WO2023090780A1 - 자연살해세포-특이적 키메릭항원수용체 및 이의 용도 - Google Patents

자연살해세포-특이적 키메릭항원수용체 및 이의 용도 Download PDF

Info

Publication number
WO2023090780A1
WO2023090780A1 PCT/KR2022/017855 KR2022017855W WO2023090780A1 WO 2023090780 A1 WO2023090780 A1 WO 2023090780A1 KR 2022017855 W KR2022017855 W KR 2022017855W WO 2023090780 A1 WO2023090780 A1 WO 2023090780A1
Authority
WO
WIPO (PCT)
Prior art keywords
cancer
natural killer
cells
chimeric antigen
cell
Prior art date
Application number
PCT/KR2022/017855
Other languages
English (en)
French (fr)
Inventor
김헌식
박효진
이은비
Original Assignee
재단법인 아산사회복지재단
울산대학교 산학협력단
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from KR1020220149000A external-priority patent/KR20230077650A/ko
Application filed by 재단법인 아산사회복지재단, 울산대학교 산학협력단 filed Critical 재단법인 아산사회복지재단
Publication of WO2023090780A1 publication Critical patent/WO2023090780A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14—Blood; Artificial blood
    • A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues

Definitions

  • the present invention relates to natural killer cell-specific chimeric antigen receptors, natural killer cells expressing the same, and uses thereof.
  • Cancer is one of the diseases that account for the largest share of the causes of death of modern people. It is a disease caused by changes in normal cells due to gene mutations, etc. refers to something Cancer is particularly characterized by "uncontrolled cell growth", and by this abnormal cell growth, a cell mass called a tumor is formed and invades surrounding tissues and, in severe cases, may metastasize to other organs of the body. . Cancer is an intractable chronic disease that in many cases cannot be fundamentally cured even when treated with surgery, radiation, and drug therapy, causing pain to patients and ultimately leading to death. In particular, in recent years, the incidence of cancer in the world is increasing by more than 5% every year due to the increase in the elderly population and environmental degradation. It is estimated that 10,000 people will die of cancer.
  • Cancer drug treatment that is, anticancer drugs
  • these targeted anticancer drugs although side effects could be lowered, they showed a limitation in that resistance developed with a high probability. Therefore, interest in immuno-cancer agents that reduce problems due to toxicity and resistance by using the body's immune system is rapidly increasing.
  • an immune checkpoint inhibitor has been developed that specifically binds to PD-L1 on the surface of cancer cells, inhibits the binding of T cells to PD-1, activates T cells, and makes them attack cancer cells.
  • these immune checkpoint inhibitors since the types of cancer exhibiting effects are not diverse, there is an urgent need to develop new immune checkpoint inhibitors that exhibit the same therapeutic effect in various cancers.
  • Natural killer cells one of the representative immune cells used in anticancer immune cell therapy, are a type of cytotoxic lymphocyte responsible for the innate immune response. Morphologically, they have large granules in the cytoplasm, It accounts for 5 to 20% of blood lymphocytes. Natural killer cells have various immunoreceptors on their surface, so they can distinguish between cancer cells and normal cells, so they have the advantage of being able to immediately detect and remove cancer cells.
  • natural killer cells not only inhibit the occurrence, proliferation, and metastasis of cancer cells and virus-infected cells, but also can effectively remove cancer stem cells, so they can prevent the recurrence of cancer caused by cancer stem cells and are considered effective anti-cancer immune cells.
  • various clinical studies have shown that when natural killer cells isolated from relatives or normal people are introduced into patients, the immune rejection reaction is extremely low compared to other immune cells, and thus the possibility of using them as cell therapy agents is attracting attention.
  • chimeric antigen receptors are artificial receptors designed to deliver antigen specificity to immune cells, and they include antigen-specific components, transmembrane components selected to activate immune cells and provide specific immunity. , and intracellular components.
  • CARs chimeric antigen receptors
  • the most representative immunotherapy is a method of treating cancer by collecting T cells from a patient, introducing and amplifying a gene encoding a chimeric antigen receptor, and translocating the gene back to the patient, that is, therapy using CAR-T cells. am.
  • CAR-T cells have side effects such as cytokine release syndrome or neurotoxicity, and there is a limitation in that autologous T cells must be used to prevent immune rejection. Furthermore, there are problems in that the manufacturing process of autologous CAR-T is very complicated, the manufacturing cost is considerable, and there are still problems of side effects on immunity. In order to overcome this, research on an allogenic off-the-shelf CAR-T is being conducted, but a CAR-T capable of solving the above problems has not yet been developed.
  • CAR-NK natural killer cell-based treatment
  • CAR-NK natural killer cell-based treatment
  • allogeneic cells can be used.
  • NK cells are more efficient in that they can be provided off-the-shelf and do not need to be customized for individual patients. It is expected that it will be applicable to -T-resistant carcinoma.
  • CAR-NK therapeutics using NK cells can be mass-produced, which can reduce the cost of treatment, and is considered an alternative treatment that can reduce solid cancer treatment and cytokine side effects due to low immunogenicity.
  • studies on chimeric antigen receptors to date have been mostly based on T cell components, and it is difficult to apply them to NK cells. Therefore, there is a need to develop new chimeric antigen receptors tailored to the characteristics of NK cells.
  • the present invention was made to solve the above problems, and a chimeric antigen receptor comprising a specific combination of natural killer cell-specific activating receptor domains effectively activates natural killer cells to promote target cell (e.g., cancer cell) killing activity It is done by confirming that it can be done.
  • target cell e.g., cancer cell
  • an object of the present invention is to provide a natural killer cell-specific chimeric antigen receptor.
  • Another object of the present invention is to provide natural killer cells expressing the chimeric antigen receptor.
  • Another object of the present invention is to provide a nucleic acid molecule encoding the chimeric antigen receptor and/or an expression vector containing the same.
  • Another object of the present invention is to provide a cell transformed with the expression vector.
  • Another object of the present invention is to provide a pharmaceutical composition for the prevention or treatment of cancer, containing natural killer cells expressing the chimeric antigen receptor as an active ingredient.
  • Another object of the present invention is to provide a cell therapy agent for preventing or treating cancer, comprising natural killer cells expressing the chimeric antigen receptor as an active ingredient.
  • Another object of the present invention is (S1) transforming the expression vector into isolated cells.
  • step (S2) To provide a method for producing a natural killer cell-specific chimeric antigen receptor, comprising culturing the transformed cell obtained in step (S1).
  • the present invention provides a natural killer cell-specific chimeric antigen receptor, comprising: (i) an antigen-binding domain; (ii) a CD8 or CD28 hinge domain; (iii) DAP10 intracellular signaling domain; (iv) a 2B4 intracellular signaling domain; and (v) a CD3z intracellular signaling domain, wherein the chimeric antigen receptor is expressed in natural killer cells.
  • the antigen-binding domain may be a tumor antigen-specific antibody or an antigen-binding fragment thereof, but is not limited thereto.
  • the chimeric antigen receptor may satisfy one or more of the following characteristics, but is not limited thereto:
  • the CD8 hinge domain comprises the amino acid sequence of SEQ ID NO: 2;
  • the CD28 hinge domain comprises the amino acid sequence of SEQ ID NO: 3;
  • the DAP10 intracellular signaling domain comprises the amino acid sequence of SEQ ID NO: 7;
  • the 2B4 intracellular signaling domain comprises the amino acid sequence of SEQ ID NO: 8.
  • the CD3z intracellular signaling domain comprises the amino acid sequence of SEQ ID NO: 9.
  • the chimeric antigen receptor may further include a CD28 transmembrane domain, but is not limited thereto.
  • the CD28 transmembrane domain may include the amino acid sequence of SEQ ID NO: 4, but is not limited thereto.
  • the chimeric antigen receptor may further include at least one selected from the group consisting of a DAP10 extracellular domain and a DAP10 transmembrane domain, but is not limited thereto.
  • the chimeric antigen receptor may satisfy one or more of the following characteristics, but is not limited thereto:
  • the DAP10 extracellular domain comprises the amino acid sequence of SEQ ID NO: 5;
  • the DAP10 transmembrane domain comprises the amino acid sequence of SEQ ID NO: 6.
  • the chimeric antigen receptor may further include a signal peptide, but is not limited thereto.
  • the signal peptide may be a CD8 signal peptide, but is not limited thereto.
  • the tumor antigen is CD19, TAG72, IL13R ⁇ 2 (Interleukin 13 receptor alpha-2 subunit), CD52, CD33, CD20, TSLPR, CD22, CD30, GD3, CD171, NCAM (Neural cell adhesion molecule ), FBP (Folate binding protein), Le(Y) (Lewis-Y antigen), PSCA (Prostate stem cell antigen), PSMA (Prostate-specific antigen membrane), CEA (Carcinoembryonic antigen), HER2 (Human epidermal growth factor receptor) 2), Mesothelin, CD44v6 (Hyaluronate receptor variant 6), B7-H3, Glypican-3, ROR1 (receptor tyrosine kinase like orphan receptor 1), Survivin, FOLR1 (folate receptor 1), WT1 (Wilm's tumor 1), VEGFR2 ( It may be one or more selected from the group consisting of vascular endothelial growth factor
  • the antigen-binding fragment may be selected from the group consisting of scFv, (scFv) 2 , Fab, Fab', and F(ab') 2 , but is not limited thereto.
  • the tumor antigen-specific antibody or antigen-binding fragment thereof may include the following heavy chain variable region and light chain variable region, but is not limited thereto:
  • a heavy chain variable region comprising a heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 26, a heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 27, and a heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 28;
  • a light chain variable region comprising a light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 30, and a light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 31.
  • the tumor antigen-specific antibody or antigen-binding fragment thereof may include the amino acid sequence of SEQ ID NO: 1, but is not limited thereto.
  • the present invention provides natural killer cells expressing the natural killer cell-specific chimeric antigen receptor according to the present invention. That is, the present invention provides a CAR-NK cell containing (expressing) the chimeric antigen receptor.
  • the natural killer cells may satisfy one or more characteristics selected from the group consisting of, but are not limited thereto:
  • the present invention provides a nucleic acid molecule encoding a natural killer cell-specific chimeric antigen receptor according to the present invention.
  • the present invention provides an expression vector containing the nucleic acid molecule.
  • the present invention provides an isolated cell into which the expression vector is introduced.
  • the present invention provides a pharmaceutical composition for preventing or treating cancer, comprising natural killer cells expressing natural killer cell-specific chimeric antigen receptors according to the present invention as an active ingredient.
  • the antigen-binding domain of the chimeric antigen receptor is a tumor antigen-specific antibody or antigen-binding fragment thereof.
  • the present invention provides a cell therapy agent for preventing or treating cancer, comprising natural killer cells expressing a natural killer cell-specific chimeric antigen receptor according to the present invention as an active ingredient.
  • the present invention provides a method for preventing or treating cancer, comprising administering natural killer cells expressing the natural killer cell-specific chimeric antigen receptor to a subject in need thereof.
  • the present invention provides the natural killer cell-specific chimeric antigen receptor, a nucleic acid molecule encoding the chimeric antigen receptor, an expression vector containing the nucleic acid molecule, and the introduction of the expression vector for the prevention or treatment of cancer.
  • the uses of the cells, and/or natural killer cells expressing the chimeric antigen receptor are provided.
  • the present invention provides the natural killer cell-specific chimeric antigen receptor, a nucleic acid molecule encoding the chimeric antigen receptor, an expression vector containing the nucleic acid molecule, and the expression vector for the production of a drug for cancer treatment.
  • the use of the introduced cells and/or natural killer cells expressing the chimeric antigen receptor is provided.
  • the drug may be a cell therapy agent for cancer treatment.
  • the cancer is colorectal cancer, rectal cancer, colon cancer, thyroid cancer, oral cancer, pharynx cancer, laryngeal cancer, cervical cancer, brain cancer, lung cancer, ovarian cancer, bladder cancer, kidney cancer, liver cancer, pancreatic cancer, prostate cancer, skin cancer , tongue cancer, breast cancer, uterine cancer, stomach cancer, bone cancer, lymphoma, hematological cancer, squamous cell carcinoma, adenocarcinoma of the lung, peritoneal cancer, skin cancer, skin melanoma, ocular melanoma, rectal cancer, perianal cancer, esophageal cancer, small intestine cancer, endocrine It may be at least one selected from the group consisting of adenocarcinoma, parathyroid cancer, adrenal cancer, soft tissue sarcoma, urethral cancer, gastrointestinal cancer, glioblastoma, ovarian cancer, endometrial cancer, salivary gland cancer, vulvar cancer
  • the present invention also includes (S1) introducing the expression vector into an isolated cell; and (S2) culturing the cells into which the expression vector has been introduced.
  • the present invention also provides a method for producing natural killer cells expressing a natural killer cell-specific chimeric antigen receptor, comprising introducing the expression vector into the isolated natural killer cells.
  • the present invention relates to a natural killer cell-specific chimeric antigen receptor (NK-CAR), and the like, wherein an NK-CAR comprising a specific combination of natural killer cell-specific activation receptor-derived domains effectively activates natural killer cells to target cells. It was completed by confirming that it could enhance the killing ability. Specifically, the inventors prepared three natural killer cell-specific CARs composed of combinations of specific domains, and natural killer cells expressing the NK-CAR produced cytokines and granzyme B in response to target cells. It was confirmed that the activation of AKT and ERK was further enhanced, and degranulation was promoted to exert a more excellent apoptotic activity.
  • NK-CAR natural killer cell-specific chimeric antigen receptor
  • the NK-CAR according to the present invention can enhance the apoptotic activity by strongly inducing the activation of natural killer cells, it can be used as an immunotherapy for the treatment of various diseases including cancer.
  • CAR-based anti-cancer treatment using natural killer cells does not cause cytokine release syndrome or neurotoxicity, and since autologous and allogeneic natural killer cells can be used, it has the advantage of having fewer side effects than CAR-T. Therefore, natural killer cells expressing NK-CAR according to the present invention are expected to be used as cell therapy agents with maximized disease treatment effects while reducing side effects.
  • FIG. 1 shows the structures of chimeric antigen receptors NK-CAR1, NK-CAR2, and NK-CAR3 according to the present invention, and a control 2 nd generation CAR.
  • Figure 2a shows the result of confirming the ratio of GFP and NK-CAR expressing cells 3 days after infection of NKL cells with the NK-CAR retrovirus according to the present invention by flow cytometry.
  • Figure 2b shows the result of confirming the ratio of GFP and NK-CAR expressing cells among NKL cells by isolating and culturing GFP-expressing cells 3 days after retrovirus infection by flow cytometry.
  • Figure 2c shows the result of confirming the ratio of GFP and NK-CAR expressing cells 3 days after infection of NK-92 cells with the NK-CAR retrovirus according to the present invention by flow cytometry.
  • FIG. 2D shows the results obtained by isolating and culturing GFP-expressing cells from NK-92 cells 3 days after retrovirus infection, and then confirming the ratio of GFP- and NK-CAR-expressing cells among them by flow cytometry.
  • Figure 3a shows the results of measuring the apoptotic activity of an empty vector, a control 2 nd CAR, or NK-CAR expressing NKL cells according to the present invention on a CD19 positive REH cell line by Europium assay (EV: empty vector, hereinafter the same) .
  • Figures 3b and 3c show the apoptotic activity of NK92 cells expressing an empty vector, a control 2 nd CAR, or an NK-CAR according to the present invention against CD19 positive REH cell line (Fig. 3b) and RAMOS cell line (Fig. 3c) Europium assay Indicates the result of measurement with .
  • FIG. 4a and 4b show MPI-1 ⁇ (FIG. 4a) and granzyme secreted from NKL cells after co-culture of an empty vector, a control 2 nd CAR, and CAR-NK expressing NKL cells according to the present invention with a CD19 positive REH cell line, respectively.
  • B shows the results of measuring the level by ELISA.
  • Figure 5a shows the result of confirming the degree of activation of AKT and ERK signals by Western blot after stimulating NKL cells or NK-CAR expressing NKL cells with CD19-positive REH cells for 2 or 5 minutes.
  • Figure 5b shows the result of confirming the activation of AKT and ERK signals by Western blot after stimulating NKL cells or NK-CAR expressing NKL cells with recombinant human CD19 Fc chimera for 2 or 5 minutes.
  • Figure 6 shows the results of measuring the degree of degranulation of NK92 cells after co-culture of NK92 cells expressing an empty vector, a control 2 nd CAR, or an NK-CAR according to the present invention with CD19-positive cells (REH or Ramos).
  • Figure 7 shows the ratio of Interferon- ⁇ -positive NK92 cells after co-culture of NK92 cells expressing an empty vector, a control 2 nd CAR, or an NK-CAR according to the present invention with CD19-positive cells (REH or Ramos). show the result.
  • FIG. 10 shows an example of a preferred amino acid sequence of NK-CAR3.
  • the present invention relates to a natural killer cell (NK cell)-specific chimeric antigen receptor (CAR), etc., wherein a chimeric antigen receptor containing a specific combination of natural killer cell-specific activated receptor domains is It was completed after confirming that it is effective in activating natural killer cells and can induce cancer cell specific death.
  • NK cell natural killer cell
  • CAR chimeric antigen receptor
  • a retroviral vector of three NK-CAR genes and a T cell-based CAR (control) gene according to the present invention was constructed (Example 1), and a retrovirus into which the vector was introduced was used to express chimeric antigen receptors in natural killer cells (NKL cells and NK92 cells) (Example 2).
  • both NK-CAR expressing NKL cells and NK92 cells kill target cells (cancer cells) more effectively than the control group. confirmed (Example 3).
  • NK-CAR-expressing NKL cells as a result of evaluating the cytokine secretion ability of NK-CAR-expressing NKL cells, when NK-CAR-expressing NKL cells were stimulated with target cells (cancer cells), MIP-1 ⁇ and granzyme B levels were decreased compared to the control group. It was confirmed that the amount of secretion was further increased (Example 4).
  • NK-CAR-expressing NKL cells were stimulated with target antigen protein or cancer cells expressing target antigen When compared to the control group, it was confirmed that the phosphorylation levels of AKT and ERK were further increased (Example 5).
  • NK-CAR-expressing NK92 cells showed a higher degree of degranulation according to target antigen recognition than the control group (Example 6).
  • NK-CAR-expressing NK92 cells produced a higher degree of cytokine production according to target antigen recognition than the control group (Example 7).
  • the natural killer cell-specific chimeric antigen receptor according to the present invention can more effectively activate natural killer cells in response to a target and enhance their apoptotic activity, thereby preventing and treating various diseases including cancer. It is expected to be used as a new immunotherapy method.
  • the present invention provides a natural killer cell-specific chimeric antigen receptor characterized in that it is expressed in natural killer cells.
  • chimeric antigen receptor refers to synthetic receptors capable of targeting a specific antigen.
  • the CAR according to the present invention has the structure of a receptor including an antigen-binding domain, a transmembrane domain, and a cytoplasmic domain, preferably a hinge region ( hinge region).
  • antigen-binding domain refers to a protein or polypeptide domain capable of specifically recognizing and binding a target antigen.
  • antigen refers to a polypeptide, compound, or other substance that can specifically bind to humoral immune mediators such as antibodies or cellular immune mediators such as T cell receptors. do.
  • the antigen according to the present invention is not limited to a specific type, and those skilled in the art can appropriately select an appropriate antigen and an antigen-binding domain capable of specifically binding to the antigen according to the purpose.
  • an antigen-binding domain specific to the bacterium or virus-specific protein may be selected.
  • the antigens are tumor antigens.
  • the tumor antigens include both tumor-specific antigens that are expressed only in cancer cells as well as tumor-associated antigens that are expressed in normal cells but are expressed at a particularly high frequency or are more active in cancer cells. do.
  • the tumor antigen may be a surface protein expressed only in cancer cells or at a higher frequency in cancer cells.
  • the tumor antigen is not limited to specific types, but preferably, CD19, TAG72, IL13R ⁇ 2 (Interleukin 13 receptor alpha-2 subunit), CD52, CD33, CD20, TSLPR, CD22, CD30, GD3, CD171, NCAM (Neural cell adhesion molecule), FBP (Folate binding protein), Le(Y) (Lewis-Y antigen), PSCA (Prostate stem cell antigen), PSMA (Prostate-specific membrane antigen), CEA (Carcinoembryonic antigen), HER2 (Human epidermal growth factor receptor 2), Mesothelin, CD44v6 (Hyaluronate receptor variant 6), B7-H3, Glypican-3, ROR1 (receptor tyrosine kinase like orphan receptor 1), Survivin, FOLR1 (folate receptor 1), WT1 (Wilm's tumor 1) , VEGFR2 (Vascular endothelial growth factor 2), EGFR (Epider
  • the "hinge region” refers to a region that is located between the antigen-binding domain and the transmembrane domain and serves as a flexible linker, and is also referred to as a "spacer".
  • the hinge region allows the antigen-binding domain to be properly positioned when the antigen-binding domain binds to an antigen to form a stable binding with the antigen.
  • the hinge region has the purpose of extending an antigen binding domain from the cell membrane of a cell expressing the CAR.
  • transmembrane domain means any polypeptide or oligopeptide that functions to connect extracellular and intracellular signaling domains across cell membranes.
  • the transmembrane domain can penetrate the cell membrane so that the antigen-binding domain of the chimeric antigen receptor is located on the cell surface (outside the cell) and the intracellular signaling domain is located inside the cell. That is, the transmembrane domain serves as a support for the chimeric antigen receptor and at the same time connects the antigen binding domain (or hinge domain) and the intracellular signaling domain.
  • intracellular signaling domain cytoplasmic domain or cytoplasmic signaling domain, CYP
  • the intracellular signaling domain serves to receive the signal transmitted by the antigen-binding domain and transmit the signal into the cell expressing the CAR.
  • the signal is transmitted inside the cell and causes activation or inhibition of a biological process.
  • the intracellular signaling domain is not particularly limited to that type, as long as it transmits a signal capable of inducing activation of NK cells when the antigen-binding domain binds to an antigen.
  • the intracellular signaling domain may include one or more intracellular co-stimulatory domains.
  • the co-stimulatory domain is located in the extracellular or intracellular portion of the CAR and serves to transmit signals to cells expressing the CAR. That is, the co-stimulatory domain contributes to inducing a sufficient response (activation) of NK cells according to the binding of the target antigen.
  • the co-stimulatory domain is, for example, CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, and / or may be selected from B7-H3 derived domains, but is not limited thereto.
  • Each domain of the chimeric antigen receptors according to the present invention may optionally be linked by a short oligopeptide or polypeptide linker.
  • the linker is not particularly limited in its length or type, as long as it can induce NK cell activation through the intracellular domain when the target antigen binds to the extracellular antigen-binding domain, and linkers known in the art can be applied without limitation.
  • Each domain of the chimeric antigen receptor according to the present invention may include each of the above domains as well as a modified form of each of the above domains.
  • the modification may be performed by substituting, deleting, or adding one or more amino acids in the amino acid sequence of the wild-type antibody and domain without modifying the functions of the antibody and domain.
  • the substitution is an alanine, or can be made by conservative amino acid substitution that does not affect the charge, polarity or hydrophobicity of the entire protein.
  • the type of immune cells (T cells, NK cells, NKT cells, macrophages, etc.) in which the chimeric antigen receptor according to the present invention can be expressed is not limited.
  • the CAR of the present invention is a natural killer cell-specific CAR and is characterized in that it is expressed in natural killer cells.
  • the CAR according to the present invention is characterized in that it is located in the cell membrane of natural killer cells. That is, the CAR according to the present invention is specialized for activating the function of natural killer cells, and when combined with a target antigen, activates a signaling pathway that activates the target cell death function of natural killer cells, resulting in natural killer cells induces to specifically kill target cells.
  • the chimeric antigen receptor according to the present invention can be expressed in allogeneic cells as well as autologous cells of the subject to be administered.
  • the hinge domain of the chimeric antigen receptor according to the present invention may be a domain derived from CD8, CD28, IgG1, IgG4, and/or KIR (killer immunoglobulin-like receptor), but is not limited thereto, and commonly used in the art. Hinge domains can be applied without limitation.
  • the hinge domain may be a CD8 (preferably, CD8 ⁇ ) hinge domain.
  • the CD8 hinge domain may include the amino acid sequence of SEQ ID NO: 2, more preferably may consist of the amino acid sequence of SEQ ID NO: 2, but is not limited thereto, and variants of the amino acid sequence are within the scope of the present invention. included within That is, the CD8 hinge domain has 70% or more, more preferably 80% or more, still more preferably 90% or more, and most preferably 95% or more sequence homology with the amino acid sequence represented by SEQ ID NO: 2, respectively. It may contain an amino acid sequence.
  • the hinge domain of the chimeric antigen receptor in the present invention may be a CD28 hinge domain.
  • the CD28 hinge domain includes the amino acid sequence of SEQ ID NO: 3 or may be encoded by a polypeptide consisting of the amino acid sequence of SEQ ID NO: 3, but is not limited thereto. That is, the CD28 hinge domain has 70% or more, more preferably 80% or more, still more preferably 90% or more, and most preferably 95% or more sequence homology with the amino acid sequence represented by SEQ ID NO: 3, respectively. It may contain an amino acid sequence.
  • the intracellular signaling domain of the chimeric antigen receptor according to the present invention may be a DAP10, 2B4, and/or CD3z-derived domain, but is not limited thereto, and can transmit a signal that activates NK cells by stimulating a target antigen. Anything can be applied without limitation.
  • the DAP10 intracellular signaling domain may include the amino acid sequence of SEQ ID NO: 7 or be encoded by a polypeptide consisting of the amino acid sequence of SEQ ID NO: 7, but is not limited thereto. That is, the DAP10 intracellular signaling domain is 70% or more, more preferably 80% or more, even more preferably 90% or more, most preferably 95% or more of the amino acid sequence represented by SEQ ID NO: 7. It may contain homologous amino acid sequences.
  • the 2B4 intracellular signaling domain may include the amino acid sequence of SEQ ID NO: 8 or be encoded by a polypeptide consisting of the amino acid sequence of SEQ ID NO: 8, but is not limited thereto. That is, the 2B4 intracellular signaling domain is 70% or more, more preferably 80% or more, even more preferably 90% or more, most preferably 95% or more of the amino acid sequence represented by SEQ ID NO: 8. It may contain homologous amino acid sequences.
  • the CD3z (CD3 ⁇ ) intracellular signaling domain may include the amino acid sequence of SEQ ID NO: 9 or be encoded by a polypeptide consisting of the amino acid sequence of SEQ ID NO: 9, but is not limited thereto. That is, the CD3z intracellular signaling domain is 70% or more, more preferably 80% or more, even more preferably 90% or more, most preferably 95% or more of the amino acid sequence represented by SEQ ID NO: 9, respectively. It may contain homologous amino acid sequences.
  • the chimeric antigen receptor according to the present invention may further include a CD28 transmembrane domain.
  • the CD28 transmembrane domain may include the amino acid sequence of SEQ ID NO: 4 or be encoded by a polypeptide consisting of the amino acid sequence of SEQ ID NO: 4, but is not limited thereto. That is, the CD28 transmembrane domain has 70% or more, more preferably 80% or more, still more preferably 90% or more, and most preferably 95% or more sequence homology with the amino acid sequence represented by SEQ ID NO: 4, respectively.
  • the branch may include an amino acid sequence.
  • the chimeric antigen receptor according to the present invention may further include a DAP10 extracellular domain.
  • the DAP10 extracellular domain may include the amino acid sequence of SEQ ID NO: 5 or be encoded by a polypeptide consisting of the amino acid sequence of SEQ ID NO: 5, but is not limited thereto. That is, the DAP10 extracellular domain has a sequence homology of at least 70%, more preferably at least 80%, even more preferably at least 90%, and most preferably at least 95% with the amino acid sequence represented by SEQ ID NO: 5.
  • the branch may include an amino acid sequence.
  • the chimeric antigen receptor according to the present invention may further include a DAP10 transmembrane domain.
  • the DAP10 transmembrane domain may include the amino acid sequence of SEQ ID NO: 6 or be encoded by a polypeptide consisting of the amino acid sequence of SEQ ID NO: 6, but is not limited thereto. That is, the DAP10 transmembrane domain has 70% or more, more preferably 80% or more, still more preferably 90% or more, and most preferably 95% or more sequence homology with the amino acid sequence represented by SEQ ID NO: 6, respectively.
  • the branch may include an amino acid sequence.
  • the chimeric antigen receptor according to the present invention may further include a signal peptide.
  • the "signal peptide” is an amino acid sequence located at the N-terminus of a protein, and serves to induce the newly synthesized protein to move to a specific location such as the endoplasmic reticulum (ER).
  • the signal peptide may be derived from a molecule selected from, for example, CD8 (CD8 ⁇ ), GM-CSF receptor ⁇ , Ig- ⁇ , and IgG1 heavy chain, but is not limited thereto.
  • the signal peptide may be a CD8 signal peptide.
  • the CD8 signal peptide may include the amino acid sequence of SEQ ID NO: 10 or be encoded by a polypeptide consisting of the amino acid sequence of SEQ ID NO: 10, but is not limited thereto. That is, the DAP10 transmembrane domain has 70% or more, more preferably 80% or more, still more preferably 90% or more, and most preferably 95% or more sequence homology with the amino acid sequence represented by SEQ ID NO: 10, respectively.
  • the branch may include an amino acid sequence.
  • the signal peptide according to the present invention is preferably located at the N-terminus of a recombinant protein (CAR) and is used to transfer the protein to the cell surface. Alternatively, the entire sequence may be truncated so that no portion of the signal peptide sequence is present.
  • CAR recombinant protein
  • the antigen-binding domain is the antigen-specific antibody or fragment thereof (preferably, an antigen-binding fragment of the antibody).
  • the antigen-binding domain is an antigen-binding domain that specifically binds to a tumor antigen, and is a tumor antigen-specific antibody or antigen-binding fragment thereof.
  • antibody means an immunoglobulin molecule immunologically reactive with a specific antigen (epitope), and includes polyclonal antibodies, monoclonal antibodies, and functional fragments thereof. (fragments) are included.
  • the term may also include forms produced by genetic engineering, such as chimeric antibodies (eg, humanized murine antibodies) and heterologous antibodies (eg, bispecific antibodies).
  • the antibody includes a heavy chain and/or light chain variable region (VH, heavy chain variable region; VL, light chain variable region).
  • VH heavy chain variable region
  • VL light chain variable region
  • the variable region includes, as a primary structure, a portion forming an antigen-binding site of an antibody molecule, and the antibody of the present invention may be composed of a partial fragment including the variable region.
  • epitope refers to a specific three-dimensional molecular structure within an antigen molecule to which an antibody specifically binds.
  • fragments of an antibody means (functional) fragments that retain the antigen-binding function of an antibody, and are preferably antigen-binding fragments of the antibody.
  • the fragment is used to include scFv, (scFv) 2 , Fab, Fab', and F(ab') 2 as well as nanobody fragments and the like.
  • the antigen-binding fragment is a scFv.
  • Fab has a structure having variable regions of light and heavy chains, constant region of light chain, and first constant region (CH1) of heavy chain, and has one "antigen" binding site.
  • Fab' differs from Fab in that it has a hinge region containing one or more cysteine residues at the C-terminus of the heavy chain CH1 domain.
  • An F(ab')2 antibody is produced by forming a disulfide bond between cysteine residues in the hinge region of Fab'.
  • Fv is a minimal antibody fragment having only a heavy chain variable region and a light chain variable region.
  • Double-chain Fv two-chain Fv
  • scFv is a heavy chain variable region and a light chain variable region are connected by a non-covalent bond.
  • Single-chain Fv (scFv) generally has a dimer-like structure like double-chain Fv because the heavy chain variable region and light chain variable region are covalently linked through a peptide linker or directly linked at the C-terminus.
  • a “single-chain Fv” or “scFv” antibody fragment refers to a protein in which the light and heavy chain variable regions of an antibody are connected by a linker consisting of a peptide sequence of 15 or less amino acids connected. These domains are present in a single polypeptide chain.
  • the Fv polypeptide may further include a polypeptide linker between the VH domain and the VL domain to allow the scFv to form a desired structure for antigen binding.
  • an “Fv” fragment is an antibody fragment that contains the complete antibody recognition and binding site. This region consists of a dimer of one heavy-chain variable domain and one light-chain variable domain in tight, virtually covalent association, for example a scFv.
  • variable region of the antigen binding site is divided into a framework region (FR) with low variability and a complementarity determining region (CDR) with high variability, and both heavy and light chains are divided into CDR1, 2, and 3. It has two CDR regions and four FR regions.
  • the complementarity determining region is a region that imparts binding specificity to an antigen among variable regions of an antibody.
  • the CDRs of each chain are typically named CDR1, CDR2, CDR3 sequentially starting from the N-terminus, and also identified by the chain in which the particular CDR is located.
  • the tumor antigen-specific antibody or antigen-binding fragment thereof according to the present invention may include the following heavy chain variable region and / or light chain variable region:
  • a heavy chain variable region comprising a heavy chain CDR1 comprising the amino acid sequence of SEQ ID NO: 26, a heavy chain CDR2 comprising the amino acid sequence of SEQ ID NO: 27, and/or a heavy chain CDR3 comprising the amino acid sequence of SEQ ID NO: 28;
  • a light chain variable region comprising a light chain CDR1 comprising the amino acid sequence of SEQ ID NO: 29, a light chain CDR2 comprising the amino acid sequence of SEQ ID NO: 30, and/or a light chain CDR3 comprising the amino acid sequence of SEQ ID NO: 31.
  • each CDR may include biological equivalents thereof. That is, each CDR may include an amino acid sequence having a sequence homology of 70% or more, more preferably 80% or more, even more preferably 90% or more, and most preferably 95% or more to the amino acid sequence indicated above. .
  • the tumor antigen-specific antibody or antigen-binding fragment thereof may contain the amino acid sequence of SEQ ID NO: 1 or be encoded by a polypeptide consisting of the amino acid sequence of SEQ ID NO: 1, but Not limited. That is, the antibody or fragment thereof has 70% or more, more preferably 80% or more, still more preferably 90% or more, and most preferably 95% or more sequence homology with the amino acid sequence represented by SEQ ID NO: 1, respectively.
  • the branch may include an amino acid sequence.
  • the tumor antigen-specific antibody or antigen-binding fragment thereof may be an anti-CD19 antibody or a scFv fragment thereof.
  • the natural killer cell-specific chimeric antigen receptor according to the present invention may include a combination of an antigen binding domain, a CD8 domain, a CD28 domain, a DAP10 domain, a 2B4 domain, and/or a CD3z domain. More specifically, the natural killer cell-specific chimeric antigen receptor according to the present invention comprises an antigen binding domain, a CD8 or CD28 hinge domain, a DAP10 intracellular signaling domain, a 2B4 intracellular signaling domain, and a CD3z intracellular signaling domain.
  • the chimeric antigen receptor may further include a CD28 transmembrane domain. It may further include at least one selected from the group consisting of DAP10 extracellular domain and DAP10 transmembrane domain.
  • the natural killer cell-specific chimeric antigen receptor comprises a combination of an antigen binding domain, a CD8 domain, a DAP10 domain, a 2B4 domain, and a CD3z domain; comprises a combination of an antigen binding domain, a CD28 domain, a DAP10 domain, a 2B4 domain, and CD3z; A combination of an antigen binding domain, a CD8 domain, a CD28 domain, a DAP10 domain, a 2B4 domain, and a CD3z domain.
  • the natural killer cell-specific chimeric antigen receptor comprises antigen binding domain, CD8 hinge domain, DAP10 extracellular domain, DAP10 transmembrane domain, DAP10 intracellular signaling domain, 2B4 intracellular signaling domain, and CD3z intracellular signaling domain (NK-CAR1).
  • the natural killer cell-specific chimeric antigen receptor is an antigen binding domain, CD28 hinge domain, DAP10 extracellular domain, DAP10 transmembrane domain, DAP10 intracellular signaling domain, 2B4 intracellular signaling domain , and a CD3z intracellular signaling domain (NK-CAR2).
  • the natural killer cell-specific chimeric antigen receptor comprises an antigen binding domain, a CD8 hinge domain, a CD28 transmembrane domain, a DAP10 intracellular signaling domain, a 2B4 intracellular signaling domain, and a CD3z intracellular Signaling domain may be sequentially included (NK-CAR3).
  • the chimeric antigen receptor according to the present invention may include the aforementioned polypeptide domains as well as biological equivalents thereof. For example, additional changes may be made to the amino acid sequence of each domain in order to further improve the antigen recognition ability and/or intracellular signal transduction ability of the chimeric antigen receptor.
  • the natural killer cell-specific chimeric antigen receptor according to the present invention is 70% or more, more preferably 80% or more, even more preferably 90% or more of the amino acid sequence represented by any one of SEQ ID NOs: 23 to 25. It may include an amino acid sequence having a sequence identity of 95% or more, most preferably 95% or more.
  • a polypeptide (or nucleic acid molecule) represented by a specific sequence herein may include the corresponding sequence as well as its biological equivalent. That is, considering a mutation having a biologically equivalent activity of a polypeptide (nucleic acid molecule), the polypeptide (or nucleic acid molecule) of one aspect is also interpreted to include a sequence showing substantial identity with the sequence described in SEQ ID NO. Specifically, a polypeptide (nucleic acid molecule) comprising an amino acid sequence (nucleotide sequence) represented by a specific sequence number is not limited to the amino acid sequence (nucleotide sequence), and variants of the amino acid sequence (nucleotide sequence) are within the scope of the present invention.
  • a polypeptide molecule (nucleic acid molecule) composed of an amino acid sequence (nucleotide sequence) represented by a specific sequence number of the present invention is a functional equivalent of a polypeptide molecule (nucleic acid molecule) constituting it, for example, a polypeptide molecule (nucleic acid molecule)
  • polypeptide (nucleic acid molecule) disclosed in the present invention is 70% or more, more preferably 80% or more, even more preferably 90% or more, most preferably 95% or more of the amino acid sequence represented by a specific sequence number. It may contain an amino acid sequence (nucleotide sequence) having the above sequence homology.
  • sequence homology includes a polypeptide (nucleic acid molecule) with The "percentage of sequence homology" for a polypeptide (nucleic acid molecule) is determined by comparing two optimally aligned sequences with a comparison region, wherein a portion of the polypeptide sequence (nucleotide sequence) in the comparison region corresponds to the optimal alignment of the two sequences. It may contain additions or deletions (i.e., gaps) relative to the reference sequence (which does not contain additions or deletions).
  • the present invention provides a cell expressing a natural killer cell-specific chimeric antigen receptor according to the present invention.
  • the cells may be in vitro or in vivo cells, and may be autologous cells and/or allogeneic cells (i.e., allogeneic cells) of an individual that requires the cells, or a heterogeneous cell thereof. (or derived from) xenogenic cells.
  • the cells may be prepared from autologous cells and/or syngeneic cells of an individual in need thereof.
  • the cell expresses the chimeric antigen receptor in its cell membrane.
  • the cells may be immune cells such as T cells, NK cells, NKT cells, and macrophages.
  • the cells are natural killer cells. That is, the present invention provides CAR-NK cells expressing the chimeric antigen receptor according to the present invention. Since NK cells have the most immediate and powerful killing ability among immune cells, the CAR-NK cells of the present invention can be a powerful immunotherapy in the treatment of diseases such as cancer.
  • natural killer cells are a type of cytotoxic lymphocytes derived from bone marrow. Natural killer cells account for 5 to 20% of all lymphocytes and are responsible for innate immunity. Although there is no major histocompatibility complex or antibody on the surface, natural killer cells provide an immediate immune response against virus-infected cells, cancer cells, and other transformed cells. do.
  • the natural killer cells include natural killer cells isolated from individuals as well as natural killer cells cultured or modified therefrom, and commercially available natural killer cell lines may also be used. That is, the natural killer cell of the present invention is not limited to a specific type, and it is sufficient as long as it has the same or similar molecular characteristics and biological activity to natural killer cells.
  • the natural killer cells may be selected from, for example, HANK1, NKL, NK92, NK-YS, YT, NOI-90, and NK101, but this is only an example, but is not limited thereto.
  • the natural killer cells expressing the chimeric antigen receptor according to the present invention may be CAR-NK cells (Chimeric antigen receptor natural killer cells).
  • Natural killer cells expressing the chimeric antigen receptor according to the present invention when recognizing a target through the receptor, are activated more quickly or at a higher level than natural killer cells that do not express the chimeric antigen receptor. It is characterized in that it can more quickly or effectively kill target cells.
  • natural killer cells expressing the chimeric antigen receptor according to the present invention may be characterized by increased cytokine production and/or secretion upon recognizing a target antigen. That is, natural killer cells expressing the NK-CAR of the present invention may produce and/or secrete cytokines at a higher degree than natural killer cells that do not express the NK-CAR upon target recognition.
  • the cytokine is secreted from activated natural killer cells and induces the death of target cells.
  • the cytokine is a cytokine capable of inducing an anticancer effect by inhibiting the growth, proliferation, migration, and/or metastasis of cancer cells.
  • the cytokine is not limited to specific types, but may preferably be MIP-1 ⁇ (Macrophage inflammatory protein-1 ⁇ ) and/or Interferon- ⁇ (interferon- ⁇ , IFN- ⁇ ). .
  • MIP-1 ⁇ Macrophage inflammatory protein-1 ⁇
  • Interferon- ⁇ Interferon- ⁇ , IFN- ⁇
  • any cytokines related to the apoptosis mechanism of natural killer cells may be included.
  • Natural killer cells expressing the chimeric antigen receptor according to the present invention may be characterized by increased production and/or secretion of granzyme when recognizing a target antigen. That is, natural killer cells expressing the NK-CAR of the present invention may produce and/or secrete granzymes at a higher degree than natural killer cells that do not express the NK-CAR upon target recognition.
  • the granzymes include both granzymes A and B.
  • natural killer cells according to the present invention may be characterized in that the activation of natural killer cells and/or the activity of signal transduction pathways related to target cell killing ability increase upon recognizing the target antigen.
  • the signal transduction pathway is a signal transduction pathway related to the anticancer activity of natural killer cells (ie, a signal transduction pathway for killing or inhibiting the growth of cancer cells). That is, natural killer cells expressing the NK-CAR of the present invention may have higher activity of the signaling pathway than natural killer cells that do not express the NK-CAR upon target recognition.
  • Representative examples of the signaling pathway include the AKT signaling pathway and the ERK signaling pathway.
  • the natural killer cell expressing the chimeric antigen receptor according to the present invention recognizes the target antigen, the phosphorylation of AKT and/or ERK in the cell increases and the AKT and/or ERK signaling pathway can be activated. there is.
  • natural killer cells expressing the chimeric antigen receptor according to the present invention may be characterized in that the degree (level) of degranulation increases upon recognizing the target antigen. That is, natural killer cells expressing the NK-CAR of the present invention can undergo degranulation more actively than natural killer cells that do not express the NK-CAR upon target recognition. As proof of this, the natural killer cells expressing the chimeric antigen receptor according to the present invention can increase the level of CD107a more than natural killer cells that do not express the chimeric antigen receptor when recognizing the target.
  • the present invention provides a nucleic acid molecule (ie, polynucleotide) encoding a natural killer cell-specific chimeric antigen receptor according to the present invention.
  • polynucleotide refers to an oligomer or polymer comprising two or more linked nucleotides or nucleotide derivatives bonded to each other, usually by phosphodiester bonds, including deoxyribonucleic acid (DNA) and ribonucleic acid (RNA).
  • Polynucleotides may also contain, for example, nucleotide analogs, or "backbone” linkages other than phosphate diester linkages, such as phosphate triester linkages, phosphoramidate linkages, phosphorothioate linkages, thioester linkages, or peptide linkages (peptide linkages).
  • nucleic acids including DNA and RNA derivatives.
  • Polynucleotides include single-stranded and/or double-stranded polynucleotides, such as deoxyribonucleic acid (DNA) and ribonucleic acid (RNA) as well as analogs of either RNA or DNA.
  • DNA deoxyribonucleic acid
  • RNA ribonucleic acid
  • the nucleic acid molecule according to the present invention includes genes encoding domains constituting the chimeric antigen receptor according to the present invention.
  • Each of the above genes may be directly linked to each other's N or C terminus, or may be linked through a linker sequence.
  • the nucleic acid molecule according to the present invention may include one or more nucleotide sequences selected from the group consisting of SEQ ID NOs: 11 to 22.
  • polynucleotides according to the present invention include functional equivalents thereof.
  • the nucleic acid molecule according to the present invention contains at least 70%, more preferably at least 80%, even more preferably at least 90%, most preferably at least one nucleotide sequence selected from the group consisting of SEQ ID NOs: 11 to 22. may include a nucleotide sequence having 95% or more sequence homology.
  • the region encoding the CD8 hinge domain in the nucleic acid molecule according to the present invention may include the nucleotide sequence represented by SEQ ID NO: 12 or 13.
  • the region encoding the CD28 hinge domain may include the nucleotide sequence represented by SEQ ID NO: 14.
  • the region encoding the CD28 transmembrane domain may include the nucleotide sequence represented by SEQ ID NO: 15.
  • regions encoding the DAP10 extracellular domain, transmembrane domain, and intracellular signaling domain may include the nucleotide sequences represented by SEQ ID NO: 16, SEQ ID NO: 17, and SEQ ID NO: 18, respectively.
  • the 2B4 intracellular signaling domain may include the nucleotide sequence represented by SEQ ID NO: 19.
  • the CD3z intracellular signaling domain may include the nucleotide sequence represented by SEQ ID NO: 20.
  • the nucleic acid molecule of the natural killer cell-specific chimeric antigen receptor may include a polynucleotide encoding a CD-19 specific antibody or a fragment thereof.
  • the polynucleotide or fragment thereof may include the nucleotide sequence of SEQ ID NO: 11.
  • nucleic acid molecule according to the present invention may include a region encoding the CD8 signal peptide (preferably, including the nucleotide sequence of SEQ ID NO: 21).
  • the present invention also provides an expression vector comprising the nucleic acid molecule according to the present invention. That is, the present invention provides a recombinant vector comprising the nucleic acid molecule according to the present invention.
  • recombinant vector refers to a vector capable of expressing a peptide or protein encoded by a heterologous nucleic acid inserted into the vector, preferably a target protein (in the present invention, NK A vector prepared to express a specific CAR).
  • the "vector” refers to any medium for the introduction and / or transfer of a base into a host cell in vitro, in vivo or in vivo, and a replicating unit capable of binding another DNA fragment to cause replication of the bound fragment ( replicon), and “replication unit” refers to any genetic unit (e.g., plasmid, phage, cosmid, chromosomes, viruses, etc.)
  • Vectors according to the present invention may be linear DNA, plasmid DNA or recombinant viral vectors, but are not limited thereto.
  • the recombinant viral vectors include, for example, viral vectors such as plasmid vectors, cosmid vectors and bacteriophage vectors, adenoviral vectors, lentiviral vectors, retroviral vectors and adeno-associated viral vectors.
  • the vector is a retroviral vector.
  • the present inventors used the pMXs-IRES-GFP retroviral vector in a specific example.
  • the recombinant vector of the present invention preferably includes a promoter, which is a transcription initiation factor to which RNA polymerase binds, an arbitrary operator sequence for regulating transcription, a sequence encoding a suitable mRNA ribosome binding site, and termination of transcription and translation. It may include a regulatory sequence, a terminator, and the like, more preferably a polyhistidine tag (an amino acid motif composed of at least 5 or more histidine residues), a signal peptide gene, and an endoplasmic reticulum retention signal peptide ), a cloning site, and the like, and may further include a tag gene, a marker gene for selection such as an antibiotic resistance gene for selecting transformants, and the like.
  • a promoter which is a transcription initiation factor to which RNA polymerase binds
  • an arbitrary operator sequence for regulating transcription a sequence encoding a suitable mRNA ribosome binding site
  • termination of transcription and translation may include a regulatory sequence,
  • the polynucleotide sequence of each gene is operably linked to a promoter.
  • operably linked refers to a functional linkage between a nucleotide expression control sequence, such as a promoter sequence, and another nucleotide sequence, whereby the control sequence is involved in the transcription of the other nucleotide sequence. and/or regulate detoxification.
  • the recombinant vector may be constructed using a prokaryotic or eukaryotic cell as a host.
  • a prokaryotic cell is used as a host, a strong promoter capable of promoting transcription (eg, pL ⁇ promoter, trp promoter, lac promoter, tac promoter, T7 promoter, etc.) ), a ribosome binding site for initiation of translation and a transcription/translation termination sequence.
  • a strong promoter capable of promoting transcription eg, pL ⁇ promoter, trp promoter, lac promoter, tac promoter, T7 promoter, etc.
  • the origin of replication at which the vector operates in the eukaryotic cell may include, but is not limited to, the f1 origin of replication, the SV40 origin of replication, the pMB1 origin of replication, the adeno origin of replication, the AAV origin of replication, and the BBV origin of replication.
  • promoters derived from the genome of mammalian cells eg, metallotionine promoter
  • promoters derived from mammalian viruses eg, adenovirus late promoter, vaccinia virus 7.5K promoter, SV40 promoter, The cytomegalovirus promoter and the tk promoter of HSV
  • adenovirus late promoter vaccinia virus 7.5K promoter
  • SV40 promoter SV40 promoter
  • the cytomegalovirus promoter and the tk promoter of HSV can be used, and usually have a polyadenylation sequence as a transcription termination sequence.
  • the gene for the tag examples include Avi tag, Calmodulin tag, polyglutamate tag, E tag, FLAG tag, HA tag, His tag (polyhistidine tag), Myc tag, S tag, SBP tag, IgG-Fc tag, and CTB.
  • tag Softag 1 tag, Softag 3 tag, Strep tag, TC tag, V5 tag, VSV tag, Xpress tag, etc.
  • the vector according to the present invention may contain a myc tag. More preferably, the myc tag may include the nucleotide sequence of SEQ ID NO: 22.
  • the nucleic acid or the vector may be transfected or transfected into a virus-producing cell, that is, a packaging cell line.
  • a virus-producing cell that is, a packaging cell line.
  • a variety of techniques commonly used to introduce exogenous nucleic acids (DNA or RNA) into prokaryotic or eukaryotic host cells for "transfection” or “transfection”, such as electrophoresis, calcium phosphate precipitation; DEAE-dextran transfection or lipofection or the like can be used.
  • the virus containing the gene of interest (a natural killer cell-specific chimeric antigen receptor-encoding nucleic acid molecule) according to the present invention can proliferate in the packaging cell line and be released extracellularly, and the virus can
  • the NK-CAR may be transduced into cells, such as NK cells, in which the final expression is desired.
  • the nucleic acid of the virus "transduced" into the cell is used to produce a target protein (natural killer cell-specific chimeric antigen receptor) with or without integration into the genome of the cell.
  • the present invention can provide isolated cells into which the expression vector according to the present invention has been introduced (transformation, transfection, transfection, etc.).
  • the cell herein refers to a cell for proliferating (amplifying) the expression vector, not a cell that ultimately expresses a natural killer cell-specific chimeric antigen receptor. That is, the cell refers to a host cell directly transduced/transformed/transfected with the aforementioned nucleic acid molecule or expression vector.
  • the expression vector is a viral vector
  • the cell may be a packaging cell for producing a virus containing the viral vector. The selection of a suitable host is believed to be obvious to one skilled in the art from the teachings herein.
  • the present invention comprises the steps of (S1) introducing the expression vector according to the present invention into a cell; and (S2) culturing cells into which the expression vector has been introduced.
  • the step (S1) is a step of amplifying the expression vector of the present invention or introducing the expression vector into a host cell to express the vector. That is, by introducing the expression vector into an appropriate host cell (transformation, transfection, transfection, etc.), the expression vector is replicated inside the cell, or a protein or the like is induced to be expressed from the expression vector (viral vector When used), a virus containing the expression vector may be induced to be produced.
  • the step (S1) may be appropriately performed by a person skilled in the art according to the type of vector and cell used. For example, when the expression vector is a viral vector, the expression vector may be introduced into a host cell by transfection.
  • the step (S2) refers to culturing the cells so that the target gene introduced into the cells is sufficiently amplified or expressed in the cells.
  • the culture after the expression vector is introduced into the host cell, is performed for a period sufficient for the expression vector to express the target protein in the host cell (or, for a period sufficient for the expression vector to replicate or containing the target gene). for a period of time sufficient to produce viruses). More preferably, the culturing may be performed for a period of time sufficient to allow the protein to be secreted into the culture medium in which the host cell is cultured (or, for a period sufficient to release the virus containing the target gene to the outside of the cell). .
  • the method includes the steps of obtaining (or amplified) natural killer cell chimeric antigen receptors generated (or amplified) from the cells after the step (S2), an expression vector containing a nucleic acid molecule encoding the same, or a virus containing the expression vector. may further include.
  • the acquisition method is appropriately selected and controlled in consideration of the characteristics of the chimeric antigen receptor, expression vector, or virus produced in the host cell, the characteristics of the host cell, the expression method, or the targeting of the chimeric antigen receptor/expression vector/virus.
  • cells can be lysed within a range that does not affect the functional structure of antibodies or their antigen-binding fragments.
  • the virus containing the expression vector can be recovered by a method such as obtaining a medium in which host cells are cultured and centrifuging to remove impurities.
  • the obtained chimeric antigen receptor/expression vector/virus may further undergo a process of further removing impurities and concentrating through methods such as chromatography, filtration through a filter, etc., and dialysis. Separation or purification of the obtained chimeric antigen receptor can be carried out by separation and purification methods commonly used for proteins, such as chromatography.
  • the chromatography may include, for example, affinity chromatography including a protein A column, protein G column, or protein L column, ion exchange chromatography, or hydrophobic chromatography.
  • the chimeric antigen receptor may be separated and purified by further combining filtration, ultrafiltration, salting out, dialysis, and the like. Isolation or purification of the virus can be achieved by filtering the medium through a porous filter to remove impurities and concentrating.
  • the present invention provides a natural killer cell-specific chimeric antigen receptor, comprising the step of introducing into natural killer cells an expression vector containing a nucleic acid molecule encoding the natural killer cell-specific chimeric antigen receptor according to the present invention
  • a method for producing natural killer cells expressing the present invention That is, the present invention provides a method for producing a CAR-NK cell comprising a chimeric antigen receptor according to the present invention.
  • the expression vector may be an expression vector amplified through the method for preparing a natural killer cell-specific chimeric antigen receptor described above.
  • the expression vector itself may be introduced into natural killer cells, or may be introduced in a form included in a virus.
  • the expression vector when the expression vector is a viral vector, the vector may be introduced into cells by infecting natural killer cells with a virus containing the expression vector (transduction).
  • the nucleic acid of the virus transduced into the cell may be inserted into the genome of the natural killer cell or expressed without being inserted, and the natural killer cell-specific chimeric antigen receptor of the present invention may be expressed therefrom.
  • the present invention provides natural killer cells expressing the natural killer cell-specific chimeric antigen receptor according to the present invention; an expression vector containing a nucleic acid molecule encoding the natural killer cell-specific chimeric antigen receptor; And / or provides a pharmaceutical composition for preventing or treating cancer, comprising cells containing the expression vector as an active ingredient.
  • the antigen-binding domain of the natural killer cell-specific chimeric antigen receptor is characterized in that it is an antigen-binding domain that specifically binds to a tumor antigen.
  • the natural killer cells may be autologous cells or allogeneic cells of an individual to whom the composition is administered.
  • cancer is used synonymously with “tumor” and refers to a condition characterized by typically uncontrolled cell growth or proliferation.
  • Cancers that can be prevented or treated using the chimeric antigen receptor according to the present invention include solid tumors and non-solid tumors (eg, hematological cancer, etc.).
  • cancer types include carcinoma, blastoma, and sarcoma, and certain leukemias or lymphoid malignancies, benign and malignant tumors, such as sarcoma, carcinoma, and melanoma, but are not limited thereto .
  • the specific type of cancer of the present invention is not limited, but colorectal cancer, rectal cancer, colon cancer, thyroid cancer, oral cancer, pharynx cancer, laryngeal cancer, cervical cancer, brain cancer, lung cancer, ovarian cancer, bladder cancer, kidney cancer, liver cancer, pancreatic cancer, prostate cancer, skin cancer , tongue cancer, breast cancer, uterine cancer, stomach cancer, bone cancer, lymphoma, hematological cancer, squamous cell carcinoma, adenocarcinoma of the lung, peritoneal cancer, skin cancer, skin melanoma, ocular melanoma, rectal cancer, perianal cancer, esophageal cancer, small intestine cancer, endocrine adenocarcinoma, parathyroid cancer, adrenal cancer, soft tissue sarcoma, urethral cancer, gastrointestinal cancer, glioblastoma, ovarian cancer, endometrial cancer, salivary gland cancer, vulvar cancer, head and neck cancer, and the like
  • the cancer according to the present invention is a cancer expressing a target antigen recognized by the chimeric antigen receptor of the present invention. That is, the cancer expresses a tumor antigen that can be recognized by the antigen-binding domain of the chimeric antigen receptor of the present invention.
  • the cancer when the CAR according to the present invention contains an anti-CD19 scFv as a cancer cell-specific antigen-binding domain, the cancer is preferably a cancer in which CD19 is overexpressed or has a higher activity in cancer cells than in normal cells. .
  • hematologic cancer refers to cancer arising from components of blood (leukocytes, red blood cells, platelets, etc.), bone marrow producing blood, and lymphatic system constituting the immune system (lymphocytes, lymph nodes, lymphatic vessels, etc.). Examples include leukemia, malignant lymphoma, and multiple myeloma. More specific examples of blood cancer include Acute Myeloid Leukemia, Acute Lymphoblastic Leukemia, Chronic Myelogenous Leukemia, Multiple Myeloma, and Lymphoma etc.
  • the cancer is lymphoma, B cell lymphoma, acute lymphoma, Burkitt's lymphoma, diffuse large B cell lymphoma, follicular lymphoma, MALT lymphoma, marginal zone It may be selected from marginal zone lymphoma, peripheral T cell lymphoma, anaplastic large cell lymphoma, lymphoblastic lymphoma, Hodgkin's lymphoma, and the like.
  • the content of natural killer cells expressing the NK-CAR, the expression vector, and/or cells containing the expression vector in the composition of the present invention can be appropriately adjusted according to the symptoms of the disease, the degree of progression of the symptoms, the condition of the patient, etc. For example, it may be 0.0001 to 99.9% by weight or 0.001 to 50% by weight based on the total weight of the composition, but is not limited thereto.
  • the content ratio is a value based on the dry amount after removing the solvent.
  • the pharmaceutical composition according to the present invention may further include suitable carriers, excipients and diluents commonly used in the manufacture of pharmaceutical compositions.
  • the excipient may be, for example, one or more selected from the group consisting of a diluent, a binder, a disintegrant, a lubricant, an adsorbent, a moisturizer, a film-coating material, and a controlled release additive.
  • compositions according to the present invention are powders, granules, sustained-release granules, enteric granules, solutions, eye drops, elsilic agents, emulsions, suspensions, spirits, troches, perfumes, and limonadese, respectively, according to conventional methods.
  • tablets, sustained-release tablets, enteric tablets, sublingual tablets, hard capsules, soft capsules, sustained-release capsules, enteric capsules, pills, tinctures, soft extracts, dry extracts, fluid extracts, injections, capsules, perfusate It can be formulated and used in the form of external preparations such as warning agents, lotions, pasta agents, sprays, inhalants, patches, sterile injection solutions, or aerosols, and the external agents are creams, gels, patches, sprays, ointments, and warning agents.
  • lotion, liniment, pasta, or cataplasma may have formulations such as the like.
  • Carriers, excipients and diluents that may be included in the pharmaceutical composition according to the present invention include lactose, dextrose, sucrose, oligosaccharide, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia gum, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinyl pyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate and mineral oil.
  • diluents or excipients such as commonly used fillers, extenders, binders, wetting agents, disintegrants, and surfactants.
  • Additives for the liquid formulation according to the present invention include water, dilute hydrochloric acid, dilute sulfuric acid, sodium citrate, sucrose monostearate, polyoxyethylene sorbitol fatty acid esters (tween esters), polyoxyethylene monoalkyl ethers, lanolin ethers, Lanolin esters, acetic acid, hydrochloric acid, aqueous ammonia, ammonium carbonate, potassium hydroxide, sodium hydroxide, prolamine, polyvinylpyrrolidone, ethyl cellulose, sodium carboxymethyl cellulose, and the like may be used.
  • a solution of white sugar, other sugars, or a sweetener may be used, and aromatics, coloring agents, preservatives, stabilizers, suspending agents, emulsifiers, thickeners, etc. may be used as necessary.
  • Purified water may be used in the emulsion according to the present invention, and emulsifiers, preservatives, stabilizers, fragrances, etc. may be used as needed.
  • Suspension agents according to the present invention include acacia, tragacantha, methylcellulose, carboxymethylcellulose, sodium carboxymethylcellulose, microcrystalline cellulose, sodium alginate, hydroxypropylmethylcellulose (HPMC), HPMC 1828, HPMC 2906, HPMC 2910, etc. Agents may be used, and surfactants, preservatives, stabilizers, colorants, and fragrances may be used as needed.
  • Injections according to the present invention include distilled water for injection, 0.9% sodium chloride injection, IV injection, dextrose injection, dextrose + sodium chloride injection, PEG, lactated IV injection, ethanol, propylene glycol, non-volatile oil-sesame oil , solvents such as cottonseed oil, peanut oil, soybean oil, corn oil, ethyl oleate, isopropyl myristate, and benzene benzoate; solubilizing agents such as sodium benzoate, sodium salicylate, sodium acetate, urea, urethane, monoethylacetamide, butazolidine, propylene glycol, twins, nijuntinamide, hexamine, and dimethylacetamide; buffers such as weak acids and their salts (acetic acid and sodium acetate), weak bases and their salts (ammonia and ammonium acetate), organic compounds, proteins, albumin, peptone, and gums; tonicity agents such as sodium chlor
  • the suppository according to the present invention includes cacao butter, lanolin, witapsol, polyethylene glycol, glycerogelatin, methylcellulose, carboxymethylcellulose, a mixture of stearic acid and oleic acid, subanal, cottonseed oil, peanut oil, palm oil, cacao butter + Cholesterol, Lecithin, Lannet Wax, Glycerol Monostearate, Tween or Span, Imhausen, Monolen (Propylene Glycol Monostearate), Glycerin, Adeps Solidus, Buytyrum Tego-G -G), Cebes Pharma 16, Hexalide Base 95, Cotomar, Hydroxycote SP, S-70-XXA, S-70-XX75 (S-70-XX95), Hyde Hydrokote 25, Hydrokote 711, Idropostal, Massa estrarium (A, AS, B, C, D, E, I, T), Massa-MF, Masupol, Masupol-15, Neos
  • Solid preparations for oral administration include tablets, pills, powders, granules, capsules, etc., and these solid preparations contain at least one excipient, for example, starch, calcium carbonate, sucrose, etc. ) or by mixing lactose and gelatin.
  • excipients for example, starch, calcium carbonate, sucrose, etc.
  • lubricants such as magnesium stearate and talc are also used.
  • Liquid preparations for oral administration include suspensions, solutions for oral administration, emulsions, syrups, etc.
  • various excipients such as wetting agents, sweeteners, aromatics, and preservatives may be included.
  • Formulations for parenteral administration include sterilized aqueous solutions, non-aqueous solvents, suspensions, emulsions, freeze-dried formulations, and suppositories.
  • Propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable esters such as ethyl oleate may be used as non-aqueous solvents and suspending agents.
  • composition according to the present invention is administered in a pharmaceutically effective amount.
  • pharmaceutically effective amount means an amount sufficient to treat a disease with a reasonable benefit / risk ratio applicable to medical treatment, and the effective dose level is the type of patient's disease, severity, activity of the drug, It may be determined according to factors including sensitivity to the drug, administration time, route of administration and excretion rate, duration of treatment, drugs used concurrently, and other factors well known in the medical field.
  • the pharmaceutical composition according to the present invention may be administered as an individual therapeutic agent or in combination with other therapeutic agents, may be administered sequentially or simultaneously with conventional therapeutic agents, and may be administered single or multiple times. Considering all of the above factors, it is important to administer an amount that can obtain the maximum effect with the minimum amount without side effects, which can be easily determined by a person skilled in the art to which the present invention belongs.
  • the pharmaceutical composition of the present invention can be administered to a subject by various routes. All modes of administration can be envisaged, eg oral administration, subcutaneous injection, intraperitoneal administration, intravenous injection, intramuscular injection, paraspinal space (intrathecal) injection, sublingual administration, buccal administration, intrarectal insertion, vaginal It can be administered by intraoral insertion, ocular administration, otic administration, nasal administration, inhalation, spraying through the mouth or nose, dermal administration, transdermal administration, and the like.
  • the pharmaceutical composition of the present invention is determined according to the type of drug as an active ingredient together with various related factors such as the disease to be treated, the route of administration, the age, sex, weight and severity of the disease of the patient.
  • subject means a subject in need of treatment of a disease, and more specifically, a human or non-human primate, mouse, rat, dog, cat, horse, cow, etc. of mammals.
  • administration means providing a given composition of the present invention to a subject by any suitable method.
  • prevention refers to any action that suppresses or delays the onset of a desired disease
  • treatment means that a desired disease and its associated metabolic abnormalities are improved or treated by administration of the pharmaceutical composition according to the present invention.
  • Any action that is beneficially altered, and “improvement” means any action that reduces a parameter related to a desired disease, for example, the severity of a symptom, by administration of the composition according to the present invention.
  • the present invention provides natural killer cells expressing the natural killer cell-specific chimeric antigen receptor according to the present invention; an expression vector containing a nucleic acid molecule encoding the natural killer cell-specific chimeric antigen receptor; And / or providing a kit for preventing or treating cancer, including the expression vector.
  • the kit according to the present invention is not limited in specific form as long as it is for the prevention or treatment of cancer, and the production, storage, introduction and expression of the chimeric antigen receptor according to the present invention into natural killer cells, administration of the natural killer cells, etc. It may include without limitation any components and devices for.
  • the present invention provides a cell therapy agent for preventing or treating cancer, comprising natural killer cells expressing a natural killer cell-specific chimeric antigen receptor according to the present invention as an active ingredient.
  • cellular therapeutic agents are cells or tissues prepared from humans through isolation, culture, and special manipulation and used for the purpose of diagnosis, prevention, or treatment of a specific disease.
  • the FDA defines cell therapy as a drug.
  • cell therapy products are manufactured through a series of processes in which living autologous, allogeneic, or xenogeneic cells are propagated and selected in vitro, or by changing the biological properties of cells by other methods, in order to restore the functions of cells or tissues. , it is used for diagnosis, prevention, and treatment of diseases.
  • each chimeric antigen receptor is as follows:
  • NK-CAR1 myc-tag, scFv of anti-CD19 monoclonal antibody binding to CD19, CD8 hinge domain, DAP10 extracellular domain, DAP10 transmembrane domain, DAP10 intracellular signaling domain, 2B4 intracellular signaling domain, and a one-molecule chimeric protein consisting of the CD3 ⁇ (also referred to as CD3z) intracellular signaling domain (termed "NK-CAR1");
  • NK-CAR2 myc-tag, scFv of anti-CD19 monoclonal antibody binding to CD19, CD28 hinge domain, DAP10 extracellular domain, DAP10 transmembrane domain, DAP10 intracellular signaling domain, 2B4 intracellular signaling domain, and One molecule of chimeric protein consisting of the CD3 ⁇ intracellular signaling domain (named "NK-CAR2");
  • T cell derived CAR consisting of myc-tag, scFv of anti-CD19 monoclonal antibody binding to CD19, CD8 hinge domain, CD28 transmembrane domain, CD28 intracellular signaling domain, and CD3 ⁇ intracellular signaling domain Protein (T cell derived CAR; termed “2 nd CAR” or “2 nd generation CAR”).
  • pMXs-CAR-IRES-GFP retroviral vector 3 expressing NK-CAR according to the present invention by cloning a nucleic acid fragment containing each of the artificial genes into a pMXs-IRES-GFP retroviral vector digested with EcoR1-Xho1
  • a retroviral vector expressing species and control T-CARs was constructed. That is, the vector encodes the chimeric antigen receptor according to the present invention together with the fluorescent protein GFP.
  • FIG. 1 The structures of NK-CAR1, NK-CAR2, NK-CAR3, and the control 2 nd CAR according to the present invention are shown in FIG. 1 .
  • E. coli DH5 ⁇ was transformed with the four types of pMXs-CAR-IRES-GFP retroviral vectors prepared in Example 1, respectively, to obtain transformants.
  • the plasmid DNA cloned in the transformant was purified using the HiSpeed Plasmid Midi Kit (Qiagen, #12643), and prepared as DNA for transfection. The DNA for transfection was subjected to the following manipulations.
  • the DNA for transfection was transfected into Plat A cells, a retroviral packaging cell line.
  • the medium was replaced 24 hours after the transfection, and 24 hours after the medium was changed, the supernatant containing the amphotropic retrovirus was obtained and filtered through a 0.45 ⁇ m filter (Nalgene, #725-2545).
  • 10 ⁇ g/mL polybrene (Sigma, #H9268) was used according to the manufacturer's instructions to inject amphotropic virus into natural killer cell lines, NKL and NK92 cell lines, at 700 G, 30 minutes, and 32 ° C. Spinfection was performed twice.
  • GFP-positive cells mean cells infected with the retrovirus prepared in this example, and Alexa Fluor ® 647-positive cells mean cells expressing the NK-CAR according to the present invention.
  • the ratio of Alexa Fluor ® 647-positive cells among GFP-positive cells (virus-infected NKL cells) and the ratio of NKL cells expressing NK-CAR were measured. As shown in Fig. 2a, about 7% of the NKL cells were infected with the CAR-retrovirus, and about 85% of them expressed the NK-CAR according to the present invention. About 12% of NKL cells were infected with the 2nd CAR virus, and about 95% of NKL cells expressing the 2nd CAR were identified.
  • NKL cells expressing GFP among NKL cells 3 days after virus infection were isolated and cultured with BD FACSAria TM II Cell Sorter (BD Biosciences), and to confirm their GFP and NK-CAR expression, as described above Similarly, it was stained with Alexa Fluor ® 647-Myc-Tag (9B11) Mouse mAb and analyzed with BD Accuri TM C6 (BD Biosciences). As a result, GFP was expressed in more than 99% of the cells, indicating that only virus-infected NKL cells were isolated and cultured (FIG. 2b).
  • the ratio of NK-CAR1 expressing cells was 70%, the ratio of NK-CAR2 expressing cells was 85%, and the ratio of NK-CAR3 expressing cells was 96% confirmed (Fig. 2b).
  • the above result means that structural differences of NK-CARs affect protein expression.
  • the ratio of cells positive for Alexa Fluor ® 647 among GFP-positive cells (NK92 cells infected with the virus) and the ratio of NK92 cells expressing NK-CAR were measured.
  • NK92 cells infected with the virus were infected with NK-CAR virus, and NK92 cells expressing NK-CAR were about 32 to 85% of them.
  • about 35% of the NK92 cells were infected with the 2nd CAR virus, and about 94% of the NK92 cells were expressing the 2nd CAR.
  • NK 92 cells expressing GFP among NK92 cells 3 days after virus infection were isolated and cultured with BD FACSAria TM II Cell Sorter (BD Biosciences), and to confirm their GFP and NK-CAR expression, the above-described cells were cultured. Stained with Alexa Fluor® 647-Myc-Tag (9B11) Mouse mAb as described above and analyzed with BD Accuri TM C6 (BD Biosciences). As a result, GFP was expressed in more than 99% of the cells, indicating that only virus-infected NK 92 cells were isolated and cultured (FIG. 2d).
  • NK cells introduced with the NK-CAR prepared in the above example were evaluated.
  • CD19-positive cell line REH on day 2 of culture was used as a target cell, and NK-CAR expressing NKL cells on day 3 of culture rested for 24 hours, and
  • NKL into which pMXs-IRES-GFP (empty vector) was introduced was used as an effector cell.
  • NK92 cells In order to rest the effector cells, the cells on the second day of culture were washed with serum free RPMI1640, suspended in 10 ml of rested RPMI1640 (+5% FBS, 0.5% pen/strep, 0.5% sodium pyruvate) medium and cultured for 24 hours. .
  • NK92 cells introduced with NK-CAR CD19-positive cell lines REH and Ramos on day 2 of culture were used as target cells, and NK-CAR expressing NK92 cells on day 2 of culture without resting, And as a control, NK92 into which pMXs-IRES-GFP (empty vector) was introduced was used as an effector cell.
  • NK-CAR-expressing NKL and NK92 cells The apoptotic activity of NK-CAR-expressing NKL and NK92 cells was measured by Europium assay, respectively.
  • the target cells were suspended in rested IMDM (+5% FBS, 0.5% pen/strep) to a concentration of 1.0 ⁇ 10 6 cells/400 ⁇ l, and then 40 ⁇ M BATDA (Perkin Elmer, #C136-100) was added to 5.0% CO. It was kept warm for 30 minutes in a 37°C, CO 2 incubator equilibrated with 2 gas.
  • NK-CAR-expressing NKL cells were kept warm for 2 hours, and NK-CAR-expressing NK92 cells were kept warm for 30 minutes.
  • FIG. 3a shows the apoptotic activity of NK-CAR introduced NKL cells.
  • EV Extra vector
  • 2 nd CAR and NK-CAR mean NKL cells infected with the virus made by the pMXs-CAR-IRES-GFP vector.
  • the effector to target ratio is 20: 1
  • the EV group did not kill REH, a CD19-positive cell line, and the 2nd CAR killed about 60% of REH cells, and the NK-CAR killed about 70 to 80 % of REH cells were killed.
  • the effector to target ratio was 10:1 or 5:1, the REH killing activity of NKL cells expressing the NK-CAR according to the present invention was higher than that of control cells expressing 2 nd CAR.
  • Figures 3b and 3c show the killing activity of NK-CAR-introduced NK92 cells against REH cells ( Figure 3b) and RAMOS cells ( Figure 3c), respectively.
  • EV Extra vector
  • 2nd CAR and NK-CAR mean NK92 cells infected with the virus made by the pMXs-CAR-IRES-GFP vector.
  • the apoptotic activity of the NK-CAR expressing cells of the present invention was significantly higher than that of the 2 nd CAR expressing cells in both REH cells and RAMOS cells, and these results were the same at all Effector to Target ratios.
  • NK-CAR3 of the present invention prepared based on a specific NK activating receptor combination (NKG2D+2B4) is particularly effective in activating NK cells.
  • cells expressing NK-CAR3 showed more excellent apoptosis activity than other NK-CAR expressing cells, which shows that NK-CAR3 among NK-CARs according to the present invention is particularly effective in activating NK cells.
  • Macrophage inflammatory protein-1 ⁇ (also called MIP-1 ⁇ ; CCL3) is a chemotactic cytokine known as a chamokine and is secreted from activated natural killer cells.
  • Granzyme B is a serine protease most commonly found in the granules of natural killer cells and cytotoxic T cells, and perforin-mediated target cell death by these cells (perforin-dependent target cell death). It is an important factor in inducing death) mechanism and is secreted together with perforin.
  • NK-CAR expressing cells MIP-1 ⁇ and granzyme B levels were measured.
  • CD19-positive cell line REH on day 2 of culture was used as a target cell, NKL cells expressing NK-CAR on day 3 of culture rested for 24 hours, and 2nd CAR transduced NKL cells as a control, pMXs-IRES-GFP (empty vector; EV ) Transduced NKL cells, and simple NKL cells (NKL cells without vector introduction) were used as effector cells.
  • pMXs-IRES-GFP empty vector; EV
  • NKL cells simple NKL cells
  • Natural killer cells that recognize the target antigen activate AKT and ERK signals to exert antitumor effects. Therefore, it was confirmed whether the NK-CAR-expressing natural killer cells according to the present invention effectively recognize the target antigen (CD19) and activate specific AKT and ERK signals.
  • CD19-positive cell line REH or recombinant human CD19 Fc chimera were used as stimulants to stimulate NK-CAR-introduced NKL cells and control NKL cells on day 3 of culture resting for 24 hours. , and confirmed changes in AKT and ERK signals.
  • the cells on the second day of culture were washed with serum free RPMI1640, suspended in 10 ml of rested RPMI1640 (+5% FBS, 0.5% pen/strep, 0.5% sodium pyruvate), and cultured for 24 hours.
  • the process of obtaining a cell lysate by stimulating NKL cells with REH cells is as follows.
  • CD19 positive cell line REH cells, anti-CD19-DAP10-2B4 CAR (a structure without CD3 ⁇ intracellular signaling domain in NK-CAR2) introduced NKL cells, and control NKL cells were 5.0 ⁇ 10 6 cells/100 ⁇ l/sample.
  • RPMI (+5% FBS, 0.5% pen/strep, 0.5% sodium pyruvate After each suspension in rested RPMI (+5% FBS, 0.5% pen/strep, 0.5% sodium pyruvate), it was cooled at 4°C for 10 minutes.
  • REH cells and CAR transduced NKL cells After mixing REH cells and control NKL cells, respectively, centrifugation was performed and the pellets were cooled at 4°C for 10 minutes.
  • the process of obtaining a cell lysate by stimulating NKL cells with a recombinant human CD19 Fc chimera is as follows. Protein G (Invitrogen, #1003D) 4.0 ⁇ 10 7 beads/sample was washed with wash buffer (1X PBS + 0.01% Tween-20 + 1% FBS). Here, 4 ⁇ g/sample of recombinant human CD19 Fc chimera (R&D, #9269-CD) was added, and rotation incubation was performed at 4°C for 1 hour.
  • Anti-CD19-DAP10-2B4 CAR (a structure without CD3 ⁇ intracellular signaling domain in NK-CAR2) introduced NKL cells and control NKL cells at 2.0 ⁇ 10 6 cells/sample were centrifuged to form a pellet and refrigerated for a minute. It was resuspended in beads solution, centrifuged to make pellets, and cooled at 4°C for 10 minutes.
  • the cell lysate obtained by the above method was subjected to SDS-PAGE using an 8% acrylamide gel, and the protein was transferred to a PVDF membrane (immobilon, #IPVH00010) by a semi-dry transfer method. After blocking with 5% skim milk, antigen-antibody reaction was performed. Primary antibodies were treated at 4°C for 16 hours, and the list of primary antibodies used is as follows: Phospho-Akt (cell signaling, #CS9271), AKT (cell signaling, #CS9272), Phospho-p44/42 Erk1/ 2 (cell signaling, #CS9101), Erk1/2 (cell signaling, #CS4695).
  • the secondary antibody (mouse anti-rabbit IgG-HRP (Santa Cruz Biotechnology, #SC2357)) was treated at room temperature for 1 hour. Then, proteins were detected with ImageQuant LAS 4000 (Fujifilm) using SuperSignal TM WestPico PLUS Chemiluminescent Substrate (Thermo Scientific, #34580).
  • NK-CAR a structure without the CD3 ⁇ intracellular signaling domain in NK-CAR2
  • FIG. 5a The results of stimulating the NK-CAR (a structure without the CD3 ⁇ intracellular signaling domain in NK-CAR2)-expressing cell lines with CD19-positive REH cells are shown in FIG. 5a.
  • control NKL cells that do not express NK-CAR showed no significant difference in the phosphorylation levels of AKT and ERK even when stimulated with REH.
  • the results of stimulation of a cell line expressing NK-CAR (a construct lacking the CD3 ⁇ intracellular signaling domain in NK-CAR2) with the recombinant human CD19 Fc chimera are shown in FIG. 5B . Similar to the above results, AKT and ERK signals were not activated in NKL cells that did not express NK-CAR even when stimulated with CD19, but phosphorylation of AKT and ERK in NKL cells expressing NK-CAR was stimulated with CD19 for 5 minutes. markedly increased.
  • Degranualation refers to a cellular process that releases antimicrobial, cytotoxic substances and the like from secretory vesicles called granules. Degranulation is observed in granulocytes (neutrophils, basophils, and eosinophils) or immune cells such as mast cells, NK cells, and T cells, and is mainly aimed at attacking invading microorganisms.
  • activated NK cells induce apoptosis by releasing substances including perforin and granzyme on the surface of target cells through degranulation.
  • the granular inner surface of NK cells is coated with CD107a.
  • CD107a After degranulation, CD107a is exposed on the surface of cytotoxic lymphocytes and thus protects the outer membrane of lymphocytes from perforin-induced damage.
  • Degranulation assays of NK cells based on externalization of CD107a allow direct detection of activation of NK cells in response to antigen. Therefore, in this Example, the activation of NK cells by the NK-CAR was verified by measuring the degree of degranulation of NK cells into which the NK-CAR of the present invention was introduced.
  • CD19-positive cell lines REH and Ramos cells on day 2 of culture were used as target cells
  • NK-CAR-introduced NK92 cells on day 2 of culture were used as target cells
  • pMXs-IRES-GFP transduced NK92 cells were used as effector cells.
  • Target cells are 1.0 ⁇ 10 5 cells/50 ⁇ l/sample
  • effector cells are 1.0 ⁇ 10 5 cells/100 ⁇ l/sample
  • anti-CD107a/LAMP1-PE (clone H4A3, BD Bioscience, #555801) is 2 ⁇ l/50 Suspended in IMDM (+10% FBS, 1% pen/strep) to ⁇ l/sample and dispensed into 96 well plates to make a final volume of 200 ⁇ l, which was equilibrated with 5.0% CO 2 gas at 37°C and CO 2 Co-cultured for 2 hours in an incubator.
  • the cell pellet was suspended in DPBS (+1% FBS) by centrifugation and anti-CD3-PerCP (clone SK7, BD Bioscience, #347344), anti-CD56-APC (clone NCAM16.2, BD Bioscience, #341025) ), and anti-CD107a/LAMP1-PE (clone H4A3, BD Bioscience, #555801), respectively, and labeled for 35 minutes in a dark room at 4°C. After washing the cells twice with DPBS (+1% FBS), CD107a expression on the surface of NK92 cells was confirmed by flow cytometry to evaluate cytotoxic degranulation.
  • NK-activating receptor NK-CAR3-introduced NK92 cells based on the combination showed the highest percentage of CD107a-positive cells in the REH-stimulated group and the Ramos-stimulated group at 21.6% and 44.7%, respectively.
  • NK-CAR of the present invention can induce degranulation of NK cells more effectively than conventional CARs, and thus promote better apoptosis activity.
  • NK-CAR-introduced NK92 cells CD19-positive cell lines REH and Ramos cells on day 2 of culture were used as target cells, NK-CAR-introduced NK92 on day 2 of culture, and 2 nd CAR transduced NK92 cells were used.
  • pMXs-IRES-GFP transduced NK92 cells were used as effector cells.
  • Target cells were suspended in IMDM (+10% FBS, 1% pen/strep) to 1.0 ⁇ 10 5 cells/100 ⁇ l/sample and effector cells were 1.0 ⁇ 10 5 cells/100 ⁇ l/sample, and then plated in a 96 well plate. Each was aliquoted and co-cultured for 1 hour in a CO 2 incubator at 37° C. equilibrated with 5.0% CO 2 gas. Thereafter, brefeldin A (GolgiPlug; BD Biosciences, #51-2301KZ) and a protein transport inhibitor containing monensin (GolgiStop; BD Bioscience, #51-2092KZ) were added, followed by further incubation for 5 hours.
  • brefeldin A GolgiPlug; BD Biosciences, #51-2301KZ
  • a protein transport inhibitor containing monensin GolgiStop; BD Bioscience, #51-2092KZ
  • the cell pellet was suspended in DPBS (+1% FBS) by centrifugation and anti-CD3-PerCP (clone SK7, BD Bioscience, #347344), anti-CD56-APC (clone NCAM16.2, BD Bioscience) , #341025) for 35 minutes in the dark at 4°C.
  • DPBS (+1% FBS the cells were fixed/permeabilized with BD Cytofix/Cytoperm solution (BD Biosciences, #51-2090KZ) for 20 minutes in the dark at 4°C.
  • the cells were washed twice with 1X BD Perm/Wash buffer (BD Biosciences, #51-2091KZ), and incubated with anti-Interferon- ⁇ -PE (clone 25723.11, BD Bioscience, #340452) for 15 hours at 4°C in the dark. dyed. After staining, cells were washed twice with 1X BD Perm/Wash buffer, and cytokine production was evaluated by checking Interferon- ⁇ expression in NK92 cells through flow cytometry.
  • 1X BD Perm/Wash buffer BD Biosciences, #51-2091KZ
  • anti-Interferon- ⁇ -PE clone 25723.11, BD Bioscience, #340452
  • the ratio of Interferon- ⁇ -positive cells in NK-CAR3-introduced NK92 cells based on the NK-activated receptor combination (NKG2D+2B4) was 19.3% and 58.6%, respectively, in the REH-stimulated group and the Ramos-stimulated group, respectively.
  • NK-CAR of the present invention can promote cytokine production of NK cells more effectively than conventional CARs, and thus induce more excellent apoptosis activity.
  • the present inventors derived a natural killer cell-specific chimeric antigen receptor capable of exerting a synergistic effect of activating natural killer cells through a combination of natural killer cell-specific activating receptors.
  • natural killer cells expressing the chimeric antigen receptor effectively recognized target cells and activated AKT and ERK signals, thereby inducing excellent antitumor activity.
  • the chimeric antigen receptor activates natural killer cells to promote the production and secretion of cytotoxic substances such as cytokines, and induces degranulation to enhance apoptotic activity.
  • the natural killer cell-specific chimeric antigen receptor of the present invention has a higher effect of activating natural killer cells and inducing apoptosis function than T cell-based CAR. Therefore, the natural killer cell-specific chimeric antigen receptor according to the present invention is a novel anti-cancer immunotherapy means, and is expected to exhibit more excellent anti-cancer effects while reducing the risk of side effects of existing anti-cancer therapies.
  • the present invention relates to a natural killer cell-specific chimeric antigen receptor (NK-CAR), and the like, wherein an NK-CAR comprising a specific combination of natural killer cell-specific activation receptor-derived domains effectively activates natural killer cells to target cells. It was completed by confirming that it could enhance the killing ability. Specifically, the inventors prepared three natural killer cell-specific CARs composed of combinations of specific domains, and natural killer cells expressing the NK-CAR produced cytokines and granzyme B in response to target cells. It was confirmed that the activation of AKT and ERK was further enhanced, and degranulation was promoted to exert a more excellent apoptotic activity.
  • NK-CAR natural killer cell-specific chimeric antigen receptor
  • the NK-CAR according to the present invention can enhance the apoptotic activity by strongly inducing the activation of natural killer cells, it can be used as an immunotherapy for the treatment of various diseases including cancer.
  • CAR-based anti-cancer treatment using natural killer cells does not cause cytokine release syndrome or neurotoxicity, and since autologous and allogeneic natural killer cells can be used, it has the advantage of having fewer side effects than CAR-T. Therefore, natural killer cells expressing NK-CAR according to the present invention are expected to be used as cell therapy agents with maximized disease treatment effects while reducing side effects.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • General Health & Medical Sciences (AREA)
  • Biomedical Technology (AREA)
  • Zoology (AREA)
  • Cell Biology (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Biotechnology (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Animal Behavior & Ethology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Biophysics (AREA)
  • Wood Science & Technology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Virology (AREA)
  • Microbiology (AREA)
  • Hematology (AREA)
  • Epidemiology (AREA)
  • Toxicology (AREA)
  • General Engineering & Computer Science (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)

Abstract

본 발명은 자연살해세포 특이적 키메릭항원수용체 (NK-CAR) 등에 관한 것으로서, 자연살해세포 특이적 활성화 수용체 유래 도메인들의 특정 조합을 포함하는 NK-CAR가 자연살해세포를 효과적으로 활성화하여 타겟세포에 대한 사멸능을 증진시킬 수 있음을 확인하여 완성된 것이다. 구체적으로, 본 발명자들은 특정 도메인들의 조합으로 이루어진 3가지의 자연살해세포 특이적 CAR를 제조하였으며, 상기 NK-CAR를 발현하는 자연살해세포는 타겟세포에 반응한 사이토카인 및 그랜자임 B의 생성이나 AKT 및 ERK 활성화가 더욱 증진되고, 탈과립화가 촉진되어 더욱 우수한 세포사멸 활성을 발휘하는 것을 확인하였다. 즉, 본 발명에 따른 NK-CAR는 자연살해세포의 활성화를 강력히 유도하여 세포사멸 활성을 증진시킬 수 있으므로, 암을 포함한 다양한 질환의 치료를 위한 면역요법으로 활용될 수 있다. 특히 자연살해세포를 이용한 CAR 기반 항암 치료는 사이토카인 방출 신드롬이나 신경독성 등을 유발하지 않고, 자가 및 동종의 자연살해세포를 이용할 수 있으므로 CAR-T 등에 비해 부작용이 적은 장점이 있다. 따라서 본 발명에 따른 NK-CAR를 발현하는 자연살해세포는 부작용은 낮추면서 질병 치료 효과는 극대화된 세포치료제로 활용될 것으로 기대된다.

Description

자연살해세포-특이적 키메릭항원수용체 및 이의 용도
본 발명은 자연살해세포 특이적 키메릭항원수용체, 이를 발현하는 자연살해세포, 및 이의 용도 등에 관한 것이다.
본 발명은 2021년 11월 22일에 출원된 한국특허출원 제10-2021-0161425호 및 2022년 11월 9일에 출원된 한국특허출원 제10-2022-0149000호에 기초한 우선권을 주장하며, 상기 출원들의 명세서 및 도면에 개시된 모든 내용은 본 출원에 원용된다.
암은 현대인의 사망원인에서 가장 큰 비중을 차지하고 있는 질환 중 하나로서 유전자의 돌연변이 등으로 인하여 정상세포가 변화하여 발생된 질병이며, 정상적인 세포의 분화, 증식, 성장 형태 등을 따르지 않는 종양 중 악성인 것을 지칭한다. 암은 특히 "제어되지 않은 세포성장"으로 특징지어지며, 이러한 비정상적인 세포 성장에 의해 종양 (tumor)이라고 불리는 세포 덩어리가 형성되어 주위의 조직으로 침투하고, 심한 경우에는 신체의 다른 기관으로 전이되기도 한다. 암은 수술, 방사선 및 약물 요법 등으로 치료를 하더라도 많은 경우에 근본적인 치유가 되지 못하고 환자에게 고통을 주며 궁극적으로는 죽음에 이르게 하는 난치성 만성질환이다. 특히, 최근에는 노년 인구의 증가, 환경 악화 등으로 인하여 세계 암 발생률은 매년 5% 이상 증가되고 있는 추세이며, WHO 보고서에 따르면 향후 25년 내 암 발생 인구는 3천 만명으로 증가되고, 이중 2천 만명의 인구는 암으로 사망할 것으로 추정되고 있다.
암의 약물 치료, 즉, 항암제는 일반적으로 세포 독성을 가지고 있는 화합물로서 암세포를 공격해 사멸시키는 방식으로 암을 치료하는데, 암세포뿐만 아니라 정상세포에도 손상을 주기 때문에 높은 부작용을 나타낸다. 따라서 부작용을 감소시키기 위하여 표적 항암제들이 개발되었다. 그러나 이러한 표적 항암제들의 경우에는 부작용은 낮출 수 있었으나, 높은 확률로 내성이 생긴다는 한계점을 나타내었다. 따라서, 최근에는 체내의 면역체계를 이용하여 독성 및 내성으로 인한 문제점을 감소시키는 면역 항암제에 대한 관심이 급증하고 있는 추세이다. 이러한 면역 항암제의 일례로서 암세포 표면의 PD-L1에 특이적으로 결합하여 T 세포의 PD-1과의 결합을 억제하여 T 세포를 활성화시키고, 암세포를 공격하도록 만드는 면역관문억제제가 개발된 바 있다. 그러나 이러한 면역관문억제제의 경우에도 효과를 나타내는 암의 종류가 다양하지 않기 때문에, 다양한 암에서 동일하게 치료 효과를 나타내는 새로운 면역관문억제제의 개발이 절실히 필요한 실정이다.
최근에는 암을 공격하는 면역세포를 체내에 직접 투입하여 암세포 사멸을 유도하는 항암 면역세포치료에 대한 연구가 활발히 이루어지고 있다. 항암 면역세포치료에 이용되는 대표적인 면역세포 중 하나인 자연살해세포 (Natural killer cells, NK cells)는 선천적 면역반응을 담당하는 세포독성 림프구의 한 종류로, 형태학적으로는 세포질에 큰 과립을 가지며, 혈중 림프구의 5 내지 20 %를 차지한다. 자연살해세포는 표면에 다양한 면역수용체가 있어 암세포 및 정상세포를 구별할 수 있으므로, 암세포를 즉각적으로 감지하여 제거할 수 있다는 장점이 있다. 특히 자연살해세포는 암세포 및 바이러스 감염 세포 등의 발생, 증식, 전이를 억제할 뿐만 아니라 암 줄기세포를 효과적으로 제거할 수 있으므로, 암 줄기세포에 의한 암의 재발을 막을 수 있어 효과적인 항암 면역세포로 여겨진다. 뿐만 아니라, 다양한 임상연구에서 친족이나 정상인으로부터 분리한 자연살해세포를 환자에 도입하였을 때 기타 면역세포에 비해 면역거부 반응이 극히 적은 것으로 나타난 바, 세포치료제로서의 활용 가능성을 주목받고 있다.
한편, 키메릭항원수용체 (chimeric antigen receptor, CAR)는 면역세포에 항원 특이성을 전달하도록 설계된 인공 수용체로서, 이들은 면역세포를 활성화하고 특이적 면역성을 제공하도록 선택된 항원 특이적 구성요소, 막관통 구성요소, 세포 내 구성요소 등으로 구성된다. 최근에는 이러한 키메릭항원수용체를 코딩하는 유전자를 도입한 세포를 이용한 암 면역요법이 시도되고 있다. 가장 대표적인 면역요법은 환자로부터 T 세포를 채취한 후, 키메릭항원수용체를 코딩하는 유전자를 도입하여 증폭하고, 다시 환자에게 이입하는 요법을 통하여 암을 치료하는 방법, 즉 CAR-T 세포를 이용한 요법이다. 그러나 CAR-T 세포는 뛰어난 항암 효과를 가짐에도 불구하고 사이토카인 방출 신드롬이나 신경독성 등의 부작용이 있으며, 면역거부반응을 방지하기 위해서는 자가유래 T 세포를 이용해야 하는 한계점이 있다. 나아가, 자가유래 CAR-T의 제조공정이 매우 복잡하고, 제조 비용이 상당하며, 여전히 면역부작용의 문제를 갖고 있다는 문제점들이 있다. 이를 극복하기 위해 동종유래 (allogenic)의 off-the-shelf CAR-T에 대한 연구가 진행되고 있으나, 아직까지 상기 문제점들을 해결할 수 있는 CAR-T는 개발되지 않은 실정이다.
따라서 최근에는 CAR-T 대비 면역부작용의 위험이 덜하면서, 동종유래 세포치료제 제작이 용이한 자연살해세포 기반 치료제 "CAR-NK"가 주목받고 있다. 자연살해세포는 기타 면역세포와 비교하여 암세포 인지 범위가 보다 넓고, 별도의 유전자 조작 없이도 동종유래 세포 제작이 가능하며, 특히 면역거부 반응 등으로 인한 이식편대숙주질환의 위험이 거의 없기 때문에 자가유래세포뿐만 아니라 동종유래세포를 활용할 수 있다는 이점이 있다. 또한 NK 세포는 T 세포와 달리 off-the-shelf로 제공 가능하고 개별 환자에게 맞춤화할 필요가 없다는 점에서 보다 효율적이며, 나아가 암세포가 항원 (tumor-associated antigens, AACs)의 발현을 줄여 발생하는 CAR-T 내성 암종에도 적용이 가능할 것으로 기대된다.
즉, NK 세포를 이용한 CAR-NK 치료제는 대량생산이 가능해 치료제 비용을 절감할 수 있으며, 면역원성이 낮아 고형암 치료제, 사이토카인 부작용 등을 낮출 수 있는 치료제 대안으로 여겨지고 있다. 그러나 현재까지 키메릭항원수용체에 대한 연구는 대부분 T 세포 구성요소에 기반한 것이며, 이를 NK 세포에 적용하기는 어려움이 있다. 따라서, NK 세포의 특성에 맞춤화된 새로운 키메릭항원수용체의 개발이 필요한 실정이다.
본 발명은 상기 문제점을 해결하기 위해 안출된 것으로서, 자연살해세포 특이적 활성화 수용체 도메인들의 특정 조합을 포함하는 키메릭항원수용체가 자연살해세포를 효과적으로 활성화하여 타겟세포 (예컨대, 암세포) 사멸 활성을 증진시킬 수 있음을 확인하여 완성된 것이다.
따라서, 본 발명의 목적은 자연살해세포 특이적 키메릭항원수용체를 제공하는 것이다.
본 발명의 다른 목적은 상기 키메릭항원수용체를 발현하는 자연살해세포를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 키메릭항원수용체를 코딩하는 핵산 분자 및/또는 이를 포함하는 발현 벡터를 제공하는 것이다.
본 발명의 또 다른 목적은, 상기 발현 벡터로 형질전환된 세포를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 키메릭항원수용체를 발현하는 자연살해세포를 유효성분으로 포함하는, 암의 예방 또는 치료용 약학적 조성물을 제공하는 것이다.
본 발명의 또 다른 목적은 상기 키메릭항원수용체를 발현하는 자연살해세포를 유효성분으로 포함하는, 암의 예방 또는 치료용 세포치료제를 제공하는 것이다.
본 발명의 또 다른 목적은 (S1) 상기 발현 벡터를 단리된 세포에 형질전환하는 단계; 및
(S2) 상기 (S1) 단계에서 수득한 형질전환 세포를 배양하는 단계를 포함하는, 자연살해세포 특이적 키메릭항원수용체의 제조방법을 제공하는 것이다.
그러나, 본 발명이 이루고자 하는 기술적 과제는 이상에서 언급한 과제에 제한되지 않으며, 언급되지 않은 또 다른 과제들은 아래의 기재로부터 본 발명이 속하는 기술 분야의 통상의 지식을 가진 자에게 명확하게 이해될 수 있을 것이다.
본 발명은 자연살해세포 특이적 키메릭항원수용체로서, (i) 항원 결합 도메인; (ii) CD8 또는 CD28 힌지 도메인; (iii) DAP10 세포내 신호전달 도메인; (iv) 2B4 세포내 신호전달 도메인; 및 (v) CD3z 세포내 신호전달 도메인을 포함하고, 상기 키메릭항원수용체는 자연살해세포에서 발현되는 것을 특징으로 하는, 자연살해세포 특이적 키메릭항원수용체를 제공한다.
본 발명의 일 구현예에서, 상기 항원 결합 도메인은 종양항원 특이적 항체 또는 이의 항원 결합 단편일 수 있으나, 이에 한정되지 않는다.
본 발명의 다른 구현예에서, 상기 키메릭항원수용체는 하기 특징 중 하나 이상을 만족할 수 있으나, 이에 한정되지 않는다:
(a) 상기 CD8 힌지 도메인은 서열번호 2의 아미노산 서열을 포함함;
(b) 상기 CD28 힌지 도메인은 서열번호 3의 아미노산 서열을 포함함;
(c) 상기 DAP10 세포내 신호전달 도메인은 서열번호 7의 아미노산 서열을 포함함;
(d) 상기 2B4 세포내 신호전달 도메인은 서열번호 8의 아미노산 서열을 포함함; 및
(e) 상기 CD3z 세포내 신호전달 도메인은 서열번호 9의 아미노산 서열을 포함함.
본 발명의 또 다른 구현예에서, 상기 키메릭항원수용체는 CD28 막관통 도메인을 더 포함할 수 있으나, 이에 한정되지 않는다.
본 발명의 또 다른 구현예에서, 상기 CD28 막관통 도메인은 서열번호 4의 아미노산 서열을 포함할 수 있으나, 이에 한정되지 않는다.
본 발명의 또 다른 구현예에서, 상기 키메릭항원수용체는 DAP10 세포외 도메인 및 DAP10 막관통 도메인으로 이루어진 군에서 선택된 하나 이상을 더 포함할 수 있으나, 이에 한정되지 않는다.
본 발명의 또 다른 구현예에서, 상기 키메릭항원수용체는 하기 특징 중 하나 이상을 만족할 수 있으나, 이에 한정되지 않는다:
(f) 상기 DAP10 세포외 도메인은 서열번호 5의 아미노산 서열을 포함함; 및
(g) 상기 DAP10 막관통 도메인은 서열번호 6의 아미노산 서열을 포함함.
본 발명의 또 다른 구현예에서, 상기 키메릭항원수용체는 신호 펩티드를 더 포함할 수 있으나, 이에 한정되지 않는다.
본 발명의 또 다른 구현예에서, 상기 신호 펩티드는 CD8 신호 펩티드일 수 있으나, 이에 한정되지 않는다.
본 발명의 또 다른 구현예에서, 상기 종양항원은 CD19, TAG72, IL13Rα2 (Interleukin 13 receptor alpha-2 subunit), CD52, CD33, CD20, TSLPR, CD22, CD30, GD3, CD171,　NCAM (Neural cell adhesion molecule), FBP (Folate binding protein), Le(Y) (Lewis-Y antigen),　PSCA (Prostate stem cell antigen), PSMA (Prostate-specific membrane antigen), CEA (Carcinoembryonic antigen), HER2 (Human epidermal growth factor receptor 2),　Mesothelin,　CD44v6 (Hyaluronate receptor variant 6), B7-H3, Glypican-3, ROR1 (receptor tyrosine kinase like orphan receptor 1), Survivin, FOLR1 (folate receptor 1), WT1 (Wilm's tumor 1), VEGFR2 (Vascular endothelial growth factor 2), EGFR, 및 KRAS로 이루어진 군에서 선택된 하나 이상일 수 있으나, 이에 한정되지 않는다.
본 발명의 또 다른 구현예에서, 상기 항원 결합 단편은 scFv, (scFv)2,　Fab,　Fab', 및 F(ab')2로 이루어진 군으로부터 선택될 수 있으나, 이에 한정되지 않는다.
본 발명의 또 다른 구현예에서, 상기 종양항원 특이적 항체 또는 이의 항원 결합 단편은 하기의 중쇄 가변영역 및 경쇄 가변영역을 포함할 수 있으나, 이에 한정되지 않는다:
(i) 서열번호 26의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 27의 아미노산 서열을 포함하는 중쇄 CDR2, 및 서열번호 28의 아미노산 서열을 포함하는 중쇄 CDR3를 포함하는 중쇄 가변영역; 및
(ii) 서열번호 29의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 30의 아미노산 서열을 포함하는 경쇄 CDR2, 및 서열번호 31의 아미노산 서열을 포함하는 경쇄 CDR3를 포함하는 경쇄 가변영역.
본 발명의 또 다른 구현예에서, 상기 종양항원 특이적 항체 또는 이의 항원 결합 단편은 서열번호 1의 아미노산 서열을 포함할 수 있으나, 이에 한정되지 않는다.
또한, 본 발명은 본 발명에 따른 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포를 제공한다. 즉, 본 발명은 상기 키메릭항원수용체를 포함하는 (발현하는) CAR-NK 세포를 제공한다.
본 발명의 일 구현예에서, 상기 자연살해세포는 하기로 이루어진 군에서 선택된 하나 이상의 특징을 만족할 수 있으나, 이에 한정되지 않는다:
(a) 항원 인식시 MIP-1α, 그랜자임 B, 및 INF-γ로 이루어진 군에서 선택된 하나 이상의 분비량이 증가함;
(b) 항원 인식시 AKT 신호 및 ERK 신호로 이루어진 군에서 선택된 하나 이상의 활성이 증가함; 및
(c) 항원 인식시 탈과립화 수준이 증가함.
또한, 본 발명은 본 발명에 따른 자연살해세포 특이적 키메릭항원수용체를 코딩하는 핵산 분자를 제공한다.
또한, 본 발명은 상기 핵산 분자를 포함하는 발현 벡터를 제공한다.
또한, 본 발명은 상기 발현 벡터가 도입된, 단리된 세포를 제공한다.
또한, 본 발명은 본 발명에 따른 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포를 유효성분으로 포함하는, 암의 예방 또는 치료용 약학적 조성물을 제공한다. 바람직하게는, 상기 키메릭항원수용체의 항원 결합 도메인은 종양항원 특이적 항체 또는 이의 항원 결합 단편이다.
또한, 본 발명은 본 발명에 따른 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포를 유효성분으로 포함하는, 암의 예방 또는 치료용 세포치료제를 제공한다.
뿐만 아니라, 본 발명은 상기 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포를 이를 필요로 하는 개체에 투여하는 단계를 포함하는, 암의 예방 또는 치료방법을 제공한다.
뿐만 아니라, 본 발명은 암의 예방 또는 치료를 위한, 상기 자연살해세포 특이적 키메릭항원수용체, 상기 키메릭항원수용체를 코딩하는 핵산 분자, 상기 핵산 분자를 포함하는 발현 벡터, 상기 발현 벡터가 도입된 세포, 및/또는 상기 키메릭항원수용체를 발현하는 자연살해세포의 용도를 제공한다.
뿐만 아니라, 본 발명은 암 치료용 약제의 제조를 위한, 상기 자연살해세포 특이적 키메릭항원수용체, 상기 키메릭항원수용체를 코딩하는 핵산 분자, 상기 핵산 분자를 포함하는 발현 벡터, 상기 발현 벡터가 도입된 세포, 및/또는 상기 키메릭항원수용체를 발현하는 자연살해세포의 용도를 제공한다. 상기 약제는 암 치료용 세포치료제일 수 있다.
본 발명의 일 구현예에서, 상기 암은 대장암, 직장암, 결장암, 갑상선암, 구강암, 인두암, 후두암, 자궁경부암, 뇌암, 폐암, 난소암, 방광암, 신장암, 간암, 췌장암, 전립선암, 피부암, 혀암, 유방암, 자궁암, 위암, 골암, 림프종, 혈액암, 편평상피세포암, 폐의 선암, 복막암, 피부암, 피부 흑색종, 안구 흑색종, 직장암, 항문부근암, 식도암, 소장암, 내분비선암, 부갑상선암, 부신암, 연조직 육종, 요도암, 위장암, 교아종, 난소암, 자궁내막암, 침샘암, 음문암, 및 두경부암으로 이루어진 군으로부터 선택된 하나 이상일 수 있으나, 이에 한정되지 않는다.
본 발명은 또한, (S1) 상기 발현 벡터를 단리된 세포에 도입시키는 단계; 및 (S2) 상기 발현 벡터가 도입된 세포를 배양하는 단계를 포함하는, 자연살해세포 특이적 키메릭항원수용체의 제조방법을 제공한다.
본 발명은 또한, 상기 발현 벡터를 단리된 자연살해세포에 도입시키는 단계를 포함하는, 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포의 제조방법을 제공한다.
본 발명은 자연살해세포 특이적 키메릭항원수용체 (NK-CAR) 등에 관한 것으로서, 자연살해세포 특이적 활성화 수용체 유래 도메인들의 특정 조합을 포함하는 NK-CAR가 자연살해세포를 효과적으로 활성화하여 타겟세포에 대한 사멸능을 증진시킬 수 있음을 확인하여 완성된 것이다. 구체적으로, 본 발명자들은 특정 도메인들의 조합으로 이루어진 3가지의 자연살해세포 특이적 CAR를 제조하였으며, 상기 NK-CAR를 발현하는 자연살해세포는 타겟세포에 반응한 사이토카인 및 그랜자임 B의 생성이나 AKT 및 ERK 활성화가 더욱 증진되고, 탈과립화가 촉진되어 더욱 우수한 세포사멸 활성을 발휘하는 것을 확인하였다. 즉, 본 발명에 따른 NK-CAR는 자연살해세포의 활성화를 강력히 유도하여 세포사멸 활성을 증진시킬 수 있으므로, 암을 포함한 다양한 질환의 치료를 위한 면역요법으로 활용될 수 있다. 특히 자연살해세포를 이용한 CAR 기반 항암 치료는 사이토카인 방출 신드롬이나 신경독성 등을 유발하지 않고, 자가 및 동종의 자연살해세포를 이용할 수 있으므로 CAR-T 등에 비해 부작용이 적은 장점이 있다. 따라서 본 발명에 따른 NK-CAR를 발현하는 자연살해세포는 부작용은 낮추면서 질병 치료 효과는 극대화된 세포치료제로 활용될 것으로 기대된다.
도 1은 본 발명에 따른 키메릭항원수용체 NK-CAR1, NK-CAR2, NK-CAR3, 및 대조군 2nd generation CAR의 구조를 나타낸다.
도 2a는 본 발명에 따른 NK-CAR 레트로바이러스를 NKL 세포에 감염시킨 후 3일이 지났을 때 GFP 및 NK-CAR 발현 세포의 비율을 유세포분석으로 확인한 결과를 나타낸다.
도 2b는 레트로바이러스 감염 3일 후의 NKL 세포들 중 GFP 발현 세포를 분리하여 배양한 후, 이들 중 GFP 및 NK-CAR 발현 세포의 비율을 유세포분석으로 확인한 결과를 나타낸다.
도 2c는 본 발명에 따른 NK-CAR 레트로바이러스를 NK-92 세포에 감염시킨 후 3일이 지났을 때 GFP 및 NK-CAR 발현 세포의 비율을 유세포분석으로 확인한 결과를 나타낸다.
도 2d는 레트로바이러스 감염 3일 후의 NK-92 세포들 중 GFP 발현 세포를 분리하여 배양한 후, 이들 중 GFP 및 NK-CAR 발현 세포의 비율을 유세포분석으로 확인한 결과를 나타낸다.
도 3a는 공벡터, 대조군 2nd CAR, 또는 본 발명에 따른 NK-CAR 발현 NKL 세포의 CD19 양성 REH 세포주에 대한 세포사멸활성을 Europium assay로 측정한 결과를 나타낸다 (EV: 공벡터, 이하 동일).
도 3b 및 3c는 공벡터, 대조군 2nd CAR, 또는 본 발명에 따른 NK-CAR을 발현하는 NK92 세포의 CD19 양성 REH 세포주 (도 3b) 및 RAMOS 세포주 (도 3c)에 대한 세포사멸활성을 Europium assay로 측정한 결과를 나타낸다.
도 4a 및 4b는 공벡터, 대조군 2nd CAR, 및 본 발명에 따른 CAR-NK 발현 NKL 세포를 각각 CD19 양성 REH 세포주와 공동배양한 후 NKL 세포로부터 분비된 MPI-1α (도 4a) 및 그랜자임 B (도 4b) 수준을 ELISA로 측정한 결과를 나타낸다.
도 5a는 NKL 세포 또는 NK-CAR 발현 NKL 세포를 CD19 양성 REH 세포로 2분 또는 5분간 자극한 후 AKT 및 ERK 신호의 활성화 정도를 웨스턴 블롯으로 확인한 결과를 나타낸다.
도 5b는 NKL 세포 또는 NK-CAR 발현 NKL 세포를 재조합 인간 CD19 Fc 키메라로 2분 또는 5분간 자극한 후 AKT 및 ERK 신호의 활성화 정도를 웨스턴 블롯으로 확인한 결과를 나타낸다.
도 6은 공벡터, 대조군 2nd CAR, 또는 본 발명에 따른 NK-CAR을 발현하는 NK92 세포를 CD19 양성 세포 (REH 또는 Ramos)와 공동배양한 후, NK92 세포의 탈과립화 정도를 측정한 결과를 나타낸다.
도 7은 공벡터, 대조군 2nd CAR, 또는 본 발명에 따른 NK-CAR을 발현하는 NK92 세포를 CD19 양성 세포 (REH 또는 Ramos)와 공동배양한 후, Interferon-γ 양성 NK92 세포의 비율을 측정한 결과를 나타낸다.
도 8은 NK-CAR1의 바람직한 아미노산 서열의 일 예를 나타낸다.
도 9은 NK-CAR2의 바람직한 아미노산 서열의 일 예를 나타낸다.
도 10은 NK-CAR3의 바람직한 아미노산 서열의 일 예를 나타낸다.
본 발명은 자연살해세포 (Natural killer cells, NK 세포) 특이적 키메릭항원수용체 (chimeric antigen receptor, CAR) 등에 관한 것으로서, 자연살해세포 특이적 활성화 수용체 도메인들의 특정 조합을 포함하는 키메릭항원수용체가 자연살해세포의 활성화에 효과적이며 암세포 특이적 사멸을 유도할 수 있음을 확인하여 완성된 것이다.
구체적으로, 본 발명의 일 실시예에서는 본 발명에 따른 3가지의 NK-CAR 유전자 및 T 세포 기반 CAR (대조군) 유전자의 레트로바이러스 벡터를 제작하였으며 (실시예 1), 상기 벡터를 도입한 레트로바이러스를 이용하여 자연살해세포 (NKL 세포 및 NK92 세포)에서 키메릭항원수용체를 발현시켰다 (실시예 2).
본 발명의 다른 실시예에서는 NK-CAR 발현 NKL 세포 및 NK92 세포의 암세포 사멸 활성을 평가한 결과, NK-CAR 발현 NKL 세포 및 NK92 세포 모두 대조군에 비해 타겟세포 (암세포)의 사멸을 더욱 효과적으로 일으키는 것을 확인하였다 (실시예 3).
본 발명의 또 다른 실시예에서는 NK-CAR 발현 NKL 세포의 사이토카인 분비능을 평가한 결과, NK-CAR 발현 NKL 세포를 타겟세포 (암세포)로 자극하였을 때 대조군에 비해 MIP-1α 및 그랜자임 B의 분비량이 더욱 증가한 것을 확인하였다 (실시예 4).
본 발명의 또 다른 실시예에서는 NK-CAR 발현 NKL 세포의 표적 항원 인식에 따른 AKT 및 ERK 신호 활성화 정도를 평가한 결과, NK-CAR 발현 NKL 세포를 타겟항원 단백질 또는 타겟항원을 발현하는 암세포로 자극하였을 때 대조군에 비해 AKT 및 ERK의 인산화 수준이 더욱 증가한 것을 확인하였다 (실시예 5).
본 발명의 또 다른 실시예에서는 NK-CAR 발현 NK92 세포는 대조군에 비해 타겟항원 인식에 따른 탈과립화 정도가 더욱 높은 것을 확인하였다 (실시예 6).
본 발명의 또 다른 실시예에서는 NK-CAR 발현 NK92 세포는 대조군에 비해 타겟항원 인식에 따른 사이토카인 생성 정도가 더욱 높은 것을 확인하였다 (실시예 7).
즉, 본 발명에 따른 자연살해세포 특이적 키메릭항원수용체는 타겟에 반응하여 자연살해세포를 더욱 효과적으로 활성화하며 이의 세포사멸 활성을 증진시킬 수 있는 바, 암을 포함한 다양한 질환의 예방 및 치료를 위한 새로운 면역요법 수단으로 활용될 것으로 기대된다.
이하, 본 발명에 대해 구체적으로 설명한다.
본 발명은 자연살해세포에서 발현되는 것을 특징으로 하는, 자연살해세포 특이적 키메릭항원수용체를 제공한다.
본 발명에 있어서, "키메릭항원수용체 (chimeric antigen receptor, CAR)"는 특정 항원을 표적화 (targeting) 할 수 있는 합성 수용체 (synthetic receptors)를 의미한다. 본 발명에 따른 CAR는 항원 결합 도메인 (antigen-binding domain), 막관통 도메인 (transmembrane domain), 및 세포내 신호전달 도메인 (cytoplasmic domain)을 포함하여 수용체의 구조를 이루고 있으며, 바람직하게는 힌지 영역 (hinge region)을 더 포함한다.
본 발명에 있어서, "항원 결합 도메인 (antigen-binding domain)"은 표적 항원을 특이적으로 인식하고 결합할 수 있는 단백질 또는 폴리펩티드 도메인을 의미한다. 본 발명에 있어서 "항원 (antigen)"은 항체 등의 체액성 면역 매개체 혹은 T 세포 수용체 (T cell receptors) 등의 세포성 면역 매개체와 특이적으로 결합할 수 있는 폴리펩티드, 화합물, 또는 기타 물질을 의미한다.
본 발명에 따른 항원은 구체적인 종류에 제한되지 않으며, 당업자는 목적에 따라 적절한 항원 및 상기 항원에 특이적으로 결합할 수 있는 항원 결합 도메인을 적절히 선택할 수 있다. 예컨대, 박테리아 또는 바이러스 등에 의한 감염성 질환을 예방 또는 치료하고자 하는 경우, 상기 박테리아 또는 바이러스 특이적 단백질에 특이적인 항원 결합 도메인을 선택할 수 있다.
바람직하게는, 상기 항원은 종양항원 (tumor antigens)이다. 상기 종양항원은 암세포에서만 발현되는 종양특이적 항원 (tumor-specific antigens)은 물론, 정상세포에서도 발현되지만 암세포에서 특히 높은 빈도로 발현되거나 더욱 활성이 높은 종양 관련 항원 (tumor-associated antigens)을 모두 포함한다. 예컨대, 상기 종양항원은 암세포에서만 발현되거나 암세포에서 더 높은 빈도로 발현되는 표면 단백질일 수 있다. 상기 종양항원은 구체적인 종류로 제한되는 것은 아니나, 바람직하게는, CD19, TAG72, IL13Rα2(Interleukin 13 receptor alpha-2 subunit), CD52, CD33, CD20, TSLPR, CD22, CD30, GD3, CD171,　NCAM (Neural cell adhesion molecule), FBP (Folate binding protein), Le(Y) (Lewis-Y antigen),　PSCA (Prostate stem cell antigen), PSMA (Prostate-specific membrane antigen), CEA (Carcinoembryonic antigen), HER2 (Human epidermal growth factor receptor 2),　Mesothelin,　CD44v6 (Hyaluronate receptor variant 6), B7-H3, Glypican-3, ROR1 (receptor tyrosine kinase like orphan receptor 1), Survivin, FOLR1 (folate receptor 1), WT1 (Wilm's tumor 1), VEGFR2 (Vascular endothelial growth factor 2), EGFR (Epidermal growth factor receptor), 및 KRAS로 이루어진 군에서 선택될 수 있다.
본 발명에 있어서, "힌지 영역 (hinge region)"은 항원 결합 도메인 및 막관통 도메인 사이에 위치하여 유연한 링커 (linker) 역할을 하는 부위를 의미하며, "스페이서 (spacer)"라고 명명되기도 한다. 상기 힌지 영역은 항원 결합 도메인이 항원과 결합하였을 때 항원 결합 도메인이 적절하게 위치하도록 하여 항원과 안정된 결합을 형성하도록 한다. 예컨대, 상기 힌지 영역은 CAR를 발현하는 세포의 세포막으로부터 항원 결합 도메인을 확장하기 위한 목적을 갖는다.
본 발명에 있어서, "막관통 도메인 (transmembrane domain, TM)"은 세포막을 가로질러 세포외 및 세포내 신호전달 도메인을 연결하는 기능을 하는 임의의 폴리펩티드 또는 올리고펩티드를 의미한다. 막관통도메인은 키메릭항원수용체의 항원 결합 도메인이 세포 표면 (세포 외부)에 위치하고, 세포내 신호전달 도메인은 세포 내에 위치할 수 있도록 세포막을 관통할 수 있다. 즉, 상기 막관통 도메인은 키메릭항원수용체의 지지대 역할을 하는 동시에 항원 결합 도메인 (또는 힌지 도메인) 및 세포내 신호전달 도메인을 연결한다.
본 발명에 있어서, "세포내 신호전달 도메인 (cytoplasmic domain 또는 cytoplasmic signaling domain, CYP)"은 세포막 안쪽의 폴리펩티드 또는 올리고펩티드를 의미한다. 세포내 신호전달 도메인은 항원 결합 도메인에 의해 전달된 신호를 받아 CAR를 발현하는 세포의 내부로 상기 신호를 전달하는 역할을 한다. 상기 신호는 세포 내부로 전달되어 생물학적 과정의 활성화 또는 억제를 유발한다. 상기 세포내 신호전달 도메인은 항원 결합 도메인이 항원과 결합하였을 때 NK 세포의 활성화를 유도할 수 있는 신호를 전달하는 것이라면 특별히 그 종류에 제한되지 않는다. 본 발명에 있어서, 세포내 신호전달 도메인은 하나 이상의 세포내 공동-자극 도메인 (co-stimulatory domain)을 포함할 수 있다. 상기 공동-자극 도메인은 CAR의 세포외 또는 세포내 부분에 위치하며, CAR를 발현하는 세포에 신호를 전달하는 역할을 수행한다. 즉, 상기 공동-자극 도메인은 타겟항원의 결합에 따른 NK 세포의 충분한 반응 (활성화)을 유도하는데 기여한다. 상기 공동-자극 도메인은, 예컨대 CD27, CD28, 4-1BB, OX40, CD30, CD40, PD-1, ICOS, LFA-1 (lymphocyte function-associated antigen-1), CD2, CD7, LIGHT, NKG2C, 및/또는 B7-H3 유래 도메인으로부터 선택될 수 있으나, 이에 제한되지 않는다.
본 발명에 따른 키메릭항원수용체들의 각 도메인들은 선택적으로 짧은 올리고펩티드 또는 폴리펩티드 링커에 의해 연결될 수 있다. 상기 링커는 세포외에 위치한 항원 결합 도메인에 타겟항원이 결합하였을 때, 세포 내 도메인을 통해 NK 세포 활성화를 유도할 수 있는 것이라면 특별히 그 길이나 종류에 제한되지 않으며, 당업계 공지된 링커가 제한 없이 적용될 수 있다.
본 발명에 따른 키메릭항원수용체의 각 도메인들은 전술한 각 도메인들은 물론, 상기 도메인들 각각의 변형된 형태를 포함할 수 있다. 이때, 상기 변형은 상기 항체 및 도메인들의 기능을 변형시키지 않고, 야생형의 항체 및 도메인의 아미노산 서열에서 하나 이상의 아미노산을 치환, 결실 또는 추가하여 수행될 수 있다. 통상적으로, 상기 치환은 알라닌이거나, 전체 단백질의 전하, 극성 또는 소수성에 영향을 주지 않는 보존적 아미노산 치환 (conservative amino acid substitution)에 의해 수행될 수 있다.
본 발명에 따른 키메릭항원수용체가 발현될 수 있는 면역세포 (T 세포, NK세포, NKT 세포, 대식세포 등)의 종류에는 제한이 없다. 바람직하게는, 본 발명의 CAR는 자연살해세포 특이적 CAR로서, 자연살해세포에서 발현되는 것을 특징으로 한다. 바람직하게는, 본 발명에 따른 CAR는 자연살해세포 세포막에 위치하는 것을 특징으로 한다. 즉, 본 발명에 따른 CAR은 자연살해세포의 기능 활성화에 특화된 것으로서, 타겟항원과 결합하면 자연살해세포의 타겟세포 사멸 기능을 발동시키는 신호전달 경로 (signaling pathway)를 활성화시켜, 결과적으로 자연살해세포가 타겟세포를 특이적으로 사멸시키도록 유도한다. 본 발명에 따른 키메릭항원수용체는 투여 대상의 자가유래세포뿐만 아니라 동종유래세포에서도 발현될 수 있다.
본 발명에 따른 키메릭항원수용체의 힌지 도메인은 CD8, CD28, IgG1, IgG4, 및/또는 KIR (killer immunoglobulin-like receptor) 유래 도메인일 수 있으나, 이에 한정되는 것은 아니고, 당업계에서 통상적으로 사용되는 힌지 도메인을 제한 없이 적용할 수 있다.
바람직하게는, 본 발명에 있어서 상기 힌지 도메인은 CD8 (바람직하게는, CD8α) 힌지 도메인일 수 있다. 바람직하게는, 상기 CD8 힌지 도메인은 서열번호 2의 아미노산 서열을 포함할 수 있고, 더욱 바람직하게는 서열번호 2의 아미노산 서열로 이루어질 수 있으나 이에 제한되지 않으며, 상기 아미노산 서열의 변이체가 본 발명의 범위 내에 포함된다. 즉, 상기 CD8 힌지 도메인은 서열번호 2로 표시되는 아미노산 서열과 각각 70% 이상, 더욱 바람직하게는 80% 이상, 더 더욱 바람직하게는 90% 이상, 가장 바람직하게는 95% 이상의 서열 상동성을 가지는 아미노산 서열을 포함할 수 있다.
또는, 본 발명에 있어서 키메릭항원수용체의 힌지 도메인은 CD28 힌지 도메인일 수 있다. 바람직하게는, 상기 CD28 힌지 도메인은 서열번호 3의 아미노산 서열을 포함하거나, 서열번호 3의 아미노산 서열로 이루어진 폴리펩티드에 의해 코딩될 수 있으나, 이에 제한되지 않는다. 즉, 상기 CD28 힌지 도메인은 서열번호 3으로 표시되는 아미노산 서열과 각각 70% 이상, 더욱 바람직하게는 80% 이상, 더 더욱 바람직하게는 90% 이상, 가장 바람직하게는 95% 이상의 서열 상동성을 가지는 아미노산 서열을 포함할 수 있다.
본 발명에 따른 키메릭항원수용체의 세포내 신호전달 도메인은 DAP10, 2B4, 및/또는 CD3z 유래 도메인일 수 있으나, 이에 한정되는 것은 아니고, 타겟항원 자극에 의해 NK 세포를 활성화시키는 신호를 전달할 수 있는 것이라면 제한 없이 적용될 수 있다.
본 발명에 있어서 상기 DAP10 세포내 신호전달 도메인은 서열번호 7의 아미노산 서열을 포함하거나, 서열번호 7의 아미노산 서열로 이루어진 폴리펩티드에 의해 코딩될 수 있으나, 이에 제한되지 않는다. 즉, 상기 DAP10 세포내 신호전달 도메인은 서열번호 7로 표시되는 아미노산 서열과 각각 70% 이상, 더욱 바람직하게는 80% 이상, 더 더욱 바람직하게는 90% 이상, 가장 바람직하게는 95% 이상의 서열 상동성을 가지는 아미노산 서열을 포함할 수 있다.
또한, 본 발명에 있어서 상기 2B4 세포내 신호전달 도메인은 서열번호 8의 아미노산 서열을 포함하거나, 서열번호 8의 아미노산 서열로 이루어진 폴리펩티드에 의해 코딩될 수 있으나, 이에 제한되지 않는다. 즉, 상기 2B4 세포내 신호전달 도메인은 서열번호 8로 표시되는 아미노산 서열과 각각 70% 이상, 더욱 바람직하게는 80% 이상, 더 더욱 바람직하게는 90% 이상, 가장 바람직하게는 95% 이상의 서열 상동성을 가지는 아미노산 서열을 포함할 수 있다.
또한, 본 발명에 있어서 상기 CD3z (CD3ζ) 세포내 신호전달 도메인은 서열번호 9의 아미노산 서열을 포함하거나, 서열번호 9의 아미노산 서열로 이루어진 폴리펩티드에 의해 코딩될 수 있으나, 이에 제한되지 않는다. 즉, 상기 CD3z 세포내 신호전달 도메인은 서열번호 9로 표시되는 아미노산 서열과 각각 70% 이상, 더욱 바람직하게는 80% 이상, 더 더욱 바람직하게는 90% 이상, 가장 바람직하게는 95% 이상의 서열 상동성을 가지는 아미노산 서열을 포함할 수 있다.
바람직하게는, 본 발명에 따른 키메릭항원수용체는 CD28 막관통 도메인을 더 포함할 수 있다. 또한 상기 CD28 막관통 도메인은 서열번호 4의 아미노산 서열을 포함하거나, 서열번호 4의 아미노산 서열로 이루어진 폴리펩티드에 의해 코딩될 수 있으나, 이에 제한되지 않는다. 즉, 상기 CD28 막관통 도메인은 서열번호 4로 표시되는 아미노산 서열과 각각 70% 이상, 더욱 바람직하게는 80% 이상, 더 더욱 바람직하게는 90% 이상, 가장 바람직하게는 95% 이상의 서열 상동성을 가지는 아미노산 서열을 포함할 수 있다.
바람직하게는, 본 발명에 따른 키메릭항원수용체는 DAP10 세포외 도메인을 더 포함할 수 있다. 또한 상기 DAP10 세포외 도메인은 서열번호 5의 아미노산 서열을 포함하거나, 서열번호 5의 아미노산 서열로 이루어진 폴리펩티드에 의해 코딩될 수 있으나, 이에 제한되지 않는다. 즉, 상기 DAP10 세포외 도메인은 서열번호 5로 표시되는 아미노산 서열과 각각 70% 이상, 더욱 바람직하게는 80% 이상, 더 더욱 바람직하게는 90% 이상, 가장 바람직하게는 95% 이상의 서열 상동성을 가지는 아미노산 서열을 포함할 수 있다.
바람직하게는, 본 발명에 따른 키메릭항원수용체는 DAP10 막관통 도메인을 더 포함할 수 있다. 또한 상기 DAP10 막관통 도메인은 서열번호 6의 아미노산 서열을 포함하거나, 서열번호 6의 아미노산 서열로 이루어진 폴리펩티드에 의해 코딩될 수 있으나, 이에 제한되지 않는다. 즉, 상기 DAP10 막관통 도메인은 서열번호 6으로 표시되는 아미노산 서열과 각각 70% 이상, 더욱 바람직하게는 80% 이상, 더 더욱 바람직하게는 90% 이상, 가장 바람직하게는 95% 이상의 서열 상동성을 가지는 아미노산 서열을 포함할 수 있다.
바람직하게는, 본 발명에 따른 키메릭항원수용체는 신호 펩티드를 더 포함할 수 있다. 본 발명에 있어서 "신호 펩티드 (signal peptide)"는 단백질의 N-말단에 위치하는 아미노산 배열로서, 새롭게 합성된 단백질이 소포체 (endoplasmic reticulum, ER) 등 특정 위치로 이동하도록 유도하는 역할을 한다. 본 발명에 있어서 신호 펩티드는, 예를 들면, CD8 (CD8α), GM-CSF 수용체α, Ig-κ, 및 IgG1 중쇄 등으로부터 선택된 분자에서 유래된 것일 수 있으나 이에 제한되는 것은 아니다. 바람직하게는, 본 발명에 있어서, 신호 펩티드는 CD8 신호 펩티드일 수 있다. 또한 상기 CD8 신호 펩티드는 서열번호 10의 아미노산 서열을 포함하거나, 서열번호 10의 아미노산 서열로 이루어진 폴리펩티드에 의해 코딩될 수 있으나, 이에 제한되지 않는다. 즉, 상기 DAP10 막관통 도메인은 서열번호 10으로 표시되는 아미노산 서열과 각각 70% 이상, 더욱 바람직하게는 80% 이상, 더 더욱 바람직하게는 90% 이상, 가장 바람직하게는 95% 이상의 서열 상동성을 가지는 아미노산 서열을 포함할 수 있다. 본 발명에 따른 신호 펩티드는 바람직하게는 재조합 단백질 (CAR)의 N 말단에 위치하는 것으로서 상기 단백질을 세포 표면으로 이동시키기 위해 사용되며, 재조합 단백질이 발현될 때 서열 일부가 잘려나가 일부 아미노산만이 남을 수도 있고, 또는 서열 전부가 잘려나가 신호 펩티드 서열 부위가 존재하지 않을 수 있다.
바람직하게는, 상기 항원 결합 도메인은 상기 항원 특이적 항체 또는 이의 단편 (바람직하게는, 상기 항체의 항원 결합 단편)이다. 본 발명의 일 구현예에서, 상기 항원 결합 도메인은 종양항원에 특이적으로 결합하는 항원 결합 도메인으로서, 종양항원 특이적 항체 또는 이의 항원 결합 단편이다.
본 발명에 있어서, "항체 (antibody)"란 면역학적으로 특정 항원 (에피토프)과 반응성을 갖는 면역글로불린 분자를 의미하며, 다클론 항체 (polyclonal antibody), 단클론 항체 (monoclonal antibody) 및 이의 기능적인 단편 (fragment)를 모두 포함한다. 또한, 상기 용어는 키메라성 항체 (예를 들면, 인간화 뮤린 항체) 및 이종결합항체 (예를 들면, 양특이성 항체)와 같은 유전공학에 의해 생산된 형태를 포함할 수 있다. 상기 항체는 구성 중 중쇄 (heavy chain) 및/또는 경쇄 (light chain)의 가변 영역 (variable region)을 포함한다 (VH, 중쇄 가변영역; VL, 경쇄 가변영역). 상기 가변 영역은 1차 구조로서 항체 분자의 항원 결합 부위를 형성하는 부분을 포함하며, 본 발명의 항체는 상기 가변 영역을 포함하는 일부 단편으로 구성될 수 있다.
상기 용어 "에피토프"는 항체가 특이적으로 결합하는 항원 분자 내의 특정한 입체분자구조를 의미한다.
본 발명에 있어서, 항체의 "단편 (fragments)"이란 항체의 항원 결합 기능을 보유하고 있는 (기능성) 단편을 의미하며, 바람직하게는 상기 항체의 항원 결합 단편이다. 상기 단편은 scFv, (scFv)2,　Fab,　Fab', 및 F(ab')2 뿐만 아니라 나노바디 단편 등을 포함하는 의미로 사용된다. 상기 단편들의 정의는 당업계에 잘 알려져 있다. 바람직하게는, 상기 항원 결합 단편은 scFv이다.
항체 단편 중 Fab는 경쇄 및 중쇄의 가변영역과 경쇄의 불변영역 및 중쇄의 첫번째 불변영역 (CH1)을 가지는 구조로 1개의　항원　결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C-말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역 (hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 디설파이드 결합을 이루면서 생성된다. Fv는 중쇄 가변영역 및 경쇄 가변영역만을 가지고 있는 최소의 항체조각이다. 이중쇄 Fv (two-chain Fv)는 비공유 결합으로 중쇄 가변영역과 경쇄 가변영역이 연결되어 있다. 단쇄 Fv (single-chain Fv: scFv)는 일반적으로 펩티드 링커를 통하여 중쇄의 가변영역과 경쇄의 가변영역이 공유결합으로 연결되거나 또는 C-말단에서 바로 연결되어 있어서 이중쇄 Fv와 같이 다이머와 같은 구조를 이룰 수 있다.
보다 구체적으로, "단일쇄 Fv" 또는 "scFv" 항체 단편은 항체의 경쇄 및 중쇄의 가변 영역을 15개 내외의 아미노산이 연결된 펩타이드 서열로 이루어진 링커 (linker)로 연결한 단백질을 의미한다. 이들 도메인은 단일 폴리펩티드 쇄 (chain) 내에 존재한다. Fv 폴리펩티드는 scFv가 항원 결합을 위해 목적하는 구조를 형성할 수 있도록 VH 도메인 및 VL 도메인 사이에 폴리펩티드 링커를 추가로 포함할 수 있다. 본 명세서에서 사용된 용어, "Fv" 단편은 완전한 항체 인식 및 결합 부위를 함유하는 항체 단편이다. 이러한 영역은 1개의 중쇄 가변 도메인과 1개의 경쇄 가변 도메인이, 예를 들어 scFv로 단단하게 사실상 공유적으로 연합된 이량체로 이루어진다.
항체는 가변영역의 서열 변화에 따라 항원 특이성이 나타나게 된다. 항원 결합 부위의 가변영역은 가변성이 적은 구조 영역 (Framework region: FR)과 가변성이 큰 상보성 결정 영역 (Complementarity determining region: CDR)으로 나눠지고, 중쇄와 경쇄 모두 CDR1, 2, 및 3으로 나뉘어지는 3개의 CDR 부위와, 4개의 FR 부위를 가진다. 상기 상보성 결정 영역은 항체의 가변영역 중에서 항원과의 결합 특이성을 부여하는 부위이다. 각각의 사슬의 CDR은 전형적으로 N-말단으로부터 시작하여 순차적으로 CDR1, CDR2, CDR3로 명명되고, 또한 특정 CDR이 위치하고 있는 사슬에 의해서 식별된다.
본 발명의 일 구현예에서, 본 발명에 따른 종양항원 특이적 항체 또는 이의 항원 결합 단편은 하기의 중쇄 가변영역 및/또는 경쇄 가변영역을 포함할 수 있다:
(i) 서열번호 26의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 27의 아미노산 서열을 포함하는 중쇄 CDR2, 및/또는 서열번호 28의 아미노산 서열을 포함하는 중쇄 CDR3를 포함하는 중쇄 가변영역; 및
(ii) 서열번호 29의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 30의 아미노산 서열을 포함하는 경쇄 CDR2, 및/또는 서열번호 31의 아미노산 서열을 포함하는 경쇄 CDR3를 포함하는 경쇄 가변영역.
본 발명에 상기 CDR들은 이의 생물학적 균등물을 포함할 수 있다. 즉, 각 CDR은 상기 표기된 아미노산 서열과 70% 이상, 더욱 바람직하게는 80% 이상, 더 더욱 바람직하게는 90% 이상, 가장 바람직하게는 95% 이상의 서열 상동성을 가지는 아미노산 서열을 포함할 수 있다.
본 발명의 다른 구현예에서, 본 발명에 따른 종양항원 특이적 항체 또는 이의 항원 결합 단편은 서열번호 1의 아미노산 서열을 포함하거나, 서열번호 1의 아미노산 서열로 이루어진 폴리펩티드에 의해 코딩될 수 있으나, 이에 제한되지 않는다. 즉, 상기 항체 또는 이의 단편은 서열번호 1로 표시되는 아미노산 서열과 각각 70% 이상, 더욱 바람직하게는 80% 이상, 더 더욱 바람직하게는 90% 이상, 가장 바람직하게는 95% 이상의 서열 상동성을 가지는 아미노산 서열을 포함할 수 있다. 가장 바람직하게는, 상기종양항원 특이적 항체 또는 이의 항원 결합 단편 항-CD19 항체 또는 이의 scFv 단편일 수 있다.
본 발명에 따른 자연살해세포 특이적 키메릭항원수용체는 항원 결합 도메인, CD8 도메인, CD28 도메인, DAP10 도메인, 2B4 도메인, 및/또는 CD3z 도메인의 조합을 포함할 수 있다. 더 구체적으로, 본 발명에 따른 자연살해세포 특이적 키메릭항원수용체는 항원 결합 도메인, CD8 또는 CD28 힌지 도메인, DAP10 세포내 신호전달 도메인, 2B4 세포내 신호전달 도메인, 및 CD3z 세포내 신호전달 도메인을 포함할 수 있다. 바람직하게는, 상기 키메릭항원수용체는 CD28 막관통 도메인을 더 포함할 수 있다. DAP10 세포외 도메인 및 DAP10 막관통 도메인으로 이루어진 군에서 선택된 하나 이상을 더 포함할 수 있다.
본 발명의 바람직한 구현예에서, 상기 자연살해세포 특이적 키메릭항원수용체는 항원 결합 도메인, CD8 도메인, DAP10 도메인, 2B4 도메인, 및 CD3z 도메인의 조합을 포함하거나; 항원 결합 도메인, CD28 도메인, DAP10 도메인, 2B4 도메인, 및 CD3z의 조합을 포함하거나; 항원 결합 도메인, CD8 도메인, CD28 도메인, DAP10 도메인, 2B4 도메인, 및 CD3z 도메인의 조합을 포함할 수 있다.
본 발명의 더욱 바람직한 구현예에서, 상기 자연살해세포 특이적 키메릭항원수용체는 항원 결합 도메인, CD8 힌지 도메인, DAP10 세포외 도메인, DAP10 막관통 도메인, DAP10 세포내 신호전달 도메인, 2B4 세포내 신호전달 도메인, 및 CD3z 세포내 신호전달 도메인을 순차적으로 포함할 수 있다 (NK-CAR1). 본 발명의 다른 구현예에서, 상기 자연살해세포 특이적 키메릭항원수용체는 항원 결합 도메인, CD28 힌지 도메인, DAP10 세포외 도메인, DAP10 막관통 도메인, DAP10 세포내 신호전달 도메인, 2B4 세포내 신호전달 도메인, 및 CD3z 세포내 신호전달 도메인을 순차적으로 포함할 수 있다 (NK-CAR2). 본 발명의 다른 구현예에서, 상기 자연살해세포 특이적 키메릭항원수용체는 항원 결합 도메인, CD8 힌지 도메인, CD28 막관통 도메인, DAP10 세포내 신호전달 도메인, 2B4 세포내 신호전달 도메인, 및 CD3z 세포내 신호전달 도메인을 순차적으로 포함할 수 있다 (NK-CAR3).
본 발명에 따른 키메릭항원수용체는 전술한 폴리펩티드 도메인은 물론, 이들의 생물학적 균등물을 포함할 수도 있다. 예를 들면, 키메릭항원수용체의 항원 인식 능력 및/또는 세포내 신호전달 능력 등을 더욱 개선하기 위해 각 도메인의 아미노산 서열에 추가적인 변화를 줄 수 있다.
또한, 바람직하게는, 본 발명에 따른 자연살해세포 특이적 키메릭항원수용체는 서열번호 23 내지 25 중 어느 하나로 표시된 아미노산 서열과 70% 이상, 더욱 바람직하게는 80% 이상, 더 더욱 바람직하게는 90% 이상, 가장 바람직하게는 95% 이상의 서열 상동성을 가지는 아미노산 서열을 포함할 수 있다.
본 명세서에서 특정 서열로 표시된 폴리펩티드 (혹은 핵산 분자)는 해당 서열뿐만 아니라 이의 생물학적 균등물을 포함할 수 있다. 즉, 폴리펩티드 (핵산 분자)의 생물학적 균등 활성을 갖는 변이를 고려한다면, 일 양상의 폴리펩티드 (또는 핵산 분자)는 서열번호에 기재된 서열과 실질적인 동일성 (substantial identity)을 나타내는 서열도 포함하는 것으로 해석된다. 구체적으로, 특정 서열번호로 표시되는 아미노산 서열 (뉴클레오티드 서열)을 포함하는 폴리펩티드 (핵산 분자)는 해당 아미노산 서열 (뉴클레오티드 서열)에만 제한되지 않으며, 상기 아미노산 서열 (뉴클레오티드 서열)의 변이체가 본 발명의 범위 내에 포함된다. 본 발명의 특정 서열번호로 표시되는 아미노산 서열 (뉴클레오티드 서열)로 이루어진 폴리펩티드 분자 (핵산 분자)란, 이를 구성하는 폴리펩티드 분자 (핵산 분자)의 작용성 등가물, 예를 들어, 폴리펩티드 분자 (핵산 분자)의 일부 아미노산 서열 (뉴클레오티드 서열)이 결실 (deletion), 치환 (substitution) 또는 삽입 (insertion)에 의해 변형되었지만, 해당 폴리펩티드 (핵산 분자)와 기능적으로 동일한 작용을 할 수 있는 변이체 (variants)를 포함하는 개념이다. 구체적으로, 본 발명에 개시된 폴리펩티드 (핵산 분자)는 특정 서열번호로 표시되는 아미노산 서열과 각각 70% 이상, 더욱 바람직하게는 80% 이상, 더 더욱 바람직하게는 90% 이상, 가장 바람직하게는 95% 이상의 서열 상동성을 가지는 아미노산 서열 (뉴클레오티드 서열)을 포함할 수 있다. 예를 들면, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 100%의 서열 상동성을 갖는 폴리펩티드 (핵산 분자)를 포함한다. 폴리펩티드 (핵산 분자)에 대한 "서열 상동성의 %"는 두 개의 최적으로 배열된 서열과 비교 영역을 비교함으로써 확인되며, 비교 영역에서의 폴리펩티드 서열 (뉴클레오티드 서열)의 일부는 두 서열의 최적 배열에 대한 참고 서열(추가 또는 삭제를 포함하지 않음)에 비해 추가 또는 삭제(즉, 갭)를 포함할 수 있다.
또한, 본 발명은 본 발명에 따른 자연살해세포 특이적 키메릭항원수용체를 발현하는 세포를 제공한다. 상기 세포는 in vitro 또는 in vivo 세포일 수 있으며, 상기 세포를 필요로 하는 개체의 자가유래세포 (autologous cells) 및/또는 동종유래세포 (즉, 동종이계세포 (allogeneic cells))이거나, 이의 이종세포 (xenogenic cells)로 제조된 것 (혹은 유래한 것)일 수 있다. 바람직하게는, 상기 세포는 이를 필요로 하는 개체의 자가유래세포 및/또는 동조유래세포로 제조된 것일 수 있다. 본 발명의 바람직한 구현예에서, 상기 세포는 이의 세포막에서 상기 키메릭항원수용체를 발현한다. 상기 세포는 T 세포, NK세포, NKT 세포, 대식세포 등과 같은 면역세포일 수 있다. 바람직하게는, 상기 세포는 자연살해세포이다. 즉, 본 발명은 본 발명에 따른 키메릭항원수용체를 발현하는, CAR-NK 세포를 제공한다. NK 세포는 면역세포들 중에서도 가장 즉각적이고 강력한 살상능력을 지닌 점에서, 본 발명의 CAR-NK 세포는 암 등의 질환 치료에 있어 강력한 면역요법이 될 수 있다.
본 발명에 있어서, "자연살해세포 (natural killer cells, NK cells)"는 골수에서 유래하는 세포독성 림프구의 한 종류이다. 자연살해세포는 전체 림프구의 5 내지 20 %를 차지하며 선천성 면역을 담당하는데, 표면에 major histocompatibility complex 또는 항체가 없지만 바이러스 감염 세포, 암세포, 기타 변형된 세포에 대해 즉각적인 면역 반응을 제공하는 것을 특징으로 한다. 상기 자연살해세포는 개체로부터 분리된 자연살해세포는 물론 이로부터 배양되거나 변형된 자연살해세포를 포함하며, 상업적으로 이용 가능한 자연살해세포주도 이용 가능하다. 즉, 본 발명의 자연살해세포 세포는 구체적인 종류에 제한되지 않고, 자연살해세포와 동일하거나 유사한 분자적 특성 및 생물학적 활성을 가지면 충분하다. 일 구현예에서, 상기 자연살해세포는 예를 들면 HANK1, NKL, NK92, NK-YS, YT, NOI-90, 및 NK101 등으로부터 선택될 수 있으나, 이는 예시일 뿐, 이에 한정되지 않는다. 본 발명에 따른 키메릭항원수용체를 발현하는 자연살해세포는 CAR-NK 세포 (Chimeric antigen receptor natural killer cell)일 수 있다.
본 발명에 따른 키메릭항원수용체를 발현하는 자연살해세포는, 상기 수용체를 통해 타겟을 인식하였을 때 해당 키메릭항원수용체를 발현하지 않는 자연살해세포에 비해 더욱 신속하게, 혹은 더욱 높은 수준으로 활성화될 수 있으며, 타겟세포를 더욱 신속하게, 혹은 효과적으로 사멸시킬 수 있는 것을 특징으로 한다.
예컨대, 본 발명에 따른 키메릭항원수용체를 발현하는 자연살해세포는 타겟항원 인식시 사이토카인의 생성 및/또는 분비가 증가하는 것을 특징으로 할 수 있다. 즉, 본 발명의 NK-CAR를 발현하는 자연살해세포는 타겟 인식시 상기 NK-CAR을 발현하지 않는 자연살해세포에 비해 사이토카인의 생성 및/또는 분비의 정도가 더 높을 수 있다. 바람직하게는, 상기 사이토카인은 활성화된 자연살해세포로부터 분비되어 타겟세포의 사멸을 유도하는 것이다. 바람직하게는, 상기 사이토카인은 암세포의 성장, 증식, 이동, 및/또는 전이 등을 억제하여 항암 효과를 유도할 수 있는 사이토카인이다. 상기 사이토카인은 구체적인 종류로 제한되는 것은 아니나, 바람직하게는 MIP-1α (대식세포염증단백질-1α; Macrophage inflammatory protein-1α) 및/또는 Interferon-γ (인터페론-γ, IFN-γ) 일 수 있다. 그러나 당업자라면 상기 언급한 사이토카인 외에도 자연살해세포의 세포사멸 매커니즘과 관련된 사이토카인이라면 모두 포함될 수 있음을 인식할 것이다.
본 발명에 따른 키메릭항원수용체를 발현하는 자연살해세포는 타겟항원 인식시 그랜자임 (Granzyme)의 생성 및/또는 분비가 증가하는 것을 특징으로 할 수 있다. 즉, 본 발명의 NK-CAR를 발현하는 자연살해세포는 타겟 인식시 상기 NK-CAR을 발현하지 않는 자연살해세포에 비해 그랜자임의 생성 및/또는 분비의 정도가 더 높을 수 있다. 상기 그랜자임은 그랜자임 A 및 B를 모두 포함한다.
또한, 본 발명에 따른 자연살해세포는 타겟항원 인식시 자연살해세포의 활성화 및/또는 타겟세포 사멸능과 관련된 신호전달경로의 활성이 증가하는 것을 특징으로 할 수 있다. 바람직하게는, 상기 신호전달경로는 자연살해세포의 항암활성과 관련된 신호전달경로이다 (즉, 암세포의 사멸 또는 성장 억제 등을 위한 신호전달경로). 즉, 본 발명의 NK-CAR를 발현하는 자연살해세포는 타겟 인식시 상기 NK-CAR을 발현하지 않는 자연살해세포에 비해 상기 신호전달경로의 활성이 더 높을 수 있다. 상기 신호전달경로의 대표적인 예로는 AKT 신호전달 경로 및 ERK 신호전달 경로가 있다. 즉, 본 발명에 따른 키메릭항원수용체를 발현하는 자연살해세포는 상기 수용체가 표적 항원을 인식하였을 때 세포 내의 AKT 및/또는 ERK의 인산화가 증가하여 AKT 및/또는 ERK 신호전달 경로가 활성화될 수 있다.
또한, 본 발명에 따른 키메릭항원수용체를 발현하는 자연살해세포는 타겟항원 인식시 탈과립화 (degranulation)의 정도 (수준)가 증가하는 것을 특징으로 할 수 있다. 즉, 본 발명의 NK-CAR를 발현하는 자연살해세포는 타겟 인식시 상기 NK-CAR을 발현하지 않는 자연살해세포에 비해 탈과립화가 더욱 활발히 일어날 수 있다. 이의 증거로, 본 발명에 따른 키메릭항원수용체를 발현하는 자연살해세포는 타겟 인식시 상기 키메릭항원수용체를 발현하지 않는 자연살해세포에 비해 CD107a의 수준이 더욱 증가할 수 있다.
또한, 본 발명은 본 발명에 따른 자연살해세포 특이적 키메릭항원수용체를 코딩하는 핵산 분자 (즉, 폴리뉴클레오티드)를 제공한다.
본 명세서에서 사용된 용어 "폴리뉴클레오티드"는 디옥시리보핵산 (DNA) 및 리보핵산 (RNA)을 포함한, 일반적으로 인산이에스테르 결합에 의해 서로 결합된 2 이상의 연결된 뉴클레오티드 또는 뉴클레오티드 유도체를 포함하는 올리고머 또는 폴리머를 나타낸다. 폴리뉴클레오티드는 또한 예를 들면 뉴클레오티드 유사체, 또는 인산이에스테르 결합 이외의 "골격" 결합, 예를 들면 인산삼에스테르 결합, 포스포르아미데이트 결합, 포스포로티오에이트 결합, 티오에스테르 결합 또는 펩타이드 결합 (펩타이드 핵산)을 포함하는 DNA 및 RNA 유도체를 포함한다. 폴리뉴클레오티드는 단일-가닥 및/또는 이중-가닥 폴리뉴클레오티드, 예를 들면 디옥시리보핵산 (DNA) 및 리보핵산 (RNA)뿐만 아니라 RNA 또는 DNA 중 어느 하나의 유사체들을 포함한다.
즉, 본 발명에 따른 핵산 분자는 본 발명에 따른 키메릭항원수용체를 구성하는 도메인들을 코딩하는 유전자를 포함한다. 상기 각 유전자들은 서로의 N 또는 C 말단에 직접 연결될 수도 있고, 링커 서열을 통해 연결될 수 있다. 바람직하게는, 본 발명에 따른 핵산 분자는 서열번호 11 내지 22로 이루어진 군에서 선택된 하나 이상의 염기서열을 포함할 수 있다. 상술한 폴리펩티드와 마찬가지로, 본 발명에 따른 폴리뉴클레오티드는 이의 작용성 등가물을 포함한다. 따라서, 본 발명에 따른 핵산 분자는 서열번호 11 내지 22로 이루어진 군에서 선택된 어느 하나 이상의 염기서열과 각각 70% 이상, 더욱 바람직하게는 80% 이상, 더 더욱 바람직하게는 90% 이상, 가장 바람직하게는 95% 이상의 서열 상동성을 가지는 염기서열을 포함할 수 있다.
구체적으로, 본 발명에 따른 핵산 분자에서 CD8 힌지 도메인을 코딩하는 부위는 서열번호 12 또는 13으로 표시된 염기서열을 포함할 수 있다. 또한, CD28 힌지 도메인을 코딩하는 부위는 서열번호 14로 표시된 염기서열을 포함할 수 있다. 또한, CD28 막관통 도메인을 코딩하는 부위는 서열번호 15로 표시된 염기서열을 포함할 수 있다. 또한, DAP10 세포외 도메인, 막관통 도메인, 및 세포내 신호전달 도메인을 코딩하는 부위는 각각 순서대로 서열번호 16, 서열번호 17, 및 서열번호 18로 표시된 염기서열을 포함할 수 있다. 또한, 2B4 세포내 신호전달 도메인은 서열번호 19로 표시된 염기서열을 포함할 수 있다. 또한, CD3z 세포내 신호전달 도메인은 서열번호 20으로 표시된 염기서열을 포함할 수 있다.
당업자는 목적에 따라 적절한 항원 결합 도메인-코딩 유전자를 선택할 수 있다. 예컨대, 상기 자연살해세포 특이적 키메릭항원수용체가 항암치료를 위한 것인 경우, 당업자는 당업계에 알려진 종양항원 특이적 항체 또는 이의 단편을 코딩하는 유전자를 활용할 수 있고, 혹은 새롭게 제작한 유전자 서열을 사용할 수 있다. 본 발명의 일 구현예에서, 상기 자연살해세포 특이적 키메릭항원수용체의 핵산 분자는 CD-19 특이적 항체를 코딩하는 폴리뉴클레오티드 또는 이의 단편을 포함할 수 있다. 바람직하게는, 상기 폴리뉴클레오티드 또는 이의 단편은 서열번호 11의 염기서열을 포함할 수 있다.
이 밖에도, 본 발명에 따른 핵산 분자는 CD8 신호 펩타이드를 코딩하는 부위 (바람직하게는, 서열번호 21의 염기서열을 포함함)를 포함할 수 있다.
또한, 본 발명은 본 발명에 따른 핵산 분자를 포함하는 발현 벡터를 제공한다. 즉, 본 발명은 본 발명에 따른 핵산 분자를 포함하는 재조합 벡터를 제공한다.
본 발명에 있어서, "재조합 벡터 (recombinant vector)"란 벡터 내에 삽입된 이종의 핵산에 의해 코딩되는 펩타이드 또는 단백질을 발현할 수 있는 벡터를 지칭하는 것으로, 바람직하게는 목적 단백질 (본 발명에서는, NK 특이적 CAR)을 발현할 수 있도록 제조된 벡터를 의미한다. 상기 "벡터"는 시험관 내, 생체 왜 또는 생체 내에서 숙주 세포로 염기의 도입 및/또는 전이를 위한 임의의 매개물을 말하며, 다른 DNA 단편이 결합하여 결합된 단편의 복제를 가져올 수 있는 복제단위 (replicon)일 수 있으며, "복제 단위"란 생체 내에서 DNA 복제의 자가 유닛으로서 기능하는, 즉, 스스로의 조절에 의해 복제 가능한, 임의의 유전적 단위 (예를 들면, 플라스미드, 파지, 코스미드, 염색체, 바이러스 등)를 말한다.
본 발명에 따른 벡터는 선형 DNA, 플라스미드 DNA 또는 재조합 바이러스성 벡터일 수 있으나, 이에 한정되지 않는다. 상기 재조합 바이러스성 벡터는, 예를 들어, 플라스미드 벡터, 코즈미드 벡터 및 박테리오파지 벡터, 아데노바이러스 벡터, 렌티바이러스 벡터, 레트로바이러스 벡터 및 아데노-연관 바이러스 벡터와 같은 바이러스 벡터를 포함한다. 바람직하게는, 상기 벡터는 레트로바이러스 벡터이다. 본 발명자들은 구체적인 실시예에서 pMXs-IRES-GFP 레트로바이러스 벡터를 사용하였다.
본 발명의 재조합 벡터는 바람직하게는 RNA 중합효소가 결합하는 전사 개시 인자인 프로모터 (promoter), 전사를 조절하기 위한 임의의 오퍼레이터 서열, 적합한 mRNA 리보좀 결합 부위를 코딩하는 서열과 전사 및 해독의 종결을 조절하는 서열, 터미네이터 등을 포함할 수 있으며, 더욱 바람직하게는 폴리히스티딘 태그 (최소 5개 이상의 히스티딘 잔기로 구성된 아미노산 모티프), 신호 펩타이드 (signal peptide) 유전자, 소포체 잔류 신호 펩타이드 (endoplasmic reticulum retention signal peptide), 클로닝 사이트 (cloning site) 등을 추가로 포함할 수 있고, 태그용 유전자, 형질전환체를 선별하기 위한 항생제 내성 유전자 등의 선별용 마커 유전자 등을 추가로 포함할 수 있다. 상기 재조합 벡터에서 상기 각 유전자들의 폴리뉴클레오티드 서열은 프로모터에 작동적으로 연결된다. 본 명세서에서 사용된 용어 "작동적으로 연결된 (operatively linked)"은 프로모터 서열과 같은 뉴클레오티드 발현 조절 서열과 다른 뉴클레오티드 서열 사이의 기능적인 결합을 의미하며, 이에 의해 상기 조절 서열은 상기 다른 뉴클레오티드 서열의 전사 및/또는 해독을 조절하게 된다.
상기 재조합 벡터는 원핵세포 또는 진핵세포를 숙주로 하여 구축될 수 있다. 예를 들어, 본 발명의 벡터가 발현벡터이고, 원핵세포를 숙주로 하는 경우에는, 전사를 진행시킬 수 있는 강력한 프로모터 (예를 들어, pLλ프로모터, trp 프로모터, lac 프로모터, tac 프로모터, T7 프로모터 등), 해독의 개시를 위한 리보좀 결합 자리 및 전사/해독 종결 서열을 포함하는 것이 일반적이다. 진핵세포를 숙주로 하는 경우, 벡터가 진핵세포에서 작동하는 복제원점은 f1 복제원점, SV40 복제원점, pMB1 복제원점, 아데노 복제원점, AAV 복제원점 및 BBV 복제원점 등을 포함할 수 있으나, 이에 한정되는 것은 아니다. 또한, 포유동물 세포의 게놈으로부터 유래된 프로모터 (예를 들어, 메탈로티오닌 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터 (예를 들어, 아데노바이러스 후기 프로모터, 백시니아 바이러스 7.5K 프로모터, SV40 프로모터, 사이토메갈로바이러스 프로모터 및 HSV의 tk프로모터)가 이용될 수 있으며, 전사 종결 서열로서 폴리아데닐화 서열을 일반적으로 갖는다.
상기 태그용 유전자로는, 대표적으로 Avi 태그, Calmodulin 태그, polyglutamate 태그, E 태그, FLAG 태그, HA 태그, His 태그 (폴리히스티딘 태그), Myc 태그, S 태그, SBP 태그, IgG-Fc 태그, CTB 태그, Softag 1 태그, Softag 3 태그, Strep 태그, TC 태그, V5 태그, VSV 태그, Xpress 태그 등이 포함될 수 있다. 바람직하게는, 본 발명에 따른 벡터는 myc 태그를 포함할 수 있다. 더욱 바람직하게는, 상기 myc 태그는 서열번호 22의 염기서열을 포함하는 것일 수 있다.
본 발명에 있어서, 상기 핵산 또는 상기 벡터는 바이러스 생산세포, 즉, 패키징 세포 (packaging cell line)에 형질주입 또는 트랜스펙션 (transfection)될 수 있다. "형질주입" 또는 "트랜스펙션"시키기 위해 원핵 또는 진핵 숙주세포 내로 외인성 핵산 (DNA 또는 RNA)을 도입하는 데에 통상 사용되는 여러 종류의 다양한 기술, 예를 들어 전기 영동법, 인산칼슘 침전법, DEAE-덱스트란 트랜스펙션 또는 리포펙션(lipofection) 등을 사용할 수 있다. 본 발명에 따른 목적 유전자 (자연살해세포 특이적 키메릭항원수용체 코딩 핵산 분자)를 포함하는 바이러스는 상기 패키징 세포주 내에서 증식하여 세포 외로 방출될 수 있으며, 상기 바이러스는 목적세포 (즉, 본 발명의 NK-CAR를 최종적으로 발현시키고자 하는 세포, 예컨대 NK cells)에 트랜스덕션 (transduction)될 수 있다. 세포 내로 "트랜스덕션"된 바이러스의 핵산은 세포의 게놈에 삽입되거나 혹은 삽입되지 않은 채로 목적 단백질 (자연살해세포 특이적 키메릭항원수용체)을 생산하는 데 사용된다.
본 발명은 본 발명에 따른 발현 벡터가 도입된 (형질전환, 형질감염, 형질주입 등), 단리된 세포를 제공할 수 있다. 여기서의 세포는 최종적으로 자연살해세포 특이적 키메릭항원수용체를 발현하는 세포가 아닌, 상기 발현 벡터를 증식 (증폭)하기 위한 세포를 의미한다. 즉, 상기 세포는 전술한 핵산 분자 또는 발현 벡터가 직접 형질도입/형질전환/형질감염된 숙주세포를 나타낸다. 예컨대, 상기 발현 벡터가 바이러스 벡터인 경우, 상기 세포는 상기 바이러스 벡터를 포함하는 바이러스를 생성하기 위한 패키징 세포일 수 있다. 적합한 숙주의 선택은 본원의 시사내용으로부터 당업계의 통상의 기술자에게 자명한 것으로 여겨진다.
또한, 본 발명은 (S1) 본 발명에 따른 발현 벡터를 세포에 도입시키는 단계; 및 (S2) 상기 발현벡터가 도입된 세포를 배양하는 단계를 포함하는, 자연살해세포 특이적 키메릭항원수용체의 제조방법을 제공한다.
상기 (S1) 단계는 본 발명의 발현 벡터를 증폭시키거나, 상기 벡터를 발현시키기 위해 숙주세포에 상기 발현 벡터를 도입하는 단계이다. 즉, 상기 발현 벡터를 적절한 숙주세포에 도입 (형질전환, 형질주입, 형질감염 등) 시켜, 세포 내부에서 발현 벡터가 복제되거나, 상기 발현 벡터로부터 단백질 등이 발현되도록 유도하거나, (바이러스성 벡터를 이용하는 경우) 상기 발현 벡터를 포함하는 바이러스가 생성되도록 유도할 수 있다. 상기 (S1) 단계는 사용되는 벡터 및 세포의 종류에 따라 당업자가 적절히 수행할 수 있다. 예컨대, 상기 발현 벡터가 바이러스성 벡터인 경우, 상기 발현 벡터를 숙주세포에 형질주입하여 도입시킬 수 있다.
상기 (S2) 단계는 세포 내로 도입된 목적 유전자가 세포 내에서 충분히 증폭 혹은 발현되도록 세포를 배양하는 단계를 의미한다. 상기 배양은, 상기 발현 벡터가 숙주세포 내로 도입된 후, 상기 발현 벡터가 숙주세포 내에서 목적 단백질이 발현되게 하기에 충분한 기간 동안 (혹은, 발현 벡터가 복제되기에 충분한 기간이나 목적 유전자를 포함하는 바이러스가 생성되기에 충분한 기간 동안) 이루어질 수 있다. 더 바람직하게는, 상기 배양은, 숙주세포가 배양되는 배양 배지 내로 상기 단백질이 분비되게 하기에 충분한 기간 동안 (혹은, 목적 유전자를 포함하는 바이러스가 세포 외부로 방출되기에 충분한 기간 동안) 이루어질 수 있다.
상기 방법은 상기 (S2) 단계 후 상기 세포로부터 생성된 (또는 증폭된) 자연살해세포 키메릭항원수용체, 이를 코딩하는 핵산 분자를 포함하는 발현 벡터, 또는 상기 발현 벡터를 포함하는 바이러스를 수득하는 단계를 더 포함할 수 있다. 숙주세포에서 생산된 키메릭항원수용체, 발현 벡터, 또는 바이러스의 특성, 숙주세포의 특성, 발현 방식, 또는 키메릭항원수용체/발현 벡터/바이러스의 표적화 여부 등을 고려하여 수득 방법을 적절히 선택 및 조절할 수 있다. 필요에 따라 세포 내 특정 소기관이나 세포질에 존재하는 키메릭항원수용체/발현 벡터/바이러스를 세포 외부로 방출하여 회수하기 위하여 항체 또는 이의　항원　결합 단편의 기능적 구조에 영향을 미치지 않는 범위에서 세포를 용해시킬 수도 있다. 또한, 상기 발현 벡터를 포함하는 바이러스는 숙주세포를 배양한 배지를 수득하고, 원심분리하여 불순물을 제거하는 등의 방법으로 항체를 회수할 수 있다.
수득한 키메릭항원수용체/발현 벡터/바이러스는 크로마토그래피, 필터 등에 의한 여과, 투석 등의 방법을 통해 불순물을 더욱 제거하고 농축하는 과정을 추가로 거칠 수 있다. 수득한 키메릭항원수용체의 분리 또는 정제는 통상의 단백질에서 사용되고 있는 분리, 정제 방법, 예를 들어 크로마토그래피에 의해 수행될 수 있다. 상기 크로마토그래피는 예를 들어, 단백질 A 컬럼, 단백질 G 컬럼, 단백질 L 컬럼을 포함하는 친화성 크로마토그래피, 이온 교환 크로마토그래피 또는 소수성 크로마토그래피를 포함할 수 있다. 상기 크로마토그래피 이외에, 추가로 여과, 초여과, 염석, 투석 등을 조합함으로써 상기 키메릭항원수용체를 분리, 정제할 수 있다. 바이러스의 분리 또는 정제는 배지를 다공성 필터로 여과하여 불순물을 제거하고, 농축시킬 수 있다.
또한, 본 발명은 본 발명에 따른 자연살해세포 특이적 키메릭항원수용체를 코딩하는 핵산 분자를 포함하는 발현 벡터를 자연살해세포에 도입시키는 단계를 포함하는, 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포의 제조방법을 제공한다. 즉, 본 발명은 본 발명에 따른 키메릭항원수용체를 포함하는 CAR-NK 세포의 제조방법을 제공한다. 상기 발현 벡터는 전술한 자연살해세포 특이적 키메릭항원수용체의 제조방법을 통해 증폭된 발현 벡터일 수 있다. 상기 발현 벡터는 그 자체가 자연살해세포에 도입될 수도 있으나, 바이러스에 포함된 형태로 도입될 수도 있다. 당업자는 발현 벡터 및 자연살해세포의 종류에 따라 적절한 도입 방법을 선택할 수 있다. 예컨대, 상기 발현 벡터가 바이러스성 벡터인 경우, 상기 발현 벡터를 포함하는 바이러스를 자연살해세포에 감염시켜 상기 벡터를 세포 내로 도입시킬 수 있다 (트랜스덕션). 세포 내로 트랜스덕션된 바이러스의 핵산은 자연살해세포의 게놈 내에 삽입되거나, 삽입되지 않은 채로 발현될 수 있으며, 이로부터 본 발명의 자연살해세포 특이적 키메릭항원수용체가 발현될 수 있다.
또한, 본 발명은 본 발명에 따른 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포; 상기 자연살해세포 특이적 키메릭항원수용체를 코딩하는 핵산 분자를 포함하는 발현 벡터; 및/또는 상기 발현 벡터를 포함하는 세포를 유효성분으로 포함하는, 암의 예방 또는 치료용 약학적 조성물을 제공한다. 여기서, 상기 자연살해세포 특이적 키메릭항원수용체의 항원 결합 도메인은 종양항원에 특이적으로 결합하는 항원 결합 도메인인 것을 특징으로 한다. 상기 자연살해세포는, 상기 조성물의 투여 대상이 되는 개체의 자가유래세포 또는 동종유래세포일 수 있다.
본 발명에 있어서, "암 (cancer)"은 "종양 (tumor)"과 동일한 의미로 사용되며, 전형적으로 통제되지 않는 세포 성장 내지 증식을 특징으로 하는 상태를 지칭한다. 본 발명에 따른 키메릭항원수용체를 이용하여 예방 또는 치료할 수 있는 암은 고형 종양 및 비-고형 종양 (예를 들어, 혈액암 등)을 포함한다. 또한, 본 발명에 있어서 암의 유형에는 암종, 아세포종, 및 육종, 및 특정 백혈병 또는 림프성 악성 종양, 양성 및 악성 종양, 예를 들어, 육종, 암종 및 흑색종을 들 수 있지만, 이에 제한되지 않는다.
본 발명의 암의 구체적인 종류에는 제한이 없으나 대장암, 직장암, 결장암, 갑상선암, 구강암, 인두암, 후두암, 자궁경부암, 뇌암, 폐암, 난소암, 방광암, 신장암, 간암, 췌장암, 전립선암, 피부암, 혀암, 유방암, 자궁암, 위암, 골암, 림프종, 혈액암, 편평상피세포암, 폐의 선암, 복막암, 피부암, 피부 흑색종, 안구 흑색종, 직장암, 항문부근암, 식도암, 소장암, 내분비선암, 부갑상선암, 부신암, 연조직 육종, 요도암, 위장암, 교아종, 난소암, 자궁내막암, 침샘암, 음문암, 및 두경부암 등으로부터 선택될 수 있다. 바람직하게는, 본 발명에 따른 암은 본 발명의 키메릭항원수용체가 인식하는 표적 항원을 발현하는 암이다. 즉, 상기 암은 본 발명의 키메릭항원수용체의 항원 결합 도메인에 의해 인식될 수 있는 종양항원을 발현하는 암이다. 예를 들어, 본 발명에 따른 CAR가 암세포 특이적 항원 결합 도메인으로서 항-CD19 scFv를 포함하는 경우, 상기 암은 바람직하게는 정상세포에 비해 암세포에서 CD19이 과발현되거나, 활성이 더욱 높은 암일 수 있다.
본 발명에 있어서, "혈액암"은 혈액의 구성 성분 (백혈구, 적혈구, 혈소판 등), 혈액을 만드는 골수, 면역체계를 구성하는 림프계 (림프구, 림프절, 림프관 등)에서 생긴 암을 의미한다. 대표적으로는 백혈병, 악성림프종, 다발성골수종 등이 이에 해당된다. 혈액암의 보다 구체적인 예시로는, 급성 골수병 백혈병 (Acute Myeloid Leukemia), 급성 림프모구 백혈병 (Acute Lymphoblastic Leukemia), 만성 골수성 백혈병 (Chronic Myelogenous Leukemia), 다발골수종 (Multiple Myeloma), 및 림프종 (Lymphoma) 등이 있다.
바람직하게는, 상기 암은 림프종, B 세포 림프종, 급성 림프종, 버킷 림프종, 미만성 B형 대세포 림프종 (difuse large B cell lymphoma), 여포 림프종 (follicular lymphoma), 말트 림프종 (MALT lymphoma), 마지날 존 림프종 (marginal zone lymphoma), 말초 T세포 림프종 (peripheral T cell lymphoma), 미분화 대세포 림프종 (anaplastic large cell lymphoma), 림프아세포 림프종 (lymphoblastic lymphoma), 호지킨 림프종 등에서 선택될 수 있다.
본 발명의 조성물 내의 상기 NK-CAR을 발현하는 자연살해세포, 발현 벡터, 및/또는 발현 벡터를 포함하는 세포의 함량은 질환의 증상, 증상의 진행 정도, 환자의 상태 등에 따라서 적절히 조절 가능하며, 예컨대, 전체 조성물 중량을 기준으로 0.0001 내지 99.9중량%, 또는 0.001 내지 50중량%일 수 있으나, 이에 한정되는 것은 아니다. 상기 함량비는 용매를 제거한 건조량을 기준으로 한 값이다.
본 발명에 따른 약학적 조성물은 약학적 조성물의 제조에 통상적으로 사용하는 적절한 담체, 부형제 및 희석제를 더 포함할 수 있다. 상기 부형제는 예를 들어, 희석제, 결합제, 붕해제, 활택제, 흡착제, 보습제, 필름-코팅 물질, 및 제어방출첨가제로 이루어진 군으로부터 선택된 하나 이상일 수 있다.
본 발명에 따른 약학적 조성물은, 각각 통상의 방법에 따라 산제, 과립제, 서방형 과립제, 장용과립제, 액제, 점안제, 엘실릭제, 유제, 현탁액제, 주정제, 트로키제, 방향수제, 리모나아데제, 정제, 서방형정제, 장용정제, 설하정, 경질캅셀제, 연질캅셀제, 서방캅셀제, 장용캅셀제, 환제, 틴크제, 연조엑스제, 건조엑스제, 유동엑스제, 주사제, 캡슐제, 관류액, 경고제, 로션제, 파스타제, 분무제, 흡입제, 패취제, 멸균주사용액, 또는에어로졸 등의 외용제 등의 형태로 제형화하여 사용될 수 있으며, 상기 외용제는 크림, 젤, 패치, 분무제, 연고제, 경고제, 로션제, 리니멘트제, 파스타제 또는 카타플라스마제 등의 제형을 가질 수 있다.
본 발명에 따른 약학적 조성물에 포함될 수 있는 담체, 부형제 및 희석제로는 락토즈, 덱스트로즈, 수크로스, 올리고당, 솔비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘 포스페이트, 칼슘 실리케이트, 셀룰로즈, 메틸 셀룰로오스, 미정질 셀룰로오스, 폴리비닐 피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 들 수 있다.
제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다.
본 발명에 따른 정제, 산제, 과립제, 캡슐제, 환제, 트로키제의 첨가제로 옥수수전분, 감자전분, 밀전분, 유당, 백당, 포도당, 과당, 디-만니톨, 침강탄산칼슘, 합성규산알루미늄, 인산일수소칼슘, 황산칼슘, 염화나트륨, 탄산수소나트륨, 정제 라놀린, 미결정셀룰로오스, 덱스트린, 알긴산나트륨, 메칠셀룰로오스, 카르복시메칠셀룰로오스나트륨, 카올린, 요소, 콜로이드성실리카겔, 히드록시프로필스타치, 히드록시프로필메칠셀룰로오스(HPMC) 1928, HPMC 2208, HPMC 2906, HPMC 2910, 프로필렌글리콜, 카제인, 젖산칼슘, 프리모젤 등 부형제; 젤라틴, 아라비아고무, 에탄올, 한천가루, 초산프탈산셀룰로오스, 카르복시메칠셀룰로오스, 카르복시메칠셀룰로오스칼슘, 포도당, 정제수, 카제인나트륨, 글리세린, 스테아린산, 카르복시메칠셀룰로오스나트륨, 메칠셀룰로오스나트륨, 메칠셀룰로오스, 미결정셀룰로오스, 덱스트린, 히드록시셀룰로오스, 히드록시프로필스타치, 히드록시메칠셀룰로오스, 정제쉘락, 전분호, 히드록시프로필셀룰로오스, 히드록시프로필메칠셀룰로오스, 폴리비닐알코올, 폴리비닐피롤리돈 등의 결합제가 사용될 수 있으며, 히드록시프로필메칠셀룰로오스, 옥수수전분, 한천가루, 메칠셀룰로오스, 벤토나이트, 히드록시프로필스타치, 카르복시메칠셀룰로오스나트륨, 알긴산나트륨, 카르복시메칠셀룰로오스칼슘, 구연산칼슘, 라우릴황산나트륨, 무수규산, 1-히드록시프로필셀룰로오스, 덱스트란, 이온교환수지, 초산폴리비닐, 포름알데히드처리 카제인 및 젤라틴, 알긴산, 아밀로오스, 구아르고무(Guar gum), 중조, 폴리비닐피롤리돈, 인산칼슘, 겔화전분, 아라비아고무, 아밀로펙틴, 펙틴, 폴리인산나트륨, 에칠셀룰로오스, 백당, 규산마그네슘알루미늄, 디-소르비톨액, 경질무수규산 등 붕해제; 스테아린산칼슘, 스테아린산마그네슘, 스테아린산, 수소화식물유(Hydrogenated vegetable oil), 탈크, 석송자, 카올린, 바셀린, 스테아린산나트륨, 카카오지, 살리실산나트륨, 살리실산마그네슘, 폴리에칠렌글리콜(PEG) 4000, PEG 6000, 유동파라핀, 수소첨가대두유(Lubri wax), 스테아린산알루미늄, 스테아린산아연, 라우릴황산나트륨, 산화마그네슘, 마크로골(Macrogol), 합성규산알루미늄, 무수규산, 고급지방산, 고급알코올, 실리콘유, 파라핀유, 폴리에칠렌글리콜지방산에테르, 전분, 염화나트륨, 초산나트륨, 올레인산나트륨, dl-로이신, 경질무수규산 등의 활택제;가 사용될 수 있다.
본 발명에 따른 액제의 첨가제로는 물, 묽은 염산, 묽은 황산, 구연산나트륨, 모노스테아린산슈크로스류, 폴리옥시에칠렌소르비톨지방산에스텔류(트윈에스텔), 폴리옥시에칠렌모노알킬에텔류, 라놀린에텔류, 라놀린에스텔류, 초산, 염산, 암모니아수, 탄산암모늄, 수산화칼륨, 수산화나트륨, 프롤아민, 폴리비닐피롤리돈, 에칠셀룰로오스, 카르복시메칠셀룰로오스나트륨 등이 사용될 수 있다.
본 발명에 따른 시럽제에는 백당의 용액, 다른 당류 혹은 감미제 등이 사용될 수 있으며, 필요에 따라 방향제, 착색제, 보존제, 안정제, 현탁화제, 유화제, 점조제 등이 사용될 수 있다.
본 발명에 따른 유제에는 정제수가 사용될 수 있으며, 필요에 따라 유화제, 보존제, 안정제, 방향제 등이 사용될 수 있다.
본 발명에 따른 현탁제에는 아카시아, 트라가칸타, 메칠셀룰로오스, 카르복시메칠셀룰로오스, 카르복시메칠셀룰로오스나트륨, 미결정셀룰로오스, 알긴산나트륨, 히드록시프로필메칠셀룰로오스(HPMC), HPMC 1828, HPMC 2906, HPMC 2910 등 현탁화제가 사용될 수 있으며, 필요에 따라 계면활성제, 보존제, 안정제, 착색제, 방향제가 사용될 수 있다.
본 발명에 따른 주사제에는 주사용 증류수, 0.9% 염화나트륨주사액, 링겔주사액, 덱스트로스주사액, 덱스트로스+염화나트륨주사액, 피이지(PEG), 락테이티드 링겔주사액, 에탄올, 프로필렌글리콜, 비휘발성유-참기름, 면실유, 낙화생유, 콩기름, 옥수수기름, 올레인산에칠, 미리스트산 이소프로필, 안식향산벤젠과 같은 용제; 안식향산나트륨, 살리실산나트륨, 초산나트륨, 요소, 우레탄, 모노에칠아세트아마이드, 부타졸리딘, 프로필렌글리콜, 트윈류, 니정틴산아미드, 헥사민, 디메칠아세트아마이드와 같은 용해보조제; 약산 및 그 염(초산과 초산나트륨), 약염기 및 그 염(암모니아 및 초산암모니움), 유기화합물, 단백질, 알부민, 펩톤, 검류와 같은 완충제; 염화나트륨과 같은 등장화제; 중아황산나트륨(NaHSO3) 이산화탄소가스, 메타중아황산나트륨(Na2S2O5), 아황산나트륨(Na2SO3), 질소가스(N2), 에칠렌디아민테트라초산과 같은 안정제; 소디움비설파이드 0.1%, 소디움포름알데히드 설폭실레이트, 치오우레아, 에칠렌디아민테트라초산디나트륨, 아세톤소디움비설파이트와 같은 황산화제; 벤질알코올, 클로로부탄올, 염산프로카인, 포도당, 글루콘산칼슘과 같은 무통화제; 시엠시나트륨, 알긴산나트륨, 트윈 80, 모노스테아린산알루미늄과 같은 현탁화제를 포함할 수 있다.
본 발명에 따른 좌제에는 카카오지, 라놀린, 위텝솔, 폴리에틸렌글리콜, 글리세로젤라틴, 메칠셀룰로오스, 카르복시메칠셀룰로오스, 스테아린산과 올레인산의 혼합물, 수바날(Subanal), 면실유, 낙화생유, 야자유, 카카오버터+콜레스테롤, 레시틴, 라네트왁스, 모노스테아린산글리세롤, 트윈 또는 스판, 임하우젠(Imhausen), 모놀렌(모노스테아린산프로필렌글리콜), 글리세린, 아뎁스솔리두스(Adeps solidus), 부티룸 태고-G(Buytyrum Tego-G), 세베스파마 16 (Cebes Pharma 16), 헥사라이드베이스 95, 코토마(Cotomar), 히드록코테 SP, S-70-XXA, S-70-XX75(S-70-XX95), 히드록코테(Hydrokote) 25, 히드록코테 711, 이드로포스탈 (Idropostal), 마사에스트라리움(Massa estrarium, A, AS, B, C, D, E, I, T), 마사-MF, 마수폴, 마수폴-15, 네오수포스탈-엔, 파라마운드-B, 수포시로(OSI, OSIX, A, B, C, D, H, L), 좌제기제 IV 타입 (AB, B, A, BC, BBG, E, BGF, C, D, 299), 수포스탈 (N, Es), 웨코비 (W, R, S, M ,Fs), 테제스터 트리글리세라이드 기제 (TG-95, MA, 57)와 같은 기제가 사용될 수 있다.
경구 투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 상기 추출물에 적어도 하나 이상의 부형제 예를 들면, 전분, 칼슘카보네이트(calcium carbonate), 수크로스(sucrose) 또는 락토오스(lactose), 젤라틴 등을 섞어 조제된다. 또한 단순한 부형제 이외에 마그네슘 스티레이트 탈크 같은 윤활제들도 사용된다.
경구 투여를 위한 액상제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구 투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제, 좌제가 포함된다. 비수성용제, 현탁제로는 프로필렌글리콜 (propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테르 등이 사용될 수 있다.
본 발명에 따른 약학적 조성물은 약학적으로 유효한 양으로 투여한다. 본 발명에 있어서, "약학적으로 유효한 양"은 의학적 치료에 적용 가능한 합리적인 수혜/위험 비율로 질환을 치료하기에 충분한 양을 의미하며, 유효용량 수준은 환자 질환의 종류, 중증도, 약물의 활성, 약물에 대한 민감도, 투여 시간, 투여 경로 및 배출비율, 치료기간, 동시 사용되는 약물을 포함한 요소 및 기타 의학 분야에 잘 알려진 요소에 따라 결정될 수 있다.
본 발명에 따른 약학적 조성물은 개별 치료제로 투여하거나 다른 치료제와 병용하여 투여될 수 있고 종래의 치료제와는 순차적 또는 동시에 투여될 수 있으며, 단일 또는 다중 투여될 수 있다. 상기한 요소들을 모두 고려하여 부작용 없이 최소한의 양으로 최대 효과를 얻을 수 있는 양을 투여하는 것이 중요하며, 이는 본 발명이 속하는 기술분야에 통상의 기술자에 의해 용이하게 결정될 수 있다.
본 발명의 약학적 조성물은 개체에게 다양한 경로로 투여될 수 있다. 투여의 모든 방식은 예상될 수 있는데, 예를 들면, 경구 복용, 피하 주사, 복강 투여, 정맥 주사, 근육 주사, 척수 주위 공간(경막내) 주사, 설하 투여, 볼점막 투여, 직장 내 삽입, 질 내 삽입, 안구 투여, 귀 투여, 비강 투여, 흡입, 입 또는 코를 통한 분무, 피부 투여, 경피 투여 등에 따라 투여될 수 있다.
본 발명의 약학적 조성물은 치료할 질환, 투여 경로, 환자의 연령, 성별, 체중 및 질환의 중등도 등의 여러 관련 인자와 함께 활성성분인 약물의 종류에 따라 결정된다.
본 발명에서 "개체"란 질병의 치료를 필요로 하는 대상을 의미하고, 보다 구체적으로는 인간 또는 비-인간인 영장류, 생쥐 (mouse), 쥐 (rat), 개, 고양이, 말, 및 소 등의 포유류를 의미한다.
본 발명에서 "투여"란 임의의 적절한 방법으로 개체에게 소정의 본 발명의 조성물을 제공하는 것을 의미한다.
본 발명에서 "예방"이란 목적하는 질환의 발병을 억제하거나 지연시키는 모든 행위를 의미하고, "치료"란 본 발명에 따른 약학적 조성물의 투여에 의해 목적하는 질환과 그에 따른 대사 이상 증세가 호전되거나 이롭게 변경되는 모든 행위를 의미하며, "개선"이란 본 발명에 따른 조성물의 투여에 의해 목적하는 질환과 관련된 파라미터, 예를 들면 증상의 정도를 감소시키는 모든 행위를 의미한다.
또한, 본 발명은 본 발명에 따른 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포; 상기 자연살해세포 특이적 키메릭항원수용체를 코딩하는 핵산 분자를 포함하는 발현 벡터; 및/또는 상기 발현 벡터를 포함하는, 암의 예방 또는 치료용 키트를 제공한다. 본 발명에 따른 키트는 암의 예방 또는 치료를 위한 것이라면 구체적인 형태에 제한이 없으며, 본 발명에 따른 키메릭항원수용체의 제조, 보관, 자연살해세포 내로의 도입 및 발현, 상기 자연살해세포의 투여 등을 위한 임의의 성분 및 기기를 제한 없이 포함할 수 있다.
또한, 본 발명은 본 발명에 따른 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포를 유효성분으로 포함하는, 암의 예방 또는 치료용 세포치료제를 제공한다.
본 발명에 있어서, "세포치료제 (cellular therapeutic agents)"란 인간으로부터 분리, 배양, 및 특수한 조작을 통해 제조되어, 특정 질환의 진단, 예방, 또는 치료의 목적으로 사용하기 위한 세포 내지 조직으로서, 미국 FDA에서는 세포치료제를 의약품으로 정의하고 있다. 구체적으로는, 세포치료제는 세포 또는 조직의 기능을 복원시키기 위해 살아있는 자가, 동종, 또는 이종 세포를 체외에서 증식 및 선별하거나, 기타의 방법으로 세포의 생물학적 특성을 변화시키는 일련의 과정을 통해 제조되어, 질병의 진단, 예방, 치료 등에 사용된다.
이하, 본 발명의 이해를 돕기 위하여 바람직한 실시예를 제시한다. 그러나 하기의 실시예는 본 발명을 보다 쉽게 이해하기 위하여 제공되는 것일 뿐, 하기 실시예에 의해 본 발명의 내용이 한정되는 것은 아니다.
[실시예]
실시예 1. 항-CD19-CAR 발현벡터의 제조
NK세포 특이적 신호전달 도메인을 바탕으로 본 발명에 따른 3가지의 항-CD19-DAP10-2B4-CD3ζ CAR의 인공합성 유전자를 제작하였으며 (하기 (1) 내지 (3)), 대조군으로서 항-CD19-CD28-CD3ζ CAR의 인공합성 유전자도 제작하였다 (하기 (4)).
각 키메릭항원수용체의 종류 및 구성은 다음과 같다:
(1) myc-tag, CD19와 결합하는 항-CD19 모노클로널 항체의 scFv, CD8 힌지 도메인, DAP10 세포외 도메인, DAP10 막관통 도메인, DAP10 세포내 신호전달 도메인, 2B4 세포내 신호전달 도메인, 및 CD3ζ (CD3z로도 지칭됨) 세포내 신호전달 도메인으로 이루어지는 1분자의 키메라 단백질 ("NK-CAR1"이라 명명함);
(2) myc-tag, CD19와 결합하는 항-CD19 모노클로널 항체의 scFv, CD28 힌지 도메인, DAP10 세포외 도메인, DAP10 막관통 도메인, DAP10 세포내 신호전달 도메인, 2B4 세포내 신호전달 도메인, 및 CD3ζ 세포내 신호전달 도메인으로 이루어지는 1분자의 키메라 단백질 ("NK-CAR2"이라 명명함);
(3) myc-tag, CD19와 결합하는 항-CD19 모노클로널 항체의 scFv, CD8 힌지 도메인, CD28 막관통 도메인, DAP10 세포내 신호전달 도메인, 2B4 세포내 신호전달 도메인, 및 CD3ζ 세포내 신호전달 도메인으로 이루어지는 1분자의 키메라 단백질 ("NK-CAR3"이라 명명함); 및
(4) myc-tag, CD19와 결합하는 항-CD19 모노클로널 항체의 scFv, CD8 힌지 도메인, CD28 막관통 도메인, CD28 세포내 신호전달 도메인, 및 CD3ζ 세포내 신호전달 도메인으로 이루어지는 1분자의 키메라 단백질 (T 세포 유래 CAR; "2nd CAR" 또는 "2nd generation CAR"이라 명명함).
상기 인공합성 유전자 각각을 포함하는 핵산단편을 EcoR1-Xho1으로 소화한 pMXs-IRES-GFP 레트로바이러스 벡터에 클로닝하여, 본 발명에 따른 NK-CAR를 발현하는 pMXs-CAR-IRES-GFP 레트로바이러스 벡터 3 종 및 대조군 T-CAR를 발현하는 레트로바이러스 벡터 1종을 제작했다. 즉, 상기 벡터는 형광단백질인 GFP와 함께 본 발명에 따른 키메릭항원수용체를 코딩한다. 본 발명에 따른 NK-CAR1, NK-CAR2, NK-CAR3, 및 대조군 2nd CAR의 구조는 도 1에 나타냈다.
실시예 2. NK-CAR 레트로바이러스 용액의 제작
실시예 1에서 제조한 4 종류의 pMXs-CAR-IRES-GFP 레트로바이러스 벡터로 대장균 DH5α를 각각 형질전환하여 형질전환체를 얻었다. 상기 형질전환체 내에서 복제된 플라스미드 DNA를 HiSpeed Plasmid Midi Kit (Qiagen, #12643)를 사용해서 정제하여, 트랜스펙션 (transfection; 형질주입)용 DNA로 준비하였다. 상기 트랜스펙션용 DNA를 이하의 조작에 적용했다.
X-tremeGENE9 (Roche, #6365787001)를 제조사의 설명에 따라 사용하여, 상기 트래스팩션용 DNA를 레트로바이러스 패키징 세포주인 Plat A 세포에 형질주입했다. 형질주입 24시간 후에 배지를 교체해주었고, 배지 교체 24시간 후에 암포트로픽 레트로바이러스를 함유하는 상층액을 획득하여 0.45 μm 필터 (Nalgene, #725-2545)로 여과했다. 이 상층액을 사용해서, 10 μg/mL polybrene (Sigma, #H9268)를 제조사의 설명에 따라 사용하여 자연살해세포 세포주인 NKL 및 NK92 세포주에 암포트로픽 바이러스를 700 G, 30분, 및 32℃ 조건으로 두 차례 spinfection 하였다.
바이러스 감염 3일차의 세포들 중 GFP를 발현하는 세포들을 BD FACSAriaTM II Cell Sorter (BD Biosciences)로 분리하여 배양하였다. 분리 3일 후의 세포를 Alexa Fluor®　647-Myc-Tag (9B11) Mouse mAb (Cell Signaling, #2233S)로 염색했고, BD AccuriTMC6 (BD Biosciences)을 이용해 분석했다. GFP 양성 세포는 본 실시예에서 제작한 레트로바이러스에 감염된 세포를 의미하고, Alexa Fluor®　647 양성 세포는 본 발명에 따른 NK-CAR를 발현하는 세포를 의미한다.
먼저, GFP 양성세포 (바이러스에 감염된 NKL 세포) 중 Alexa Fluor®　647 양성인 세포의 비율, NK-CAR를 발현하는 NKL 세포의 비율을 측정했다. 도 2a에 나타낸 바와 같이, CAR-레트로바이러스에 감염된 NKL 세포는 약 7%이고, 이들 중 본 발명에 따른 NK-CAR를 발현하는 NKL 세포는 대략 85%인 것으로 나타났다. 2nd CAR 바이러스에 감염된 NKL 세포는 약 12%이고, 이들 중 2nd CAR를 발현하는 NKL 세포는 약 95%로 확인되었다.
이어서, 바이러스 감염 3일 후의 NKL 세포들 중 GFP를 발현하는 NKL 세포를 BD FACSAriaTM II Cell Sorter (BD Biosciences)로 분리하여 배양하였고, 이들의 GFP 및 NK-CAR 발현을 확인하기 위해 상기 서술한 바와 같이 Alexa Fluor®　647-Myc-Tag (9B11) Mouse mAb로 염색하여 BD AccuriTMC6 (BD Biosciences)로 분석했다. 그 결과 99% 이상의 세포에서 GFP가 발현된 바, 바이러스에 감염된 NKL 세포들만 분리배양되었음을 알 수 있었다 (도 2b). GFP 양성 세포 대비 NK-CAR을 발현 세포의 비율을 관찰한 결과, NK-CAR1 발현 세포의 비율은 70%, NK-CAR2 발현 세포의 비율은 85%, NK-CAR3 발현 세포의 비율은 96%임을 확인하였다 (도 2b). 상기 결과는 NK-CAR의 구조적 차이가 단백질 발현에 영향을 준다는 것을 의미한다.
또한, GFP 양성세포 (바이러스에 감염된 NK92 세포) 중 Alexa Fluor®　647 양성인 세포의 비율, NK-CAR를 발현하는 NK92 세포의 비율을 측정했다. 도 2c에 나타낸 바와 같이, NK-CAR 바이러스에 감염된 NK92 세포는 약 22 내지 26%이고, 이들 중 NK-CAR를 발현하는 NK92 세포는 대략 32 내지 85%이었다. 2nd CAR 바이러스에 감염된 NK92 세포는 약 35%이고, 이들 중 2nd CAR를 발현하는 NK92 세포는 대략 94%인 것으로 확인됐다.
이어서, 바이러스 감염 3일 후의 NK92 세포들 중 GFP를 발현하는 NK 92 세포를 BD FACSAriaTM II Cell Sorter (BD Biosciences)로 분리하여 배양하였고, 이들의 GFP 및 NK-CAR 발현을 확인하기 위해 상기 서술한 바와 같이 Alexa Fluor®　647-Myc-Tag (9B11) Mouse mAb로 염색하여 BD AccuriTMC6 (BD Biosciences)로 분석했다. 그 결과 99% 이상의 세포에서 GFP가 발현된 바, 바이러스에 감염된 NK 92 세포들만 분리배양 되었음을 알 수 있었다 (도 2d). GFP 양성 세포 대비 NK-CAR을 발현 세포의 비율을 관찰한 결과, NK-CAR2 발현 세포의 비율은 63.7%, NK-CAR3 발현 세포의 비율은 96.6%임을 확인하였다 (도 2d). 상기 결과는, 앞선 결과와 마찬가지로, NK-CAR의 구조적 차이가 단백질 발현에 영향을 준다는 것을 의미한다.
실시예 3. NK-CAR 발현 NK 세포의 항원 특이적 세포사멸 활성 평가
본 실시예에서는 상기 실시예를 통해 제조한 NK-CAR가 도입된 NK 세포의 세포사멸활성을 평가하였다. 먼저, NK-CAR가 도입된 NKL 세포의 세포사멸 활성을 평가하기 위해, 배양 2일째의 CD19 양성세포주 REH를 타겟 세포로 사용하였고, 24시간 휴지시킨 배양 3일째의 NK-CAR 발현 NKL 세포, 및 대조군으로서 pMXs-IRES-GFP (공벡터)가 도입된 NKL를 이펙터 세포로 사용하였다. 이펙터 세포를 휴지시키기 위해 배양 2일째의 세포를 serum free RPMI1640으로 워시 (wash)하고 10ml의 rested RPMI1640 (+5% FBS, 0.5% pen/strep, 0.5% sodium pyruvate) 배지에 현탁하여 24시간 배양하였다. 또한, NK-CAR가 도입된 NK92 세포의 세포사멸 활성을 평가하기 위해, 배양 2일째의 CD19 양성세포주 REH 및 Ramos를 타겟 세포로 사용하였고, 휴지시키지 않은 배양 2일째의 NK-CAR 발현 NK92 세포, 및 대조군으로서 pMXs-IRES-GFP (공벡터)가 도입된 NK92를 이펙터 세포로 사용하였다.
NK-CAR 발현 NKL 및 NK92 세포의 세포사멸활성은 각각 Europium assay을 통해 측정하였다. 먼저 타겟세포를 1.0×106 cells/400 μl이 되도록 rested IMDM (+5% FBS, 0.5% pen/strep)에 현탁한 후 40 μM BATDA (Perkin Elmer, #C136-100)를 첨가하여 5.0% CO2 가스로 평형화한 37℃, CO2 인큐베이터에서 30분간 보온했다. 이후 1 mM sulfinpyrazone (Sigma, #S9509)가 포함된 rested IMDM (1mM sulfinpyrazone가 포함된 rested IMDM를 assay media로 명명)으로 워시하고, 5.0×104 cells/1 ml이 되도록 assay media로 현탁하여 well 당 100 μl씩 첨가했다. 또, 이펙터 세포를 assay media에 현탁하고, Effector to Target (E:T) 비가 NK-CAR 발현 NKL 세포의 경우 20:1, 10:1, 또는 5:1이 되도록; NK-CAR 발현 NK92 세포의 경우 4:1, 2:1, 또는 1:1이 되도록 100 μl 첨가했다. 이펙터 세포 대신에 spontaneous control로서 배지를, maximum lysis control로써 2% Triton X-100을 100μl 첨가한 well을 준비했다.
세포 및 각 대조군을 준비한 후, 96-well 플레이트를 5.0% CO2가스로 평형화한 37℃, CO2 인큐베이터에서 보온했다. NK-CAR 발현 NKL 세포의 경우 2시간 보온했으며, NK-CAR 발현 NK92 세포의 경우 30분 보온했다.
이어서, 상층액 20μl을 0.3 M acetic acid를 포함한 20% europium solution (Perkin Elmer, #C135-100)에 5분 동안 반응시킨 후 Victor X4 multilabel plate reader(Perkin Elmer사)로 형광광도를 측정하여 세포살해활성 (%)을 계산했다. 세포살해활성 (%)의 계산식은 다음과 같다: 세포살해활성 (%)=100×(각 웰의 측정값-Spontaneous control의 측정 값) / (Maximum lysis control의 측정 값- Spontaneous control의 측정 값).
Europium assay 결과는 도 3a 내지 3c에 나타냈다. 먼저, 도 3a는 NK-CAR 도입 NKL 세포의 세포사멸 활성을 나타낸다. EV (Empty vector)는 pMXs-IRES-GFP 벡터에 의해 만들어진 바이러스로 감염시킨 세포를, 2nd CAR 및 NK-CAR는 pMXs-CAR-IRES-GFP 벡터에 의해 만들어진 바이러스로 감염시킨 NKL 세포를 의미한다. 도면에 나타낸 바와 같이, Effector to Target 비가 20:1 일 때, EV군은 CD19 양성세포주인 REH를 사멸시키지 못했으며, 2nd CAR는 약 60%의 REH 세포를, NK-CAR는 약 70내지 80 %의 REH 세포를 사멸시킨 것으로 나타났다. 또한, Effector to Target 비가 10:1 또는 5:1 일 때에도, 본 발명에 따른 NK-CAR를 발현하는 NKL 세포의 REH 사멸 활성은 대조군 2nd CAR 발현 세포에 비해 높은 것으로 나타났다.
도 3b 및 3c는 각각 NK-CAR 도입 NK92 세포의 REH 세포 (도 3b) 및 RAMOS 세포 (도 3c)에 대한 사멸 활성을 나타낸다. EV (Empty vector)는 pMXs-IRES-GFP 벡터에 의해 만들어진 바이러스로 감염시킨 세포를, 2nd CAR 및 NK-CAR는 pMXs-CAR-IRES-GFP 벡터에 의해 만들어진 바이러스로 감염시킨 NK92 세포를 의미한다. 도면에 나타난 바와 같이, REH 세포 및 RAMOS 세포 모두에서 2nd CAR 발현 세포 대비 본 발명의 NK-CAR 발현 세포의 세포사멸 활성이 현저히 높았으며, 이와 같은 결과는 모든 Effector to Target 비에서 동일했다.
상기 결과들은 NKL 및 NK92 세포에 NK-CAR가 도입되면서, NKL 및 NK92 세포가 CD19를 인식하고 CD19 특이적으로 타겟 세포를 사멸시키는 능력을 획득했음을 보여주는 것이다. 또한 특정 NK 활성화 수용체 조합 (NKG2D+2B4)에 기반하여 제작한 본 발명의 NK-CAR3가 NK세포 활성화에 특히 효과적임을 보여준다. 특히, NK-CAR3를 발현하는 세포는 기타 NK-CAR 발현 세포보다도 더욱 우수한 세포사멸 활성을 보였는데, 이는 본 발명에 따른 NK-CAR 중 NK-CAR3이 NK 세포의 활성화에 특히 효과적임을 보여주는 것이다.
실시예 4. NK-CAR 발현 NK 세포의 사이토카인 분비능 확인
대식세포염증단백질-1α (Macrophage inflammatory protein-1α, MIP-1α; CCL3로도 불림)은 캐모카인으로 알려진 화학주성 (chemotactic) 사이토카인이며, 활성화된 자연살해세포로부터 분비된다. 그랜자임 B (Granzyme B)는 자연살해세포 및 세포독성 T세포의 그래뉼에서 가장 흔히 발견되는 세린 프로테아제 (serine protease)로서, 상기 세포들에 의한 퍼포린-매개성 표적세포 사멸 (perforin-dependent target cell death) 기작 유도에 중요한 인자이며, 퍼포린과 함께 분비된다. 즉, MIP-1α 및 그랜자임 B는 자연살해세포의 활성화 정도의 척도가 되는 바, 본 발명에 따른 NK-CAR가 NKL 세포의 세포사멸 기능을 효과적으로 유도하는지 확인하기 위해, NK-CAR 발현 세포의 MIP-1α 및 그랜자임 B 수준을 측정했다.
배양 2일째의 CD19 양성세포주 REH를 타겟 세포로 사용하였고, 24시간 휴지시킨 배양 3일째의 NK-CAR 발현 NKL 세포, 및 대조군으로서 2nd CAR 도입 NKL 세포, pMXs-IRES-GFP (공벡터; EV) 도입 NKL 세포, 및 단순 NKL 세포 (벡터가 도입되지 않은 NKL 세포)를 이펙터 세포로 사용하였다. 이펙터 세포를 휴지시키기 위해 배양 2일째의 세포를 serum free RPMI1640으로 워시하고 rested RPMI1640 (+5% FBS, 0.5% pen/strep, 0.5% sodium pyruvate) 10 ml에 현탁하여 24시간 배양하였다.
타겟세포인 REH를 1.0×106 cells/100 μl/샘플, 이펙터세포를 0.5×106 cells/150 μl/샘플이 되도록 rested IMDM (+5% FBS, 0.5% pen/strep)에 현탁한 후 96 well plate에 분주하였다.
이를 5.0% CO2 가스로 평형화한 37℃ CO2 인큐베이터에서 8시간 공동 배양하였다. 이후, 세포 배양액을 원심분리하여 상층액을 획득하였고, Human CCL3/MIP-1alpha DuoSet ELISA kit (R&D Systems, #DY270), Human Granzyme B DuoSet ELISA kit (R&D Systems, #DY2906)를 제조사의 설명에 따라 사용하여 상기 상층액 내의 MIP-1α, 및 Granzyme B 분비량을 확인하였다.
그 결과, 도 4a 및 4b에 나타낸 바와 같이, 활성화된 NK 세포에 의해 분비되는 MIP-1α 및 그랜자임 B는 CAR을 발현하는 세포에 의해서만 생성 및 분비된 것으로 나타났다. 뿐만 아니라, 본 발명에 따른 NK-CAR을 발현하는 NKL 세포의 사이토카인 분비량이 2nd CAR를 발현하는 NKL 세포보다 현저히 높은 것으로 나타났다. 상기 결과는 본 발명에 따른, 특정 수용체 조합에 기반한 NK-CAR이 자연살해세포의 타겟세포 사멸 기능을 효과적으로 활성화하고 사이토카인 분비를 촉진한다는 것을 보여준다.
실시예 5. NK-CAR 발현 NK 세포의 AKT 및 ERK 신호경로 활성화 확인
타겟항원을 인식한 자연살해세포는 AKT 및 ERK 신호를 활성화하여 항종양 효과 등을 발휘한다. 따라서, 본 발명에 따른 NK-CAR 발현 자연살해세포가 타겟항원 (CD19)을 효과적으로 인식하여 특이적인 AKT 및 ERK 신호 활성화를 일으키는지 확인하였다. 이를 위해, CD19 양성세포주인 REH 또는 재조합 인간 CD19 Fc 키메라 (Recombinant Human CD19 Fc Chimera)를 자극원으로 하여, 24시간 동안 휴지시킨 배양 3일째의 NK-CAR 도입 NKL 세포 및 대조군인 NKL 세포를 자극하였으며, 이에 따른 AKT 및 ERK 신호의 변화를 확인하였다. 세포를 휴지시키기 위해 배양 2일째의 세포를 serum free RPMI1640으로 워시하고 rested RPMI1640 (+5% FBS, 0.5% pen/strep, 0.5% sodium pyruvate) 10 ml에 현탁하여 24시간 동안 배양하였다.
REH 세포로 NKL 세포를 자극하여 세포 용해물을 획득한 과정은 다음과 같다. CD19 양성세포주인 REH 세포, 항 CD19-DAP10-2B4 CAR (NK-CAR2에서 CD3ζ 세포내 신호전달 도메인이 없는 구조) 도입 NKL 세포, 및 대조군인 NKL 세포를 5.0×106 cells/100 μl/샘플이 되도록 rested RPMI (+5% FBS, 0.5% pen/strep, 0.5% sodium pyruvate)으로 각각 현탁한 후, 4℃에서 10분간 보냉했다. 이어서, REH 세포와 CAR 도입 NKL 세포; 그리고 REH 세포와 대조군 NKL 세포를 각각 섞어준 후 원심분리하여 pellet 상태로 4℃에서 10분간 보냉했다. 이후 37℃ Water bath에서 2분, 5분간 자극하였고, 자극이 끝난 후에는 얼음에서 5분간 보냉하여 자극을 종결시켰다. 이후 DPBS로 세척하였고, lysis buffer를 넣고 vortex를 한 후 얼음에서 세포용해 (lysis)를 진행했다. 이후 원심분리하여 세포 용해물을 획득하였다.
재조합 인간 CD19 Fc 키메라로 NKL 세포를 자극하여 세포 용해물을 획득한 과정은 다음과 같다. Protein G (Invitrogen, #1003D) 4.0×107 beads/샘플을 wash buffer (1X PBS + 0.01% Tween-20 + 1% FBS)로 워시하였다. 여기에 재조합 인간 CD19 Fc 키메라 (R&D, #9269-CD) 4 μg/샘플을 첨가하였고, 4℃에서 1시간동안 rotation incubation 했다. 이후, wash buffer로 워시를 해주었고, 4.0×107 beads/100 μl/샘플이 되도록 rested RPMI (+5% FBS, 0.5% pen/strep, 0.5% sodium pyruvate)으로 현탁하여 재조합 인간 CD19 Fc 키메라가 코팅된 Protein G beads solution을 제작했다. 항-CD19-DAP10-2B4 CAR (NK-CAR2에서 CD3ζ 세포내 신호전달 도메인이 없는 구조) 도입 NKL 세포 및 대조군인 NKL 세포를 2.0×106 cells/샘플을 원심분리하여 pellet을 만들고 4℃에서 10분간 보냉했다. 이를 beads solution으로 재현탁한 후 원심분리하여 pellet을 만들고 4℃에서 10분간 보냉했다. 이후 37℃ Water bath에서 2분, 5분간 자극하였고, 자극이 끝난 후에는 얼음에서 5분간 보냉하여 자극을 종결시켰다. 이후 DPBS로 washing을 하였고, lysis buffer를 넣고 vortex를 한 후 얼음에서 세포용해를 진행했다. 이후 원심분리하여 세포 용해물을 획득하였다.
상기 방법으로 획득한 세포용해물을 8% 아크릴 아마이드 겔을 사용하여 SDS-PAGE하였고, 반건식 전사방법 (semi-dry transfer)으로 PVDF 멤브레인 (immobilon, #IPVH00010)에 단백질을 전사하였다. 이후 5% skim milk로 블락킹을 한 후 항원항체 반응을 진행했다. 1차 항체는 4℃에서 16시간 동안 처리하였으며, 사용한 1차 항체 목록은 다음과 같다: Phospho-Akt (cell signaling, #CS9271), AKT (cell signaling, #CS9272), Phospho-p44/42 Erk1/2 (cell signaling, #CS9101), Erk1/2 (cell signaling, #CS4695). 2차 항체 (mouse anti-rabbit IgG-HRP (Santa Cruz Biotechnology, #SC2357))는 상온에서 1시간 처리하였다. 이후, SuperSignalTM WestPico PLUS Chemiluminescent Substrate (Thermo Scientific, #34580)를 사용하여 ImageQuant LAS 4000 (fujifilm 사)로 단백질을 검출하였다.
NK-CAR (NK-CAR2에서 CD3ζ 세포내 신호전달 도메인이 없는 구조)발현 세포주를 CD19 양성 REH 세포로 자극한 결과는 도 5a에 나타냈다. 동량의 AKT 및 ERK를 로딩하였을 때, NK-CAR 발현 세포는 REH로 5분간 자극하였을 때 전체 AKT 대비 인산화된 AKT (pS476-pAKT) 수준이 현저하게 증가하였으며, 전체 ERK 대비 인산화된 ERK 수준 역시 NK-CAR 발현 세포에서 두드러지게 증가한 것으로 나타났다. 반면, NK-CAR를 발현하지 않는 대조군 NKL 세포는 REH로 자극해도 AKT 및 ERK의 인산화 정도에 큰 차이가 없었다. NK-CAR (NK-CAR2에서 CD3ζ 세포내 신호전달 도메인이 없는 구조) 발현 세포주를 재조합 인간 CD19 Fc 키메라로 자극한 결과는 도 5b에 나타냈다. 상기 결과와 마찬가지로, NK-CAR를 발현하지 않는 NKL 세포는 CD19로 자극해도 AKT 및 ERK 신호가 활성화되지 않았으나, NK-CAR를 발현하는 NKL 세포는 CD19로 5분간 자극하였을 때 AKT 및 ERK의 인산화가 현저하게 증가하였다.
상기 결과들은 본 발명에 따른 NK-CAR를 발현하는 자연살해세포는 타겟항원인 CD19를 효과적으로 인식하여 특이적으로 AKT 및 ERK 신호 활성화를 일으킬 수 있음을 보여준다.
실시예 6. NK-CAR 발현 NK 세포의 세포독성 탈과립화 확인
탈과립 (degranualation)은 과립 (granule)이라고 하는 분비 소포로부터 항균성 세포독성 물질 등을 방출하는 세포 과정을 지칭한다. 탈과립은 과립구 (호중구, 호염기구, 및 호산구)나 비만세포, NK 세포, T 세포와 같은 면역세포에서 관찰되며, 주로 침입성 미생물을 공격하는 것을 목적으로 한다. 특히, 활성화된 NK 세포는 탈과립을 통해 표적세포의 표면에 퍼포린 및 그랜자임을 포함한 물질을 방출하여 세포사멸을 유도한다. NK 세포의 과립 내부 표면은 CD107a로 코팅되어 있다. 탈과립 후, CD107a는 세포독성 림프구 표면에 노출되므로 퍼포린으로 인한 손상으로부터 림프구의 외막을 보호한다. CD107a의 외부화에 기반한 NK 세포의 탈과립 분석은 항원에 반응한 NK 세포의 활성화의 직접적인 검출을 가능케 한다. 따라서, 본 실시예에서는 본 발명의 NK-CAR이 도입된 NK 세포의 탈과립화 정도를 측정하여 NK-CAR에 의한 NK 세포의 활성화를 검증하였다.
구체적으로, CAR 도입 NK92 세포의 세포독성 탈과립화를 평가하기 위해, 배양 2일째의 CD19 양성 세포주 REH 및 Ramos 세포를 타겟 세포로 사용하였고, 배양 2일째의 NK-CAR 도입 NK92 세포, 및 대조군으로서 2nd CAR 도입 NK92 세포로 사용하였다. 또한, pMXs-IRES-GFP 도입 NK92 세포를 이펙터 세포로 사용하였다.
타겟 세포는 1.0×105cells/50 μl/sample, 이펙터 세포는 1.0×105cells/100 μl/sample, anti-CD107a/LAMP1-PE (clone H4A3, BD Bioscience, #555801)는 2 μl/50 μl/sample이 되도록 IMDM (+10% FBS, 1% pen/strep)에 현탁하고 96 well plate에 각각 분주하여 최종 부피를 200 μl로 하고, 이를 5.0% CO2가스로 평형화한 37℃, CO2 인큐베이터에서 2시간 공동 배양하였다. 이후, 원심분리하여 세포 펠렛을 DPBS (+1% FBS)에 현탁하고 anti-CD3-PerCP (clone SK7, BD Bioscience, #347344), anti-CD56-APC (clone NCAM16.2, BD Bioscience, #341025), 및 anti-CD107a/LAMP1-PE (clone H4A3, BD Bioscience, #555801)를 각각 처리하여 4℃의 암실에서 35분 동안 표지 하였다. 이후 DPBS (+1% FBS)로 세포를 2회 워시한 후, NK92 세포 표면의 CD107a 발현을 유세포분석기를 통해 확인하여 세포독성 탈과립화를 평가하였다.
그 결과, 도 6에 나타낸 바와 같이, NK 세포를 CD19를 발현하는 타겟세포와 공동배양 하였을 때, 공백터 (EV) 도입 세포 대비 CAR이 도입된 NK92 세포에서 CD107a 양성 세포의 비율이 증가되어 있는 것을 확인하였다. 또한, NK-CAR 도입 NK92 세포 및 2nd CAR 도입 NK92 세포를 비교한 결과, 2nd CAR 도입 세포 대비 본 발명의 NK-CAR이 도입된 NK92 세포의 탈과립화 수준이 더 높았으며, 특히 NK 활성화 수용체 조합 (NKG2D+2B4)에 기반한 NK-CAR3 도입 NK92 세포는 REH 자극군 및 Ramos 자극군에서 CD107a 양성 세포의 비율이 각각 21.6%, 44.7% 로 가장 높은 것으로 나타났다.
상기 결과는 본 발명의 NK-CAR이 기존의 CAR에 비해 더욱 효과적으로 NK 세포의 탈과립화를 유도할 수 있으며, 따라서 더욱 우수한 세포사멸 활성을 촉진할 수 있음을 보여준다.
실시예 7. NK-CAR 발현 NK 세포의 사이토카인 생성 정도 확인
본 실시예에서는 본 발명의 NK-CAR이 NK 세포를 활성화하여 사이토카인의 생성을 촉진하는지 추가로 검증하였다.
구체적으로, NK-CAR 도입 NK92 세포의 사이토카인 생산을 평가하기 위해, 배양 2일째의 CD19 양성세포주 REH 및 Ramos 세포를 타겟 세포로 사용하였고, 배양 2일째의 NK-CAR 도입 NK92, 및 대조군으로서 2nd CAR 도입 NK92 세포를 사용하였다. 또한, pMXs-IRES-GFP 도입 NK92 세포를 이펙터 세포로 사용하였다.
타겟 세포를 1.0×105 cells/100 μl/sample, 이펙터 세포를 1.0×105 cells/100 μl/sample이 되도록 IMDM (+10% FBS, 1% pen/strep)에 현탁한 후 96 well plate에 각각 분주하여, 이를 5.0% CO2가스로 평형화한 37℃, CO2 인큐베이터에서 1시간 공동 배양하였다. 이후, brefeldin A (GolgiPlug; BD Biosciences, #51-2301KZ) 및 monensin을 함유하는 단백질 수송 억제제 (GolgiStop; BD Bioscience, #51-2092KZ)를 첨가한 후, 추가로 5시간 동안 배양하였다. 총 6시간 후, 원심분리하여 세포 펠렛을 DPBS (+1% FBS)에 현탁하고 anti-CD3-PerCP (clone SK7, BD Bioscience, #347344), anti-CD56-APC (clone NCAM16.2, BD Bioscience, #341025)로 4℃의 암실에서 35분 동안 표지 하였다. 이후 DPBS (+1% FBS)로 세포를 2회 워시한 후 BD Cytofix/Cytoperm 용액(BD Biosciences, #51-2090KZ)으로 4℃의 암실에서 20분간 세포고정/투과화 시켰다. 이후 세포를 1X BD Perm/Wash buffer(BD Biosciences, #51-2091KZ)로 두 번 워시하고, anti-Interferon-γ-PE (clone 25723.11, BD Bioscience, #340452)로 4℃의 암실에서 15시간동안 염색하였다. 염색 후, 세포를 1X BD Perm/Wash buffer로 두 번 세척하고, NK92 세포의 Interferon-γ 발현을 유세포분석기를 통해 확인하여 사이토카인 생성을 평가하였다.
결과는 도 7에 나타냈다. 각 NK92 세포 내의 Interferon-γ 생성을 확인한 결과, CD19를 발현하는 타겟세포와 공동배양 하였을 때 공백터 (EV) 도입 세포 대비 CAR가 도입된 NK92 세포에서 Interferon-γ 양성 세포의 비율이 증가되어 있는 것을 확인하였다. 또한, NK-CAR 도입 세포 및 2nd CAR 도입 세포를 비교한 결과, 2nd CAR 도입 NK92 세포 대비 본 발명의 NK-CAR이 도입된 NK92 세포의 Interferon-γ 양성 세포의 비율이 더 높았으며, 특히 NK 활성화 수용체 조합 (NKG2D+2B4)에 기반한 NK-CAR3 도입 NK92 세포의 Interferon-γ 양성 세포의 비율은 REH 자극군 및 Ramos 자극군에서 각각 19.3% 및 58.6%로 가장 높은 것을 확인하였다.
상기 결과는 본 발명의 NK-CAR이 기존의 CAR에 비해 더욱 효과적으로 NK 세포의 사이토카인 생성을 촉진할 수 있으며, 따라서 더욱 우수한 세포사멸 활성을 유도할 수 있음을 보여준다.
이상에서 살펴본 바와 같이, 본 발명자들은 자연살해세포 특이적 활성화 수용체의 조합을 통해 시너지적인 자연살해세포 활성화 효과를 발휘할 수 있는 자연살해세포 특이적 키메릭항원수용체를 도출하였다. 다양한 자연살해세포를 이용한 실험에서, 상기 키메릭항원수용체를 발현하는 자연살해세포는 타겟세포를 효과적으로 인식하여 AKT 및 ERK 신호를 활성화함으로써 우수한 항종양 활성을 유도하였다. 또한, 상기 키메릭항원수용체는 자연살해세포를 활성화하여 사이토카인 등의 세포독성 물질의 생성 및 분비를 촉진하며, 탈과립화를 유도하여 세포사멸 활성을 증진시키는 것으로 나타났다. 특히, 본 발명의 자연살해세포 특이적 키메릭항원수용체는 T 세포 기반의 CAR에 비해 자연살해세포의 활성화 및 세포사멸 기능 유도 효과가 더욱 높은 것이 확인되었다. 따라서, 본 발명에 따른 자연살해세포 특이적 키메릭항원수용체는 신규한 항암 면역요법 수단으로서, 기존의 항암요법의 부작용 위험은 줄이면서 더욱 우수한 항암 효과를 발휘할 것으로 기대된다.
전술한 본 발명의 설명은 예시를 위한 것이며, 본 발명이 속하는 기술분야의 통상의 지식을 가진 자는 본 발명의 기술적 사상이나 필수적인 특징을 변경하지 않고서 다른 구체적인 형태로 쉽게 변형이 가능하다는 것을 이해할 수 있을 것이다. 그러므로 이상에서 기술한 실시예들은 모든 면에서 예시적인 것이며 한정적이 아닌 것으로 이해해야 한다.
본 발명과 관련된 구체적인 서열정보는 아래 표 1에 나타냈다.
구분 서열 서열번호
Anti-CD19 scFv DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEITGGGGSGGGGSGGGGSEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQGTSVTVSS 1
CD8 hinge domain TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD 2
CD28 hinge domain IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP 3
CD28 TM domain FWVLVVVGGVLACYSLLVTVAFIIFWV 4
DAP10 EC domain QTTPGERSSLPAFYPGTSGSCSGCGSLSLP 5
DAP10 TM domain LLAGLVAADAVASLLIVGAVF 6
DAP10 CYP domain LCARPRRSPAQEDGKVYINMPGRG 7
2B4 CYP domain WRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYS 8
CD3z CYP domain RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR 9
CD8α signal peptide MALPVTALLLPLALLLHAARP 10
Anti-CD19 scFv GATATACAGATGACGCAGACAACGTCAAGTCTTTCCGCCAGCTTGGGAGACCGAGTGACTATATCTTGTAGAGCAAGCCAGGATATTTCTAAGTATCTTAACTGGTACCAACAAAAGCCCGATGGAACGGTTAAGCTGCTTATATACCATACCAGTAGACTCCACTCCGGCGTACCATCACGGTTTTCTGGCAGTGGCTCCGGGACCGACTATTCTTTGACGATCTCTAATCTCGAACAAGAGGATATTGCAACATACTTTTGTCAGCAAGGCAATACCTTGCCATATACGTTTGGGGGCGGGACAAAACTTGAGATAACCGGCGGCGGTGGTTCAGGCGGTGGCGGTTCCGGTGGTGGGGGATCAGAGGTTAAGCTTCAGGAATCCGGACCAGGTTTGGTTGCCCCCAGCCAATCTCTCAGCGTTACATGCACGGTTTCAGGCGTCAGTCTCCCCGATTACGGTGTAAGTTGGATTCGGCAACCTCCGCGAAAGGGTCTGGAATGGCTGGGGGTTATTTGGGGGAGTGAGACAACTTATTACAACTCTGCACTTAAGAGTCGGCTTACCATCATCAAGGATAATTCAAAATCACAAGTATTCCTGAAGATGAACTCATTGCAAACAGATGATACAGCTATATACTATTGTGCCAAGCATTACTATTATGGTGGTTCTTATGCAATGGATTACTGGGGGCAAGGCACGTCAGTGACAGTGAGTTCA 11
CD8 hinge domain_NK-CAR1 ACCACAACCCCAGCACCCCGGCCCCCTACACCTGCACCAACCATCGCCAGCCAGCCTCTGTCCCTGAGGCCAGAGGCCTGCCGCCCCGCCGCCGGCGGAGCAGTGCACACAAGGGGCCTGGACTTCGCCTGTGAT 12
CD8 hinge domain_NK-CAR3 ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGAT 13
CD28 hinge domain ATTGAAGTTATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCC 14
CD28 TM domain TTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTG 15
DAP10 EC domain CAGACAACCCCCGGCGAGCGCAGCTCCCTGCCAGCCTTTTACCCTGGCACCTCCGGCTCTTGCAGCGGATGTGGCTCCCTGTCTCTGCCT 16
DAP10 TM domain CTGCTGGCCGGCCTGGTGGCCGCCGACGCAGTGGCCTCTCTGCTGATCGTGGGAGCCGTGTTC 17
DAP10 CYP domain CTGTGCGCCAGGCCACGGAGATCCCCAGCACAGGAGGATGGCAAGGTGTATATCAACATGCCTGGCAGGGGA 18
2B4 CYP domain TGGCGGAGAAAGCGGAAGGAGAAGCAGAGCGAGACATCCCCTAAGGAGTTTCTGACCATCTACGAGGACGTGAAGGATCTGAAGACAAGGCGCAATCACGAGCAGGAGCAGACATTCCCCGGCGGAGGCTCCACCATCTATTCTATGATCCAGAGCCAGAGCTCCGCCCCCACATCCCAGGAGCCTGCCTACACCCTGTATTCCCTGATCCAGCCCAGCCGGAAGTCTGGCAGCCGGAAGAGAAACCACTCCCCATCTTTTAATAGCACCATCTACGAAGTGATCGGCAAGTCCCAGCCAAAGGCACAGAACCCAGCAAGGCTGTCTCGCAAGGAGCTGGAGAATTTCGACGTGTATAGC 19
CD3z CYP domain AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC 20
CD8α signal peptide ATGGCGCTCCCTGTCACCGCACTGCTTCTTCCGCTGGCACTGCTGCTGCACGCTGCACGGCCT 21
myc-tag GAGCAAAAACTTATCTCTGAAGAGGACCTC 22
NK-CAR1_full insert MALPVTALLLPLALLLHAARPEQKLISEEDLDIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEITGGGGSGGGGSGGGGSEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQGTSVTVSSTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGRGWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR 23
NK-CAR2_full insert MALPVTALLLPLALLLHAARPEQKLISEEDLDIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEITGGGGSGGGGSGGGGSEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQGTSVTVSSIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPQTTPGERSSLPAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGRGWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR 24
NK-CAR3_full insert MALPVTALLLPLALLLHAARPEQKLISEEDLDIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHTSRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGTKLEITGGGGSGGGGSGGGGSEVKLQESGPGLVAPSQSLSVTCTVSGVSLPDYGVSWIRQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVFLKMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQGTSVTVSSTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDFWVLVVVGGVLACYSLLVTVAFIIFWVLCARPRRSPAQEDGKVYINMPGRGWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR 25
Anti-CD19 scFv H chain_CDR1 GVSLPDYGVS 26
Anti-CD19 scFv H chain_CDR2 VIWGSETTYYNSALKSR 27
Anti-CD19 scFv H chain_CDR3 HYYYGGSYAMDY 28
Anti-CD19 scFv L chain_CDR1 RASQDISKYLN 29
Anti-CD19 scFv L chain_CDR2 SRLHSGV 30
Anti-CD19 scFv L chain_CDR3 QQGNTLPYT 31
본 발명은 자연살해세포 특이적 키메릭항원수용체 (NK-CAR) 등에 관한 것으로서, 자연살해세포 특이적 활성화 수용체 유래 도메인들의 특정 조합을 포함하는 NK-CAR가 자연살해세포를 효과적으로 활성화하여 타겟세포에 대한 사멸능을 증진시킬 수 있음을 확인하여 완성된 것이다. 구체적으로, 본 발명자들은 특정 도메인들의 조합으로 이루어진 3가지의 자연살해세포 특이적 CAR를 제조하였으며, 상기 NK-CAR를 발현하는 자연살해세포는 타겟세포에 반응한 사이토카인 및 그랜자임 B의 생성이나 AKT 및 ERK 활성화가 더욱 증진되고, 탈과립화가 촉진되어 더욱 우수한 세포사멸 활성을 발휘하는 것을 확인하였다. 즉, 본 발명에 따른 NK-CAR는 자연살해세포의 활성화를 강력히 유도하여 세포사멸 활성을 증진시킬 수 있으므로, 암을 포함한 다양한 질환의 치료를 위한 면역요법으로 활용될 수 있다. 특히 자연살해세포를 이용한 CAR 기반 항암 치료는 사이토카인 방출 신드롬이나 신경독성 등을 유발하지 않고, 자가 및 동종의 자연살해세포를 이용할 수 있으므로 CAR-T 등에 비해 부작용이 적은 장점이 있다. 따라서 본 발명에 따른 NK-CAR를 발현하는 자연살해세포는 부작용은 낮추면서 질병 치료 효과는 극대화된 세포치료제로 활용될 것으로 기대된다.

Claims (25)

  1. 자연살해세포 특이적 키메릭항원수용체로서,
    (i) 항원 결합 도메인;
    (ii) CD8 또는 CD28 힌지 도메인;
    (iii) DAP10 세포내 신호전달 도메인;
    (iv) 2B4 세포내 신호전달 도메인; 및
    (v) CD3z 세포내 신호전달 도메인을 포함하고, 상기 키메릭항원수용체는 자연살해세포에서 발현되는 것을 특징으로 하는, 자연살해세포 특이적 키메릭항원수용체.
  2. 제1항에 있어서,
    상기 항원 결합 도메인은 종양항원 특이적 항체 또는 이의 항원 결합 단편인 것을 특징으로 하는, 자연살해세포 특이적 키메릭항원수용체.
  3. 제1항에 있어서,
    상기 키메릭항원수용체는 하기 특징 중 하나 이상을 만족하는 것을 특징으로 하는, 자연살해세포 특이적 키메릭항원수용체:
    (a) 상기 CD8 힌지 도메인은 서열번호 2의 아미노산 서열을 포함함;
    (b) 상기 CD28 힌지 도메인은 서열번호 3의 아미노산 서열을 포함함;
    (c) 상기 DAP10 세포내 신호전달 도메인은 서열번호 7의 아미노산 서열을 포함함;
    (d) 상기 2B4 세포내 신호전달 도메인은 서열번호 8의 아미노산 서열을 포함함; 및
    (e) 상기 CD3z 세포내 신호전달 도메인은 서열번호 9의 아미노산 서열을 포함함.
  4. 제1항에 있어서,
    상기 키메릭항원수용체는 CD28 막관통 도메인을 더 포함하는 것을 특징으로 하는, 자연살해세포 특이적 키메릭항원수용체.
  5. 제4항에 있어서,
    상기 CD28 막관통 도메인은 서열번호 4의 아미노산 서열을 포함하는 것을 특징으로 하는, 자연살해세포 특이적 키메릭항원수용체.
  6. 제1항에 있어서,
    상기 키메릭항원수용체는 DAP10 세포외 도메인 및 DAP10 막관통 도메인으로 이루어진 군에서 선택된 하나 이상을 더 포함하는 것을 특징으로 하는, 자연살해세포 특이적 키메릭항원수용체.
  7. 제6항에 있어서,
    상기 키메릭항원수용체는 하기 특징 중 하나 이상을 만족하는 것을 특징으로 하는, 자연살해세포 특이적 키메릭항원수용체:
    (f) 상기 DAP10 세포외 도메인은 서열번호 5의 아미노산 서열을 포함함; 및
    (g) 상기 DAP10 막관통 도메인은 서열번호 6의 아미노산 서열을 포함함.
  8. 제1항에 있어서,
    상기 키메릭항원수용체는 신호 펩티드를 더 포함하는 것을 특징으로 하는, 자연살해세포 특이적 키메릭항원수용체.
  9. 제8항에 있어서,
    상기 신호 펩티드는 CD8 신호 펩티드인 것을 특징으로 하는, 자연살해세포 특이적 키메릭항원수용체.
  10. 제2항에 있어서,
    상기 종양항원은 CD19, TAG72, IL13Rα2 (Interleukin 13 receptor alpha-2 subunit), CD52, CD33, CD20, TSLPR, CD22, CD30, GD3, CD171,　NCAM (Neural cell adhesion molecule), FBP (Folate binding protein), Le(Y) (Lewis-Y antigen),　PSCA (Prostate stem cell antigen), PSMA (Prostate-specific membrane antigen), CEA (Carcinoembryonic antigen), HER2 (Human epidermal growth factor receptor 2),　Mesothelin,　CD44v6 (Hyaluronate receptor variant 6), B7-H3, Glypican-3, ROR1 (receptor tyrosine kinase like orphan receptor 1), Survivin, FOLR1 (folate receptor 1), WT1 (Wilm's tumor 1), VEGFR2 (Vascular endothelial growth factor 2), EGFR, 및 KRAS로 이루어진 군에서 선택된 하나 이상인 것을 특징으로 하는, 자연살해세포 특이적 키메릭항원수용체.
  11. 제2항에 있어서,
    상기 항원 결합 단편은 scFv, (scFv)2,　Fab,　Fab', 및 F(ab')2로 이루어진 군으로부터 선택된 것을 특징으로 하는,　자연살해세포 특이적 키메릭항원수용체.
  12. 제2항에 있어서,
    상기 종양항원 특이적 항체 또는 이의 항원 결합 단편은 하기의 중쇄 가변영역 및 경쇄 가변영역을 포함하는 것을 특징으로 하는, 자연살해세포 특이적 키메릭항원수용체:
    서열번호 26의 아미노산 서열을 포함하는 중쇄 CDR1, 서열번호 27의 아미노산 서열을 포함하는 중쇄 CDR2, 및 서열번호 28의 아미노산 서열을 포함하는 중쇄 CDR3를 포함하는 중쇄 가변영역; 및
    서열번호 29의 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 30의 아미노산 서열을 포함하는 경쇄 CDR2, 및 서열번호 31의 아미노산 서열을 포함하는 경쇄 CDR3를 포함하는 경쇄 가변영역.
  13. 제1항 내지 제12항 중 어느 한 항의 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포.
  14. 제13항에 있어서,
    상기 자연살해세포는 하기로 이루어진 군에서 선택된 하나 이상의 특징을 만족하는 것을 특징으로 하는, 자연살해세포:
    (a) 항원 인식시 MIP-1α, 그랜자임 B, 및 INF-γ로 이루어진 군에서 선택된 하나 이상의 분비량이 증가함;
    (b) 항원 인식시 AKT 신호 및 ERK 신호로 이루어진 군에서 선택된 하나 이상의 활성이 증가함; 및
    (c) 항원 인식시 탈과립화 수준이 증가함.
  15. 제1항 내지 제12항 중 어느 한 항의 자연살해세포 특이적 키메릭항원수용체를 코딩하는 핵산 분자.
  16. 제15항의 핵산 분자를 포함하는 발현 벡터.
  17. 제16항의 발현 벡터가 도입된, 단리된 세포.
  18. 제2항 내지 제12항 중 어느 한 항의 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포를 유효성분으로 포함하는, 암의 예방 또는 치료용 약학적 조성물.
  19. 제18항에 있어서,
    상기 암은 대장암, 직장암, 결장암, 갑상선암, 구강암, 인두암, 후두암, 자궁경부암, 뇌암, 폐암, 난소암, 방광암, 신장암, 간암, 췌장암, 전립선암, 피부암, 혀암, 유방암, 자궁암, 위암, 골암, 림프종, 혈액암, 편평상피세포암, 폐의 선암, 복막암, 피부암, 피부 흑색종, 안구 흑색종, 직장암, 항문부근암, 식도암, 소장암, 내분비선암, 부갑상선암, 부신암, 연조직 육종, 요도암, 위장암, 교아종, 난소암, 자궁내막암, 침샘암, 음문암, 및 두경부암으로 이루어진 군으로부터 선택된 하나 이상인 것을 특징으로 하는, 약학적 조성물.
  20. 제2항 내지 제12항 중 어느 한 항의 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포를 유효성분으로 포함하는, 암의 예방 또는 치료용 세포치료제.
  21. (S1) 제16항의 발현 벡터를 단리된 세포에 도입시키는 단계; 및
    (S2) 상기 발현 벡터가 도입된 세포를 배양하는 단계를 포함하는, 자연살해세포 특이적 키메릭항원수용체의 제조방법.
  22. 제16항의 발현 벡터를 단리된 자연살해세포에 도입시키는 단계를 포함하는, 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포의 제조방법.
  23. 제2항 내지 제12항 중 어느 한 항의 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포를 이를 필요로 하는 개체에 투여하는 단계를 포함하는, 암의 예방 또는 치료방법.
  24. 제2항 내지 제12항 중 어느 한 항의 자연살해세포 특이적 키메릭항원수용체를 발현하는 자연살해세포의 암의 예방 또는 치료를 위한 용도.
  25. 암 치료용 약제의 제조를 위한, 제2항 내지 제12항 중 어느 한 항의 자연살해세포 특이적 키메릭항원수용체, 상기 키메릭항원수용체를 코딩하는 핵산 분자, 상기 핵산 분자를 포함하는 발현 벡터, 상기 발현 벡터가 도입된 세포, 또는 상기 키메릭항원수용체를 발현하는 자연살해세포의 용도.
PCT/KR2022/017855 2021-11-22 2022-11-14 자연살해세포-특이적 키메릭항원수용체 및 이의 용도 WO2023090780A1 (ko)

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
KR10-2021-0161425 2021-11-22
KR20210161425 2021-11-22
KR1020220149000A KR20230077650A (ko) 2021-11-22 2022-11-09 자연살해세포-특이적 키메릭항원수용체 및 이의 용도
KR10-2022-0149000 2022-11-09

Publications (1)

Publication Number Publication Date
WO2023090780A1 true WO2023090780A1 (ko) 2023-05-25

Family

ID=86397481

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/017855 WO2023090780A1 (ko) 2021-11-22 2022-11-14 자연살해세포-특이적 키메릭항원수용체 및 이의 용도

Country Status (1)

Country Link
WO (1) WO2023090780A1 (ko)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150038684A1 (en) * 2012-02-13 2015-02-05 Seattle Children's Hospital (dba Seattle Children's Research Institute) Bispecific chimeric antigen receptors and therapeutic uses thereof
KR20180081010A (ko) * 2017-01-05 2018-07-13 한국생명공학연구원 항-코티닌 키메릭 항원 수용체를 발현하는 자연살해 세포
KR20200115358A (ko) * 2019-03-28 2020-10-07 한국생명공학연구원 Car 유전자가 도입된 nk 세포의 제조방법 및 그의 용도

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20150038684A1 (en) * 2012-02-13 2015-02-05 Seattle Children's Hospital (dba Seattle Children's Research Institute) Bispecific chimeric antigen receptors and therapeutic uses thereof
KR20180081010A (ko) * 2017-01-05 2018-07-13 한국생명공학연구원 항-코티닌 키메릭 항원 수용체를 발현하는 자연살해 세포
KR20200115358A (ko) * 2019-03-28 2020-10-07 한국생명공학연구원 Car 유전자가 도입된 nk 세포의 제조방법 및 그의 용도

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
GONG YING, KLEIN WOLTERINK ROEL G. J., WANG JIANXIANG, BOS GERARD M. J., GERMERAAD WILFRED T. V.: "Chimeric antigen receptor natural killer (CAR-NK) cell design and engineering for cancer therapy", JOURNAL OF HEMATOLOGY & ONCOLOGY, vol. 14, no. 1, 1 December 2021 (2021-12-01), XP055978991, DOI: 10.1186/s13045-021-01083-5 *
YE LI, HERMANSON DAVID L., MORIARITY BRANDEN S., KAUFMAN DAN S.: "Human iPSC-Derived Natural Killer Cells Engineered with Chimeric Antigen Receptors Enhance Anti-tumor Activity", CELL STEM CELL, ELSEVIER, CELL PRESS, AMSTERDAM, NL, vol. 23, no. 2, 1 August 2018 (2018-08-01), AMSTERDAM, NL , pages 181 - 192, XP055700643, ISSN: 1934-5909, DOI: 10.1016/j.stem.2018.06.002 *

Similar Documents

Publication Publication Date Title
WO2019182425A1 (ko) 신규 키메라 항원 수용체 암호화 유전자가 형질도입된 유전자 변형 nk 세포주 및 그의 용도
WO2018044105A1 (ko) 항체 중쇄불변부위 이종이중체 (heterodimeric Fc)에 융합된 IL-21 (heterodimeric Fc-fused IL-21) 및 이를 포함하는 약제학적 조성물
WO2021256724A1 (ko) Bcma를 표적으로 하는 키메라 항원 수용체 및 이의 용도
WO2020032784A1 (ko) Hla-dr에 결합하는 키메라 항원 수용체 및 car-t 세포
WO2017030370A1 (ko) 항-코티닌 항체가 연결된 키메라 항체 수용체 및 이의 용도
WO2020153605A1 (ko) 메소텔린 특이적인 키메라 항원 수용체 및 이를 발현하는 t 세포
WO2018056736A1 (ko) 신규 자연살해 세포주 및 그의 용도
WO2020101361A1 (ko) 형질전환된 t세포를 이용한 제대혈 유래 자연살해세포의 배양방법
WO2021066420A1 (ko) Cd138에 특이적으로 결합하는 키메릭 항원 수용체, 이를 발현하는 면역세포 및 이의 항암 용도
WO2023277361A1 (ko) 메소텔린 특이적 항체 및 이의 용도
WO2022218226A1 (zh) 工程化免疫细胞及其用途
WO2022025638A1 (ko) 면역시냅스를 안정화시키는 키메라 항원 수용체(car) t 세포
WO2022231032A1 (ko) 항-cntn4 특이적 항체 및 그의 용도
WO2021153979A1 (ko) 항-taa 항체, 항-pd-l1 항체 및 il-2를 포함하는 융합단백질 및 이의 용도
WO2024076121A1 (ko) Cd5를 표적하는 키메라 항원 수용체 및 이를 발현하는 면역세포
WO2023090780A1 (ko) 자연살해세포-특이적 키메릭항원수용체 및 이의 용도
WO2016126071A1 (ko) 키메릭 항원 수용체 전달용 ctla-4 타겟팅 트랜스-스플라이싱 라이보자임 및 이의 용도
WO2022231298A1 (ko) 신규한 항-cd5 키메릭 항원 수용체 및 이를 발현하는 면역세포
WO2022250440A1 (ko) Erbb3 특이적인 키메라 항원 수용체 및 이를 발현하는 면역세포 치료제
WO2023022271A1 (ko) 항-igsf1 항체 및 이의 용도
CN111212849A (zh) 用于癌症的过继性细胞疗法的组合物和方法
WO2020117004A1 (ko) 인간 항-antxr 키메라 항원 수용체 및 이의 용도
WO2018128486A1 (ko) Ceacam6에 특이적으로 결합하는 항-ceacam6 키메릭 항원 수용체
WO2023249463A1 (ko) 면역관문 제어 인자를 발현하는 면역세포 및 이의 용도
WO2021172690A1 (ko) 메소텔린 특이적인 키메라 항원 수용체 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22895986

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 18712346

Country of ref document: US

NENP Non-entry into the national phase

Ref country code: DE