusion protein dimer from the culture may be performed by a method known in the art.
  • the recovery method is not particularly limited thereto as long as the produced fusion protein of the present invention can be recovered.
  • the recovery method is centrifugation, filtration, extraction, spraying, drying, evaporation, precipitation, crystallization, electrophoresis, fractional dissolution (eg ammonium sulfate precipitation), chromatography (eg ion exchange, affinity, hydrophobicity, and size exclusion).
  • Another aspect of the present invention provides a pharmaceutical composition for preventing or treating cancer comprising the IGSF1 antibody or fragment thereof as an active ingredient.
  • the cancer may be a cancer in which IGSF1 is overexpressed.
  • the cancer is gastric cancer, liver cancer, lung cancer, non-small cell lung cancer, colorectal cancer, bladder cancer, bone cancer, blood cancer, breast cancer, melanoma, thyroid cancer, parathyroid cancer, bone marrow cancer, rectal cancer, throat cancer, laryngeal cancer, esophageal cancer, pancreatic cancer, tongue cancer , It may be any one selected from the group consisting of skin cancer, sinus tumor, uterine cancer, head or neck cancer, gallbladder cancer, oral cancer, perianal cancer, colon cancer, and central nervous system tumor.
  • prevention refers to all activities of suppressing or delaying the onset of cancer by administration of the pharmaceutical composition.
  • treatment refers to all activities that improve or beneficially change symptoms of cancer by administration of the pharmaceutical composition.
  • the anti-IGSF1 antibody or fragment thereof can exhibit anticancer activity, it may be included in any amount (effective amount) depending on the purpose of use, formulation, and combination.
  • effective amount refers to the amount of an active ingredient capable of inducing an anticancer effect. Such an effective amount can be determined empirically within the ordinary skill of the skilled artisan.
  • the pharmaceutical composition of the present invention contains the antibody as an active ingredient in an amount of about 0.1% to about 90% by weight, specifically about 0.5% to about 75% by weight, more specifically about 1% to about 1% by weight based on the total weight of the composition. It may contain 50% by weight.
  • the pharmaceutical composition of the present invention may include a conventional non-toxic pharmaceutically acceptable carrier formulated into a formulation according to a conventional method.
  • the pharmaceutically acceptable carrier may be any carrier as long as it is a non-toxic material suitable for delivery to a patient. Distilled water, alcohol, fats, waxes and inert solids may be included as carriers. Pharmaceutically acceptable adjuvants (buffers, dispersants) may also be included in the pharmaceutical composition.
  • the term "pharmaceutically acceptable carrier” refers to a carrier or diluent that does not stimulate organisms and does not inhibit the biological activity and properties of the administered compound.
  • Acceptable pharmaceutical carriers for compositions formulated as liquid solutions are sterile and biocompatible, and include saline, sterile water, Ringer's solution, buffered saline, albumin injection solution, dextrose solution, maltodextrin solution, glycerol, ethanol and One or more of these components may be mixed and used, and other conventional additives such as sweeteners, solubilizers, wetting agents, emulsifiers, isotonic agents, absorbents, antioxidants, preservatives, lubricants, fillers, buffers, and bacteriostatic agents may be added as necessary. can do.
  • compositions of the present invention can be prepared in a variety of dosage forms for parenteral administration (eg, intramuscular, intravenous or subcutaneous injection).
  • parenteral administration eg, intramuscular, intravenous or subcutaneous injection.
  • the pharmaceutical composition of the present invention may be formulated in the form of an injection, transdermal administration, nasal inhalation, and suppository along with a suitable carrier according to a method known in the art.
  • injectable formulations include sterilized aqueous solutions, non-aqueous solutions, suspensions, emulsions, freeze-dried formulations and suppositories.
  • Propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable esters such as ethyl oleate may be used as non-aqueous solvents and suspensions.
  • Witepsol, Macrogol, Tween 61, cacao butter, laurin paper, glycerogeratin and the like may be used as a base for the suppository.
  • conventional additives such as solubilizers, tonicity agents, suspending agents, emulsifiers, stabilizers, and preservatives may be included in the injection.
  • An antibody or composition of the present invention can be administered to a patient in a therapeutically effective amount or a pharmaceutically effective amount.
  • the term "administration” means introducing a predetermined substance into a subject by an appropriate method, and the administration route of the composition may be administered through any general route as long as it can reach the target tissue.
  • Intraperitoneal administration, intravenous administration, intramuscular administration, subcutaneous administration, intradermal administration, topical administration, intranasal administration, intrarectal administration may be administered, but is not limited thereto.
  • terapéuticaally effective amount or “pharmaceutically effective amount” is an amount of an antibody or composition effective for preventing or treating a target disease, sufficient to treat the disease with a reasonable benefit / risk ratio applicable to medical treatment It means an amount that does not cause side effects.
  • the level of the effective amount is the patient's state of health, type of disease, severity, activity of the drug, sensitivity to the drug, method of administration, time of administration, route of administration and excretion rate, duration of treatment, factors including drugs used in combination or concurrently, and It may be determined according to other factors well known in the medical field.
  • the effective amount of the antibody in the composition of the present invention may vary depending on the age, sex, and weight of the patient, and is generally about 0.1 mg to about 1,000 mg, or about 5 mg to about 200 mg per kg of body weight per day or It can be administered every other day or divided into 1 to 3 times a day. However, since it may increase or decrease depending on the route of administration, severity of disease, sex, weight, age, etc., the scope of the present invention is not limited thereto.
  • the term "individual” refers to a subject to which the composition of the present invention can be applied (prescribed), and may be mammals such as rats, mice, livestock, and the like, including humans. Preferably, it may be a human, but is not limited thereto.
  • the antibody of the present invention or a pharmaceutical composition containing the same may be administered as an individual therapeutic agent or in combination with other therapeutic agents, may be administered sequentially or simultaneously with conventional therapeutic agents, and may be administered single or multiple times.
  • the other therapeutic agent may further include any compound or natural extract known to have anticancer activity and whose safety has already been verified to increase or enhance anticancer activity.
  • Another aspect of the present invention provides the use of an antibody or fragment thereof specific to IGSF1 for preparing a drug for preventing or treating cancer.
  • Anti-IGSF1 antibodies and fragments thereof, cancer, prevention and treatment herein are the same as described above.
  • Another aspect of the present invention provides the use of an antibody or fragment thereof specific for IGSF1 for preventing and treating cancer.
  • Anti-IGSF1 antibodies and fragments thereof, cancer, prevention and treatment herein are the same as described above.
  • Another aspect of the present invention provides a method for preventing and treating cancer comprising administering an antibody or fragment thereof specific to IGSF1 to a subject.
  • the anti-IGSF1 antibody and fragment thereof, cancer, administration, treatment and prevention are the same as described above.
  • the subject may be a mammal, preferably a human.
  • the subject may be a cancer patient or an individual who is highly likely to suffer from cancer.
  • the administration route, dosage and frequency of administration of the IGSF1-specific antibody or fragment thereof may be administered to the subject in various ways and amounts depending on the condition of the patient and the presence or absence of side effects, and the optimal administration method, dosage and frequency of administration can be selected in an appropriate range by a person skilled in the art.
  • the IGSF1-specific antibody or fragment thereof may be administered in combination with other drugs or biochemically active substances known to have therapeutic effects on cancer, or formulated in combination with other drugs.
  • IGSF1 protein expression vector After amplifying only the extracellular domain of IGSF1 through PCR from the Jurkat cell cDNA library, using the N293F vector (Yi Biologics Co., Ltd.), human Fc (fragment crystallizable region) and Histag ( his-tag) was fused to construct an IGSF1 protein expression vector.
  • HEK293F cells were transfected with the constructed IGSF1 expression vector, and cultured for 6 days in a medium supplemented with 1 mM Valporic acid (valproate).
  • first purification of the IGSF1 extracellular domain using protein A agarose second purification of the IGSF1 extracellular domain using Superdex 200 gel filtration chromatography, It was used for antibody selection.
  • bio-panning is performed using the prepared human antibody library phage (Y Bio Logics Co., Ltd.) to specifically bind to the antigen Only phages were eluted. Second and third rounds of biopanning were performed with the phages amplified in the first round of biopanning. ELISA was performed to confirm the antigen specificity of the positive phage antibody pool obtained through each round of biopanning. In addition, it was confirmed that the anti-IGSF1 antibody was enriched in the phage pool obtained through the third round.
  • the specificity of IGSF1 and other antigens was comparatively analyzed through ELISA method.
  • the antibodies obtained in this way were converted from phage to whole IgG vectors, and it was confirmed that the heavy and light chain sequences of the 95 converted clones matched those of the phage antibodies.
  • the most optimized antibody was selected and named "WM-A1-3389".
  • the CDR sequences of the WM-A1-3389 antibody are shown in Table 1 below.
  • the polynucleotide (SEQ ID NO: 23) encoding the heavy chain (SEQ ID NO: 21) was loaded into the N293F vector (Y BioLogics Co., Ltd.) (hereafter, HC DNA).
  • the polynucleotide (SEQ ID NO: 24) encoding the light chain (SEQ ID NO: 22) was loaded into the N293F vector (Y BioLogics Co., Ltd.) (hereinafter referred to as LC DNA).
  • the WM-A1-3389 antibody was obtained and purified. The purified protein was confirmed by SDS-PAGE.
  • IGSF1 was overexpressed in NCI-H292, a human lung cancer cell line, or HEK293E, a human embryonic kidney cell line, to construct an IGSF1 overexpressed cell line (FIG. 1).
  • MOCK is a control group without IGSF1 expression.
  • an expression vector (OriGene Technologies, Inc., Cat No.RC209621) containing a polynucleotide encoding IGSF1 was transfected into human lung cancer cell line NCI-H292 cells or human embryonic kidney cell line HEK293F cells. Thereafter, transfected cells were selected by culturing in a medium containing G418 (neomycin). The IGSF1 expression level was checked for the selected clones, and the clone showing the highest IGSF1 expression was selected and used in the experiment.
  • MOCK means an empty vector not loaded with a polynucleotide encoding IGSF1.
  • Example 2.2 Analysis of the relationship between IGSF1 expression and tumor-infiltrating lymphocytes in lung cancer cell line spheroids
  • tumor-infiltrating lymphocytes TIL
  • TIL tumor-infiltrating lymphocytes
  • NCI-H292 IGSF1 O/E cells and NCI-H292 MOCK cells were each 2 ⁇ 10 4 cells/well in a U-Bottom 96-well plate (Nunc, 174925 ) and incubated for 72 hours in a 37 ° C carbon dioxide incubator.
  • Peripheral blood mononuclear cells (PBMC) were prepared by centrifugation at 1,200 rpm for 10 minutes, removing the supernatant, and resuspending in PBS.
  • the formed spheroids were transferred to an ultra-low-attachment 96-well plate (Corning, CLS3474) by 2 wells, and then seeded with CFSE-stained peripheral blood mononuclear cells at 1 ⁇ 10 5 cells/well and incubated at 37° C. in a carbon dioxide incubator for 24 co-cultured for a period of time.
  • Tumor-infiltrating lymphocytes TIL
  • NCI-H292 MOCK cells were used as a control for IGSF1 overexpressing cells.
  • TIL tumor infiltrating lymphocytes
  • Example 2.3 Analysis of the relationship between IGSF1 expression and tumor-infiltrating lymphocytes in tumor tissues of humanized mice transplanted with lung cancer cell lines
  • tumor-infiltrating lymphocytes were identified in tumor tissues of humanized mice transplanted with IGSF1-overexpressing human lung cancer cells.
  • NSG mice SID (NSGA) mice, F transplanted with human peripheral blood mononuclear cells (PBMC) were treated with NCI-H292 IGSF1 O/E cells, a human lung cancer cell line overexpressing IGSF1, or NCI-H292 MOCK cells as a control group. Tumor parts of the mice were collected on the 17th day after transplantation at 5 ⁇ 10 6 cells per mouse.
  • Human peripheral blood mononuclear cells were isolated from the collected tumors and subjected to FACS analysis, and tumor-infiltrating lymphocytes and IGSF1 expression levels in the tumor tissue were confirmed through immunohistochemical staining of the tumor tissue.
  • the tumor tissue was first treated with collagenase B (Roche, cat. #11088815001) and reacted at 37° C. for 2 hours or more to decompose the tumor tissue. When the tumor tissue was completely disintegrated into cells, it was separated into single cells by pipetting with a 1 ml pipette.
  • the isolated single cells were transferred to a 50 ml tube (SPL, cat. #50050) and washed with 20 ml of PBS. Then, centrifugation was performed at 1,200 rpm for 3 minutes and the supernatant was removed. The remaining cells were reacted with DNase I (Roche, cat. #11284932001) at 37°C for 20 minutes. Thereafter, 20 ml of PBS was added, and the supernatant was removed by centrifugation at 1,200 rpm for 3 minutes. Remaining cells were treated with 0.25% Trysin/EDTA (GIBCO, cat. #15400-054). After mixing the cells well, a cell strainer (SPL, cat.
  • IGSF1 tumor lymphocytes expressed in the tumor and the expression of IGSF1 were confirmed by immunohistochemical staining.
  • human lung cancer cell line NCI-H292 IGSF1 O/E cells or NCI-H292 MOCK cells were injected into NSG mice (SID (NSGA) mice, F) transplanted with human peripheral blood mononuclear cells (PBMC), 5 ⁇ 10 per mouse. 6 cells were transplanted. After that, on day 17, sections of tumor tissue collected from mice were deparaffinized and rehydrated.
  • Target retrieval buffer for heat-induced epitope retrieval, it was immersed in target retrieval buffer and heated in a microwave oven for 15 minutes. Then, after being placed in target retrieval buffer for 30 minutes, washed three times with Tris-buffered saline-0.05% Tween 20 (TBS-T), and blocked for 60 minutes with a blocking solution.
  • Anti-IGSF1 antibody (Santacruz, sc-393786) as primary antibody was diluted 1:100 and allowed to bind overnight at 4°C.
  • hCD45+ cells which are human immune cells, decreased in the tumor tissues of humanized mice transplanted with IGSF1 overexpressing human lung cancer cells (NCI-H292 IGSF1 O/E) (FIG. 4 ).
  • the binding affinity of the WM-A1-3389 antibody to the IGSF1 antigen was confirmed at the in vitro level using ELISA analysis.
  • PBST 4% skim milk
  • WM-A1-3389 antibody was serially diluted in 4% skim milk (PBST) at 1/3 concentration to 12 concentrations, and then reacted at room temperature for 2 hours.
  • PBST 4% skim milk
  • the wells were washed with PBST, treated with human IgG Fc-HRP antibody, and allowed to react at room temperature for 1 hour.
  • TMB peroxidase substrate was added to check the degree of color development, and the absorbance was measured at 450 nm, and the results were compared and analyzed.
  • the Kd value of the WM-A1-3389 antibody was 2.2 ⁇ 10 -11 , indicating high binding affinity to the IGSF1 antigen (FIG. 5).
  • IGSF1 overexpressing human lung cancer cells NCI-H292 IGSF1 O/E
  • NCI-H292 MOCK NCI-H292 MOCK
  • the media of NCI-H292 IGSF1 O/E cells and NCI-H292 MOCK cells were removed, washed once with PBS, and treated with 2 ml of 0.25% trypsin-EDTA to separate the cells.
  • the separated cells were diluted with 8 ml of PBS (hereinafter referred to as FACS buffer) containing 2% FBS and 0.05% sodium azide, and then centrifuged at 1,200 rpm for 1 minute to remove the supernatant. Then, the cells were resuspended in FACS buffer to a concentration of 1 ⁇ 10 5 cells/ml. Thereafter, the supernatant was removed by dispensing 1 ml each into a FACS tube and centrifuging at 1,200 rpm for 1 minute.
  • the pellet remaining in the FACS tube was released by vortexing, and the WM-A1-3389 antibody was diluted by 1/4 from 20 ⁇ M to 0 ⁇ M per 200 ⁇ l of FACS buffer to a total of 12 concentrations. , and reacted at 4° C. for 30 minutes. After the reaction was completed, 1 ml of FACS buffer was added to each tube, and the supernatant was removed by centrifugation at 1,200 rpm for 1 minute. This process was carried out a total of two times.
  • the pellet remaining in the FACS tube was released by vortexing, and FITC-labeled goat anti-human IgG antibody (Invitrogen, 62-8411) was added at 5 ⁇ g/ml per 200 ⁇ l of FACS buffer and incubated at 4° C. for 30 minutes. reacted After completion of the reaction, 1 ml of FACS buffer was added to each tube, and the supernatant was removed by centrifugation at 1,200 rpm for 1 minute. This process was performed twice in total.
  • the remaining pellet was resuspended in 200 ⁇ l of FACS buffer and subjected to FACS analysis.
  • FACS analysis the FITC fluorescence value labeled on each cell was measured using a BD LSRFortessa TM Flow Cytometer, and the results were analyzed using FlowJo software, and the EC50 value was calculated using a sigma plot program.
  • NCI-H292 MOCK cells were used as a control for IGSF1 overexpressing cells.
  • the medium of IGSF1 overexpressed human lung cancer cells (NCI-H292 IGSF1 O/E) and its control (NCI-H292 MOCK) was removed, washed once with PBS, and 2 ml of 0.25% trypsin-EDTA.
  • Cells were separated by treatment.
  • the separated cells were diluted with 8 ml of PBS (hereinafter referred to as FACS buffer) containing 2% FBS and 0.05% sodium azide, and then centrifuged at 1,200 rpm for 1 minute to remove the supernatant.
  • the cells were resuspended in FACS buffer to a concentration of 1 ⁇ 10 5 cells/ml. Thereafter, the supernatant was removed by dispensing 1 ml each into a FACS tube and centrifuging at 1,200 rpm for 1 minute.
  • the pellet remaining in the FACS tube was released by vortexing, and 0.4 ⁇ g of human IgG isotype antibody (Bio X cell, BE0297) or WM-A1-3389 antibody per 200 ⁇ l of FACS buffer was added and reacted at 4° C. for 30 minutes. After completion of the reaction, 1 ml of FACS buffer was added to each tube, and the supernatant was removed by centrifugation at 1,200 rpm for 1 minute. This process was performed a total of two times.
  • the cell pellet remaining in the FACS tube was released by vortexing, and 0.4 ⁇ g of FITC-labeled goat anti-human IgG antibody (Invitrogen, 62-8411) per 200 ⁇ l of FACS buffer was added and reacted for 30 minutes at 4° C. made it
  • the WM-A1-3389 antibody-treated group showed 2.6% binding ability in the control group (NCI-H292 MOCK) and 78.9% binding force in the IGSF1 overexpressing cells (NCI-H292 IGSF1 O/E). binding was shown (FIG. 7).
  • IGSF1 overexpressed NCI-H292 IGSF1 O / E cells and HEK293E IGSF1 O / E cells were transfected with shRNA (hereinafter, shIGSF1) that specifically binds to mRNA encoding IGSF1 to reduce the expression of IGSF1 (
  • shIGSF1 K/D cells the binding ability of the WM-A1-3389 antibody to the intracellular IGSF1 antigen was measured.
  • a control for transfection IGSF1 K / D
  • scramble RNA without shIGSF1 hereinafter referred to as sc cells
  • a human IgG isotype was used as a control for the WM-A1-3389 antibody.
  • the binding ability in IGSF1 K/D cells was compared with the binding ability in sc cells.
  • NCI-H292 MOCK cells and HEK293E MOCK cells were used as controls for IGSF1 overexpressing cells, respectively.
  • NCI-H292 IGSF1 O/E and MOCK
  • HEK293E IGSF1 O/E and MOCK
  • Example 5 Analysis of immunocancer efficacy of anti-IGSF1 antibodies in lung cancer cell spheroids
  • lung cancer cell spheroids and peripheral blood mononuclear cells were co-cultured to confirm tumor infiltrating lymphocytes (TIL) and immunogenic cell death.
  • the co-cultured cells and the supernatant were collected in a tube and centrifuged at 1,200 rpm for 2 minutes to remove the supernatant.
  • the cell pellet was treated with 500 ⁇ l of 0.25% trypsin-EDTA to form single cells, diluted with 2 ml of PBS (hereafter referred to as FACS buffer) containing 2% FBS and 0.05% NaN 3 , and centrifuged at 1,200 rpm for 3 minutes. It was separated and the supernatant was removed.
  • PBS hereafter referred to as FACS buffer
  • TIL tumor infiltrating lymphocytes
  • ICD immunogenic cell death
  • IGSF1-overexpressing human lung cancer cells NCI-H292 IGSF1 O/E were transplanted into peripheral blood mononuclear cell humanized model (PBMC humanized model) mice. Afterwards, the tumor growth inhibitory effect of the WM-A1-3389 antibody was evaluated.
  • 6-week-old female peripheral blood mononuclear cell humanized mice (Gem biosciences) were purchased and purified for 1 week, and then IGSF1-overexpressing human lung cancer cells NCI-H292 IGSF1 O/E (5 ⁇ 10 6 cells/mouse) were mixed with PBS. It was diluted in Matrigel and injected subcutaneously (200 ⁇ l) into the right ventral side of the mouse. When the size of the tumor reached about 120 mm 3 , IgG isotype (control) or WM-A1-3389 antibody was intraperitoneally administered at a dose of 10 mg/kg, respectively. Administration was performed once every 3 days for 4 weeks, and the tumor size and body weight of mice were measured twice a week.
  • FACS analysis was performed by collecting blood and tumors from satellite group mice. After the administration was completed, the experimental animals were euthanized, and the tumors were removed and weighed. A human IgG isotype was used as a control for the WM-A1-3389 antibody.
  • the WM-A1-3389 antibody-administered group showed higher tumor growth inhibition efficacy than the control group, and showed a tumor inhibition rate (TGI) of about 64.5% (FIG. 11).
  • TGI tumor inhibition rate
  • Example 7 Analysis of IGSF1 expression in tissues of lung cancer patients of Caucasian ethnicity
  • IGSF1 The expression of IGSF1 in tissues of Caucasian lung cancer patients was confirmed by immunohistochemical staining.
  • target recovery buffer for heat-induced epitope recovery, followed by heating in a microwave oven for 15 minutes did After that, the target recovery buffer was further reacted for 30 minutes. Then, after washing three times with Tris buffered saline 0.05% Tween 20 (TBS-T), blocking was performed for 60 minutes with a blocking solution.
  • Anti-IGSF1 antibody (Santacruz, sc-393786) as primary antibody was diluted 1:100 and allowed to bind overnight at 4°C.
  • tissue sections were washed 3 times with TBS-T and reacted with endogenous peroxidase blocking reagent (Cell Marque, 925B) for 5 minutes. And, the secondary antibodies (Vector, PK-6101 PK-6102) were bound for 60 minutes at room temperature. Thereafter, washed three times with TBS-T, treated with avidin-biotin, and reacted for 60 minutes, followed by DAB staining (Vector, SK-4100). Stained tissue sections were observed under a microscope (FIG. 13).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Microbiology (AREA)
  • Epidemiology (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Mycology (AREA)
  • Peptides Or Proteins (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Biotechnology (AREA)
  • General Engineering & Computer Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)

Abstract

본　발명은　IGSF1에　특이적으로 결합하는 신규한　항체 및 이를 유효성분으로　포함하는　암　예방　또는　치료용 약학　조성물에 관한　것으로, 구체적으로 IGSF1의 C 말단에 결합하는 항체를 제공한다. 본 발명에 따른 항 IGSF1 항체는 IGSF1에 높은 특이성과 높은 결합력을 나타냈다. 본 발명에 따른 항 IGSF1 항체는 IGSF1이 과발현된 폐암 세포 스페로이드와 인간 말초 단핵세포를 공동 배양 시, 스페로이드 내의 면역세포의 침윤을 증가시켰다. 또한, 본 발명에 따른 항 IGSF1 항체는 IGSF1이 과발현된 인간 폐암 세포를 이식한 인간화 마우스의 종양 성장을 억제시키고, 종양 조직 내 사이토카인의 발현을 증가시켰다. 상기 결과를 통해 항 IGSF1 항체는 IGSF1 발현이 증가된 폐암 조직 내로 면역세포의 침윤 및 면역반응을 증가시킴으로써 종양 성장을 억제시킬 수 있음을 확인하였다. 따라서, 상기 항 IGSF1 항체는 IGSF1이 과발현된 암을 효과적으로 치료하는 항암제로 활용될 수 있다.

Description

항-IGSF1 항체 및 이의 용도
본　발명은　IGSF1에　특이적으로 결합하는 신규한　항체 및 이를 유효성분으로　포함하는　암　예방　또는　치료용 약학　조성물에 관한　것이다.
암에 대한 연구가 오랫동안 심도 있게 수행되어 왔음에도 불구하고, 환경오염, 잘못된 식생활 습관 등으로 인해 암 발생률은 계속 증가하고 있다. 전 세계적으로 매년 10,000만명이 넘는 암 환자가 발생하고 있으며, 세계보건기구(WHO)는　사망의 주요원인 중 하나로 암을 꼽고 있다. 이와 같이, 암은 현대 사회에서 사망률 1위를 차지하는 주요 질병으로서 현재까지 많은 연구에도 불구하고 획기적인 치료법이 없는 실정이다.
암의 치료에 있어 항암제와 같은 화학적 치료 용법은 어느 정도 효과를 거두고 있으나, 암의 다양한 발병 기전과 항암제 내성으로 인하여 많은 연구가 요구되고 있다. 최근 수십년간 진단과 치료기술의 발달로 암 치료율이 향상되었으나, 많은 진행성 암에 있어서 5년 생존율은 5 내지 50%에 머무르고 있다. 또한, 일부 암에 있어서는 다양한 연구와 치료에도 불구하고 지난 20년간의 생존율이 크게 변하지 못한 상태이다.
이와 같이, 암은 종래의 암 치료 요법에 의해 쉽게 치료되지 못하고 재발이 일어나고 있으며 다른 부위로의 전이가 일어나므로, 보다 본질적인 치료방법이 요구되고 있는 실정이다. 이에, 암의 악성화, 전이 및 재발의 원인으로 판단되는 암 세포의 특징이 되는 바이오마커를 타겟으로 암을 치료하기 위한 물질 개발에 관심이 높아지고 있다.
한편, 대한민국 공개공보 제2016-0014564호에서는 IGSF1(immunoglobulin superfamily member 1) 유전자가 MET(mesenchymal-epithelial transition factor) 저해제에 대한 감수성 예측용 바이오마커로 사용할 수 있다는 점에 대해 개시하고 있다. 상기 문헌에서는, 암 환자를 치료하기 전에 상기 바이오마커를 이용하여 환자 개개인의 감수성을 판정함으로써 치료 효과가 높은 항암제를 선택할 수 있음을 개시하고 있다. 그러나, IGSF1에 특이적인 항체가 항암제로 활용될 수 있다는 점에 대하여는 개시된 바 없다.
본 발명자들은 치료 효과가 높은 항암제를 개발하기 위하여, 특히, IGSF1이 과발현된 암을 효과적으로 치료하기 위한 치료제를 개발하기 위해 연구한 결과, IGSF1의 C 말단에 특이적으로 결합하는 항체를 개발하였고, 상기 항체가 암을 효과적으로 예방 또는 치료함을 확인하였다.
상기 목적을 달성하기 위하여, 본 발명의 일 측면은 IGSF1의 C 말단에 특이적으로 결합하는 항-IGSF1 항체를 유효성분으로 포함하는 항암제를 제공한다.
본 발명의 또 다른 측면은, 서열번호 1의 H-CDR1, 서열번호 2의 H-CDR2 및 서열번호 3의 H-CDR3을 포함하는 중쇄 가변영역; 및 서열번호 4의 L-CDR1, 서열번호 5의 L-CDR2 및 서열번호 6의 L-CDR3을 포함하는 경쇄 가변영역을 포함하는 IGSF1에 특이적인 항체 또는 이의 단편을 제공한다.
본 발명의 또 다른 측면은, 상기 IGSF1에 특이적인 항체 또는 이의 단편을 암호화하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 발현 벡터 및 상기 발현 벡터가 도입된 형질전환 세포를 제공한다.
본 발명의 또 다른 측면은, 상기 형질전환 세포를 배양하는 단계; 및 항-IGSF1 항체 또는 이의 단편을 회수하는 단계를 포함하는 IGSF1에 특이적인 항체 또는 이의 단편을 생산하는 방법을 제공한다.
본 발명의 또 다른 측면은, 상기 IGSF1에 특이적인 항체 또는 이의 단편을 유효성분으로 포함하는 암 예방 또는 치료용 약학 조성물을 제공한다.
본 발명의 또 다른 측면은, 상기 IGSF1에 특이적인 항체 또는 이의 단편을 개체에 투여하는 단계를 포함하는 암 예방 또는 치료 방법을 제공한다.
본 발명에 따른 항-IGSF1 항체는 IGSF1에 높은 특이성과 높은 결합력을 나타냈다. 본 발명에 따른 항-IGSF1 항체는 IGSF1이 과발현된 폐암 세포 스페로이드와 인간 말초 단핵세포를 공동 배양 시, 스페로이드 내로 면역세포의 침윤을 증가시켰다. 또한, 본 발명에 따른 항-IGSF1 항체는 IGSF1이 과발현된 인간 폐암 세포가 이식된 인간화 마우스에서 종양 성장을 억제시켰다. 뿐만 아니라, 상기 항체는 종양 조직 내 존재하는 Cytotoxic T 림프구에서 사이토카인의 발현을 증가시켰다. 상기 결과를 통해 항-IGSF1 항체는 IGSF1 발현이 증가된 종양 조직 내로 면역세포의 침윤 및 면역반응을 증가시킴으로써 종양 성장을 억제시킬 수 있음을 확인하였다. 따라서, 상기 항-IGSF1 항체는 IGSF1이 과발현된 암을 효과적으로 치료하는 항암제로 활용될 수 있다.
도 1은 IGSF1 과발현 인간 폐암 세포(NCI-H292 IGSF1 O/E) 및 대조군(NCI-H292 MOCK)에서 IGSF1 발현량을 웨스턴 블롯 및 RT-PCR을 통해 확인한 도면이다.
도 2는 IGSF1 과발현 인간 폐암 세포(NCI-H292 IGSF1 O/E) 및 대조군(NCI-H292 MOCK) 스페로이드와 인간 말초 단핵세포(PBMC)를 공동 배양 시, 스페로이드 내에 존재하는 종양침윤림프구(TIL)를 확인한 도면이다.
도 3은 IGSF1 과발현 인간 폐암 세포(NCI-H292 IGSF1 O/E) 또는 대조군(NCI-H292 MOCK)을 이식한 마우스의 종양 조직에서 종양침윤림프구의 존재를 확인하기 위하여, hCD45+ 세포의 분포 정도를 유세포 분석을 통해 분석한 결과를 나타낸 그래프이다.
도 4는 IGSF1 과발현 인간 폐암 세포(NCI-H292 IGSF1 O/E) 또는 대조군(NCI-H292 MOCK)을 이식한 마우스의 종양 조직에서 IGSF1의 발현 및 종양침윤림프구의 존재를 면역조직화학염색법(immunohistochemistry)으로 확인한 결과를 나타낸 도면이다.
도 5는 IGSF1 항원에 대한 WM-A1-3389 항체의 결합 친화도를 ELISA를 이용하여 분석한 결과를 나타낸 그래프이다.
도 6은 세포 내 IGSF1 항원에 대한 WM-A1-3389 항체의 결합 친화도를 FACS 분석을 이용하여 분석한 결과를 나타낸 그래프이다.
도 7은 IGSF 과발현 인간 폐암 세포(NCI-H292 IGSF1 O/E) 및 대조군(NCI-H292 MOCK)에서 세포에서 발현되는 IGSF1에 대한 WM-A1-3389 항체의 결합력을 FACS 분석을 이용하여 분석한 결과를 나타낸 그래프이다.
도 8은 2종의 IGSF1 과발현 인간 폐암 세포(NCI-H292 IGSF1 O/E 및 HEK293E IGSF1 O/E) 및 대조군(NCI-H292 MOCK 및 HEK293E MOCK)에 shIGSF1을 처리한 IGSF1 녹다운(K/D) 세포주에서 WM-A1-3389 항체의 결합 특이성을 분석한 결과를 나타낸 그래프이다.
도 9는 IGSF1 과발현 인간 폐암 세포(NCI-H292 IGSF1 O/E) 스페로이드와 인간 말초 단핵세포(PBMC)를 공동 배양 시, IgG 또는 WM-A1-3389 항체 처리 후 스페로이드 내에 존재하는 종양침윤림프구(TIL)를 현미경 이미지를 통해 확인한 도면이다.
도 10은 IGSF1 과발현 인간 폐암 세포(NCI-H292 IGSF1 O/E) 및 대조군(NCI-H292 MOCK) 스페로이드와 인간 말초 단핵세포(PBMC)를 공동 배양 시, IgG 또는 WM-A1-3389 항체 처리 후 스페로이드 내의 HMGB1 및 Hsp90의 발현을 나타낸 그래프이다.
도 11은 IGSF1 과발현 인간 폐암 세포(NCI-H292 IGSF1 O/E)를 이식한 마우스 모델에서 IgG 또는 WM-A1-3389 항체 투여군의 종양 크기를 측정하여 나타낸 그래프이다.
도 12는 IGSF1 과발현 인간 폐암 세포(NCI-H292 IGSF1 O/E)를 이식한 마우스 모델에서 IgG 또는 WM-A1-3389 항체 투여군 마우스의 개체별 종양 크기를 나타낸 그래프이다.
도 13는 코카서스 인종(caucasian) 폐암 환자 조직에서 IGSF1의 발현 정도를 분석한 결과를 나타낸 도면이다.
본 발명의 일 측면은, IGSF1의 C 말단에 특이적으로 결합하는 항-IGSF1 항체를 유효성분으로 포함하는 항암제를 제공한다.
본 명세서에서 사용된 용어, "IGSF1"은 인간 및 다른 포유류 종의 X 염색체에서 발견되는 IGSF1 유전자에 의해 암호화된 막단백질이다. 정상세포에서 IGSF1의 기능에 대해서는 잘 알려져 있지 않으나, IGSF1 돌연변이는 IGSF1 결핍 증후군(IGSF1 deficiency syndrome) 또는 중추성 갑상선 기능 저하증 등의 질병을 유발하는 것으로 알려져 있다.
본 발명에서 상기 IGSF1은 포유류의 IGSF1이라면 제한없이 포함될 수 있으나, 바람직하게는 인간 IGSF1을 의미할 수 있다. 또한, 본 발명에서 상기 IGSF1 단백질은 천연형 또는 변이체 IGSF1 단백질을 모두 포함하나, 이에 제한되지 않는다. 상기 천연형 IGSF1 단백질이란 천연형 IGSF1 단백질의 아미노산 서열을 포함하는 폴리펩타이드를 일반적으로 지칭하며, 상기 천연형 IGSF1 단백질의 아미노산 서열이란 천연 발생 IGSF1에서 발견되는 아미노산 서열을 일반적으로 지칭한다. 상기 IGSF1에 대한 정보는 미국국립보건원의 GenBank 등 공지의 데이터베이스로부터 얻을 수 있으며, 예를 들어 Genebank accession number NP_001164433.1의 아미노산 서열 또는 서열번호 19의 아미노산 서열을 가질 수 있으나, 이에 제한되지 않는다.
본 명세서에서 사용된 용어, "항-IGSF1 항체"는 IGSF1에 결합할 수 있는 항체를 의미하며, 본 발명에서 "IGSF1에 특이적인 항체"와 혼용되어 사용될 수 있다. 특히, 항-IGSF1 항체는 IGSF1의 C 말단에 특이적으로 결합할 수 있다. 상기 항체의 형태는 전체(whole) 항체 및 항체 단편을 모두 포함할 수 있다.
본 명세서에서 사용된 용어, "항암제"는 암에 대하여 예방 또는 치료 효과를 나타내는 모든 조성물 또는 약제를 포함할 수 있다.
본 발명에서 상기 IGSF1의 C 말단에 결합하는 항-IGSF1 항체는 IGSF1이 과발현되어 있는 암을 효과적으로 사멸시킬 수 있다. 이때, 상기 암은 위암, 간암, 폐암, 비소세포 폐암, 대장암, 방관암, 골암, 혈액암, 유방암, 흑색종양, 갑상선암, 부갑성선암, 골수암, 직장암, 인후암, 후두암, 식도암, 췌장암, 설암, 피부암, 죄종양, 자궁암, 두부 또는 경부암, 담낭암, 구강암, 항문 부근암, 결장암 및 중추신경계 종양으로 구성된 군으로부터 선택되는 어느 하나인 것일 수 있으나, IGSF1이 과발현 되어 있는 암이면 이에 제한되지 않는다.
항-IGSF1 항체
본 발명의 또 다른 측면은, 서열번호 1의 H-CDR1, 서열번호 2의 H-CDR2 및 서열번호 3의 H-CDR3을 포함하는 중쇄 가변영역; 및 서열번호 4의 L-CDR1, 서열번호 5의 L-CDR2 및 서열번호 6의 L-CDR3을 포함하는 경쇄 가변영역을 포함하는 IGSF1에 특이적인 항체 또는 이의 단편을 제공한다.
본 명세서에서 사용된 용어, "항체"는 특정 항원과 면역학적으로 반응하는 면역글로불린 분자로, 항원을 특이적으로 인식하는 단백질 분자를 의미한다. 상기 항체는 전체(whole) 항체, 단일클론항체, 다클론항체, 단일 도메인 항체, 단쇄 항체, 다중특이적 항체, 인간 항체, 인간화 항체, 키메라 항체, 인트라바디(intrabody), scFv, Fab 단편, F(ab') 단편, 이황화 결합으로 연결한 Fv(sdFv) 및 상기 중 임의의 에피토프(epitope) 결합 단편을 포함하지만, 이에 제한되지 않는다.
면역글로불린의 중쇄 및 경쇄는 각각 불변영역(constant region) 및 가변영역(variable region)을 포함할 수 있다.
면역글로불린의 경쇄 및 중쇄 가변영역은, 상보성 결정 영역(complementarity determining region, CDR)이라 불리는 3개의 다변가능한 영역 및 4개의 구조영역(framework region, FR)을 포함한다. 상기 CDR은 주로 항원의 에피토프에 결합하는 역할을 한다. 각각의 사슬의 CDR은 전형적으로 N 말단으로부터 시작하여 순차적으로 CDR1, CDR2, CDR3로 불리고, 특정 CDR이 위치하고 있는 사슬에 의해서 식별된다. 본 발명의 IGSF1에 특이적인 항체 및 이의 단편은 서열번호 1의 H-CDR1, 서열번호 2의 H-CDR2 및 서열번호 3의 H-CDR3을 포함하는 중쇄 가변영역(VH)을 포함할 수 있다. 또한, 본 발명의 IGSF1에 특이적인 항체 및 이의 단편은 서열번호 4의 L-CDR1, 서열번호 5의 L-CDR2 및 서열번호 6의 L-CDR3을 포함하는 경쇄 가변영역(VL)을 포함할 수 있다. 이때, 상기 중쇄 가변영역은 서열번호 7의 아미노산 서열을 가질 수 있으며, 상기 경쇄 가변영역은 서열번호 8의 아미노산 서열을 가질 수 있다. 본 명세서에서 상기 항체는 WM-A1-3389로 지칭될 수 있다.
상기 항체의 중쇄 가변영역은 서열번호 7의 아미노산 서열과 약 90%, 약 91%, 약 92%, 약 93%, 약 94%, 약 95%, 약 96%, 약 97%, 약 98%, 약 99%, 또는 약 100% 동일성을 갖는 아미노산 서열을 포함하거나 이들로 이루어질 수 있다. 또한, 상기 항체의 경쇄 가변영역은 서열번호 8의 아미노산 서열과 약 90%, 약 91%, 약 92%, 약 93%, 약 94%, 약 95%, 약 96%, 약 97%, 약 98%, 약 99% 또는 약 100% 동일성을 갖는 아미노산 서열을 포함하거나 이들로 이루어질 수 있다.
면역글로불린 중쇄 불변영역(CH)은 상이한 아미노산 조성 및 순서를 나타내므로, 상이한 유형의 항원성을 보유한다. 따라서, 면역글로불린은 다섯 가지 카테고리로 분류될 수 있으며, 면역글로불린 이소형, 즉, IgM, IgD, IgG, IgA 및 IgE로 지칭될 수 있다. 이에 상응하는 중쇄는 각각 μ 사슬, δ 사슬, γ 사슬, α 사슬 및 ε 사슬이다. 또한, 힌지 영역(hinge region)의 아미노산 조성 및 중쇄 이황화 결합의 수와 위치에 따라, 동일한 유형의 Ig는 상이한 하위 유형으로 분류될 수 있다. 예를 들어, IgG는 IgG1, IgG2, IgG3 및 IgG4로 분류될 수 있다. 경쇄는 상이한 불변영역에 따라 κ 또는 λ 사슬로 분류될 수 있다. 다섯 가지 유형의 IgG 각각은 κ 또는 λ 사슬을 가질 수 있다.
본 발명의 IGSF1에 특이적인 항체가 불변영역을 포함하는 경우, IgG, IgA, IgD, IgE, IgM 유래 또는 이들이 부분적으로 혼합(hybrid)된 불변영역을 포함할 수 있다.
본 명세서에서 사용된 용어, "혼합된(hybrid)"은 단쇄 면역 글로불린 중쇄 불변영역 내에 2개 이상의 상이한 기원의 면역글로불린 중쇄 불변영역에 해당하는 서열이 존재함을 의미한다. 예를 들어 IgG, IgA, IgD, IgE 및 IgM의 CH1, CH2 및 CH3으로 이루어진 그룹으로부터 선택되는 1개 내지 4개 도메인으로 이루어진 도메인의 하이브리드가 가능하다.
또한, 본 발명의 상기 IGSF1에 특이적인 항체가 경쇄 불변영역(LC)을 포함하는 경우, 상기 경쇄 불변영역은 λ 또는 κ 경쇄 유래일 수 있다.
본 명세서에서 사용하는 용어, "항체 단편"은 항원-결합 활성을 갖는 Fab 단편, Fab' 단편, F(ab')2 단편뿐만 아니라, IGSF1에 결합하는 Fv 단편인 scFv 단편을 지칭하며, 본 발명에 기술된 항체의 CDR 영역을 포함한다. Fv 단편은 불변 영역 없이, 중쇄 가변 영역 및 경쇄 가변 영역을 포함하며, 모든 항원-결합 자리를 보유하는 최소 항체 단편이다.
항-IGSF1 항체를 암호화하는 폴리뉴클레오티드
본 발명의 또 다른 측면은, IGSF1에 특이적인 항체 또는 이의 단편을 암호화하는 폴리뉴클레오티드를 제공한다. 상기 항-IGSF1 항체 및 이의 단편은 전술한 바와 같다. 이때, 상기 폴리뉴클레오티드의 중쇄 영역은 서열번호 9의 염기서열을 포함할 수 있고, 경쇄 영역은 서열번호 10의 염기서열을 포함할 수 있다.
상기 폴리뉴클레오티드는 동일한 폴리펩타이드를 암호화한다면, 하나 이상의 염기가 치환, 결실, 삽입 또는 이들의 조합에 의해 변이될 수 있다. 폴리뉴클레오티드 서열을 화학적으로 합성하여 제조하는 경우, 당업계에 널리 공지된 합성법, 예를 들어 문헌(Engels and Uhlmann, Angew Chem IntEd Engl., 37:73-127, 1988)에 기술된 방법을 이용할 수 있으며, 트리에스테르, 포스파이트, 포스포르아미다이트 및 H-포스페이트 방법, PCR 및 기타 오토프라이머 방법, 고체 지지체상의 올리고뉴클레오티드 합성법 등을 들 수 있다.
일 구체예에 따르면, 상기 폴리뉴클레오티드는 서열번호 9 또는 서열번호 10 각각의 염기서열과 적어도 약 70%, 적어도 약 75%, 적어도 약 80%, 적어도 약 85%, 적어도 약 86%, 적어도 약 87%, 적어도 약 88%, 적어도 약 89%, 적어도 약 90%, 적어도 약 91%, 적어도 약 92%, 적어도 약 93%, 적어도 약 94%, 적어도 약 95%, 적어도 약 96%, 적어도 약 97%, 적어도 약 98%, 적어도 약 99% 또는 적어도 약 100%의 동일성을 가지는 염기서열을 포함할 수 있다.
상기 폴리뉴클레오티드는 신호서열(signal sequence) 또는 리더 서열(leader sequence)을 추가적으로 포함할 수 있다. 여기에서 사용된 용어 "신호서열"은 목적 단백질의 분비를 지시하는 신호펩타이드를 암호화하는 핵산을 의미한다. 상기 신호펩타이드는 숙주 세포에서 번역된 후에 절단된다. 구체적으로, 본원 발명의 신호서열은 ER(endoplasmic reticulum) 막을 관통하는 단백질의 이동을 개시하는 아미노산 서열을 암호화하는 뉴클레오티드이다.
신호서열은 당업계에 그 특징이 잘 알려져 있으며, 통상 16 내지 30개의 아미노산 잔기를 포함하나, 그보다 더 많거나 적은 아미노산 잔기를 포함할 수 있다. 통상적인 신호 펩타이드는 기본 N 말단 영역, 중심의 소수성 영역 및 보다 극성인(polar) C 말단 영역의 세 영역으로 구성된다. 중심 소수성 영역은 미성숙 폴리펩타이드가 이동하는 동안 막지질 이중층을 통하여 신호서열을 고정시키는 4 내지 12개의 소수성 잔기를 포함한다.
개시 이후에, 신호서열은 흔히 신호 펩티다아제(signal peptidases)로 알려진 세포 효소에 의하여 ER의 루멘(lumen) 내에서 절단된다. 이때, 상기 신호서열은 tPa(tissue plasminogen activation), HSV gDs(signal sequence of herpes simplex virus glycoprotein D), IgG 신호서열 또는 성장 호르몬(growth hormone)의 분비신호서열일 수 있다. 바람직하게, 포유동물 등을 포함하는 고등 진핵 세포에서 사용되는 분비 신호서열을 사용할 수 있다.
본원 발명에서 유용한 신호서열은 항체 경쇄 신호서열, 예를 들면 항체 14.18(Gillies et al., J. Immunol. Meth 1989. 125:191-202), 항체 중쇄 신호서열, 예를 들면, MOPC141 항체 중쇄 신호서열(Sakano et al., Nature, 1980. 286: 676-683) 및 당업계에 알려진 다른 신호서열(예, Watson et al., Nucleic Acid Research, 1984. 12:5145-5164를 참조)을 포함한다.
폴리뉴클레오티드가 적재된 벡터
본 발명의 또 다른 측면은, 상기 IGSF1에 특이적인 항체 또는 이의 단편을 암호화하는 폴리뉴클레오티드를 포함하는 벡터를 제공한다. 상기 폴리뉴클레오티드의 중쇄 영역은 서열번호 9의 염기서열을 포함할 수 있고, 경쇄 영역은 서열번호 10의 염기서열을 포함할 수 있다. 또한, 상기 폴리뉴클레오티드는 신호서열(signal sequence) 또는 리더 서열(leader sequence)을 추가적으로 포함할 수 있다. 여기서 IGSF1에 특이적인 항체 및 이의 단편 및 신호서열은 전술한 바와 같다.
이때, 상기 벡터는 상기 중쇄 및 경쇄의 폴리뉴클레오티드를 각각 포함하는 2개의 벡터 또는 상기 폴리뉴클레오티드를 모두 포함하는 바이시스트로닉 벡터일 수 있다.
본 명세서에서 사용하는 용어, "벡터"는 숙주 세포에 도입되어 숙주 세포 유전체 내로 재조합 및 삽입될 수 있다. 또는 상기 벡터는 에피좀으로서 자발적으로 복제될 수 있는 뉴클레오티드 서열을 포함하는 핵산 수단으로 이해된다. 상기 벡터는 선형 핵산, 플라스미드, 파지미드, 코스미드, RNA 벡터, 바이러스 벡터, 미니 염색체 및 이의 유사체들을 포함한다. 바이러스 벡터의 예로는 레트로바이러스, 아데노바이러스 및 아데노 관련 바이러스를 포함하나 이에 제한되지 않는다.
구체적으로, 상기 벡터는 플라스미드 DNA, 파아지 DNA 등이 될 수 있고, 상업적으로 개발된 플라스미드(pUC18, pBAD, pIDTSAMRT-AMP 등), 대장균 유래 플라스미드(pYG601BR322, pBR325, pUC118, pUC119 등), 바실러스 서브틸리스 유래 플라스미드(pUB110, pTP5 등), 효모-유래 플라스미드(YEp13, YEp24, YCp50 등), 파아지 DNA(Charon4A, Charon21A, EMBL3, EMBL4, λgt10, λgt11, λZAP 등), 동물 바이러스 벡터(레트로바이러스(retrovirus), 아데노바이러스(adenovirus), 백시니아 바이러스(vaccinia virus) 등), 곤충 바이러스 벡터(배큘로바이러스(baculovirus) 등) 등이 될 수 있다. 상기 벡터는 숙주 세포에 따라서 단백질의 발현량과 수식 등이 다르게 나타나므로, 목적에 가장 적합한 숙주세포를 선택하여 사용함이 바람직하다.
또한, 상기 플라스미드는 항생제 내성 유전자와 같은 선별 마커를 포함할 수 있고, 플라스미드를 유지하는 숙주 세포는 선택적인 조건하에서 배양될 수 있다.
본 명세서에서 사용하는 용어, 목적 단백질의 "유전자 발현" 또는 "발현"은 DNA 서열의 전사, mRNA 전사체의 번역 및 융합 단백질 생산물 또는 이의 단편의 분비를 의미하는 것으로 이해된다. 유용한 발현 벡터는 RcCMV(Invitrogen, Carlsbad) 또는 이의 변이체일 수 있다. 상기 발현 벡터는 포유류 세포에서 목적 유전자의 연속적인 전사를 촉진하기 위한 인간 CMV(cytomegalovirus) 프로모터 및 전사 후 RNA의 안정상태 수준을 높이기 위한 우태 성장 인자(bovine growth hormone) 폴리아데닐레이션 신호서열을 포함할 수 있다.
항-IGSF1 항체를 발현하는 형질전환 세포
본 발명의 또 다른 측면은, 상기 IGSF1에 특이적인 항체 또는 이의 단편을 암호화하는 폴리뉴클레오티드를 포함하는 발현 벡터가 도입된 형질전환 세포를 제공한다. IGSF1에 특이적인 항체 및 이의 단편은 전술한 바와 같다.
본 명세서에서 사용하는 용어, "형질전환 세포"는 재조합 발현 벡터가 도입될 수 있는 원핵세포 및 진핵세포를 나타낸다. 상기 형질전환 세포는 벡터를 숙주 세포에 도입하여 형질전환시켜서 제작될 수 있다. 또한, 상기 벡터에 포함된 폴리뉴클레오티드를 발현시켜 본 발명의 융합단백질을 생산할 수 있다.
상기 형질전환은 다양한 방법에 의하여 수행될 수 있다. 본 발명의 융합단백질을 생산할 수 있는 한, 특별히 이에 제한되지 않는다, 구체적으로, 상기 형질전환 방법은 CaCl2 침전법, CaCl2 침전법에 DMSO(dimethyl sulfoxide)라는 환원물질을 사용함으로써 효율을 높인 Hanahan 방법, 전기천공법(electroporation), 인산칼슘 침전법, 원형질 융합법, 실리콘 카바이드 섬유를 이용한 교반법, 아그로박테리아 매개된 형질전환법, PEG를 이용한 형질전환법, 덱스트란 설페이트, 리포펙타민 및 건조/억제 매개된 형질전환 방법 등 이 사용될 수 있다. 또한, 감염(infection)을 수단으로 하여 바이러스 입자를 사용하여 목적물을 세포 내로 전달시킬 수 있다. 또한, 유전자 밤바드먼트 등에 의해 벡터를 숙주세포 내로 도입할 수 있다.
또한, 상기 형질전환 세포의 제작에 사용되는 숙주세포 역시 본 발명의 융합단백질을 생산할 수 있는 한, 특별히 이에 제한되지 않는다. 구체적으로 상기 숙주 세포는 원핵세포, 진핵세포, 포유동물, 식물, 곤충, 균류 또는 세포성 기원의 세포를 포함할 수 있지만 이에 한정되지 않는다. 상기 원핵세포의 일 예로는 대장균을 사용할 수 있다. 또한, 진핵세포의 일 예로는 효모를 사용할 수 있다. 또한, 상기 포유동물 세포로 CHO 세포, F2N 세포, COS 세포, BHK 세포, 바우스(Bowes) 흑색종 세포, HeLa 세포, 911 세포, AT1080 세포, A549 세포, SP2/0 세포, 인간 림프아구(human lymphoblastoid), NSO 세포, HT-1080 세포, PERC.6 세포, HEK293 세포 또는 HEK293T 세포 등을 사용할 수 있으나, 이에 한정되지 않으며, 당업자에게 알려진 포유동물 숙주세포로 사용 가능한 세포는 모두 이용 가능하다.
전술한 바와 같이, 항-IGSF1 항체 및 이의 단편의 치료제로서의 특성을 최적화하거나 기타 다른 목적을 위해, 호스트 세포가 갖고 있는 당화(glycosylation) 관련 유전자를 당업자에게 알려져 있는 방법을 통해 조작하여 융합단백질의 당쇄 패턴(예를 들어, 시알 산, 퓨코실화, 당화)을 조정할 수 있다.
항-IGSF1 항체의 생산방법
본 발명의 또 다른 측면은, 상기 IGSF1에 특이적인 항체 또는 이의 단편을 생산방법을 제공한다. 이때, IGSF1에 특이적인 항체 및 이의 단편은 전술한 바와 같다.
상기 융합단백질의 생산방법은 i) 상기 형질전환 세포를 배양하는 단계; 및 ii) 본 발명의 항-IGSF1 항체 또는 이의 단편을 회수하는 단계를 포함할 수 있다.
본 명세서에서 사용하는 용어, "배양"이란, 미생물을 적당히 인공적으로 조절한 환경조건에서 생육시키는 방법을 의미한다.
상기 형질전환 세포를 배양하는 방법은 당업계에 널리 알려져 있는 방법을 이용하여 수행할 수 있다. 구체적으로, 상기 배양은 본 발명의 융합단백질을 발현시켜서 생산할 수 있는 한 특별히 이에 제한되지 않는다. 구체적으로, 상기 배양은 배치 공정 또는 주입 배치 또는 반복 주입 배치 공정(fed batch or repeated fed batch process)에서 연속식으로 배양할 수 있다.
또한, 배양물로부터 상기 융합단백질 이량체를 회수하는 단계는 당업계에 공지된 방법에 의해 수행될 수 있다. 구체적으로, 상기 회수 방법은 생산된 본 발명의 융합단백질을 회수할 수 있는 한, 특별히 이에 제한되지 않는다. 바람직하게는, 상기 회수 방법은 원심분리, 여과, 추출, 분무, 건조, 증발, 침전, 결정화, 전기영동, 분별용해(예를 들면, 암모늄설페이트 침전), 크로마토그래피(예를 들어, 이온 교환, 친화성, 소수성 및 크기배제) 등의 방법일 수 있다.
항-IGSF1 항체의 용도
본 발명의 또 다른 측면은, 상기 IGSF1 항체 또는 이의 단편을 유효성분으로 포함하는 암 예방 또는 치료용 약학 조성물을 제공한다.
이때, 상기 암은 IGSF1이 과발현되어 있는 암일 수 있다. 또한, 상기 암은 위암, 간암, 폐암, 비소세포 폐암, 대장암, 방관암, 골암, 혈액암, 유방암, 흑색종양, 갑상선암, 부갑성선암, 골수암, 직장암, 인후암, 후두암, 식도암, 췌장암, 설암, 피부암, 죄종양, 자궁암, 두부 또는 경부암, 담낭암, 구강암, 항문 부근암, 결장암 및 중추신경계 종양으로 구성된 군으로부터 선택되는 어느 하나인 것일 수 있다.
상기 용어 "예방"은 상기 약학적 조성물의 투여에 의해 암의 발생을 억제하거나 그의 발병을 지연시키는 모든 행위를 말한다. 상기 용어 "치료"는 상기 약학적 조성물의 투여에 의해 암의 증세가 호전되거나 이롭게 변경하는 모든 행위를 말한다.
본 발명의 암 예방 또는 치료용 약학 조성물에서 상기 항-IGSF1 항체 또는 이의 단편이 항암 활성을 나타낼 수 있는 한, 용도, 제형, 배합 목적 등에 따라 임의의 양(유효량)으로 포함될 수 있다. 여기서 "유효량"이란 항암 효과를 유도할 수 있는 유효성분의 양을 말한다. 이러한 유효량은 당업자의 통상의 능력 범위 내에서 실험적으로 결정될 수 있다. 본 발명의 약학 조성물은 유효성분으로서 상기 항체를 조성물의 총 중량을 기준으로 약 0.1 중량% 내지 약 90 중량%, 구체적으로 약 0.5 중량% 내지 약 75 중량%, 보다 구체적으로 약 1 중량% 내지 약 50 중량%로 함유할 수 있다.
본 발명의 약학 조성물은, 통상적인 방법에 따라 제제로 배합되는 통상적이고 무독성인 약학적으로 허용가능한 담체를 포함할 수 있다.
상기 약학적으로 허용 가능한 담체는 환자에게 전달하기에 적절한 비-독성 물질이면 어떠한 담체라도 가능하다. 증류수, 알코올, 지방, 왁스 및 비활성 고체가 담체로 포함될 수 있다. 약물학적으로 허용되는 애쥬번트(완충제, 분산제) 또한 약물학적 조성물에 포함될 수 있다.
본 명세서에서 사용된 용어, "약학적으로 허용가능한 담체"란 생물체를 자극하지 않고 투여 화합물의 생물학적 활성 및 특성을 저해하지 않는 담체 또는 희석제를 말한다. 액상 용액으로 제제화되는 조성물에 있어서 허용되는 약학적 담체로는, 멸균 및 생체에 적합한 것으로서, 식염수, 멸균수, 링거액, 완충 식염수, 알부민 주사용액, 덱스트로즈 용액, 말토 덱스트린 용액, 글리세롤, 에탄올 및 이들 성분 중 한 성분 이상을 혼합하여 사용할 수 있으며, 필요에 따라 감미제, 용해 보조제, 습윤제, 유화제, 등장화제, 흡수제, 항산화제, 보존제, 활택제, 충전제, 완충액, 정균제 등 다른 통상의 첨가제를 첨가할 수 있다.
본 발명의 조성물은 비경구 투여(예컨대, 근육내, 정맥내 또는 피하 주사)를 위한 다양한 제형으로 제조될 수 있다. 본 발명의 약학 조성물이 비경구용 제형으로 제조될 경우, 적합한 담체와 함께 당업계에 공지된 방법에 따라 주사제, 경피 투여제, 비강 흡입제 및 좌제의 형태로 제제화될 수 있다. 주사용 제제에는 멸균된 수용액제, 비수성용제, 현탁제, 유제, 동결건조 제제 및 좌제가 포함된다. 비수성용제, 현탁제로는 프로필렌글리콜, 폴리에틸렌글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔, 마크로골, 트윈61, 카카오지, 라우린지, 글리세로제라틴 등이 사용될 수 있다. 한편, 주사제에는 용해제, 등장화제, 현탁화제, 유화제, 안정화제, 방부제 등과 같은 종래의 첨가제가 포함될 수 있다.
약제학적 조성물의 제제화와 관련하여서는 당업계에 공지되어 있으며, 구체적으로 문헌[Remington's Pharmaceutical Sciences(19th ed., 1995)] 등을 참조할 수 있다. 상기 문헌은 본 명세서의 일부로서 간주된다.
본 발명의 항체 또는 조성물은 치료학적으로 유효한 양 또는 약학적으로 유효한 양으로 환자에 투여될 수 있다.
본 명세서에서 사용하는 용어 "투여"란, 적절한 방법으로 개체에게 소정의 물질을 도입하는 것을 의미하며, 상기 조성물의 투여 경로는 목적 조직에 도달할 수 있는 한 어떠한 일반적인 경로를 통하여 투여될 수 있다. 복강내 투여, 정맥내 투여, 근육내 투여, 피하 투여, 피내 투여, 국소 투여, 비내 투여, 직장내 투여될 수 있으나, 이에 한정되지는 않는다.
여기서 "치료학적으로 유효한 양" 또는 "약학적으로 유효한 양"이란 대상 질환을 예방 또는 치료하는데 유효한 항체 또는 조성물의 양으로서, 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분하며 부작용을 일으키지 않을 정도의 양을 의미한다. 상기 유효량의 수준은 환자의 건강상태, 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 방법, 투여 시간, 투여 경로 및 배출 비율, 치료 기간, 배합 또는 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다.
구체적으로, 본 발명의 조성물에서 항체의 유효량은 환자의 나이, 성별, 체중에 따라 달라질 수 있으며, 일반적으로는 체중 kg 당 약 0.1 mg 내지 약 1,000 mg, 또는 약 5 mg 내지 약 200 mg을 매일 또는 격일 투여하거나 1일 1회 내지 3회로 나누어 투여할 수 있다. 그러나, 투여 경로, 질병의 중증도, 성별, 체중, 연령 등에 따라서 증감될 수 있으므로, 본 발명의 범위는 이에 한정되지 않는다.
상기 용어 "개체"란 본 발명의 조성물이 적용(처방)될 수 있는 대상을 의미하며, 인간을 포함한 쥐, 생쥐, 가축 등의 포유동물일 수 있다. 바람직하게는, 인간일 수 있으나 이에 제한되지 않는다.
본 발명의 항체 또는 이를 포함하는 약학 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고, 종래의 치료제와 순차적으로 또는 동시에 투여될 수 있으며, 단일 또는 다중 투여될 수 있다. 이때, 상기 다른 치료제는 항암 활성의 상승, 보강을 위하여 이미 안전성이 검증되고 항암 활성을 갖는 것으로 공지된 임의의 화합물이나 천연 추출물을 추가로 포함할 수 있다.
상기한 요소들을 모두 고려하여 최소한의 부작용으로 또는 부작용 없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여하는 것이 중요하며, 이는 당업자에 의해 용이하게 결정될 수 있다.
본 발명의 또 다른 측면은, 암 예방 또는 치료용 약제를 제조하기 위한 IGSF1에 특이적인 항체 또는 이의 단편의 용도를 제공한다. 여기서 항-IGSF1 항체 및 이의 단편, 암, 예방 및 치료는 상술한 바와 동일하다.
본 발명의 또 다른 측면은, IGSF1에 특이적인 항체 또는 이의 단편의 암 예방 및 치료 용도를 제공한다. 여기서 항-IGSF1 항체 및 이의 단편, 암, 예방 및 치료는 상술한 바와 동일하다.
본 발명의 또 다른 측면은, IGSF1에 특이적인 항체 또는 이의 단편을 개체에 투여하는 단계를 포함하는 암 예방 및 치료 방법을 제공한다. 여기서 항-IGSF1 항체 및 이의 단편, 암, 투여, 치료 및 예방은 상술한 바와 동일하다.
상기 개체는 포유동물일 수 있으며, 바람직하게는 인간일 수 있다. 또한, 상기 개체는 암 환자이거나 암을 앓을 가능성이 큰 개체일 수 있다.
상기 IGSF1에 특이적인 항체 또는 이의 단편의 투여경로, 투여량 및 투여횟수는 환자의 상태 및 부작용의 유무에 따라 다양한 방법 및 양으로 대상에게 투여될 수 있고, 최적의 투여방법, 투여량 및 투여횟수는 통상의 기술자가 적절한 범위로 선택할 수 있다. 또한, 상기 IGSF1에 특이적인 항체 또는 이의 단편은 암에 대하여 치료효과가 공지된 다른 약물 또는 생가학적 활성물질과 병용하여 투여되거나, 다른 약물과의 조합 제제 형태로 제형화될 수 있다.
이하, 본 발명을 하기 실시예에 의해 상세히 설명한다. 단, 하기 실시예는 본 발명을 예시하기 위한 것일 뿐, 본 발명이 이들에 의해 제한되는 것은 아니다.
실시예 1. 항-IGSF1 항체 제작
실시예 1.1. IGSF1 항원 발현 및 정제
Jurkat 세포 cDNA 라이브러리에서 PCR 방법을 통해 IGSF1의 세포외 도메인만을 증폭한 후, N293F 벡터(와이바이오로직스(주))를 이용하여 카복시 말단(C 말단)에 인간 Fc(fragment crystallizable region) 및 히스택(his-tag)을 융합시켜 IGSF1 단백질 발현 벡터를 제작하였다. HEK293F 세포에 제작한 IGSF1 발현 벡터를 형질감염(transfection)시킨 후, 1 mM Valporic acid(valproate)를 첨가한 배지에서 6일 동안 배양하였다. 그리고, protein A 아가로오즈(agarose)를 사용하여 IGSF1 세포외 도메인을 1차 정제(purification)한 후, Superdex 200 겔 여과 크로마토그래피(chratography)를 이용하여 IGSF1 세포외 도메인을 2차 정제한 후, 항체 선별에 사용하였다.
실시예 1.2. IGSF1 인간 항체의 선별
IGSF1 항원을 코팅하고 블로킹한 후 준비된 인간 항체 라이브러리 파아지(phage)(와이바이오로직스(주))를　이용하여　바이오패닝(bio-panning, 와이바이오로직스(주))을 진행하여 항원에 특이적으로 결합한 파아지들만 용출(elution)하였다. 첫 번째 라운드의 바이오패닝에서 증폭된 파아지를 가지고 두 번째 및 세 번째 라운드의 바이오패닝을 수행하였다. 각 라운드의 바이오패닝을 통해 얻어진 양성 파아지 항체 풀(pool)에 대한 항원과의 특이성을 확인하고자 ELISA를 수행하였다. 또한, 세 번째 라운드를 통해 얻어진 파아지 풀에 항-IGSF1 항체가 인리치(enrich)된 것을 확인하였다. 각 폴리 파아지 ELISA에서 결합능이 큰 세 번째 라운드의 패닝으로부터 수 백 종의 모노클론(monoclone)들을 선별하였고, 이를 이용하여 ELISA 분석을 통해 IGSF1에 특이적으로 결합하는지 여부를 확인하여 예비 항체 클론을 확보하였다. 선별된 예비 항체 클론들에 대해 DNA 염기서열 분석을 통해 염기서열이 서로 다른 파아지를 99종 선별하였다. 선별된 99종의 양성 파아지 클론들은 항원인 IGSF1에는 강하게 결합하였으나, 다른 항원들에 대해서는 결합하지 않는 것을 확인하였다. 상기 방법을 통해 추가적으로 다양한 다른 항원을 이용하여 IGSF1 항원에 특이성을 나타내는 항체를 선별한 결과 총 95종을 선별할 수 있었다.
실시예 1.3. IGSF1 항원에 대한 특이성 확인
선별한 항체에 대해 IGSF1을 비롯한 다른 항원들에 대한 특이성을 ELISA 방법을 통해 비교 분석하였다. 대조군 항원들인 mFc, hRAGE-Fc, CD58-Fc, ITGA6-Fc 등 다양한 종류의 불특정 항원에 대해서 파아지 클론들의 결합 여부를 확인하였다. 이와 같이 하여 수득한 항체들에 대해 파아지에서 IgG whole 벡터로 전환을 하였고, 전환된 95개 클론의 중쇄 서열 및 경쇄 서열이 파아지 항체의 서열과 일치하는 것을 확인하였다. 수득된 항체 중 가장 최적화된 항체를 선별하고, 이를 "WM-A1-3389"라 명명하였다. WM-A1-3389 항체의 CDR 서열은 하기 표 1과 같다.
WM-A1-3389
CDR 아미노산 서열 서열번호
H-CDR1 GGTFSTYA 1
H-CDR2 IIPFVGTV 2
H-CDR3 VRDGGRSYFDS 3
L-CDR1 TSNIGSNL 4
L-CDR2 DNH 5
L-CDR3 VAWDDSLNGYV 6
실시예 1.4. WM-A1-3389 항체 생산
WM-A1-3389 항체를 생산하기 위하여, 중쇄(서열번호 21)를 암호화하는 폴리뉴클레오티드(서열번호 23)를 N293F 벡터(와이바이오로직스(주))에 적재하였다(이하, HC DNA). 또한, 경쇄(서열번호 22)를 암호화하는 폴리뉴클레오티드(서열번호 24)를 N293F 벡터(와이바이오로직스(주))에 적재하였다(이하, LC DNA). 상기 벡터를 세포에 형질전환 시킨 후, WM-A1-3389 항체를 수득 및 정제하였다. 정제된 단백질은 SDS-PAGE을 통해 확인하였다.
아미노산 서열 서열번호
중쇄
(heavy chain)		 QVQLVQSGAEVKRPGSSVKVSCKASGGTFSTYAISWVRQAPGQGLEWMGRIIPFVGTVDYAQKFQDRVTITADKSTNTAYMELSSLRSEDTAVYYCVRDGGRSYFDSWGPGILVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK 21
경쇄
(light chain)		 QFVLTQPPSVSAAPGQDVIISCSGNTSNIGSNLVSWFQQFPETAPKLLIYDNHKRPSGISDRFSGTKSGTSASLAISGLQSEDEADYYCVAWDDSLNGYVFGTGTKVTVLRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 22
실시예 2. IGSF1 발현과 종양침윤림프구의 관련성 분석
실시예 2.1. IGSF1 과발현 세포주 제작
IGSF1을 인간 폐암 세포주인 NCI-H292 또는 인간 배아 신장 세포주 HEK293E 세포에 과발현시켜, IGSF1이 과발현된 세포주를 제작하였다(도 1). 이때, MOCK은 IGSF1 발현이 없는 대조군이다.
구체적으로, IGSF1를 코딩하는 폴리뉴클레오티드가 포함된 발현벡터(OriGene Technologies,Inc., Cat No.RC209621)를 인간 폐암 세포주 NCI-H292 세포 또는 인간 배아 신장 세포주 HEK293F 세포에 형질감염(transfection)시켰다. 그 뒤, G418(neomycin)이 포함된 배지에서 배양하여 형질감염된 세포를 선별하였다. 선별된 클론(clone)들에 대해서 IGSF1 발현 수준을 확인하여, 가장 높은 IGSF1 발현을 보인 클론을 선택하여 실험에 사용하였다. MOCK은 IGSF1을 코딩하는 폴리뉴클레오티드가 적재되지 않은 공벡터를 의미한다.
실시예 2.2. 폐암 세포주 스페로이드에서 IGSF1 발현과 종양침윤림프구의 관련성 분석
폐암에서 IGSF1 발현과 종양침윤림프구(tumor-infiltrating lymphocytes, TIL)와의 상관관계를 세포 수준에서 확인하기 위하여, IGSF1을 과발현시킨 폐암 세포를 이용한 스페로이드에서 종양침윤림프구를 확인하였다.
먼저, 폐암 세포 스페로이드를 제작하기 위하여, NCI-H292 IGSF1 O/E 세포 및 NCI-H292 MOCK 세포를 각각 2×104 cells/웰(well)이 되도록 U-Bottom 96-웰 플레이트(Nunc, 174925)에 시딩(seeding)하여 37℃ 이산화탄소 배양기에서 72시간동안 배양하였다. 말초 혈액 단핵세포(peripheral blood mononuclear cell, PBMC)는 1,200 rpm에서 10분간 원심 분리하여 상층액을 제거하고 PBS에 재현탁하여 준비하였다. CFSE(carboxyfluorescein succinimidyl ester, Invitrogen, C34554)에 DMSO 18 ㎕를 넣어 5 mM 농도로 만들고, PBS에 1 mM이 되도록 희석하였다. 준비한 말초 혈액 단핵세포 1×106 cells/㎖ 당 1 mM CFSE 용액을 1 ㎕씩 첨가한 뒤, 37℃ 이산화탄소 배양기에서 10분간 염색하였다. 그리고, PBS 양의 5배 분량의 FBS(fetal bovine serum)가 포함된 배지를 염색한 말초 혈액 단핵세포(PBMC)가 포함된 용액에 첨가하였다. 그 후, 37℃ 이산화탄소 배양기에서 5분간 반응시켰다. 1,200 rpm에서 10분간 원심 분리하여 상층액을 제거한 후, 염색된 말초 혈액 단핵세포를 배지에 재현탁시켜 실험에 사용할 말초 혈액 단핵세포를 준비하였다.
그 후, 형성된 스페로이드를 2웰씩 초저부착 96-웰 플레이트(Corning, CLS3474)에 옮긴 후, CFSE로 염색된 말초 혈액 단핵세포를 1×105 cells/웰이 되도록 시딩하여 37℃ 이산화탄소 배양기에서 24시간 동안 공동 배양하였다. 종양침윤림프구(TIL)는 형광 현미경을 통해 관찰하였다. 이때, NCI-H292 MOCK 세포는 IGSF1 과발현 세포에 대한 대조군으로 사용하였다.
그 결과, IGSF1 과발현 인간 폐암 세포(NCI-H292 IGSF1 O/E) 스페로이드에서 대조군(NCI-H292 MOCK)에 비해 종양침윤림프구(TIL)가 감소하는 것을 확인하였다(도 2).
실시예 2.3. 폐암 세포주를 이식한 인간화 마우스의 종양 조직에서 IGSF1 발현과 종양침윤림프구의 관련성 분석
폐암에서 IGSF1의 발현과 종양침윤림프구(TIL)와의 상관관계를 in vivo 수준에서 확인하기 위하여, IGSF1을 과발현시킨 인간 폐암 세포를 이식한 인간화 마우스의 종양 조직에서 종양침윤림프구를 확인하였다.
구체적으로, 인간 말초 혈액 단핵세포(PBMC)를 이식한 NSG mice(SID(NSGA) mice, F)에 IGSF1 과발현 인간 폐암 세포주인 NCI-H292 IGSF1 O/E 세포 또는 대조군인 NCI-H292 MOCK 세포를 한 마리당 5×106 cells로 이식 후 17일 째에 마우스의 종양 부분을 채취하였다.
채취된 종양에서 각각 인간 말초 혈액 단핵세포를 분리하여 FACS 분석하고, 종양 조직의 면역조직화학염색(immunohistochemistry)을 통해 종양 조직 내의 종양침윤림프구 및 IGSF1 발현량을 확인하였다. 종양에 침윤된 인간 말초 혈액 단핵세포를 확인하기 위하여, 먼저 종양 조직에 collagenase B(Roche, cat. #11088815001)를 처리하고 37℃에서 2시간 이상 반응시켜 종양 조직을 분해시켰다. 종양 조직이 완전히 세포로 분해되면 l ㎖ 파이펫으로 파이펫팅하여 단일 세포로 분리하였다.
분리된 단일 세포를 50 ㎖ 튜브(SPL, cat. #50050)로 옮긴 뒤, PBS 20 ㎖로 세척하였다. 그 후, 1,200 rpm에서 3분간 원심분리하고 상층액을 제거하였다. 남아 있는 세포에 DNase I(Roche, cat. #11284932001)을 37℃에서 20분간 반응시켰다. 그 후, PBS를 20 ㎖ 첨가하고, 1,200 rpm에서 3분간 원심분리하여 상층액을 제거하였다. 남아 있는 세포에 0.25% Trysin/EDTA(GIBCO, cat. #15400-054)를 처리하였다. 세포를 잘 섞은 뒤, 새로운 50 ㎖ 튜브 위에 cell strainer(SPL, cat. #93070)를 올리고 세포를 걸러주었다. 걸러진 세포가 있는 튜브에 20 ㎖ PBS를 첨가하고 잘 혼합하였다. 그 후, 1,200 rpm에서 3분간 원심분리하고 상층액을 제거한 후, 남아있는 세포에 Stain Buffer(BD, cat. #554656) 1 ㎖을 넣고 세척하였다.
분리한 세포의 비특이성 항체 반응을 차단하기 위해 Human Fc block(BD, cat. #564219)을 2 ㎍씩 첨가하고 10분간 상온에서 반응하였다. 반응 후, 항-인간 CD45(BD, cat. #564357) 항체를 넣어 주고 4℃에서 30분간 빛을 차단한 상태로 반응시켰다. 반응 후 Stain Buffer 1 ㎖을 첨가하여 세척하였다. 그 후, 1,200 rpm에서 3분간 원심 분리하고 상층액을 제거하여 세포를 모은 후 Stain Buffer를 200 ㎕씩 첨가하여 BD LSRFortessaTM Flow Cytometer로 분석하였다(도 3).
또한, 면역조직화학염색법을 통해 종양 내 발현된 종양림프구 분포 및 IGSF1의 발현을 확인하였다. 구체적으로, 인간 말초 혈액 단핵세포(PBMC)를 이식한 NSG mice(SID(NSGA) mice, F)에 인간 폐암 세포주인 NCI-H292 IGSF1 O/E 세포 또는 NCI-H292 MOCK 세포를 한 마리당 5×106 cells로 이식하였다. 그 후 17일 째에 마우스에서 채취한 종양 조직의 절편을 탈 파라핀화하고 재수화하였다.
그 후, 열-유도된 에피토프 복구를 위해 표적 복구 완충액에 담궈 전자레인지에서 15분 동안 가열하였다. 그리고, 표적 복구 완충액에서 30분 동안 놓아둔 후, 트리스 완충 식염수-0.05% 트윈 20(TBS-T)로 3번 세척하고, 블로킹 용액으로 60분 간 블로킹하였다. 1차 항체로 항-IGSF1 항체(Santacruz, sc-393786)를 1:100 희석하여 4℃에서 밤새도록(overnight) 결합시켰다. 다음날, TBS-T로 3번 세척하고, 내인성 퍼옥시다제 차단 시약(Cell Marque, 925B)으로 상온에서 5분간 반응시킨 후, 2차 항체(Vector, PK-6101 PK-6102)를 상온에서 60분간 결합시켰다. TBS-T로 3번 세척 후, 아비딘-바이오틴과 60분 동안 반응시켰다. 최종 DAB 염색(Vector, SK-4100)을 실시한 후 탈수 과정을 거쳐 조직 염색을 마무리하고, 염색된 조직 절편을 현미경으로 관찰하였다.
그 결과, 대조군(NCI-H292 MOCK)에 비해 IGSF1 과발현 인간 폐암 세포(NCI-H292 IGSF1 O/E)가 이식된 인간화 마우스의 종양 조직에서 인간 면역세포인 hCD45+ 세포가 감소하는 것을 확인하였다(도 4).
실시예 3. 항-IGSF1 항체의 결합 친화도 분석
실시예 3.1. In vitro 수준에서 항-IGSF1 항체의 결합 친화도 분석
WM-A1-3389 항체의 IGSF1 항원에 대한 결합 친화도(binding affinity)를 ELISA 분석을 이용하여 in vitro 수준에서 확인하였다.
구체적으로, 100 ng IGSF1을 처리하여 96-웰 플레이트를 코팅(coating)한 후, 4% skim milk(PBST)를 200 ㎕씩 첨가하여 상온에서 1시간 동안 블로킹하였다. WM-A1-3389 항체를 4% skim milk(PBST)에 1/3씩 12개 농도로 연속 희석하여 처리한 후, 상온에서 2시간 동안 반응시켰다. 반응이 끝난 후, PBST로 웰을 세척하고 인간 IgG Fc-HRP 항체를 처리하여 상온에서 1시간 동안 반응시켰다. 그리고 PBST로 웰을 세척한 후, TMB peroxidase substrate를 첨가하여 발색 정도를 확인 뒤, 450 nm에서 흡광도를 측정하여 결과를 비교 분석하였다.
그 결과, WM-A1-3389 항체의 Kd 값이 2.2×10-11로, IGSF1 항원에 대해 높은 결합 친화도를 나타냈다(도 5).
실시예 3.2. 세포 내 IGSF1에 대한 항-IGSF1 항체의 결합 친화능 분석
세포 수준에서 WM-A1-3389 항체의 IGSF1 항원에 대한 결합 친화를 확인하기 위하여, IGSF1 과발현 인간 폐암 세포(NCI-H292 IGSF1 O/E) 및 대조군(NCI-H292 MOCK)을 이용하여 IGSF1에 대한 WM-A1-3389 항체의 결합력을 확인하였다.
구체적으로, NCI-H292 IGSF1 O/E 세포 및 NCI-H292 MOCK 세포의 배지를 제거하고, PBS로 1회 세척한 뒤, 0.25% trypsin-EDTA를 2 ㎖ 처리하여 세포를 분리하였다. 분리된 세포는 2% FBS 및 0.05% sodium azide가 포함된 PBS(이하, FACS 버퍼) 8 ㎖로 희석한 뒤, 1,200 rpm에서 1분간 원심 분리하여 상층액을 제거하였다. 그리고, 세포를 1×105 cells/㎖이 되도록 FACS 버퍼로 재현탁시켰다. 그 후, FACS 튜브에 1 ㎖씩 분주하고 1,200 rpm에서 1분간 원심 분리하여 상층액을 제거하였다.
FACS 튜브에 남아있는 펠렛(pellet)을 볼텍싱(vortexing)하여 풀어주고, WM-A1-3389 항체를 FACS 버퍼 200 ㎕당 20 μM에서 0 μM까지 1/4씩 희석하여 총 12개의 농도로 넣은 후, 4℃에서 30분간 반응시켰다. 반응이 끝난 후, 각 튜브에 FACS 버퍼를 1 ㎖씩 넣고 1,200 rpm에서 1분간 원심 분리하여 상층액을 제거하였다. 이 과정은 총 2번 진행하였다. FACS 튜브에 남아있는 펠렛은 볼텍싱하여 풀어주고, FITC가 표지된 염소 항-인간 IgG 항체(Invitrogen, 62-8411)를 FACS 버퍼 200 ㎕당 5 ㎍/㎖씩 넣고 4℃에서 차광하여 30분동안 반응시켰다. 반응 종료 후, 각 튜브에 FACS 버퍼를 1 ㎖씩 첨가하고 1,200 rpm에서 1분간 원심 분리하여 상층액을 제거하였다. 이 과정은 총 2번 실시하였다.
마지막으로 상층액 제거 후 남아있는 펠렛을 FACS 버퍼 200 ㎕에 재현탁하여 FACS 분석하였다. FACS 분석은 BD LSRFortessaTM Flow Cytometer를 이용하여 각 세포에 표지된 FITC 형광값을 측정한 후, FlowJo 소프트웨어를 사용하여 결과 분석하였으며, EC50 값은 sigma plot 프로그램을 사용하여 계산하였다. 이때, NCI-H292 MOCK 세포는 IGSF1 과발현 세포에 대한 대조군으로 사용하였다.
그 결과, 대조군(NCI-H292 MOCK)에서는 WA-A1-3389 항체의 농도와 무관하게 결합이 확인되지 않았다. 반면, IGSF1이 과발현된 인간 폐암 세포(NCI-H292 IGSF1 O/E)에서는 WM-A1-3389 항체의 EC50 값이 69 nM로 확인되었다(도 6).
실시예 4. 세포 내 IGSF1 항원에 대한 항-IGSF1 항체의 항원 특이성 분석
세포 수준에서 IGSF1 항원에 대한 WM-A1-3389 항체의 항원 특이적 결합 능력(target selectivity)을 분석하기 위하여, IGSF1이 과발현된 인간 폐암 세포(NCI-H292 IGSF1 O/E)를 이용하여, 세포에서 발현되는 IGSF1에 대한 WM-A1-3389 항체의 결합을 확인하였다.
구체적으로, IGSF1이 과발현된 인간 폐암 세포(NCI-H292 IGSF1 O/E) 및 이의 대조군(NCI-H292 MOCK)의 배지를 제거하고, PBS로 1회 세척한 뒤, 0.25% trypsin-EDTA를 2 ㎖ 처리하여 세포를 분리하였다. 분리된 세포는 2% FBS 및 0.05% sodium azide가 포함된 PBS(이하, FACS 버퍼) 8 ㎖로 희석한 뒤, 1,200 rpm에서 1분간 원심 분리하여 상층액을 제거하였다. 그리고, 세포를 1×105 cells/㎖이 되도록 FACS 버퍼로 재현탁시켰다. 그 후, FACS 튜브에 1 ㎖씩 분주하고 1,200 rpm에서 1분간 원심 분리하여 상층액을 제거하였다.
FACS 튜브에 남아있는 펠렛을 볼텍싱하여 풀어주고, 인간 IgG isotype 항체(Bio X cell, BE0297) 또는 WM-A1-3389 항체를 FACS 버퍼 200 ㎕ 당 0.4 ㎍씩 넣은 후 4℃에서 30분간 반응시켰다. 반응 종료 후, 각 튜브에 FACS 버퍼를 1 ㎖씩 첨가하고 1,200 rpm에서 1분간 원심 분리하여 상층액을 제거하였다. 이 과정을 총 2번 실시하였다. FACS 튜브에 남아있는 세포 펠렛은 볼텍싱하여 풀어주고, FITC가 표지된 염소 항-인간 IgG 항체(Invitrogen, 62-8411)를 FACS 버퍼 200 ㎕ 당 0.4 ㎍씩 넣고 4℃에서 차광하여 30분동안 반응시켰다.
반응이 끝나고 각 튜브에 FACS 버퍼를 1 ㎖씩 첨가하고 1,200 rpm에서 1분간 원심 분리하여 상층액을 제거하였다. 이 과정을 총 2번 진행하였다. 마지막으로 상층액 제거 후 남아있는 펠렛을 FACS 버퍼 200 ㎕에 재현탁하여 FACS 분석하였다. FACS 분석은 BD LSRFortessaTM Flow Cytometer를 이용하여 각 세포에 표지된 FITC 형광값을 측정하고 FlowJo 소프트웨어를 사용하여 결과 분석하였다. 이때, NCI-H292 MOCK 세포는 IGSF1 과발현 세포에 대한 대조군으로 사용하였고, 인간 IgG isotype은 WM-A1-3389 항체에 대한 대조군으로 사용하였다.
그 결과, WM-A1-3389 항체 처리군은 IgG isotype 처리군과 비교하여 대조군(NCI-H292 MOCK)에서는 2.6%의 결합력을 보였고, IGSF1 과발현 세포(NCI-H292 IGSF1 O/E)에서는 78.9%의 결합을 나타냈다(도 7).
다음으로 IGSF1이 과발현된 NCI-H292 IGSF1 O/E 세포 및 HEK293E IGSF1 O/E 세포에 IGSF1을 코딩하는 mRNA에 특이적으로 결합하는 shRNA(이하, shIGSF1)를 형질 주입하여 IGSF1의 발현을 감소시킨(이하, IGSF1 K/D 세포) 뒤, 세포 내 IGSF1 항원에 대한 WM-A1-3389 항체의 결합력을 측정하였다. 이때, 형질 주입(IGSF1 K/D)의 대조군으로서 shIGSF1을 사용하지 않은 scramble RNA(이하, sc 세포)를 사용하였고, WM-A1-3389 항체에 대한 대조군으로 인간 IgG isotype을 사용하였다. WM-A1-3389 항체의 항원 특이성은 sc 세포에서의 결합력을 기준으로 IGSF1 K/D 세포에서의 결합력을 비교하였다. 또한, IGSF1 과발현 세포에 대한 대조군으로 각각 NCI-H292 MOCK 세포 및 HEK293E MOCK 세포를 사용하였다.
구체적으로, NCI-H292(IGSF1 O/E 및 MOCK) 및 HEK293E(IGSF1 O/E 및 MOCK) 세포주의 배지를 제거하고, PBS로 1회 세척한 뒤, NCI-H292 세포는 0.25% trypsin-EDTA, HEK293E 세포는 0.05% trypsin-EDTA를 각각 2 ㎖씩 처리하여 세포를 분리하였다. 분리된 세포는 배양 배지 8 ㎖로 희석한 뒤, 800 rpm에서 3분간 원심 분리하여 상층액을 제거하였다. 남아있는 세포를 각각 1×105 cells/㎖(NCI-H292), 0.5×105 cells/㎖(HEK293E) 농도가 되도록 재현탁시킨 후, 60 mm 배양 플레이트에 3 ㎖씩 첨가하고, 37℃ 세포 배양기에서 하루동안 배양하였다. 다음 날 shIGSF1 형질 주입을 진행하였다. 1.5 ㎖ 튜브에 jet PRIME 버퍼 200 ㎕와 shIGSF1 10 nM을 넣고 혼합해준 뒤, jet PRIME 시약 4 ㎕를 넣고 혼합하여 상온에서 10분간 반응시켰다. 그리고 전날 준비해 놓은 세포의 배지를 교체한 후, 형질 주입 혼합물을 200 ㎕씩 각 세포에 첨가하여 세포 배양기에서 24시간 반응시켰다. 24시간 뒤에 새로운 배양 배지로 교체하고, 24시간 동안 추가 배양하였다.
형질 주입이 끝난 세포는 배지를 제거하고, 상기와 같은 방법으로 FACS 분석을 수행하였다.
그 결과, sc 세포주에서 인간 IgG isotype 처리군 대비 WM-A1-3389 항체 결합을 확인하였다. 또한, 상기 결합력을 기준으로 IGSF1 발현을 감소시켰을 때(IGSF1 K/D 세포), WM-A1-3389 항체의 결합력이 함께 감소하는 것을 확인하였다(도 8).
실시예 5. 폐암 세포 스페로이드에서 항-IGSF1 항체의 면역 항암 효능 분석
세포 수준에서 WM-A1-3389 항체의 면역 항암 효능을 분석하기 위하여, 폐암 세포 스페로이드와 말초 혈액 단핵세포(PBMC)를 공동 배양하여 종양침윤림프구(TIL) 및 면역원성 세포 사멸을 확인하였다.
폐암 세포 스페로이드와 말초 혈액 단핵세포의 공동 배양은 실시예 2.2와 동일한 방법으로 수행하였다.
공동 배양한 세포와 상층액을 튜브에 모아 1,200 rpm에서 2분간 원심 분리하여 상층액을 제거하였다. 세포 펠렛은 0.25% trypsin-EDTA 500 ㎕를 처리하여 단일 세포로 만든 후, 2% FBS와 0.05% NaN3를 첨가한 PBS(이하, FACS 버퍼) 2 ㎖로 희석한 뒤, 1,200 rpm에서 3분간 원심 분리하여 상층액을 제거하였다. 남은 세포 펠렛을 FACS 버퍼 200 ㎕에 재현탁 시킨 후, 항-HMGB1 항체(Biolegend, 651408) 및 항-Hsp90 항체(Enzo Life Science, ADI-SPA-830PE-D)를 첨가하여 4℃에서 30분간 염색시켰다.
각 튜브에 FACS 버퍼 1 ㎖씩 넣고, 1,200 rpm에서 2분간 원심분리하여 상층액을 제거하였다. 이 과정을 총 2번 반복하였다. 그 후, BD LSRFortessaTM Flow Cytometer를 이용하여 분석하였다. FACS 분석 결과는 FlowJo 소프트웨어를 사용하여 분석하였다. 또한, 종양침윤림프구(TIL)는 형광 현미경을 통해 관찰하였다. 이때, WM-A1-3389 항체에 대한 대조군으로 인간 IgG isotype을 사용하였다.
그 결과, IGSF1 과발현 폐암 세포(NCI-H292 IGSF1 O/E) 스페로이드에서 대조군에 비해 WM-A1-3389 항체 처리군에서 종양침윤림프구(TIL)가 증가하는 것을 확인하였다(도 9). 또한 면역원성 세포 사멸(ICD)도 IGSF1 과발현 폐암 세포 스페로이드에서 대조군에 비해 WM-A1-3389 항체 처리군에서 증가하는 것을 확인하였다(도 10).
실시예 6. 동종이식 마우스 모델에서 항-IGSF1 항체의 종양 성장 억제 효능 분석
동물 수준에서의 WM-A1-3389 항체의 항암 효능을 확인하기 위하여, 말초 혈액 단핵세포 인간화 모델(PBMC humanized model) 마우스에 IGSF1이 과발현된 인간 폐암 세포(NCI-H292 IGSF1 O/E)를 이식한 후, WM-A1-3389 항체의 종양 성장 억제 효능을 평가하였다.
구체적으로, 6주령 암컷 말초 혈액 단핵세포 인간화 마우스(Gem biosciences)를 구입하여 1주 동안 순화 후, IGSF1이 과발현 인간 폐암 세포 NCI-H292 IGSF1 O/E(5×106 cells/마리)를 PBS와 Matrigel에 희석하여 마우스의 오른쪽 배측면에 피하(200 ㎕)로 주사하였다. 종양의 크기가 약 120 mm3이 되었을 때 IgG isotype(대조군) 또는 WM-A1-3389 항체를 각각 10 mg/kg 용량으로 복강 투여하였다. 투여는 3일에 한 번씩 4주 동안 실시하였으며, 주 2회 마우스의 종양 크기와 체중을 측정하였다. 투여 22일째 되는 날, Satellite group 마우스의 혈액과 종양을 채취하여 FACS 분석을 실시하였다. 투여가 종료된 후, 실험 동물을 안락사시켜 종양을 적출하여 무게를 측정하였다. WM-A1-3389 항체에 대한 대조군으로 인간 IgG isotype을 사용하였다.
그 결과, WM-A1-3389 항체 투여군은 대조군에 비해 종양 성장 억제 효능이 높게 나타났으며, 약 64.5%의 종양 억제율(TGI)을 보였다(도 11). 또한, 개별 개체들에 대해서도 종양 성장이 억제되는 것을 확인할 수 있었다(도 12).
실시예 7. 코카서스 인종 폐암 환자 조직에서 IGSF1 발현 분석
코카서스 인종(caucasian) 폐암 환자 조직에서 IGSF1의 발현을 면역조직화학염색법으로 확인하였다.
구체적으로, 인간 비소세포 폐암(non-small cell lung cancer) 환자 조직 절편을 탈 파라핀화하고 재수화한 뒤, 열-유도된 에피토프 복구를 위해 표적 복구 완충액에 담근 후, 전자레인지에서 15분동안 가열하였다. 그 후, 표적 복구 완충액에 30분 추가 반응시켰다. 그 후, 트리스 완충 식염수 0.05% 트윈 20(TBS-T)로 3번 세척 후, 블로킹 용액으로 60분 동안 블로킹하였다. 1차 항체로 항-IGSF1 항체(Santacruz, sc-393786)를 1:100으로 희석하여 4℃에서 밤새도록(overnight) 결합시켰다. 다음날, 조직 절편을 TBS-T로 3번 세척한 후, 내인성 퍼옥시다제 차단 시약(Cell Marque, 925B)으로 5분 동안 반응시켰다. 그리고, 2차 항체(Vector, PK-6101 PK-6102)를 상온에서 60분 동안 결합시켰다. 그 후, TBS-T로 3번 세척하고 아비딘-바이오틴을 처리하고 60분 동안 반응시킨 뒤, DAB 염색(Vector, SK-4100)을 수행하였다. 염색된 조직 절편을 현미경을 통해 관찰하였다(도 13).

Claims (12)

  1. IGSF1의 C 말단에 특이적으로 결합하는 항-IGSF1 항체를 유효성분으로 포함하는 항암제.
  2. 서열번호 1의 H-CDR1, 서열번호 2의 H-CDR2 및 서열번호 3의 H-CDR3을 포함하는 중쇄 가변영역; 및
    서열번호 4의 L-CDR1, 서열번호 5의 L-CDR2 및 서열번호 6의 L-CDR3을 포함하는 경쇄 가변영역을 포함하는 것인, IGSF1에 특이적인 항체 또는 이의 단편.
  3. 제2항에 있어서,
    상기 중쇄 가변영역은 서열번호 7의 아미노산 서열을 가지며;
    상기 경쇄 가변영역은 서열번호 8의 아미노산 서열을 가지는 것인, IGSF1에 특이적인 항체 또는 이의 단편.
  4. 서열번호 1의 H-CDR1, 서열번호 2의 H-CDR2 및 서열번호 3의 H-CDR3을 포함하는 중쇄 가변영역을 암호화하는 폴리뉴클레오티드.
  5. 서열번호 4의 L-CDR1, 서열번호 5의 L-CDR2 및 서열번호 6의 L-CDR3을 포함하는 경쇄 가변영역을 암호화하는 폴리뉴클레오티드.
  6. 제4항 및 제5항의 폴리뉴클레오티드를 포함하는 발현 벡터.
  7. 제6항의 벡터가 도입된 형질전환 세포.
  8. i) 제7항의 형질전환 세포를 배양하는 단계; 및
    ii) IGSF1에 특이적인 항체 또는 이의 단편을 회수하는 단계를 포함하는 IGSF1에 특이적인 항체 또는 이의 단편의 생산방법.
  9. 제2항 또는 제3항의 IGSF1에 특이적인 항체 또는 이의 단편을 유효성분으로 포함하는 암 예방 또는 치료용 약학 조성물.
  10. 제9항에 있어서,
    상기 암은 IGSF1이 과발현된 것을 특징으로 하는, 암 예방 또는 치료용 약학 조성물.
  11. 제10항에 있어서,
    상기 암은 위암, 간암, 폐암, 비소세포 폐암, 대장암, 방광암, 골암, 혈액암, 유방암, 흑색종양, 갑상선암, 부갑상선암, 골수암, 직장암, 인후암, 후두암, 식도암, 췌장암, 설암, 피부암, 뇌종양, 자궁암, 두부 또는 경부암, 담낭암, 구강암, 항문 부근암, 결장암 및 중추신경계 종양으로 구성된 군으로부터 선택되는 어느 하나인 것인, 암 예방 또는 치료용 약학 조성물.
  12. 제2항 또는 제3항의 IGSF1에 특이적인 항체 또는 이의 단편을 개체에 투여하는 단계를 포함하는 암 예방 또는 치료 방법.
PCT/KR2021/011139 2021-08-20 2021-08-20 항-igsf1 항체 및 이의 용도 WO2023022271A1 (ko)

Priority Applications (6)

Application Number Priority Date Filing Date Title
CA3177927A CA3177927A1 (en) 2021-08-20 2021-08-20 Anti-igsf1 antibody and use thereof
CN202180048750.4A CN116635418A (zh) 2021-08-20 2021-08-20 抗igsf1抗体及其用途
AU2021437023A AU2021437023A1 (en) 2021-08-20 2021-08-20 Anti-IGSF1 antibody and use thereof
BR112022021592A BR112022021592A2 (pt) 2021-08-20 2021-08-20 Anticorpo anti-igsf1 e uso do mesmo
PCT/KR2021/011139 WO2023022271A1 (ko) 2021-08-20 2021-08-20 항-igsf1 항체 및 이의 용도
KR1020237005825A KR20240046103A (ko) 2021-08-20 2021-08-20 항-igsf1 항체 및 이의 용도

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
PCT/KR2021/011139 WO2023022271A1 (ko) 2021-08-20 2021-08-20 항-igsf1 항체 및 이의 용도

Publications (1)

Publication Number Publication Date
WO2023022271A1 true WO2023022271A1 (ko) 2023-02-23

Family

ID=85223221

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2021/011139 WO2023022271A1 (ko) 2021-08-20 2021-08-20 항-igsf1 항체 및 이의 용도

Country Status (6)

Country Link
KR (1) KR20240046103A (ko)
CN (1) CN116635418A (ko)
AU (1) AU2021437023A1 (ko)
BR (1) BR112022021592A2 (ko)
CA (1) CA3177927A1 (ko)
WO (1) WO2023022271A1 (ko)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024090916A1 (ko) * 2022-10-24 2024-05-02 웰마커바이오 주식회사 항-ｉｇｓｆ1 항체를 포함하는 암 치료용 약학 조성물

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090053243A1 (en) * 2005-02-27 2009-02-26 Institute For Antibodies Co., Ltd Anti-IgSF4 Antibody and Utilization of the Same
KR20160014564A (ko) 2014-07-29 2016-02-11 재단법인 아산사회복지재단 Met 저해제에 대한 감수성 예측용 신규한 바이오 마커 및 이의 용도

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20090053243A1 (en) * 2005-02-27 2009-02-26 Institute For Antibodies Co., Ltd Anti-IgSF4 Antibody and Utilization of the Same
KR20160014564A (ko) 2014-07-29 2016-02-11 재단법인 아산사회복지재단 Met 저해제에 대한 감수성 예측용 신규한 바이오 마커 및 이의 용도

Non-Patent Citations (7)

* Cited by examiner, † Cited by third party
Title
BERNARD DANIEL J, BRÛLÉ EMILIE, SMITH COURTNEY L, JOUSTRA SJOERD D, WIT JAN M: "From Consternation to Revelation: Discovery of a Role for IGSF1 in Pituitary Control of Thyroid Function", JOURNAL OF THE ENDOCRINE SOCIETY, vol. 2, no. 3, 1 March 2018 (2018-03-01), US , pages 220 - 231, XP093036316, ISSN: 2472-1972, DOI: 10.1210/js.2017-00478 *
ENGELSUHLMANN, ANGEW CHEM INTED ENGL., vol. 37, 1988, pages 73 - 127
GILLIES ET AL., J. IMMUNOL. METHODS, vol. 125, 1989, pages 191 - 202
SAKANO ET AL., NATURE, vol. 286, 1980, pages 676 - 683
WANG YING, BRÛLÉ EMILIE, SILANDER TANYA, BAK BEATA, JOUSTRA SJOERD D., BERNARD DANIEL J.: "The short mRNA isoform of the immunoglobulin superfamily, member 1 gene encodes an intracellular glycoprotein", PLOS ONE, vol. 12, no. 7, 7 July 2017 (2017-07-07), pages e0180731 - e0180731-11, XP093036318, DOI: 10.1371/journal.pone.0180731 *
WATSON ET AL., NUCLEIC ACID RESEARCH, vol. 12, 1984, pages 5145 - 5164
YAOYAO GUAN; YINGHAO WANG; ADHEESH BHANDARI; ERJIE XIA; OUCHEN WANG: "IGSF1: A novel oncogene regulates the thyroid cancer progression", CELL BIOCHEMISTRY AND FUNCTION, vol. 37, no. 7, 25 July 2019 (2019-07-25), GB , pages 516 - 524, XP071523442, ISSN: 0263-6484, DOI: 10.1002/cbf.3426 *

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2024090916A1 (ko) * 2022-10-24 2024-05-02 웰마커바이오 주식회사 항-ｉｇｓｆ1 항체를 포함하는 암 치료용 약학 조성물

Also Published As

Publication number Publication date
CA3177927A1 (en) 2023-02-20
BR112022021592A2 (pt) 2023-03-14
KR20240046103A (ko) 2024-04-08
AU2021437023A1 (en) 2023-03-09
CN116635418A (zh) 2023-08-22

Similar Documents

Publication Publication Date Title
EP2718323B1 (en) HUMAN ANTIGEN BINDING PROTEINS THAT BIND TO A COMPLEX COMPRISING BETA-KLOTHO AND AN FGFR1c
JP7361610B2 (ja) 抗ｐｄ－ｌ１抗体及びその使用
WO2020111913A1 (en) Anti-4-1bb antibody and use thereof
KR101683884B1 (ko) 항-ＥｐＣＡＭ 항체 및 이의 용도
KR100909290B1 (ko) 항암 항체
WO2021201571A1 (ko) Igsf1 에 대한 항체를 유효성분으로 포함하는 암 예방 또는 치료용 약학 조성물 및 이를 이용한 암 치료 방법
WO2021256724A1 (ko) Bcma를 표적으로 하는 키메라 항원 수용체 및 이의 용도
KR20210142638A (ko) Cd3 항원 결합 단편 및 이의 응용
TW202115123A (zh) 一種抗ｐｄ－ｌ１抗原結合蛋白及其應用
WO2023022271A1 (ko) 항-igsf1 항체 및 이의 용도
CN114369161B (zh) Mica抗体及其应用
KR20180016320A (ko) 프로그램화된 세포 사멸 단백질(pd-1)에 대한 신규 항체 및 이의 용도
JP2024502758A (ja) Ｃｄ７３結合タンパク質及びその使用
WO2017074013A1 (ko) 인간 및 마우스 sema3a에 교차결합하는 항체 및 그의 용도
WO2019216675A1 (ko) 조절 t 세포 표면 항원의 에피토프 및 이에 특이적으로 결합하는 항체
WO2022231032A1 (ko) 항-cntn4 특이적 항체 및 그의 용도
WO2022216014A1 (ko) 항-cntn4 항체 및 그의 용도
WO2023211068A1 (ko) 항-igsf1 항체 및 항-pd-1 항체를 포함하는 암 치료용 약학 조성물
WO2022025585A1 (ko) 항-lilrb1 항체 및 그의 용도
WO2023229303A1 (ko) Igsf1의 c-말단에 결합하는 항체 및 이의 용도
EP4161962A1 (en) Human anti-grp94 antibodies and uses
WO2023277627A1 (ko) 뇌혈관장벽 투과성 융합 단백질 및 이의 용도
WO2022124764A1 (ko) Cd47에 특이적인 항체 및 이의 용도
WO2023090780A1 (ko) 자연살해세포-특이적 키메릭항원수용체 및 이의 용도
WO2022250450A1 (ko) 항 메소텔린 scFv를 포함하는 키메릭 항원 수용체 및 이의 용도

Legal Events

Date Code Title Description
ENP Entry into the national phase

Ref document number: 3177927

Country of ref document: CA

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 202180048750.4

Country of ref document: CN

WWE Wipo information: entry into national phase

Ref document number: 17997019

Country of ref document: US

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112022021592

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 2021437023

Country of ref document: AU

Date of ref document: 20210820

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 112022021592

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20221024

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 21930594

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2021930594

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2021930594

Country of ref document: EP

Effective date: 20240320