WO2022250440A1 - Erbb3 특이적인 키메라 항원 수용체 및 이를 발현하는 면역세포 치료제 - Google Patents

Erbb3 특이적인 키메라 항원 수용체 및 이를 발현하는 면역세포 치료제 Download PDF

Info

Publication number
WO2022250440A1
WO2022250440A1 PCT/KR2022/007396 KR2022007396W WO2022250440A1 WO 2022250440 A1 WO2022250440 A1 WO 2022250440A1 KR 2022007396 W KR2022007396 W KR 2022007396W WO 2022250440 A1 WO2022250440 A1 WO 2022250440A1
Authority
WO
WIPO (PCT)
Prior art keywords
erbb3
chimeric antigen
antigen receptor
cells
seq
Prior art date
Application number
PCT/KR2022/007396
Other languages
English (en)
French (fr)
Inventor
김태돈
이수연
홍승범
Original Assignee
한국생명공학연구원
주식회사 이수앱지스
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 한국생명공학연구원, 주식회사 이수앱지스 filed Critical 한국생명공학연구원
Publication of WO2022250440A1 publication Critical patent/WO2022250440A1/ko

Links

Images

Classifications

    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/461—Cellular immunotherapy characterised by the cell type used
    • A61K39/4613—Natural-killer cells [NK or NK-T]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/463—Cellular immunotherapy characterised by recombinant expression
    • A61K39/4631—Chimeric Antigen Receptors [CAR]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464402—Receptors, cell surface antigens or cell surface determinants
    • A61K39/464403—Receptors for growth factors
    • A61K39/464406—Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ ErbB4
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70517—CD8
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/70521—CD28, CD152
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09—Recombinant DNA-technology
    • C12N15/11—DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/62—DNA sequences coding for fusion proteins
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • C12N5/0602—Vertebrate cells
    • C12N5/0634—Cells from the blood or the immune system
    • C12N5/0646—Natural killers cells [NK], NKT cells
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00—Genetically modified cells

Definitions

  • the present invention relates to an ErbB3 (Receptor Tyrosine-protein Kinase ErbB3) specific chimeric antigen receptor, an immune cell comprising the same, and a use thereof.
  • the chimeric antigen receptor according to the present invention exhibits excellent affinity and binding ability to ErbB3, and immune cells expressing the chimeric antigen receptor have excellent cytotoxicity to cancer cells expressing ErbB3, which is useful in immune cell therapy for cancer treatment. can be useful
  • T cells are cells that play an important role in mediating adaptive immunity. T cells are activated through stimulation of antigen-recognizing receptors (T cell receptor, TCR), co-stimulatory molecules, and cytokines. In addition, the TCR of T cells induces an immune response through major histocompatibility complex (MHC molecules) combined with an antigen, and cancer cells suppress the expression of MHC molecules as a mechanism to evade the immune response. Immune cell therapy (adoptive immune therapy, adoptive cellular therapy) is being developed using these characteristics of T cells.
  • T cell receptor T cell receptor
  • MHC molecules major histocompatibility complex
  • Anticancer therapy development using immune cells has been developed centering on T cells, and as in vitro culture and proliferation of tumor antigen-specific T cells have become possible, anticancer T cell therapy has shown tangible results (Gattinoni L, et al. , Nat Rev Immunol. 2006;6(5):383-93).
  • the number of tumor antigen-specific T cells present in the patient's body is very small, it takes a long period of one month or more to secure sufficient T cells by in vitro proliferation of these T cells.
  • a chimeric antigen receptor chimeric antigen receptor
  • the CAR protein is designed in such a way that the variable region (single chain variable fragment; scFv) of an antibody that recognizes a cancer antigen is connected to the intracellular signaling domain through a spacer region (extracellular hinge + transmembrane domain).
  • the intracellular signaling domain is mainly based on the intracellular signaling domain of the CD3 zeta chain, which is the signaling subunit of the T cell receptor (1st generation CAR), and is a co-stimulatory molecule that promotes the growth and differentiation of T cells. It has evolved in the form of adding an intracellular signaling domain of .
  • CAR-T cell therapies use the intracellular signaling domains of CD28 and 4-1BB co-stimulatory molecules, respectively (second-generation CARs), followed by CD28 and 4-1BB intracellular
  • second-generation CARs second-generation CARs
  • a CAR (3rd generation CAR) containing a signaling domain at the same time is being attempted (van der Stegen SJ, etal., Nat Rev Drug Discov. 2015;14(7):499-509).
  • ErbB3 is a member of the ErbB/HER family of receptor tyrosine kinases (RTKs).
  • RTKs receptor tyrosine kinases
  • Other members of this group include EGFR (also known as ErbB1 or HER1), ErbB2 (also known as HER2 or HER2/Neu), and ErbB4 (also known as HER4).
  • ErbB receptors regulate cell proliferation, survival and differentiation by activating intracellular signaling cascades leading to alterations in gene expression. ErbB3 has been found to be overexpressed in various cancer types including breast, gastrointestinal and pancreatic cancers.
  • the present inventors developed a chimeric antigen receptor containing an scFv that specifically targets cancer cell-ErbB3, confirmed that immune cells expressing the scFv exhibit excellent anticancer effects, and completed the present invention.
  • An object of the present invention is to provide a novel chimeric antigen receptor that exhibits a high anticancer effect against cancer expressing ErbB3 and immune cells containing the same.
  • Another object of the present invention is to provide a nucleic acid encoding the chimeric antigen receptor, an expression vector containing the nucleic acid, and a virus containing the expression vector.
  • Another object of the present invention is to provide a composition for treating cancer comprising the immune cells, a method for treating cancer using the immune cells, a use of the immune cells for treating cancer, and a use of the immune cells for preparing a drug for treating cancer. is to provide
  • the present invention provides an extracellular domain including an antigen binding site that specifically binds to ErbB3 (Receptor Tyrosine-protein Kinase ErbB3) (extracellular binding domain); transmembrane domain; And a chimeric antigen receptor (CAR) comprising an intracellular signaling domain.
  • ErbB3 Receptor Tyrosine-protein Kinase ErbB3
  • extracellular binding domain transmembrane domain
  • CAR chimeric antigen receptor
  • the present invention also provides a nucleic acid encoding the chimeric antigen receptor, an expression vector containing the nucleic acid, a virus containing the expression vector, and an immune cell expressing the chimeric antigen receptor.
  • the present invention also provides a composition for treating cancer comprising the immune cells, a method for treating cancer using the immune cells, a use of the immune cells for treating cancer, and a use of the immune cells for preparing a drug for treating cancer. .
  • Figure 2 shows the results of establishing an NK92 cell line expressing ErbB3-CAR.
  • Figure 3a shows the results of screening cancer cell lines expressing ErbB3.
  • Figure 3b shows the results of confirming the cytotoxicity of each ErbB3-CAR NK92 to ErbB3-expressing cancer cells.
  • 5a shows the result of confirming the amount of IFN-r secretion in CAR NK92 cells co-cultured with cancer cells expressing ErbB3.
  • Figure 5b shows the results of confirming degranulation in CAR NK92 cells co-cultured with cancer cells expressing ErbB3.
  • Figure 6 shows the results confirming the efficacy of CAR NK92 at the single cell level.
  • Figure 7b shows the results of selecting cancer cell lines satisfying all of the targets of each CAR NK92.
  • Figure 7c shows the results of comparing the cytotoxicity of each CAR NK92 cells.
  • Figure 8b shows the results of confirming the NK92 cell line expressing CD16.
  • Figure 8c shows the results of measuring ADCC using ErbB3 ScFv.
  • 9B shows the NK92 cell line (442S1 vs. LJM716) expressing ErbB3-CAR.
  • Figure 9c shows the result of comparing the cytotoxicity (442S1 vs. LJM716) of ErbB3-CAR NK92.
  • 5 types of ErbB3 ScFv (442S1, 451M3, 472S2, 446, 464) that specifically bind to ErbB3 expressed in cancer cells are each used as the ectodomain of a chimeric antigen receptor (CAR).
  • CAR construct was constructed using In addition, it was designed to express myc and hinge in the external domain to confirm that CAR is expressed on the cell surface through myc, and the internal domain is a signaling domain with CD3-zeta and a costimulatory molecule.
  • a third-generation CAR was constructed by adding CD28 and DAP10.
  • the present invention provides an extracellular domain comprising an antigen binding site that specifically binds to ErbB3 (extracellular binding domain); transmembrane domain; And a chimeric antigen receptor (CAR) comprising an intracellular signaling domain.
  • extracellular domain comprising an antigen binding site that specifically binds to ErbB3 (extracellular binding domain); transmembrane domain; And a chimeric antigen receptor (CAR) comprising an intracellular signaling domain.
  • CAR chimeric antigen receptor
  • CAR Chomeric antigen receptor
  • CARs include an extracellular domain, a transmembrane domain and an intracellular signaling domain.
  • Cancer cells can be killed by introducing a gene encoding a receptor that recognizes a cancer cell surface antigen that is specifically expressed on the surface of cancer cells into immune cells. Through immune cells containing receptors that bind to antigens specifically expressed in cancer cells, an immune response can be induced by targeting only cancer cells.
  • the first-generation CAR included an extracellular domain containing an antigen recognition site specifically expressed in cancer cells, a transmembrane domain, and an intracellular signaling domain, and only CD3 ⁇ was used as the signaling domain, but the therapeutic effect on cancer was insignificant. However, there was a problem that the duration was short.
  • a second-generation CAR combining a co-stimulatory domain (CD28 or CD137/4-1BB) and CD3 ⁇ was prepared. Compared to the first-generation CAR, the number of immune cells containing the CAR remaining in the body significantly increased. . While the second-generation CAR used one costimulatory domain, the third-generation CAR used two or more costimulatory domains.
  • the co-stimulatory domain may be combined with 4-1BB, CD28 or OX40 to achieve the expansion and persistence of immune cells including the CAR in vivo.
  • cytokines such as IL-12 or IL-15 are included so that CAR-based immune proteins of cytokines can be additionally expressed, and the 5th generation CAR contains interleukins to enhance immune cells. further comprising a receptor chain such as IL-2R ⁇ .
  • extracellular binding domain refers to a portion of a CAR including an antigen binding domain having the ability to specifically bind to a desired target antigen.
  • An extracellular binding domain is any protein that retains the ability to specifically recognize and bind to a biological molecule (eg, a cell surface receptor or tumor protein, lipid, polysaccharide, or other cell surface targeting molecule, or component thereof); may include polypeptides, oligopeptides or peptides.
  • a binding domain includes any naturally occurring, synthetic, semisynthetic or recombinantly produced binding partner for a biological molecule of interest.
  • affinity can be defined as the equilibrium dissociation constant (Kd) of a particular binding interaction having units of M (eg, 10 ⁇ 5 M to 10 ⁇ 13 M or less).
  • the affinity of the extracellular binding domains and CARs according to the invention can be measured using conventional techniques, such as competition ELISA (Enzyme-Linked Immunosorbent Assay) or labeled ligands or using Biacore T100 (Pisces, N.J.) surface-plasmon resonance devices such as Cataway (available from Biacore Inc.) or coupling using optical biosensor technology such as EnSpire or the EPIC system available from Corning and Perkin Elmer, respectively. It can be easily measured by association or displacement analysis.
  • the binding domain specifically binding to ErbB3 may be an anti-ErbB3 antibody or an antigen binding fragment thereof.
  • the binding domain specifically binding to ErbB3 is a heavy chain CDR1 selected from the group consisting of SEQ ID NOs: 1, 9, 17, 25 and 33;
  • Heavy chain CDR2 selected from the group consisting of SEQ ID Nos: 2, 10, 18, 26, 34,
  • a heavy chain CDR3 selected from the group consisting of SEQ ID NOs: 3, 11, 19, 27, and 35;
  • a light chain CDR1 selected from the group consisting of SEQ ID NOs: 4, 12, 20, 28 and 36;
  • a light chain CDR2 selected from the group consisting of SEQ ID Nos: 5, 13, 21, 29 and 37, and
  • It may be a single chain variable fragment (scFv) of an anti-ErbB3 antibody comprising a light chain CDR3 selected from the group consisting of SEQ ID NOs: 6, 14, 22, 30 and 38.
  • scFv single chain variable fragment
  • the antibody or antigen-binding fragment thereof that binds to ErbB3 comprises a heavy chain CDR1 comprising the sequence of SEQ ID NO: 1, a heavy chain CDR2 comprising the sequence of SEQ ID NO: 2, a heavy chain CDR3 comprising the sequence of SEQ ID NO: 3, a light chain CDR1 comprising the sequence of SEQ ID NO: 4, a light chain CDR2 comprising the sequence of SEQ ID NO: 5, and a light chain CDR3 comprising the sequence of SEQ ID NO: 6;
  • the heavy chain CDR1 comprising the sequence of SEQ ID NO: 9, the heavy chain CDR2 comprising the sequence of SEQ ID NO: 10, the heavy chain CDR3 comprising the sequence of SEQ ID NO: 11, the light chain CDR1 comprising the sequence of SEQ ID NO: 12, and the sequence of SEQ ID NO: 13 a light chain CDR2 comprising, a light chain CDR3 comprising the sequence of SEQ ID NO: 14;
  • the heavy chain CDR1 comprising the sequence of SEQ ID NO: 17, the heavy chain CDR2 comprising the sequence of SEQ ID NO: 18, the heavy chain CDR3 comprising the sequence of SEQ ID NO: 19, the light chain CDR1 comprising the sequence of SEQ ID NO: 20, and the sequence of SEQ ID NO: 21 a light chain CDR2 comprising, a light chain CDR3 comprising the sequence of SEQ ID NO: 22;
  • heavy chain CDR1 comprising the sequence of SEQ ID NO: 25
  • heavy chain CDR2 comprising the sequence of SEQ ID NO: 26
  • heavy chain CDR3 comprising the sequence of SEQ ID NO: 27
  • light chain CDR1 comprising the sequence of SEQ ID NO: 28
  • SEQ ID NO: 29 light chain CDR2 comprising the sequence, light chain CDR3 comprising the sequence of SEQ ID NO: 30;
  • the heavy chain CDR1 comprising the sequence of SEQ ID NO: 33
  • the heavy chain CDR2 comprising the sequence of SEQ ID NO: 34
  • the heavy chain CDR3 comprising the sequence of SEQ ID NO: 35
  • the light chain CDR1 comprising the sequence of SEQ ID NO: 36
  • the sequence of SEQ ID NO: 37 and a light chain CDR3 comprising the sequence of SEQ ID NO: 38.
  • the "antibody” refers to an anti-ErbB3 antibody that specifically binds to ErbB3.
  • the scope of the present invention includes not only complete antibody forms that specifically bind to ErbB3, but also antigen-binding fragments of the antibody molecules.
  • antibody variable domain refers to the light and heavy chain portions of an antibody molecule that include the amino acid sequences of the complementarity determining regions (CDRs; ie, CDR1, CDR2, and CDR3), and framework regions (FR). .
  • CDRs complementarity determining regions
  • FR framework regions
  • VH refers to the variable domain of the heavy chain.
  • VL refers to the variable domain of the light chain.
  • CDRs complementarity determining regions
  • Each variable domain typically has three CDR regions identified as CDR1, CDR2 and CDR3.
  • a complete antibody has a structure having two full-length light chains and two full-length heavy chains, and each light chain is linked to the heavy chain by disulfide bonds.
  • the heavy chain constant region has gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ), and epsilon ( ⁇ ) types, and subclasses include gamma 1 ( ⁇ 1), gamma 2 ( ⁇ 2), and gamma 3 ( ⁇ 3). ), gamma4 ( ⁇ 4), alpha1 ( ⁇ 1) and alpha2 ( ⁇ 2).
  • the constant region of the light chain has kappa ( ⁇ ) and lambda ( ⁇ ) types.
  • fragment of an antibody refers to a fragment having an antigen-binding function, and is used in the sense of including scFv, Fab, F(ab') 2 and Fv fragments.
  • Fab has a structure having light chain and heavy chain variable regions, light chain constant region, and heavy chain first constant region (CH1), and has one antigen binding site.
  • Fab' differs from Fab in that it has a hinge region containing one or more cysteine residues at the C-terminus of the heavy chain CH1 domain.
  • An F(ab')2 antibody is produced by forming a disulfide bond between cysteine residues in the hinge region of Fab'.
  • Fv is a minimal antibody fragment having only a heavy chain variable region and a light chain variable region.
  • the heavy chain variable region and the light chain variable region are connected by a non-covalent bond
  • the heavy chain variable region and the light chain variable region are generally connected through a peptide linker. They are covalently linked or directly linked at the C-terminus, so that they can form a dimer-like structure like double-chain Fv.
  • Such antibody fragments can be obtained using proteolytic enzymes (for example, restriction digestion of whole antibodies with papain yields Fab, and digestion with pepsin yields F(ab')2 fragments), gene It can also be produced through recombinant technology.
  • a “single-chain Fv” or “scFv” antibody fragment comprises the VH and VL domains of an antibody, which domains are present in a single polypeptide chain.
  • the Fv polypeptide may further include a polypeptide linker between the VH and VL domains that allows the scFv to form a desired structure for antigen binding.
  • VH and VL in scFv including the heavy chain variable region (VH) and light chain variable region (VL) of an antibody may be connected through a linker.
  • the binding domain specifically binding to ErbB3 is an anti-ErbB3 antibody comprising a heavy chain variable region comprising a sequence selected from the group consisting of SEQ ID NOs: 7, 15, 23, 31 and 39 It may be a single chain variable fragment (scFv).
  • the binding domain specifically binding to ErbB3 is a single chain variable fragment of an anti-ErbB3 antibody comprising a light chain variable region comprising a sequence selected from the group consisting of SEQ ID NOs: 8, 16, 24, 32 and 40. fragment; scFv).
  • the antibody or antigen-binding fragment thereof that binds to ErbB3 includes a heavy chain variable region comprising the sequence of SEQ ID NO: 7, a light chain variable region comprising the sequence of SEQ ID NO: 8, a heavy chain variable region comprising the sequence of SEQ ID NO: 15, and SEQ ID NO: A light chain variable region comprising the sequence of SEQ ID NO: 16, a heavy chain variable region comprising the sequence of SEQ ID NO: 23, a light chain variable region comprising the sequence of SEQ ID NO: 24, a heavy chain variable region comprising the sequence of SEQ ID NO: 31, SEQ ID NO: 32 It may include a light chain variable region comprising the sequence, a heavy chain variable region comprising the sequence of SEQ ID NO: 39, or a light chain variable region comprising the sequence of SEQ ID NO: 40.
  • the antibody or antibody fragment of the present invention may include not only the sequence of the anti-ErbB3 antibody of the present invention described herein, but also a biological equivalent thereof, within the scope of specifically recognizing ErbB3.
  • additional changes may be made to the amino acid sequence of the antibody to further improve its binding affinity and/or other biological properties.
  • modifications include, for example, deletions, insertions and/or substitutions of residues in the amino acid sequence of the antibody.
  • amino acid variations are made based on the relative similarity of amino acid side chain substituents, such as hydrophobicity, hydrophilicity, charge, size, etc.
  • arginine, lysine and histidine are all positively charged residues; Alanine, glycine and serine have similar sizes; It can be seen that phenylalanine, tryptophan and tyrosine have similar shapes. Accordingly, based on these considerations, arginine, lysine and histidine; alanine, glycine and serine; And phenylalanine, tryptophan and tyrosine are biologically functional equivalents.
  • the antibodies of the present invention or the nucleic acid molecules encoding them are construed to include sequences showing substantial identity with the sequences described in SEQ ID NOs.
  • the above substantial identity is at least 90% when the sequence of the present invention and any other sequence described above are aligned so as to correspond as much as possible, and the aligned sequence is analyzed using an algorithm commonly used in the art. It refers to sequences exhibiting homology, most preferably at least 95% homology, 96% or more, 97% or more, 98% or more, 99% or more homology. Alignment methods for sequence comparison are known in the art.
  • the NCBI Basic Local Alignment Search Tool (BLAST) is accessible from NBCI, etc., and can be used in conjunction with sequence analysis programs such as blastp, blasm, blastx, tblastn, and tblastx on the Internet.
  • the BLAST is accessible at www.ncbi.nlm.nih.gov/BLAST/.
  • a sequence homology comparison method using this program can be found at www.ncbi.nlm.nih.gov/BLAST/blast_help.html.
  • an antibody or antigen-binding fragment thereof of the present invention is 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% as compared to the specified sequence described herein or entirely. , 99%, or greater homology.
  • homology can be determined by sequence comparison and/or alignment by methods known in the art. For example, a sequence comparison algorithm (ie, BLAST or BLAST 2.0), manual alignment, or visual inspection can be used to determine the percent sequence homology of a nucleic acid or protein of the invention.
  • the linker may be a peptide linker and may have a length of about 10-25 aa.
  • hydrophilic amino acids such as glycine and/or serine may be included.
  • the linker may include, for example, (GS) n , (GGS) n , (GSGGS) n or (G n S) m (n and m are each 1 to 10), for example (G n S) m (n and m are each 1 to 10), but is not limited thereto.
  • the chimeric antigen receptor may be characterized in that it includes a transmembrane domain.
  • the "transmembrane domain” is a part of the CAR that fuses the extracellular binding portion and the intracellular signaling domain and anchors the CAR to the plasma membrane of immune effector cells.
  • Transmembrane domains can be from natural, synthetic, semisynthetic or recombinant sources.
  • the transmembrane domain is the alpha ( ⁇ ), beta ( ⁇ ) or zeta ( ⁇ ) chain of the T-cell receptor (TCR), CD28, CD3 epsilon ( ⁇ ), CD45, CD4, CD5, CD8, It may be selected from the group consisting of CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 and CD154, but is not limited thereto.
  • the transmembrane domain may be attached to the extracellular binding domain of the CAR via a linker.
  • the linker may be a short oligo- or polypeptide linker of 2 to 10 amino acids in length, preferably a glycine (G)-serine (S) doublet, but is not limited thereto. .
  • the binding domain of a CAR is usually followed by one or more “hinge domains”.
  • the extracellular domain may additionally include a signal peptide (SP) and/or a hinge together with a binding domain that specifically binds to ErbB3.
  • SP signal peptide
  • the extracellular domain is a domain through which a main signal is transmitted and exists outside the cell membrane and is a domain for specifically recognizing a target, that is, ErbB3.
  • hinge domain refers to an important role in positioning an extracellular binding domain containing an antigen binding site away from the effector cell surface to enable proper cell/cell contact, antigen binding and activation. It is part of the CAR in charge.
  • CARs generally include one or more hinge domains between the extracellular binding domain and the transmembrane domain. Hinge domains may be derived from natural, synthetic, semi-synthetic or recombinant sources. A hinge domain may comprise the amino acid sequence of a naturally occurring immunoglobulin hinge region or an altered immunoglobulin hinge region.
  • “Altered hinge region” refers to (a) a naturally occurring hinge region with up to 30% amino acid change (e.g., amino acid substitutions or deletions of up to 25%, 20%, 15%, 10% or 5%), (b) up to of at least 10 amino acids (e.g., at least 12, 13, 14, or 15 amino acids) in length with 30% amino acid changes (e.g., amino acid substitutions or deletions of up to 25%, 20%, 15%, 10%, or 5%) part of a naturally occurring hinge region, or (c) a core hinge region (which is 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15, or at least 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in length).
  • a core hinge region which is 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15, or at least 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15 amino acids in length.
  • one or more cysteine residues in a naturally occurring immunoglobulin hinge region may be substituted with one or more other amino acid residues (eg, one or more serine residues).
  • the altered immunoglobulin hinge region may alternatively or additionally have the proline residues of the wild-type immunoglobulin hinge region substituted with another amino acid residue (eg, a serine residue).
  • Hinge domains include hinge regions derived from the extracellular regions of type 1 membrane proteins such as CD8, CD4, CD28 and CD7, which can be wild-type hinge regions from these molecules or can be varied.
  • any transmembrane domain including the hinge domain may be used as long as it is capable of connecting the extracellular domain and the intracellular signaling domain between cell membranes. It may preferably consist of a hinge domain and a transmembrane domain derived from CD8, but is not limited thereto.
  • binding domain and the transmembrane domain may be linked by a spacer domain.
  • the spacer domain may be a hinge domain.
  • the spacer domain may include a CD28-derived hinge domain and/or a CD8-derived hinge domain, and may include all or part of the CD28-derived hinge domain and/or CD8-derived hinge domain.
  • the hinge region or spacer region of the present invention may be one or more selected from the Myc epitope, the CD8 hinge region, and Fc, and may preferably include the Myc epitope and the CD8 hinge region.
  • the Myc epitope and CD8 hinge region of the present invention function as a linking domain (spacer).
  • the CD8 hinge region of the present invention may include the sequence of GVTVSSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLD (SEQ ID NO: 41).
  • the Myc epitope may include the sequence of ANNKNSSQKRI (SEQ ID NO: 42).
  • the chimeric antigen receptor may be characterized in that it includes an intracellular signaling domain.
  • the intracellular signaling domain is a part located inside the cell membrane of immune cells, that is, in the cytoplasm, and when the binding domain included in the extracellular domain binds to a target antigen, it transmits a signal within the cell to the immune cell refers to the site that activates the immune response of
  • the intracellular signaling domain may include an intracellular signaling domain and/or a co-stimulatory signaling domain.
  • the signaling domain may induce activation of the normal effector function of the immune cell in which the CAR is located.
  • cytolytic activation or helper activation can be induced through secretion of cytokines.
  • the signal transduction domain may comprise a truncated fragment of an intracellular signaling domain sufficient to transduce an effector function signal.
  • the intracellular signaling domain is T-cell receptor (TCR) zeta ( ⁇ ), FcR gamma ( ⁇ ), FcR beta ( ⁇ ), CD3 gamma ( ⁇ ), CD3 delta ( ⁇ ), CD3 epsilon ( ⁇ ), CD3 a primary signaling domain selected from the group consisting of zeta ( ⁇ ), CD5, CD22, CD79a, CD79b and CD66d; and/or CD2, CD7, CD27, CD28, CD30, CD40, 4-1BB (CD137), OX40 (CD134), CDS, ICAM-1, ICOS (CD278), LFA-1 (CD11a/CD18), GITR, MyD88 , DAP10, DAP12, PD-1, LIGHT, NKG2C, B7-H3, and a co-stimulatory signaling domain selected from the group consisting of ligands that specifically bind to CD83.
  • TCR T-cell receptor
  • zeta ⁇
  • FcR gamma
  • intracellular signaling domain refers to effector cell functions such as activation, including release of cytotoxic factors for CAR-bound target cells, cytokine production, proliferation and refers to the portion of a CAR that is involved in the delivery of messages of effective CAR binding to a target antigen into the interior of immune effector cells to elicit cytotoxic activity or other cellular responses triggered by antigen binding to the CAR's extracellular binding domain.
  • An effector function refers to a specific function of a cell, for example, an effector function of an immune cell may be a cytolytic activity, or may support or be active an activity involving the secretion of cytokines.
  • an intracellular signaling domain refers to a portion of a protein that transmits effector signals and directs a cell to perform a specific function.
  • Immune cell activation is mediated by two different classes of intracellular signaling domains.
  • immune cell activation is mediated by a primary signaling domain that initiates an antigen-dependent primary activation and a costimulatory signaling domain that acts in an antigen-independent manner to provide a secondary signal.
  • the intracellular signaling domain may include a "primary signaling domain” and a "co-stimulatory signaling domain”.
  • primary signaling domain refers to a signaling domain that regulates immune cell activation in a stimulating or inhibiting manner.
  • Primary signaling domains that act in a stimulatory manner may contain signaling motifs known as immunoreceptor tyrosine-based activation motifs or ITAMs.
  • ITAM containing the primary signaling domain may be selected from the group consisting of TCR ⁇ , FcR ⁇ , FcR ⁇ , CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , CD5, CD22, CD79a, CD79b and CD66d, but is not limited thereto.
  • the primary signaling domain may preferably be characterized in that CD3 ⁇ (zeta) comprising the amino acid sequence represented by SEQ ID NO: 9, but is not limited thereto.
  • CD3 ⁇ (zeta) may comprise the sequence of RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 43).
  • co-stimulatory signaling domain refers to an intracellular signaling domain of a co-stimulatory molecule.
  • a costimulatory signaling region refers to a portion of a CAR comprising the intracellular signaling domain of a costimulatory molecule.
  • CD2 CD2, CD7, CD27, CD28, CD30, CD40, 4-1BB (CD137), OX40 (CD134), CDS, ICAM-1, ICOS (CD278), LFA-1 (CD11a/CD18), GITR, MyD88, DAP10, It may include a co-stimulatory signaling domain selected from the group consisting of DAP12, PD-1, LIGHT, NKG2C, B7-H3, and a ligand that specifically binds to CD83, but is not limited thereto. not.
  • the costimulatory molecule may be DAP10, but is not limited thereto.
  • DAP10 may include the sequence of LCARPRRSPAQEDGKVYINMPGRG (SEQ ID NO: 44).
  • the chimeric antigen receptor of the present invention uses DAP10 and CD3 zeta as intracellular signaling domains, thereby exhibiting an apoptotic effect on cancer cells with high NK cell activity.
  • the chimeric antigen receptor according to the present invention may be characterized by including two or more intracellular signaling domains, and in the case of including two or more intracellular signaling domains, the intracellular signaling domains may be connected in series with each other. have. Alternatively, they may be linked through an oligopeptide linker or polypeptide linker of 2 to 10 amino acids, and examples of such a linker sequence include a glycine-serine continuous sequence.
  • the linker may include, for example, (GS) n , (GGS) n , (GSGGS) n or (G n S) m (n and m are each 1 to 10), for example (G n S) m (n and m are each 1 to 10), but is not limited thereto.
  • the intracellular signaling domain may include at least one selected from the group consisting of a costimulatory signaling domain of CD28 or DAP10 and an intracellular signaling domain of CD3 zeta. It is not limited.
  • the chimeric antigen receptor may further include an immune function stimulating factor of immune cells, and the immune function stimulating factor of immune cells may be an interleukin signal sequence.
  • the interleukin signal sequence may induce IL-12, IL-8, or IL-2 expression, but is not limited thereto.
  • IL-7 or CCL19 may be exemplified as an immune function promoting factor of T cells among the immune cells.
  • a signal peptide may be additionally included in front of the scFv.
  • the nucleic acid encoding the chimeric antigen receptor may further include a nucleic acid encoding a signal peptide.
  • the signal peptide may be, for example, GM-CSF or CD8 ⁇ signal peptide. It may be CD8 alpha or mouse light kappa signal peptide, and in the case of CD8 alpha, the signal peptide of the present invention may include the sequence of MALPVTALLLPLALLLHAARP (SEQ ID NO: 45).
  • the chimeric antigen receptor may further include an interleukin receptor chain including a JAK binding motif and a STAT 3/5 association motif, and IL-2R ⁇ may be exemplified. It is not limited.
  • the present invention relates to a nucleic acid encoding the chimeric antigen receptor.
  • Nucleic acid is meant to comprehensively include DNA (gDNA and cDNA) and RNA molecules, and nucleotides, which are the basic structural units in nucleic acids, include not only natural nucleotides, but also analogs in which sugar or base sites are modified. .
  • the sequences of nucleic acids encoding the heavy and light chain variable regions of the present invention may be modified. Such modifications include additions, deletions, or non-conservative or conservative substitutions of nucleotides.
  • Nucleic acids (polynucleotides) encoding chimeric antigen receptors according to the present invention can be modified by codon optimization, which is due to codon degeneracy, and many nucleotide sequences encoding polypeptides or variant fragments thereof That it exists will be well understood by those skilled in the art. Some of these polynucleotides (nucleic acids) have minimal homology to the nucleotide sequence of any naturally occurring gene.
  • polynucleotides that are variable due to differences in codon usage are preferred, for example, polynucleotides (nucleic acids) optimized for codon selection in humans, primates and/or mammals.
  • the present invention relates to an expression vector containing the nucleic acid and a virus containing the expression vector.
  • vector refers to a nucleic acid molecule capable of transferring or transporting other nucleic acid molecules.
  • the transferred nucleic acid is generally linked to a vector nucleic acid molecule, eg, inserted into a vector nucleic acid molecule.
  • a vector may contain sequences that direct autonomous replication in a cell, or may contain sequences sufficient to permit integration into host cell DNA.
  • the vector may be selected from the group consisting of DNA, RNA, plasmid, lentivirus vector, adenovirus vector and retroviral vector, but is not limited thereto.
  • Vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence.
  • the nucleic acid encoding the antibody is operably linked to a promoter.
  • “Operably linked” means a functional linkage between a nucleic acid expression control sequence (eg, a promoter, signal sequence, or array of transcriptional regulator binding sites) and another nucleic acid sequence, whereby the control sequence is linked to the other nucleic acid. It will regulate the transcription and/or translation of the sequence.
  • a nucleic acid expression control sequence eg, a promoter, signal sequence, or array of transcriptional regulator binding sites
  • a strong promoter capable of promoting transcription e.g., tac promoter, lac promoter, lacUV5 promoter, lpp promoter, pL ⁇ promoter, pR ⁇ promoter, rac5 promoter, amp promoter, recA promoter, SP6 promoter, trp promoter and T7 promoter, etc.
  • a ribosome binding site for initiation of translation e.g., amp promoter, recA promoter, SP6 promoter, trp promoter and T7 promoter, etc.
  • a promoter derived from the genome of a mammalian cell eg, metallotionine promoter, ⁇ -actin promoter, human hemoglobin promoter, and human muscle creatine promoter
  • mammalian Promoters derived from animal viruses such as adenovirus late promoter, vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus (CMV) promoter, tk promoter from HSV, mouse mammary tumor virus (MMTV) promoter, LTR promoter from HIV , the promoter of Moloney virus, the promoter of Epstein-Barr virus (EBV) and the promoter of Rousssarcoma virus (RSV) can be used, and usually has a polyadenylation sequence as a transcription termination sequence.
  • a mammalian Cell eg, metallotionine promoter, ⁇ -actin promoter, human hemoglobin promoter, and human muscle creatine promoter
  • mammalian Promoters derived from animal viruses such
  • vectors may be fused with other sequences to facilitate purification of antibodies expressed therefrom.
  • Sequences to be fused include, for example, glutathione S-transferase (Pharmacia, USA), maltose binding protein (NEB, USA), FLAG (IBI, USA) and 6x His (hexahistidine; Quiagen, USA).
  • the vector contains an antibiotic resistance gene commonly used in the art as a selectable marker, for example, for ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin and tetracycline. There is a resistance gene.
  • virus means a genetically modified virus to express the chimeric antigen receptor of the present invention for use in cancer treatment or the like.
  • To be genetically modified is to add foreign genetic material in the form of DNA or RNA to the total genetic material in a cell.
  • the nucleic acid or the vector is transfected or transfected with a virus.
  • a variety of techniques commonly used to introduce exogenous nucleic acids (DNA or RNA) into prokaryotic or eukaryotic host cells for "transfection” or “transfection”, such as electrophoresis, calcium phosphate precipitation; DEAE-dextran transfection or lipofection or the like can be used.
  • the present invention relates to an immune cell expressing the chimeric antigen receptor on its surface.
  • the immune cells can induce immunity to induce a desired cancer treatment effect, for example, T cells, NK cells, NKT cells, cytokine induced killer cells (Cytokine Induced Killer cells, CIK) , It may be selected from the group consisting of macrophages and dendritic cells, but is not limited thereto. Preferably, it can be characterized as a T cell.
  • immune cells expressing the chimeric antigen receptor are CAR-T cells (Chimeric Antigen Receptor T Cell), CAR-NK cells (Chimeric Antigen Receptor Natural Killer Cell), CAR-NKT cells (Chimeric Antigen Receptor Natural Killer Cell) T Cell) or CAR-macrophage (Chimeric Antigen Receptor Macrophage).
  • the T cells are cytotoxic T lymphocytes (Cytotoxic T lymphocyte; CTL); It may be characterized in that it is selected from the group consisting of T cells isolated from tumor infiltrating lymphocytes (TIL) and peripheral blood mononuclear cells (PBMC).
  • CAR-NK cells refer to cells into which a chimeric antigen receptor is introduced into natural killer (NK) cells.
  • NK natural killer
  • Reaction initiation of problems due to persistent toxicity, risk of autoimmune disease, problems of graft-versus-host disease (GVHD) and non-target toxicity problems of cancer immunotherapy using existing CAR-T therapeutics Not only can it be solved through an on/off switch, but it also has the advantage of being able to be used as a general-purpose treatment because it can target various cancer cells.
  • the present invention relates to a composition for treating cancer comprising immune cells (eg, T cells or NK cells) expressing the chimeric antigen receptor.
  • T cells include CD4 positive T cells; CD8 positive cytotoxic T lymphocyte (CTL); gamma-delta T cells; It may be characterized in that it is selected from the group consisting of T cells isolated from tumor infiltrating lymphocyte (TIL) and peripheral blood mononuclear cells (PBMC), but is not limited thereto.
  • cancer and “tumor” are used interchangeably and refer to or refer to a mammalian physiological condition typically characterized by unregulated cell growth/proliferation.
  • Cancer or carcinoma that can be treated with the composition of the present invention is not particularly limited, and includes both solid cancer and hematological cancer.
  • An example of such cancer may include breast cancer, but is not limited thereto.
  • the therapeutic composition of the present invention is a composition for the prevention or treatment of cancer, and the term of the present invention, “prevention” refers to any action that inhibits or delays the progression of cancer by administering the composition of the present invention, and “treatment” " means inhibition of the development of cancer, relief or elimination of symptoms.
  • the composition preferably includes, but is not limited to, the number of immune cells expressing the chimeric antigen receptor according to the present invention that is 1 to 10 times the number of tumor cells in the treatment subject.
  • a pharmaceutical composition containing immune cells expressing a chimeric antigen receptor according to the present invention may additionally include a pharmaceutically acceptable excipient.
  • excipients include surfactants, preferably polysorbate-based nonionic surfactants; buffers such as neutral buffered saline and human salt buffered saline; sugars or sugar alcohols such as glucose, mannose, sucrose or dextran, and mannitol; amino acids such as glycine and histidine, or proteins or polypeptides; antioxidants; chelating agents such as EDTA or glutathione; penetrant; adjuvants; and preservatives may be included, but are not limited thereto.
  • the pharmaceutical composition of the present invention contains 1 to 10 times the number of the immune cells (eg, T cells, or NK cells) within the treatment target within a single dose. it could be
  • compositions of the present invention may be formulated using methods known in the art to provide rapid, sustained or delayed release of the active ingredient after administration to a non-human mammal.
  • the dosage form may be in the form of a powder, granule, tablet, emulsion, syrup, aerosol, soft or hard gelatin capsule, sterile injectable solution, or sterile powder.
  • the pharmaceutical composition may be in various oral or parenteral formulations. When formulated, it is prepared using diluents or excipients such as commonly used fillers, extenders, binders, wetting agents, disintegrants, and surfactants.
  • Solid preparations for oral administration include tablets, pills, powders, granules, capsules, etc., and these solid preparations include at least one excipient in one or more compounds, for example, starch, calcium carbonate, sucrose or lactose ( lactose) and gelatin. In addition to simple excipients, lubricants such as magnesium stearate and talc are also used.
  • Liquid preparations for oral administration include suspensions, solutions for oral administration, emulsions, syrups, etc.
  • Formulations for parenteral administration include sterilized aqueous solutions, non-aqueous solvents, suspensions, emulsions, freeze-dried formulations, and suppositories.
  • Propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable esters such as ethyl oleate may be used as non-aqueous solvents and suspending agents.
  • As a base for suppositories witepsol, macrogol, tween 61, cacao butter, laurin paper, glycerogelatin, and the like may be used.
  • the present invention relates to a cancer treatment method comprising administering immune cells expressing the chimeric antigen receptor to a subject.
  • the present invention relates to the use of the immune cells for cancer treatment.
  • the present invention relates to the use of the immune cells for preparing a drug for the treatment of cancer.
  • the subject may be a mammal having a tumor, specifically a human, but is not limited thereto.
  • Immune cells expressing a chimeric antigen receptor or a composition containing the same according to the present invention can be administered by oral administration, infusion, intravenous injection, intramuscular injection, subcutaneous injection, or intraperitoneally. It may be administered by intraperitoneal injectoon, intrarectal administration, topical administration, intranasal injection, etc., but is not limited thereto.
  • the dosage of the active ingredient may be appropriately selected according to various factors such as the route of administration, age, sex, weight, and severity of the patient, and the therapeutic composition according to the present invention has the effect of preventing, improving or treating cancer symptoms. It can be administered in parallel with a known compound having.
  • Example 1 Construction of NK cells expressing a CAR with ErbB3 (HER3) ScFv as an ectodomain
  • a CAR construct was constructed using five ErbB3 ScFv candidates (442S1, 451M3, 472S2, 446, and 464) that specifically bind to ErbB3 (HER3) expressed in cancer cells as ectodomains of the CAR.
  • Each of the five CAR constructs was inserted into a lentiviral vector, a CAR-expressing lentivirus was constructed, and a CAR-expressing NK92 cell line was established using this (FIG. 2).
  • 3 types (442S1, 451M3, 472S2) with high cytotoxicity were selected among 5 types of ErbB3-CAR NK92 candidates, and cytotoxicity according to the ratio of CAR NK92 and cancer cells (Effector cell: Target cell; E:T ratio) was reconfirmed. It was confirmed that all three types of CAR NK92 showed cytotoxicity according to the E:T ratio in cancer cells expressing ErbB3, and cytotoxicity in cancer cells not expressing ErbB3 was similar to that of the control group (FIG. 4).
  • CAR NK92 targeting ErbB2 (HER2) of two types (Cot-CAR NK92; universal concept CAR; HER2-targeting mediator is used, HER2-CAR NK92) and ErbB3-CAR NK92, cells of 442S1 with the highest efficacy Toxicity was compared.
  • CAR expression was confirmed in each CAR NK92 cell (FIG. 7a), and cancer cells expressing all of the targets for each CAR NK92 were selected (FIG. 7b).
  • cytotoxicity of ErbB3-CAR NK92 (442S1) was significantly higher than that of other CAR NK92 (FIG. 7c).
  • ADCC Antibody-dependent cellular cytotoxicity
  • LJM716 third-party ErbB3 ScFv having the same target as the ErbB3 ScFv (442S1) used for the ectodomain of the ErbB3-CAR NK92.
  • Whether each ScFv binds to the corresponding cancer cells was confirmed using flow cytometry (FIG. 8a), and ADCC was performed using CD16-expressing NK92 (CD16+NK92) cells (FIG. 8b).
  • a CAR was constructed with a third-party ErbB3 ScFv (LJM716) to establish a CAR-expressing NK92 cell line, and the efficacy was compared with ErbB3-CAR NK92 (442S1). Except for the ectodomain of the CAR, the remaining constructs (transmembrane and endodomain) were prepared in the same structure (FIG. 9a), and an NK92 cell line expressing CAR was established using lentivirus (FIG. 9b).
  • ErbB3-CAR NK92 (442S1) exhibits specific anticancer efficacy against cancer cells expressing ErbB3 and has higher efficacy compared to the conventional ErbB3 ScFv (LJM716).
  • the chimeric antigen receptor according to the present invention exhibits excellent affinity and binding ability to ErbB3, and immune cells expressing the chimeric antigen receptor have excellent cytotoxicity to cancer cells expressing ErbB3, which is useful in immune cell therapy for cancer treatment. can be useful

Abstract

본 발명은 ErbB3 (Receptor Tyrosine-protein Kinase ErbB3) 특이적인 키메라 항원 수용체, 이를 포함하는 면역세포 및 이의 용도에 관한 것이다. 본 발명에 따른 키메라 항원 수용체는 ErbB3에 대한 우수한 친화도 및 결합력을 나타내며, 상기 키메라 항원 수용체를 발현하는 면역세포는 ErbB3을 발현하는 암세포에 대한 세포독성이 우수하여, 암 치료를 위한 면역세포 치료에 유용하게 사용될 수 있다.

Description

ERBB3 특이적인 키메라 항원 수용체 및 이를 발현하는 면역세포 치료제
본 발명은 ErbB3 (Receptor Tyrosine-protein Kinase ErbB3) 특이적인 키메라 항원 수용체, 이를 포함하는 면역세포 및 이의 용도에 관한 것이다. 본 발명에 따른 키메라 항원 수용체는 ErbB3에 대한 우수한 친화도 및 결합력을 나타내며, 상기 키메라 항원 수용체를 발현하는 면역세포는 ErbB3을 발현하는 암세포에 대한 세포독성이 우수하여, 암 치료를 위한 면역세포 치료에 유용하게 사용될 수 있다.
T 세포(T cells)는 적응성 면역반응(adaptive immunity)을 매개하는 중요한 역할을 하는 세포이다. T 세포는 항원을 인지할 수 있는 수용체(T cell receptor, TCR), 공자극인자(co-stimulatory molecules), 그리고 사이토카인(cytokines) 자극을 통해서 활성화된다. 또한, T 세포의 TCR은 항원과 결합된 MHC 분자(major histocompatibility complex, MHC molecules)를 통해 면역반응을 일으키는데, 암세포는 면역반응을 회피하기 위한 기전으로 MHC 분자의 발현을 억제한다. 면역세포 치료제(adoptive immune therapy, adoptive cellular therapy)는 T 세포의 이러한 특성을 이용하여 개발되고 있다.
면역세포를 이용한 항암치료법 개발은 T 세포를 중심으로 발전되어 왔으며, 종양항원 특이적 T 세포의 체외 배양 및 증식이 가능해지면서, 항암 T 세포치료법이 가시적인 성과를 보여왔다(Gattinoni L, et al., Nat Rev Immunol. 2006;6(5):383-93). 그러나, 환자 체내에 존재하는 종양항원특이적 T 세포의 숫자는 매우 적어서, 이들 T 세포를 체외 증식시켜 충분한 T 세포를 확보하는 데에는 한 달 이상의 긴 기간이 필요하다는 단점이 있었다.
이에, 치료용 항체 분야에서 축적된 재조합 항체 제작기술을 바탕으로, 암세포 표면에 발현하는 종양항원을 인지하는 재조합 항체와 T 세포 활성화를 유도하는 신호전달 도메인을 연결한 키메라 항원 수용체(chimeric antigen receptor; CAR) 유전자를 T 세포에 도입함으로써, 짧은 기간 내에 종양특이적 T 세포를 다량 확보하는 기술이 개발되었으며, 이들 T 세포는 CAR-T 세포라 명명되었다(Kershaw MH, et al., Nat Rev Immunol. 2005;5(12):928-40; Restifo NP, et al., Nat Rev Immunol. 2012;12(4):269-81).
CAR 단백질은 암항원을 인지하는 항체의 가변영역 (single chain variable fragment; scFv)이 연결부위(spacer region; extracellular hinge + transmembrane domain)를 통해 세포내 신호전달 도메인(intracellular signaling domain)에 연결된 형태로 디자인되어 있다(Dotti G, et al., Immunol Rev. 2014;257(1):107-26). 세포내 신호전달 도메인은 주로 T cell receptor의 신호전달 subunit인 CD3 zeta chain의 세포내 신호전달 도메인을 기본으로 하고 있으며(1세대 CAR), 여기에 T 세포의 성장 및 분화를 촉진하는 공동-자극 분자의 세포내 신호전달 도메인을 추가하는 형태로 진화되어 왔다. 예를 들면, 현재 시판되고 있는 두 종의 CAR-T 세포 치료제는 각각 CD28과 4-1BB 공자극 분자의 세포내 신호전달 도메인을 사용하고 있으며(2세대 CAR), 이후 CD28과 4-1BB 세포내 신호전달 도메인을 동시에 포함하는 CAR(3세대 CAR) 등이 시도되고 있다(van der Stegen SJ, etal., Nat Rev Drug Discov. 2015;14(7):499-509).
한편, ErbB3는 수용체 티로신 키나제(RTK)의 ErbB/HER 계열의 구성원이다. 이 그룹의 다른 구성원은 EGFR(ErbB1 또는 HER1로서도 공지됨), ErbB2(HER2 또는 HER2/Neu로서도 공지됨), 및 ErbB4(HER4로서도 공지됨)를 포함한다. ErbB 수용체는 유전자 발현시 변경을 유도하는 세포내 신호전달 캐스케이드(cascade)를 활성화시킴으로써 세포 증식, 생존 및 분화를 조절한다. ErbB3은 유방암, 위장암 및 췌장암을 포함하는 다양한 암 유형에서 과발현되는 것으로 밝혀졌다.
이러한 기술적 배경하에서, 본 발명자들은 암세포-ErbB3을 특이적으로 표적하는 scFv를 포함하는 키메라 항원 수용체를 개발하고, 이를 발현하는 면역세포가 우수한 항암 효과를 나타내는 것을 확인하고, 본 발명을 완성하였다.
본 배경기술 부분에 기재된 상기 정보는 오직 본 발명의 배경에 대한 이해를 향상시키기 위한 것이며, 이에 본 발명이 속하는 기술분야에서 통상의 지식을 가지는 자에게 있어 이미 알려진 선행기술을 형성하는 정보를 포함하지 않을 수 있다.
발명의 요약
본 발명의 목적은 ErbB3을 발현하는 암에 대한 높은 항암 효과를 나타내는 새로운 키메라 항원 수용체 및 이를 포함하는 면역세포를 제공하는 데 있다.
본 발명의 다른 목적은 상기 키메라 항원 수용체를 코딩하는 핵산, 상기 핵산을 포함하는 발현 벡터 및 상기 발현 벡터를 포함하는 바이러스를 제공하는 데 있다.
본 발명의 또 다른 목적은 상기 면역세포를 포함하는 암 치료용 조성물, 상기 면역세포를 이용한 암 치료 방법, 암 치료를 위한 상기 면역세포의 용도 및 암 치료용 약제 제조를 위한 상기 면역세포의 사용을 제공하는 데 있다.
상기 목적을 달성하기 위하여, 본 발명은 ErbB3 (Receptor Tyrosine-protein Kinase ErbB3)에 특이적으로 결합하는 항원 결합 부위를 포함하는 세포외 도메인 (extracellular binding domain); 막횡단 도메인(transmembrane domain); 및 세포내 신호전달 도메인(intracellular signaling domain)을 포함하는 키메라 항원 수용체(Chimeric antigen receptor; CAR)를 제공한다.
본 발명은 또한, 상기 키메라 항원 수용체를 코딩하는 핵산, 상기 핵산을 포함하는 발현 벡터, 상기 발현 벡터를 포함하는 바이러스 및 상기 키메라 항원 수용체를 발현하는 면역세포를 제공한다.
본 발명은 또한, 상기 면역세포를 포함하는 암 치료용 조성물, 상기 면역세포를 이용한 암 치료방법, 암 치료를 위한 상기 면역세포의 용도 및 암 치료용 약제 제조를 위한 상기 면역세포의 사용을 제공한다.
도 1은 ErbB3(HER3)에 특이적으로 결합하는 ErbB3 ScFv 후보 5종(442S1, 451M3, 472S2, 446, 464)을 각각 CAR의 외부 도메인 (ectodomain)으로 사용하여 CAR 구조체 (construct)를 제작한 결과를 나타낸 것이다.
도 2는 ErbB3-CAR를 발현하는 NK92 세포주를 확립한 결과를 나타낸 것이다.
도 3a는 ErbB3를 발현하는 암세포주를 선별한 결과를 나타낸 것이다.
도 3b는 ErbB3 발현 암세포에 대한 각 ErbB3-CAR NK92의 세포독성을 확인한 결과를 나타낸 것이다.
도 4는 CAR NK92와 암세포의 비율 (E:T ratio)에 따른 ErbB3-CAR NK92의 세포독성을 확인한 결과를 나타낸 것이다.
도 5a는 ErbB3를 발현하는 암세포와 공동배양한 CAR NK92세포에서 IFN-r 분비량을 확인한 결과를 나타낸 것이다.
도 5b는 ErbB3를 발현하는 암세포와 공동배양한 CAR NK92세포에서 탈과립 (degranulation)을 확인한 결과를 나타낸 것이다.
도 6은 단일세포 수준에서 CAR NK92의 효능을 확인한 결과를 나타낸 것이다.
도 7a는 ErbB3-CAR NK92 각각에서 CAR 발현을 확인한 결과를 나타낸 것이다.
도 7b는 각 CAR NK92의 타겟을 모두 만족하는 암세포주를 선별한 결과를 나타낸 것이다.
도 7c는 각 CAR NK92세포의 세포독성을 비교한 결과를 나타낸 것이다.
도 8a는 암세포에 대하여 각 ErbB3 ScFv의 결합을 확인한 결과를 나타낸 것이다.
도 8b는 CD16을 발현하는 NK92 세포주를 확인한 결과를 나타낸 것이다.
도 8c는 ErbB3 ScFv를 이용한 ADCC를 측정한 결과를 나타낸 것이다.
도 9a는 ErbB3-CAR 구조체 (construct)를 제작한 결과를 나타낸 것이다.
도 9b는 ErbB3-CAR를 발현하는 NK92 세포주 (442S1 vs. LJM716)를 나타낸 것이다.
도 9c는 ErbB3-CAR NK92의 세포독성 (442S1 vs. LJM716)을 비교한 결과를 나타낸 것이다.
발명의 상세한 설명 및 바람직한 구현예
다른 식으로 정의되지 않는 한, 본 명세서에서 사용된 모든 기술적 및 과학적 용어들은 본 발명이 속하는 기술분야에서 숙련된 전문가에 의해서 통상적으로 이해되는 것과 동일한 의미를 갖는다. 일반적으로 본 명세서에서 사용된 명명법은 본 기술분야에서 잘 알려져 있고 통상적으로 사용되는 것이다.
본 발명의 일 실시예에 따르면, 암세포에서 발현되는 ErbB3에 특이적으로 결합하는 ErbB3 ScFv 5종(442S1, 451M3, 472S2, 446, 464)을 각각 키메라 항원 수용체 (CAR)의 외부 도메인 (Ectodomain)으로 사용하여 CAR 구조체 (construct)를 제작하였다. 추가로 외부 도메인에 myc과 힌지 (hinge)를 발현하도록 제작하여 myc을 통하여 CAR가 세포 표면으로 발현되는 것을 확인하도록 하였으며, 내부 도메인은 신호전달 도메인으로 CD3-zeta와 공자극 분자 (costimulatory molecule)로 CD28과 DAP10을 추가하여 제3세대 CAR를 제작하였다.
따라서, 본 발명은 일 관점에서, ErbB3에 특이적으로 결합하는 항원 결합 부위를 포함하는 세포외 도메인 (extracellular binding domain); 막횡단 도메인(transmembrane domain); 및 세포내 신호전달 도메인(intracellular signaling domain)을 포함하는 키메라 항원 수용체(Chimeric antigen receptor; CAR)에 관한 것이다.
'키메라 항원 수용체(Chimeric antigen receptor; CAR)'는 표적 항원 및 해당 항원을 발현하는 세포에 대하여 면역반응을 유도할 수 있도록 설계된 합성 construct이다. CAR는 세포외 도메인, 막횡단 도메인 및 세포내 신호전달 도메인을 포함한다. 암세포의 표면에 특이적으로 발현되는 암세포 표면 항원을 인식하는 수용체를 코딩하는 유전자를 면역세포에 도입하여, 암세포를 사멸시킬 수 있다. 암세포에서 특이적으로 발현하는 항원과 결합하는 수용체를 포함하는 면역세포를 통해, 암세포만 표적하여 면역반응을 일으킬 수 있다.
1세대 CAR에서는 암세포에서 특이적으로 발현하는 항원 인식 부위를 포함하는 세포외 도메인, 막횡단 도메인 및 세포내 신호전달 도메인을 포함하고, 신호전달 도메인으로서 CD3ζ만을 이용하였는데, 암에 대한 치료 효과가 미미하였고, 지속시간이 짧다는 문제가 있었다.
면역세포에 대한 반응성 향상을 위하여 공자극 도메인(CD28 또는 CD137/4-1BB)과 CD3ζ를 결합한 2세대 CAR가 제조되었는데, 1세대 CAR와 비교하여 체내에 잔존하는 CAR 포함 면역세포의 수가 현저히 증가하였다. 2세대 CAR는 한 가지의 공자극 도메인을 이용한 것에 반해, 3세대 CAR에서는 두 가지 이상의 공자극 도메인을 이용하였다. 생체 내 CAR를 포함하는 면역세포의 확장 및 지속성 달성을 위해 공자극 도메인을 4-1BB, CD28 또는 OX40 등과 결합시킬 수 있다.
4세대 CAR에서는 IL-12 또는 IL-15와 같은 사이토카인을 암호화하는 추가 유전자를 포함하여, 사이토카인의 CAR 기반 면역단백질이 추가로 발현될 수 있도록 하고, 5세대 CAR는 면역세포 강화를 위해 인터루킨 리셉터 체인, 예를 들어, IL-2Rβ를 추가로 포함한다.
상기 "세포외 결합 도메인(extracellular binding domain)"이란, 목적하는 표적 항원에 특이적으로 결합하는 능력을 갖는 항원 결합 도메인(antigen binding domain)을 포함하는 CAR의 부분을 의미한다. 세포외 결합 도메인은, 생물학적 분자(예: 세포 표면 수용체 또는 종양 단백질, 지질, 다당류, 또는 기타 세포 표면 표적 분자, 또는 이의 성분)를 특이적으로 인식하고 이에 결합하는 능력을 보유하는 임의의 단백질, 폴리펩타이드, 올리고펩타이드 또는 펩타이드를 포함할 수 있다. 결합 도메인은 목적하는 생물학적 분자를 위한 임의의 천연 발생, 합성, 반합성 또는 재조합에 의해 생성된 결합 파트너를 포함한다.
본 발명의 용어 "특이적으로 결합하는"이란, 배경 결합보다 큰 결합 친화성으로 또 다른 분자에 대한 분자의 결합을 의미하는 것이다. 예를 들면, 세포외 결합 도메인은 약 10-5M 이상의 친화성 또는 Ka(즉, 1/M의 단위를 갖는 특정 결합 상호작용의 평형 해리 상수)로 표적 분자에 결합하거나 이와 연합하는 경우, 표적 분자에 대해 특이적으로 결합한다. 또는, 친화성은 M의 단위를 갖는 특정 결합 상호작용의 평형 해리 상수(Kd)(예: 10-5M 내지 10-13M 또는 그 이하)로 정의될 수 있다.
본 발명에 따른 세포외 결합 도메인 및 CAR의 친화성은 통상의 기술, 예를 들면, 경쟁 ELISA(효소-결합된 면역흡착 검정) 또는 표지된 리간드를 사용하거나 바이아코어(Biacore) T100(이는 뉴저지주 피스카타웨이 바이아코어 인코포레이티드로부터 이용 가능함) 등의 표면-플라스몬 공명 장치 또는 각각 코닝(Corning) 및 퍼킨 엘머(Perkin Elmer)로부터 이용가능한 EPIC 시스템 또는 EnSpire 등의 광학 바이오센서 기술을 사용하는 결합 회합 또는 치환 분석에 의해 용이하게 측정할 수 있다.
본 발명에 있어서, 상기 ErbB3에 특이적으로 결합하는 결합 도메인은 항-ErbB3 항체 또는 이의 항원 결합 단편(antigen binding fragment)인 것을 특징으로 할 수 있다.
바람직하게는, 상기 ErbB3에 특이적으로 결합하는 결합 도메인은 서열번호 1, 9, 17, 25 및 33으로 구성된 군에서 선택된 중쇄 CDR1,
*29서열번호 2, 10, 18, 26, 34로 구성된 군에서 선택된 중쇄 CDR2,
서열번호 3, 11, 19, 27, 35로 구성된 군에서 선택된 중쇄 CDR3; 및
서열번호 4, 12, 20, 28 및 36로 구성된 군에서 선택된 경쇄 CDR1,
서열번호 5, 13, 21, 29 및 37로 구성된 군에서 선택된 경쇄 CDR2, 및
서열번호 6, 14, 22, 30 및 38로 구성된 군에서 선택된 경쇄 CDR3를 포함하는 항-ErbB3 항체의 단일 사슬 가변 단편(single chain variable fragment; scFv)일 수 있다.
본 발명에 있어, 상기 ErbB3에 결합하는 항체 또는 이의 항원 결합단편은 서열번호 1의 서열을 포함하는 중쇄 CDR1, 서열번호 2의 서열을 포함하는 중쇄 CDR2, 서열번호 3의 서열을 포함하는 중쇄 CDR3, 서열번호 4의 서열을 포함하는 경쇄 CDR1, 서열번호 5의 서열을 포함하는 경쇄 CDR2, 서열번호 6의 서열을 포함하는 경쇄 CDR3;
서열번호 9의 서열을 포함하는 중쇄 CDR1, 서열번호 10의 서열을 포함하는 중쇄 CDR2, 서열번호 11의 서열을 포함하는 중쇄 CDR3, 서열번호 12의 서열을 포함하는 경쇄 CDR1, 서열번호 13의 서열을 포함하는 경쇄 CDR2, 서열번호 14의 서열을 포함하는 경쇄 CDR3;
서열번호 17의 서열을 포함하는 중쇄 CDR1, 서열번호 18의 서열을 포함하는 중쇄 CDR2, 서열번호 19의 서열을 포함하는 중쇄 CDR3, 서열번호 20의 서열을 포함하는 경쇄 CDR1, 서열번호 21의 서열을 포함하는 경쇄 CDR2, 서열번호 22의 서열을 포함하는 경쇄 CDR3;
*37서열번호 25의 서열을 포함하는 중쇄 CDR1, 서열번호 26의 서열을 포함하는 중쇄 CDR2, 서열번호 27의 서열을 포함하는 중쇄 CDR3, 서열번호 28의 서열을 포함하는 경쇄 CDR1, 서열번호 29의 서열을 포함하는 경쇄 CDR2, 서열번호 30의 서열을 포함하는 경쇄 CDR3; 또는
서열번호 33의 서열을 포함하는 중쇄 CDR1, 서열번호 34의 서열을 포함하는 중쇄 CDR2, 서열번호 35의 서열을 포함하는 중쇄 CDR3, 서열번호 36의 서열을 포함하는 경쇄 CDR1, 서열번호 37의 서열을 포함하는 경쇄 CDR2, 서열번호 38의 서열을 포함하는 경쇄 CDR3를 포함한다.
상기 "항체(antibody)"는 ErbB3에 특이적으로 결합하는 항-ErbB3 항체를 의미한다. 본 발명의 범위에는 ErbB3에 특이적으로 결합하는 완전한 항체 형태 뿐만 아니라, 상기 항체 분자의 항원 결합 단편도 포함된다.
본원에 사용된 바와 같은 "항체 가변 도메인"은 상보성 결정 영역 (CDR; 즉, CDR1, CDR2, 및 CDR3), 및 골격 영역 (FR)의 아미노산 서열을 포함하는 항체 분자의 경쇄 및 중쇄 부분을 지칭한다. VH는 중쇄의 가변 도메인을 지칭한다. VL은 경쇄의 가변 도메인을 지칭한다.
"상보성 결정 영역" (CDR; 즉, CDR1, CDR2, 및 CDR3)은 항원 결합을 위해 필요한 존재인, 항체 가변 도메인의 아미노산 잔기를 지칭한다. 각 가변 도메인은 전형적으로, CDR1, CDR2 및 CDR3으로서 확인된 3개의 CDR 영역을 갖는다.
완전한 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다. 중쇄 불변영역은 감마 (γ), 뮤 (μ), 알파 (α), 델타 (δ) 및 엡실론 (ε) 타입을 가지고 서브클래스로 감마1 (γ1), 감마2 (γ2), 감마3 (γ3), 감마4 (γ4), 알파1 (α1) 및 알파2 (α2)를 가진다. 경쇄의 불변영역은 카파 (κ) 및 람다 (λ) 타입을 가진다.
본 발명에서, 항체의 "단편"은, 항원 결합 기능을 보유하고 있는 단편을 의미하며, scFv, Fab, F(ab')2 및 Fv 단편 등을 포함하는 의미로 사용된다. 항체 단편 중 Fab는 경쇄 및 중쇄의 가변영역과 경쇄의 불변영역 및 중쇄의 첫 번째 불변영역 (CH1)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C-말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 디설파이드 결합을 이루면서 생성된다. Fv는 중쇄 가변영역 및 경쇄 가변영역만을 가지고 있는 최소의 항체조각이다. 이중쇄 Fv (two-chain Fv)는 비공유 결합으로 중쇄 가변영역과 경쇄 가변영역이 연결되어 있고 단쇄 Fv (single-chain Fv, scFv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변영역과 경쇄의 가변영역이 공유결합으로 연결되거나 또는 C-말단에서 바로 연결되어 있어서 이중쇄 Fv와 같이 다이머와 같은 구조를 이룰 수 있다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻을 수 있고 (예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다), 유전자 재조합 기술을 통하여 제작할 수도 있다.
"단일쇄 Fv" 또는 "scFv" 항체 단편은 항체의 VH 및 VL 도메인을 포함하는데, 이들 도메인은 단일 폴리펩티드 쇄 내에 존재한다. Fv 폴리펩티드는 scFv가 항원 결합을 위해 목적하는 구조를 형성할 수 있도록 하는 VH 도메인과 VL 도메인 사이에 폴리펩티드 링커를 추가로 포함할 수 있다.
본 발명에 있어서, 항체의 중쇄 가변영역(VH) 및 경쇄 가변영역(VL)을 포함하는 scFv에서 VH 및 VL은 링커를 통해 연결될 수 있다. 본 발명의 일 실시예에서, 상기 ErbB3에 특이적으로 결합하는 결합 도메인은 서열번호 7, 15, 23, 31 및 39로 구성된 군에서 선택된 서열을 포함하는 중쇄 가변영역을 포함하는 항-ErbB3 항체의 단일 사슬 가변 단편(single chain variable fragment; scFv)일 수 있다. 상기 ErbB3에 특이적으로 결합하는 결합 도메인은 서열번호 8, 16, 24, 32 및 40로 구성된 군에서 선택된 서열을 포함하는 경쇄 가변영역을 포함하는 항-ErbB3 항체의 단일 사슬 가변 단편(single chain variable fragment; scFv)일 수 있다.
상기 ErbB3에 결합하는 항체 또는 이의 항원 결합단편은 서열번호 7의 서열을 포함하는 중쇄 가변영역, 서열번호 8의 서열을 포함하는 경쇄 가변영역, 서열번호 15의 서열을 포함하는 중쇄 가변영역, 서열번호 16의 서열을 포함하는 경쇄 가변영역, 서열번호 23의 서열을 포함하는 중쇄 가변영역, 서열번호 24의 서열을 포함하는 경쇄 가변영역, 서열번호 31의 서열을 포함하는 중쇄 가변영역, 서열번호 32의 서열을 포함하는 경쇄 가변영역, 또는 서열번호 39의 서열을 포함하는 중쇄 가변영역, 서열번호 40의 서열을 포함하는 경쇄 가변영역을 포함할 수 있다.
본 발명의 항체 또는 항체 단편은 ErbB3을 특이적으로 인식할 수 있는 범위 내에서, 본 명세서에 기재된 본 발명의 항-ErbB3 항체의 서열뿐만 아니라, 이의 생물학적 균등물도 포함할 수 있다. 예를 들면, 항체의 결합 친화도 및/또는 기타 생물학적 특성을 보다 더 개선시키기 위하여 항체의 아미노산 서열에 추가적인 변화를 줄 수 있다. 이러한 변형은 예를 들어, 항체의 아미노산 서열 잔기의 결실, 삽입 및/또는 치환을 포함한다. 이러한 아미노산 변이는 아미노산 곁사슬 치환체의 상대적 유사성, 예컨대, 소수성, 친수성, 전하, 크기 등에 기초하여 이루어진다. 아미노산 곁사슬 치환체의 크기, 모양 및 종류에 대한 분석에 의하여, 아르기닌, 라이신과 히스티딘은 모두 양전하를 띤 잔기이고; 알라닌, 글라이신과 세린은 유사한 크기를 가지며; 페닐알라닌, 트립토판과 타이로신은 유사한 모양을 갖는다는 것을 알 수 있다. 따라서, 이러한 고려 사항에 기초하여, 아르기닌, 라이신과 히스티딘; 알라닌, 글라이신과 세린; 그리고 페닐알라닌, 트립토판과 타이로신은 생물학적으로 기능 균등물이라 할 수 있다.
상술한 생물학적 균등 활성을 갖는 변이를 고려한다면, 본 발명의 항체 또는 이를 코딩하는 핵산 분자는 서열번호에 기재된 서열과 실질적인 동일성 (substantial identity)을 나타내는 서열도 포함하는 것으로 해석된다. 상기의 실질적인 동일성은, 상기한 본 발명의 서열과 임의의 다른 서열을 최대한 대응되도록 얼라인하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 얼라인된 서열을 분석한 경우에, 최소 90%의 상동성, 가장 바람직하게는 최소 95%의 상동성, 96% 이상, 97% 이상, 98% 이상, 99% 이상의 상동성을 나타내는 서열을 의미한다. 서열비교를 위한 얼라인먼트 방법은 당업계에 공지되어 있다. NCBI Basic Local Alignment Search Tool (BLAST)은 NBCI 등에서 접근 가능하며, 인터넷 상에서 blastp, blasm, blastx, tblastn 및 tblastx와 같은 서열 분석 프로그램과 연동되어 이용할 수 있다. BLSAT는 www.ncbi.nlm.nih.gov/BLAST/에서 접속 가능하다. 이 프로그램을 이용한 서열 상동성 비교 방법은 www.ncbi.nlm.nih.gov/BLAST/blast_ help.html에서 확인할 수 있다.
이에 기초하여, 본 발명의 항체 또는 그의 항원 결합 단편은 명세서에 기재된 명시된 서열 또는 전체와 비교하여 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 또는 그 이상의 상동성을 가질 수 있다. 이러한 상동성은 당업계에 공지된 방법에 의한 서열 비교 및/또는 정렬에 의해 결정될 수 있다. 예를 들어, 서열 비교 알고리즘 (즉, BLAST 또는 BLAST 2.0), 수동 정렬, 육안 검사를 이용하여 본 발명의 핵산 또는 단백질의 퍼센트 서열 상동성을 결정할 수 있다.
상기 링커는 펩타이드 링커일 수 있으며, 약 10-25 aa 길이를 가질 수 있다. 예를 들어, 글리신 및/또는 세린과 같은 친수성 아미노산이 포함될 수 있다. 상기 링커는 예를 들어, (GS)n, (GGS)n, (GSGGS)n 또는 (GnS)m (n, m은 각각 1 내지 10)을 포함할 수 있으며, 예를 들어 (GnS)m (n, m은 각각 1 내지 10)일 수 있으나, 이에 제한되는 것은 아니다.
상기 키메라 항원 수용체는 막횡단 도메인(transmembrane domain)을 포함하는 것을 특징으로 할 수 있다.
상기 "막횡단 도메인(transmembrane domain)"이란, 세포외 결합 부분 및 세포내 신호전달 도메인을 융합시키고 면역 작동 세포의 원형질 막에 CAR를 고정시키는 CAR의 일부이다. 막횡단 도메인은 천연, 합성, 반합성 또는 재조합 공급원으로부터 유래할 수 있다. 본 발명에 있어서, 상기 막횡단 도메인은 T-세포 수용체(TCR)의 알파(α), 베타(β) 또는 제타(ζ) 사슬, CD28, CD3 엡실론(ε), CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 및 CD154로 구성된 군에서 선택되는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
상기 막횡단 도메인은 링커(linker)를 통해 CAR의 세포외 결합 도메인에 부착될 수 있다. 예를 들어, 링커는 2 내지 10개 아미노산 길이의 짧은 올리고- 또는 폴리펩타이드 링커일 수 있으며, 바람직하게는 글라이신(G)-세린(S) 이중체(doublet)일 수 있으나, 이에 제한되는 것은 아니다.
CAR의 결합 도메인은 일반적으로 하나 이상의 "힌지 도메인(hinge domain)"이 후속한다. 따라서, 본 발명에 있어서, 상기 세포외 도메인은 ErbB3에 특이적으로 결합하는 결합 도메인과 함께 추가적으로 신호 펩티드(signal peptide; SP) 및/또는 힌지(hinge)를 포함하는 것을 특징으로 할 수 있다. 세포외 도메인은 주신호가 전달되는 부위로 세포막 외부에 존재하며 타겟, 즉, ErbB3을 특이적으로 인식하기 위한 도메인이다.
본 발명의 용어 "힌지 도메인"이란, 적절한 세포/세포 접촉, 항원 결합 및 활성화를 가능하게 하도록 작동 세포 표면으로부터 떨어져 항원 결합 부위를 포함하는 세포외 도메인 (extracellular binding domain)의 위치결정에 중요한 역할을 담당하는 CAR의 일부이다. CAR는 일반적으로 세포외 결합 도메인과 막횡단 도메인 사이에 하나 이상의 힌지 도메인을 포함한다. 힌지 도메인은 천연, 합성, 반-합성 또는 재조합 공급원으로부터 유래될 수 있다. 힌지 도메인은 천연 발생 면역글로불린 힌지 영역 또는 변화된 면역글로불린 힌지 영역의 아미노산 서열을 포함할 수 있다. "변화된 힌지 영역"은 (a) 최대 30%의 아미노산 변화(예: 최대 25%, 20%, 15%, 10% 또는 5%의 아미노산 치환 또는 결실)을 갖는 천연 발생 힌지 영역, (b) 최대 30% 아미노산 변화(예: 최대 25%, 20%, 15%, 10% 또는 5%의 아미노산 치환 또는 결실)을 갖는 적어도 10개 아미노산(예: 적어도 12, 13, 14 또는 15개 아미노산) 길이의 천연 발생 힌지 영역의 일부, 또는 (c) 코어 힌지 영역(이는 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 또는 15, 또는 적어도 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 또는 15개 아미노산 길이일 수 있다)을 포함하는 천연 발생 힌지 영역의 일부를 지칭한다. 특정 실시형태에서, 천연 발생 면역글로불린 힌지 영역에서 하나 이상의 시스테인 잔기는 하나 이상의 다른 아미노산 잔기(예: 하나 이상의 세린 잔기)로 치환될 수 있다. 변화된 면역글로불린 힌지 영역은 대안적으로 또는 추가적으로 또 다른 아미노산 잔기(예: 세린 잔기)로 치환된 야생형 면역글로불린 힌지 영역의 프롤린 잔기를 가질 수 있다. 힌지 도메인은 CD8, CD4, CD28 및 CD7 등의 유형 1 막단백질의 세포외 영역으로부터 유래하는 힌지 영역을 포함하고, 이는 이들 분자로부터의 야생형 힌지 영역일 수 있거나 변화될 수 있다.
본 발명에 있어서, 상기 힌지 도메인을 포함하는 막횡단 도메인은 상기 세포외 도메인과 세포내 신호전달 도메인을 세포막 사이로 연결 가능하다면 어떠한 것이든 사용 가능하다. 바람직하게는 CD8로부터 유래된 힌지 도메인 및 막횡단 도메인으로 이루어질 수 있지만, 이에 제한되는 것은 아니다.
경우에 따라서, 상기 결합 도메인과 막횡단 도메인은 스페이서(spacer) 도메인으로 연결될 수 있다.
바람직하게는, 상기 스페이서 도메인은 힌지 도메인일 수 있다. 본 발명에 있어서, 상기 스페이서 도메인은 CD28 유래의 힌지 도메인 및/또는 CD8 유래의 힌지 도메인을 포함할 수 있으며, 상기 CD28 유래의 힌지 도메인 및/또는 CD8 유래의 힌지 도메인의 전체 또는 일부를 포함하는 것일 수 있다.
본 발명의 힌지 영역 또는 스페이서 영역은 Myc 에피토프, CD8 힌지 영역 및 Fc로부터 1개 이상 선택된 것일 수 있으며, 바람직하게는 Myc 에피토프 및 CD8 힌지영역을 포함하는 것일 수 있다. 본 발명의 Myc 에피토프 및 CD8 힌지영역은 연결 도메인 (스페이서)로 기능한다.
본 발명의 CD8 힌지 영역은 GVTVSSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLD (서열번호 41)의 서열을 포함할 수 있다. 상기 Myc 에피토프는 ANKNSSQKRI (서열번호 42)의 서열을 포함할 수 있다.
본 발명에 있어서, 상기 키메라 항원 수용체는 세포내 신호전달 도메인(intracellular signaling domain)을 포함하는 것을 특징으로 할 수 있다.
본 발명에 있어서, 상기 세포내 신호전달 도메인은 면역세포의 세포막 안쪽, 즉 세포질에 위치하게 되는 부분으로서, 세포외 도메인에 포함된 결합 도메인이 표적 항원에 결합하였을 때, 세포 내에 신호 전달하여 면역세포의 면역반응을 활성화시키는 부위를 의미한다.
본 발명에 있어서, 상기 세포내 신호전달 도메인은 세포내 신호전달 도메인 및/또는 공자극(co-stimulatory) 신호전달 영역을 포함하는 것을 특징으로 할 수 있다.
상기 신호전달 도메인은 CAR이 위치된 면역세포의 정상 효과기 기능에 대한 활성화를 유도할 수 있다. 예를 들어 사이토카인의 분비를 통해 세포용해 활성화 또는 헬퍼 활성화를 유도할 수 있다. 상기 신호 전달 도메인은 효과기 기능 신호를 형질도입하기에 충분한 세포내 신호전달 도메인의 절단된 단편을 포함할 수 있다.
상기 세포내 신호전달 도메인은 T-세포 수용체(TCR) 제타(ζ), FcR 감마(γ), FcR 베타(β), CD3 감마(γ), CD3 델타(δ), CD3 엡실론(ε), CD3 제타(ζ), CD5, CD22, CD79a, CD79b 및 CD66d로 구성된 군에서 선택되는 1차 신호전달 도메인(primary signaling domain); 및/또는 CD2, CD7, CD27, CD28, CD30, CD40, 4-1BB(CD137), OX40(CD134), CDS, ICAM-1, ICOS(CD278), LFA-1(CD11a/CD18), GITR, MyD88, DAP10, DAP12, PD-1, LIGHT, NKG2C, B7-H3 및 CD83과 특이적으로 결합하는 리간드로 구성된 군에서 선택되는 공자극 신호전달 도메인(co-stimulatory signaling domain)을 포함하는 것을 특징으로 할 수 있다.
본 발명의 용어 "세포내 신호전달 도메인(intracellular signaling domain)"이란, 작동 세포 기능, 예를 들면, CAR-결합된 표적 세포에 대한 세포독성 인자의 방출을 포함하는 활성화, 사이토카인 생성, 증식 및 세포독성 활성, 또는 CAR의 세포외 결합 도메인에 대한 항원 결합으로 유발된 기타 세포 반응을 유발하기 위해 면역 작동 세포의 내부로 표적 항원에 대한 효과적 CAR 결합의 메시지의 전달에 관여하는 CAR의 부분을 의미하는 것이다. 작동 기능은 세포의 특수한 기능을 지칭하며, 예를 들면, 면역세포의 작동 기능은 세포용해 활성일 수 있거나, 사이토카인의 분비를 포함하는 활성을 지원할 수 있거나 활성일 수 있다. 따라서, 세포내 신호전달 도메인은 작동 기능 신호를 전달하고 세포가 특수한 기능을 수행하도록 지시하는 단백질의 일부를 의미한다.
면역세포 활성화는 세포내 신호전달 도메인의 2개 상이한 부류에 의해 매개된다. 예를 들면, 항원-의존성 일차 활성화를 개시하는 1차 신호전달 도메인 및 2차 신호를 제공하기 위해 항원-독립적 방식으로 작용하는 공자극 신호전달 도메인에 의해 면역세포 활성화가 매개된다. 따라서, 상기 세포내 신호전달 도메인은 "1차 신호전달 도메인(primary signaling domain)" 및 "공자극 신호전달 도메인(co-stimulatory signaling domain)"을 포함하는 것을 특징으로 할 수 있다.
본 발명의 용어 "1차 신호전달 도메인(primary signaling domain)"이란, 면역세포 활성화를 자극 또는 억제 방식으로 조절하는 신호전달 도메인을 의미하는 것이다. 자극 방식으로 작용하는 1차 신호전달 도메인은 면역수용체 티로신-기반 활성화 모티브 또는 ITAM으로 공지되어 있는 신호전달 모티브를 함유할 수 있다. 1차 신호전달 도메인을 함유하는 ITAM은 TCRζ, FcRγ, FcRβ, CD3γ, CD3δ, CD3ε, CD3ζ, CD5, CD22, CD79a, CD79b 및 CD66d로 구성된 군에서 선택될 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, 상기 1차 신호전달 도메인은 바람직하게는, 서열번호 9로 표시되는 아미노산 서열을 포함하는 CD3ζ(zeta)인 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다. CD3ζ(zeta)는 RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (서열번호 43)의 서열을 포함할 수 있다.
본 발명의 용어 "공자극 신호전달 도메인(co-stimulatory signaling domain)"이란, 공자극 분자의 세포내 신호전달 도메인을 의미한다. 공자극 신호전달 영역은 공자극 분자의 세포내 신호전달 도메인을 포함하는 CAR의 일 부분을 의미한다. CD2, CD7, CD27, CD28, CD30, CD40, 4-1BB(CD137), OX40(CD134), CDS, ICAM-1, ICOS(CD278), LFA-1(CD11a/CD18), GITR, MyD88, DAP10, DAP12, PD-1, LIGHT, NKG2C, B7-H3 및 CD83과 특이적으로 결합하는 리간드로 구성된 군에서 선택되는 공자극 신호전달 도메인(co-stimulatory signaling domain)을 포함할 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, 상기 공자극 분자는 DAP10일 수 있으나, 이에 제한되는 것은 아니다. DAP10은 LCARPRRSPAQEDGKVYINMPGRG (서열번호 44)의 서열을 포함할 수 있다.
본 발명의 키메릭 항원 수용체는 세포 내 신호전달 도메인으로 DAP10 및 CD3 zeta를 이용함으로써 NK 세포의 높은 활성으로 암 세포에 대한 사멸효과를 나타낼 수 있다.
본 발명에 따른 키메라 항원 수용체는 2개 이상의 세포내 신호전달 도메인을 포함하는 것을 특징으로 할 수 있으며, 2개 이상의 세포내 신호전달 도메인을 포함하는 경우에는 세포내 신호전달 도메인들이 서로 직렬로 연결될 수 있다. 또는 2~10 아미노산으로 이루어지는 올리고 펩티드 링커 또는 폴리펩티드 링커를 통해 연결되어 있을 수도 있고, 이러한 링커 서열의 예로서 글리신-세린 연속 서열을 들 수 있다. 상기 링커는 예를 들어, (GS)n, (GGS)n, (GSGGS)n 또는 (GnS)m (n, m은 각각 1 내지 10)을 포함할 수 있으며, 예를 들어 (GnS)m (n, m은 각각 1 내지 10)일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, 상기 세포내 신호전달 도메인은 CD28 또는 DAP10의 공자극 신호전달 영역 및 CD3 zeta의 세포내 신호전달 도메인으로 구성된 군에서 선택되는 어느 하나 이상을 포함하는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, 상기 키메라 항원 수용체는 면역세포의 면역 기능 촉진 인자를 추가로 포함할 수 있으며, 상기 면역세포의 면역 기능 촉진 인자는 인터루킨 신호 서열(interleukin signal sequence)인 것을 특징으로 할 수 있다. 상기 인터루킨 신호 서열은 IL(interleukin)-12, IL-8 또는 IL-2 발현을 유도하는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다. 또한, 상기 면역세포 중 T 세포의 면역 기능 촉진 인자로는 IL-7 또는 CCL19를 예로 들 수 있다.
CAR 설계시 scFv 앞에 신호 펩타이드(signal peptide)를 추가로 포함할 수 있다. 상기 키메라 항원 수용체를 코딩하는 핵산은 신호 펩타이드(signal peptide)를 코딩하는 핵산을 더 포함하는 것을 특징으로 할 수 있다.
상기 신호 펩타이드는 예를 들어 GM-CSF, CD8α signal peptide 등이 사용될 수 있다. CD8 알파 또는 마우스 경쇄 카파 신호 펩타이드 (Mouse light kappa signal peptid) 일 수 있으며, CD8 알파인 경우, 본 발명의 신호 펩타이드는 MALPVTALLLPLALLLHAARP (서열번호 45)의 서열을 포함할 수 있다.
본 발명에 있어서, 상기 키메라 항원 수용체는 JAK 결합 모티프 및 STAT 3/5 회합 모티프를 포함하는 인터루킨 수용체 사슬(interleukin receptor chain)을 추가로 포함할 수 있으며, IL-2Rβ를 그 예로 들 수 있으나, 이에 제한되는 것은 아니다.
본 발명은 다른 관점에서, 상기 키메라 항원 수용체를 코딩하는 핵산에 관한 것이다.
"핵산"는 DNA (gDNA 및 cDNA) 및 RNA 분자를 포괄적으로 포함하는 의미를 가지며, 핵산에서 기본 구성단위인 뉴클레오타이드는 자연의 뉴클레오타이드 뿐만 아니라, 당 또는 염기 부위가 변형된 유사체 (analogue)도 포함한다. 본 발명의 중쇄 및 경쇄 가변영역을 코딩하는 핵산의 서열은 변형될 수 있다. 상기 변형은 뉴클레오타이드의 추가, 결실, 또는 비보존적 치환 또는 보존적 치환을 포함한다.
본 발명에 따른 키메라 항원 수용체를 코딩하는 핵산(폴리뉴클레오타이드)은 코돈 최적화에 의해 변형될 수 있으며, 이는 코돈의 축퇴성(degeneracy)에서 기인한 것으로, 폴리펩티드 또는 이의 변이체 단편을 코딩하는 많은 뉴클레오타이드 서열이 존재한다는 것은 통상의 기술자가 잘 이해할 수 있을 것이다. 이들 폴리뉴클레오타이드(핵산)의 일부는 임의의 자연 발생형 유전자의 뉴클레오타이드 서열과 최소 상동성을 보유한다.
특히 코돈 활용법의 차이로 인해 가변적인 폴리뉴클레오타이드(핵산), 예를 들어 인간, 영장류 및/또는 포유동물의 코돈 선택에 최적화된 폴리뉴클레오타이드(핵산)가 바람직하다.
본 발명은 또 다른 관점에서, 상기 핵산을 포함하는 발현 벡터 및 상기 발현 벡터를 포함하는 바이러스에 관한 것이다.
본 발명의 용어 "벡터"란, 다른 핵산 분자를 전이시키거나 수송할 수 있는 핵산 분자를 의미하는 것이다. 전이된 핵산은 일반적으로 벡터 핵산 분자에 연결되는데, 예를 들면, 벡터 핵산 분자 내에 삽입된다. 벡터는 세포에서의 자율적 복제를 지시하는 서열을 포함할 수 있거나, 숙주 세포 DNA 내로의 통합을 가능하게 하는데 충분한 서열을 포함할 수 있다. 상기 벡터는 DNA, RNA, 플라스미드, 렌티바이러스 벡터, 아데노바이러스 벡터 및 레트로바이러스 벡터로 구성된 군에서 선택되는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
벡터 성분에는 일반적으로, 다음 중의 하나 이상이 포함되지만, 그에 제한되지 않는다: 신호 서열, 복제 기점, 하나 이상의 마커 유 전자, 증강인자 요소, 프로모터, 및 전사 종결 서열.
상기 벡터에서 항체를 코딩하는 핵산은 프로모터와 작동적으로 연결되어 있다.
"작동적으로 연결"은 핵산 발현조절서열 (예: 프로모터, 시그널 서열, 또는 전사조절인자 결합 위치의 어레이)과 다른 핵산 서열사이의 기능적인 결합을 의미하며, 이에 의해 상기 조절서열은 상기 다른 핵산 서열의 전사 및/또는 해독을 조절하게 된다.
원핵 세포를 숙주로 하는 경우에는, 전사를 진행시킬 수 있는 강력한 프로모터 (예컨대, tac 프로모터, lac 프로모터, lacUV5 프로모터, lpp 프로모터, pLλ 프로모터, pRλ프로모터, rac5 프로모터, amp 프로모터, recA 프로모터, SP6 프로모터, trp 프로모터 및 T7 프로모터 등), 해독의 개시를 위한 라이보좀 결합 자리 및 전사/해독 종결 서열을 포함하는 것이 일반적이다. 또한, 예를 들어, 진핵 세포를 숙주로 하는 경우에는, 포유동물 세포의 지놈으로부터 유래된 프로모터(예: 메탈로티오닌 프로모터, β-액틴 프로모터, 사람 헤로글로빈 프로모터 및 사람 근육 크레아틴 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터(예: 아데노바이러스 후기 프로모터, 백시니아 바이러스 7.5K 프로모터, SV40프로모터, 사이토메갈로바이러스 (CMV) 프로모터, HSV의 tk 프로모터, 마우스 유방종양 바이러스 (MMTV) 프로모터, HIV의 LTR 프로모터, 몰로니 바이러스의 프로모터엡스타인바 바이러스 (EBV)의 프로모터 및 로우스 사코마 바이러스 (RSV)의 프로모터)가 이용될 수 있으며, 전사 종결 서열로서 폴리아데닐화 서열을 일반적으로 갖는다.
경우에 따라서, 벡터는 그로부터 발현되는 항체의 정제를 용이하게 하기 위하여 다른 서열과 융합될 수도 있다. 융합되는 서열은, 예컨대 글루타티온 S-트랜스퍼라제 (Pharmacia, USA), 말토스 결합 단백질 (NEB, USA), FLAG (IBI, USA) 및 6x His (hexahistidine; Quiagen, USA) 등이 있다.
상기 벡터는 선택표지로서 당업계에서 통상적으로 이용되는 항생제 내성 유전자를 포함하며, 예를 들어 암피실린, 겐타마이신, 카베니실린, 클로람페니콜, 스트렙토마이신, 카나마이신, 게네티신, 네오마이신 및 테트라사이클린에 대한 내성 유전자가 있다.
본 발명에 있어서, "바이러스"는 암의 치료 등에 사용하기 위해, 본 발명의 키메라 항원 수용체를 발현하도록 유전적으로 변형된 것을 의미한다. 유전적으로 변형되었다는 것은 세포에서 전체 유전자 재료로 DNA 또는 RNA의 형태로 외부 유전자 재료를 부가하는 것이다.
본 발명에 있어서, 상기 핵산 또는 상기 벡터는 바이러스에 형질주입 또는 트랜스펙션(transfection)된다. "형질주입" 또는 "트랜스펙션"시키기 위해 원핵 또는 진핵 숙주세포 내로 외인성 핵산(DNA 또는 RNA)을 도입하는 데에 통상 사용되는 여러 종류의 다양한 기술, 예를 들어 전기 영동법, 인산칼슘 침전법, DEAE-덱스트란 트랜스펙션 또는 리포펙션(lipofection) 등을 사용할 수 있다.
본 발명은 또 다른 관점에서, 상기 키메라 항원 수용체를 표면에 발현하는 면역세포에 관한 것이다.
본 발명에 있어서, 상기 면역세포는 면역을 유도하여 목적하는 암 치료 효과를 유발할 수 있는 것으로, 예를 들어, T 세포, NK 세포, NKT 세포, 사이토카인 유도 살해세포(Cytokine Induced Killer cell, CIK), 마크로파지 및 수지상세포로 구성된 군에서 선택될 수 있으나, 이에 제한되는 것은 아니다. 바람직하게는 T 세포인 것을 특징으로 할 수 있다.
따라서, 본 발명에 따른 키메라 항원 수용체를 발현하는 면역세포는 CAR-T 세포(Chimeric Antigen Receptor T Cell), CAR-NK 세포(Chimeric Antigen Receptor Natural Killer Cell), CAR-NKT 세포(Chimeric Antigen Receptor Natural killer T Cell) 또는 CAR-대식세포(Chimeric Antigen Receptor Macrophage) 등일 수 있다. 본 발명에 있어서, 상기 T 세포는 세포독성 T 림프구(Cytotoxic T lymphocyte; CTL); 종양 침윤 림프구(Tumor infiltrating lymphocyte; TIL) 및 말초혈액 단핵세포(Peripheral blood mononuclear cell; PBMC)에서 분리한 T 세포로 구성된 군에서 선택되는 것을 특징으로 할 수 있다.
본 발명에 있어, 특히 CAR-NK 세포는 NK (Natural killer) 세포에 키메릭 항원 수용체가 도입된 세포를 의미한다. 기존의 CAR-T 치료제를 이용한 암 면역치료가 가지고 있는 지속적인 독성에 의한 문제점, 자가면역 질환의 위험, 이종세포 이식에 대한 이식편대숙주질환 (GVHD)의 문제점 및 비표적 독성 문제 등을 반응 개시(on)/중지(off)의 스위치를 통해 해결할 수 있을 뿐만 아니라, 다양한 암세포를 표적할 수 있도록 하여 범용의 치료제로 활용가능한 장점이 있다.
본 발명은 또 다른 관점에서, 상기 키메라 항원 수용체를 발현하는 면역세포(예컨대, T 세포 또는 NK세포)를 포함하는 암 치료용 조성물에 관한 것이다. 상기 T 세포는 CD4 양성 T 세포; CD8 양성 세포독성 T 림프구(Cytotoxic T lymphocyte; CTL); gamma-delta T 세포; 종양 침윤 림프구(Tumor infiltrating lymphocyte; TIL) 및 말초혈액 단핵세포(Peripheral blood mononuclear cell; PBMC)에서 분리한 T 세포로 구성된 군에서 선택되는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다.
본 발명에 있어서, "암"과 "종양"은 동일한 의미로 사용되며, 전형적으로 조절되지 않은 세포 성장/증식을 특징으로 하는 포유동물의 생리학적 상태를 지칭하거나 의미한다.
본 발명의 조성물로 치료할 수 있는 암 또는 암종은 특별히 제한되지 않으며, 고형암 및 혈액암을 모두 포함한다. 이러한 암의 예로는 유방암을 예로 들 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 치료용 조성물은 암의 예방 또는 치료를 위한 조성물로서, 본 발명의 용어, "예방"은 본 발명의 조성물의 투여로 암을 억제시키거나 진행을 지연시키는 모든 행위를 의미하며, "치료"는 암의 발전의 억제, 증상의 경감 또는 제거를 의미한다.
상기 조성물에는 본 발명에 따른 키메라 항원 수용체를 발현하는 면역세포의 수가 치료 대상 내의 종양 세포 수의 1배 내지 10배로 포함되는 것이 바람직하지만, 이에 한정되는 것은 아니다.
본 발명에 따른 키메라 항원 수용체를 발현하는 면역세포를 포함하는 약학 조성물에는 약제학적으로 허용되는 부형제가 추가적으로 포함될 수 있다. 그러한 부형제의 예로는, 계면활성제, 바람직하게는 폴리소르베이트 계열의 비이온성 계면활성제; 중성 완충 염수, 인간염 완충 염수 등의 완충제; 글루코스, 만노스, 수크로스 또는 덱스트란, 만니톨 등의 당 또는 당알콜류; 글리신, 히스티딘 등의 아미노산이나 단백질 또는 폴리펩티드; 항산화제; EDTA 또는 글루타티온 등의 킬레이트제 예컨대; 침투제; 보조제; 및 보존제가 포함될 수 있지만, 이에 한정되는 것은 아니다.
본 발명의 일 실시예에 따르면, 본 발명의 약학 조성물은 1회 투여량 내에 상기 면역세포(예컨대, T 세포, 또는 NK세포)의 수가 치료 대상 내의 상기 종양세포 수의 1배 내지 10배로 포함된 것일 수 있다.
본 발명의 조성물은 인간을 제외한 포유동물에 투여된 후 활성 성분의 신속, 지속 또는 지연된 방출을 제공할 수 있도록 당업계에 공지된 방법을 사용하여 제형화될 수 있다. 제형은 분말, 과립, 정제, 에멀젼, 시럽, 에어로졸, 연질 또는 경질 젤라틴 캅셀, 멸균 주사용액, 멸균 분말의 형태일 수 있다.
상기 약학 조성물은 경구 또는 비경구의 여러 가지 제형일 수 있다. 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다. 경구투여를 위한 고형제제에는 정제, 환제, 산제, 과립제, 캡슐제 등이 포함되며, 이러한 고형제제는 하나 이상의 화합물에 적어도 하나 이상의 부형제 예를 들면, 전분, 탄산칼슘, 수크로오스(sucrose) 또는 락토오스(lactose), 젤라틴 등을 섞어 조제된다. 또한 단순한 부형제 이외에 스테아린산 마그네슘, 탈크 등과 같은 윤활제들도 사용된다. 경구투여를 위한 액상제제로는 현탁제, 내용액제, 유제, 시럽제 등이 해당되는데 흔히 사용되는 단순 희석제인 물, 리퀴드 파라핀 이외에 여러 가지 부형제, 예를 들면 습윤제, 감미제, 방향제, 보존제 등이 포함될 수 있다. 비경구투여를 위한 제제에는 멸균된 수용액, 비수성용제, 현탁제, 유제, 동결건조제제, 좌제가 포함된다. 비수성용제, 현탁용제로는 프로필렌글리콜(propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트와 같은 주사 가능한 에스테로 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(witepsol), 마크로골, 트윈(tween) 61, 카카오지, 라우린지, 글리세로젤라틴 등이 사용될 수 있다.
본 발명은 또 다른 관점에서, 상기 키메라 항원 수용체를 발현하는 면역세포를 개체에 투여하는 단계를 포함하는 암 치료방법에 관한 것이다.
본 발명은 또 다른 관점에서, 암 치료를 위한 상기 면역세포의 용도에 관한 것이다.
본 발명은 또 다른 관점에서, 암 치료용 약제 제조를 위한 상기 면역세포의 사용에 관한 것이다.
상기 대상체는 종양을 가진 포유류일 수 있으며, 구체적으로는 인간일 수 있으나, 이에 한정되는 것은 아니다.
본 발명에 따른 키메라 항원 수용체를 발현하는 면역세포 또는 이를 포함하는 조성물은 경구투여, 주입(infusion), 정맥내 투여(intravenous injection), 근육내 투여(intramuscular injection), 피하 투여(subcutaneous injection), 복강내 투여(intraperitoneal injectoon), 직장내 투여(Intrarectal administration), 국소 투여(topical administration), 비내 투여(intranasal injection) 등으로 투여될 수 있지만, 이에 한정되는 것은 아니다.
활성 성분의 투여량은 투여 경로, 환자의 연령, 성별, 체중 및 환자의 중증도 등의 여러 인자에 따라 적절히 선택될 수 있고, 본 발명에 따른 치료용 조성물은 암 증상을 예방, 개선 또는 치료하는 효과를 가지는 공지의 화합물과 병행하여 투여할 수 있다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 예시하기 위한 것으로서, 본 발명의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지 않는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예 1. ErbB3 (HER3) ScFv를 외부 도메인 (ectodomain)으로 하는 CAR를 발현하는 NK세포 제작
암세포에서 발현되는 ErbB3(HER3)에 특이적으로 결합하는 ErbB3 ScFv 후보 5종(442S1, 451M3, 472S2, 446, 464)을 CAR의 외부 도메인 (ectodomain)으로 사용하여 CAR 구조체를 제작하였다.
Figure PCTKR2022007396-appb-img-000001
CAR가 세포 표면으로 발현되는 것을 확인하기 위하여 외부 도메인 (ectodomain)에 myc과 힌지 (hinge)를 발현하도록 하였으며, CD28과 DAP10 및 살상능에 관여하는 CD3zeta를 엔도 도메인 (endodomain)으로 이용하였다.
각 도메인에 대응하는 구체적인 서열 정보는 다음 표 2에 나타내었다.
Figure PCTKR2022007396-appb-img-000002
각각의 CAR 구조체 5종을 렌티바이러스 (lentiviral vector)에 삽입하고, CAR를 발현하는 렌티바이러스를 제작하였으며, 이를 이용하여 CAR를 발현하는 NK92 세포주를 확립하였다 (도 2).
실시예 2. ErbB3를 발현하는 암세포에 대한 ErbB3-CAR NK92의 효능 확인
암세포에 대한 ErbB3-CAR NK92의 살상능(cytotoxicity)을 확인하기 위하여 ErbB3를 발현하는 암세포주를 유세포분석기(Flowcytometry)를 이용하여 확인 및 선별하였으며(도 3a), Calcein-AM법을 이용하여 각 암세포에 대한 ErbB3-CAR NK92의 세포독성 (cytotoxicity)을 비교하였다. 대조군(NK92 또는 PURO-NK92)과 비교하여 ErbB3를 발현하는 암세포에 대한 각 CAR NK92의 세포독성이 증가됨을 확인하였으며, ErbB3를 발현하지 않는 암세포에서는 대조군과 유사한 세포독성을 보임을 확인하였다 (도 3b).
또한, 5종의 ErbB3-CAR NK92 후보 중 세포독성이 높은 3종(442S1, 451M3, 472S2)를 선별하여, CAR NK92와 암세포의 비율(Effector cell: Target cell; E:T ratio)에 따른 세포독성을 재확인하였다. ErbB3를 발현하는 암세포에서는 CAR NK92 3종 모두 E:T ratio에 따른 세포독성을 보이는 것을 확인하였으며, ErbB3를 발현하지 않는 암세포에 대해서는 세포독성이 대조군과 유사함을 확인하였다 (도 4).
더욱이, 각 ErbB3-CAR NK92세포를 암세포와 공동배양 (co-culture)한 후 분비되는 사이토카인 (cytokine)의 양 및 탈과립 (degranulation)의 정도를 확인하였다. ELISA법을 이용하여 사이토카인 (IFN-r)의 양을 확인한 결과 ErbB3를 발현하는 암세포와 공동배양한 CAR NK92 세포에서 대조군 대비 더 많은 양의 IFN-r가 분비되었음을 확인하였으며(도 5a), 탈과립 또한 CD107a의 발현양으로 확인 한 결과 ErbB3를 발현하는 암세포와 공동배양한 군에서 더 많이 발현됨을 확인하였다 (도 5b).
단일 세포 수준에서 ErbB3-CAR NK92의 세포독성 및 암세포와 접촉하는 빈도수(contact frequency), 암세포를 사멸하는데 소요되는 시간(killing time)을 확인한 결과 대조군(PURO-NK92, Ecto;Ectodomain이 결실된 구조의 NK92)과 암세포와 접촉하는 빈도수는 유사하게 나타난 반면, 세포독성은 대조군에 비하여 높게 나타났으며, 암세포를 사멸하는데 걸리는 시간 또한 대조군과 비교하여 더 짧은 것을 확인하였다 (도 6).
실시예 3. ErbB3-CAR NK92의 효능 비교
ErbB3-CAR NK92의 효능을 비교하기 위하여 타켓이 다른 외부 도메인 (ectodomain)을 갖는 CAR NK92 세포주와 세포독성을 비교하였다. ErbB2(HER2)를 타겟으로 하는 CAR NK92 두 종 (Cot-CAR NK92; universal concept의 CAR; HER2를 타겟으로 하는 매개체를 사용함, HER2-CAR NK92)과 ErbB3-CAR NK92 중 효능이 가장 좋은 442S1의 세포독성을 비교하였다. 각 CAR NK92 세포에서 CAR의 발현을 확인하였으며 (도 7a), 각 CAR NK92에 대한 타겟을 모두 발현하는 암세포를 선별하였다 (도 7b). 해당 암세포에 대한 세포독성을 비교해본 결과 다른 CAR NK92에 비하여 ErbB3-CAR NK92(442S1)의 세포독성이 월등히 높게 나타나는 것을 확인하였다 (도 7c).
또한, ErbB3-CAR NK92의 외부 도메인 (Ectodomain)에 이용된 ErbB3 ScFv(442S1)와 타겟이 동일한 타사의 ErbB3 Scfv(LJM716)를 이용하여 ADCC(Antibody-dependent cellular cytotoxicity)를 확인하였다. 각 ScFv가 해당 암세포에 결합하는지 여부를 Flow cytometry를 이용하여 확인하였으며(도 8a), CD16을 발현하는 NK92(CD16+NK92)세포(도 8b)를 이용하여 ADCC를 수행하였다. 그 결과 ErbB3를 발현하는 암세포에서 ErbB3-CAR NK92에 사용된 ErbB3 ScFv(442S1)가 타사의 ErbB3 ScFv(LJM716)에 비하여 높은 ADCC를 나타내는 것을 확인하였다 (도 8c).
더욱이, 타사의 ErbB3 ScFv(LJM716)로 CAR를 제작하여 CAR를 발현하는 NK92 세포주를 확립하고, ErbB3-CAR NK92(442S1)과 효능을 비교하였다. CAR의 외부 도메인 (Ectodomain)을 제외한 나머지 구조체 (Transmembrane과 endodomain)는 동일한 구조로 제작하였으며(도 9a), 렌티바이러스를 이용하여 CAR를 발현하는 NK92 세포주를 확립하였다(도 9b). 각 ErbB3-CAR NK92의 세포독성을 비교해본 결과, 442S1-CAR NK92 세포가 LJM716-CAR NK92세포다 타겟(ErbB3)이 발현하는 암세포에 대하여 더 높은 세포독성을 보이는 것을 확인하였으며, ErbB3를 발현하지 않는 암세포에 대해서는 두 CAR NK92세포의 세포독성이 유사함을 확인하였다 (도 9c).
ErbB3-CAR NK92(442S1)은 ErbB3를 발현하는 암세포에 대하여 특이적인 항암효능을 나타내며, 기존의 ErbB3 ScFv(LJM716)과 비교했을 때 더 높은 효능을 지니는 것을 확인하였다.
본 발명에 따른 키메라 항원 수용체는 ErbB3에 대한 우수한 친화도 및 결합력을 나타내며, 상기 키메라 항원 수용체를 발현하는 면역세포는 ErbB3을 발현하는 암세포에 대한 세포독성이 우수하여, 암 치료를 위한 면역세포 치료에 유용하게 사용될 수 있다.
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서 이러한 구체적 기술은 단지 바람직한 실시 양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서, 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.
전자파일 첨부하였음.

Claims (16)

  1. ErbB3 (Erb-B2 Receptor Tyrosine Kinase 3)에 특이적으로 결합하는 항원 결합 부위를 포함하는 세포외 도메인 (extracellular binding domain);
    막횡단 도메인(transmembrane domain); 및
    세포내 신호전달 도메인(intracellular signaling domain)을 포함하는 키메라 항원 수용체(Chimeric antigen receptor; CAR).
  2. 제1항에 있어서, 상기 ErbB3에 특이적으로 결합하는 결합 도메인은
    서열번호 1, 9, 17, 25 및 33으로 구성된 군에서 선택된 중쇄 CDR1,
    서열번호 2, 10, 18, 26, 34로 구성된 군에서 선택된 중쇄 CDR2,
    서열번호 3, 11, 19, 27, 35로 구성된 군에서 선택된 중쇄 CDR3; 및
    서열번호 4, 12, 20, 28 및 36로 구성된 군에서 선택된 경쇄 CDR1,
    서열번호 5, 13, 21, 29 및 37로 구성된 군에서 선택된 경쇄 CDR2, 및
    서열번호 6, 14, 22, 30 및 38로 구성된 군에서 선택된 경쇄 CDR3를 포함하는 항-ErbB3 항체의 단일 사슬 가변 단편(single chain variable fragment; scFv)인 것을 특징으로 하는 키메라 항원 수용체.
  3. 제1항에 있어서, 상기 ErbB3에 특이적으로 결합하는 결합 도메인은 서열번호 7, 15, 23, 31 및 39로 구성된 군에서 선택된 서열을 포함하는 중쇄 가변영역을 포함하는 항-ErbB3 항체의 단일 사슬 가변 단편(single chain variable fragment; scFv)인 것을 특징으로 하는 키메라 항원 수용체.
  4. 제1항에 있어서, 상기 ErbB3에 특이적으로 결합하는 결합 도메인은 서열번호 8, 16, 24, 32 및 40로 구성된 군에서 선택된 서열을 포함하는 경쇄 가변영역을 포함하는 항-ErbB3 항체의 단일 사슬 가변 단편(single chain variable fragment; scFv)인 것을 특징으로 하는 키메라 항원 수용체.
  5. 제1항에 있어서, 상기 세포외 도메인은 신호 펩티드(signal peptide) 및/또는 힌지(hinge)를 더 포함하는 것을 특징으로 하는 키메라 항원 수용체.
  6. 제5항에 있어서, 상기 신호 펩티드는 CD8의 신호 펩티드인 것을 특징으로 하는 키메라 항원 수용체.
  7. 제5항에 있어서, 상기 힌지는 CD28 또는 CD8의 힌지를 포함하는 것을 특징으로 하는 키메라 항원 수용체.
  8. 제1항에 있어서, 상기 막횡단 도메인은 T-세포 수용체(TCR)의 알파(α), 베타(β) 또는 제타(ζ) 사슬, CD28, CD3 엡실론(ε), CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 및 CD154로 구성된 군에서 선택되는 것을 특징으로 하는 키메라 항원 수용체.
  9. 제1항에 있어서, 상기 세포내 신호전달 도메인은
    T-세포 수용체(TCR) 제타(ζ), FcR 감마(γ), FcR 베타(β), CD3 감마(γ), CD3 델타(δ), CD3 엡실론(ε), CD3 제타(ζ), CD5, CD22, CD79a, CD79b 및 CD66d로 구성된 군에서 선택되는 1차 신호전달 도메인(primary signaling domain); 및/또는
    CD2, CD7, CD27, CD28, CD30, CD40, 4-1BB(CD137), OX40(CD134), CDS, ICAM-1, ICOS(CD278), LFA-1(CD11a/CD18), GITR, MyD88, DAP10, DAP12, PD-1, LIGHT, NKG2C, B7-H3 및 CD83과 특이적으로 결합하는 리간드로 구성된 군에서 선택되는 공자극 신호전달 도메인(co-stimulatory signaling domain)을 포함하는 것을 특징으로 하는 키메라 항원 수용체.
  10. 제1항 내지 제9항 중 어느 한 항에 따른 키메라 항원 수용체를 코딩하는 핵산.
  11. 제10항의 핵산을 포함하는 발현 벡터.
  12. 제11항의 발현 벡터를 포함하는 바이러스.
  13. 제1항 내지 제9항 중 어느 한 항의 키메라 항원 수용체를 표면에 발현하는 면역세포.
  14. 제13항에 있어서, 상기 면역세포는 T 세포, NK 세포, NKT 세포, 사이토카인 유도 살해세포(Cytokine Induced Killer cell, CIK), 마크로파지 및 수지상세포로 구성된 군에서 선택되는 것을 특징으로 하는 면역세포.
  15. 제13항의 면역세포를 포함하는 암 치료용 조성물.
  16. 제15항에 있어서, 상기 암은 유방암인 것을 특징으로 하는 암 치료용 조성물.
PCT/KR2022/007396 2021-05-25 2022-05-25 Erbb3 특이적인 키메라 항원 수용체 및 이를 발현하는 면역세포 치료제 WO2022250440A1 (ko)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR1020210066590A KR20220159507A (ko) 2021-05-25 2021-05-25 ErbB3 특이적인 키메라 항원 수용체 및 이를 발현하는 면역세포 치료제
KR10-2021-0066590 2021-05-25

Publications (1)

Publication Number Publication Date
WO2022250440A1 true WO2022250440A1 (ko) 2022-12-01

Family

ID=84228993

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/007396 WO2022250440A1 (ko) 2021-05-25 2022-05-25 Erbb3 특이적인 키메라 항원 수용체 및 이를 발현하는 면역세포 치료제

Country Status (4)

Country Link
KR (1) KR20220159507A (ko)
AR (1) AR125935A1 (ko)
TW (1) TW202246311A (ko)
WO (1) WO2022250440A1 (ko)

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102644398B1 (ko) * 2023-01-06 2024-03-07 의료법인 명지의료재단 옻나무 추출물과 사이토카인 유도 살해세포를 포함하는 면역항암 조성물

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20190055008A (ko) * 2017-11-14 2019-05-22 앱클론(주) 항-her2 항체 또는 그의 항원 결합 단편, 및 이를 포함하는 키메라 항원 수용체
US20200289561A1 (en) * 2016-06-20 2020-09-17 Shanghai Cell Therapy Research Institute Killer cell capable of efficiently and stably expressing antibody, and uses thereof
EP3733839A1 (en) * 2017-12-28 2020-11-04 Shanghai Cell Therapy Group Co., Ltd Antibody-modified chimeric antigen receptor modified t cell and uses thereof
US20200354676A1 (en) * 2017-11-10 2020-11-12 Chineo Medical Technology Co., Ltd. Modified immune cells and uses thereof
KR20210021347A (ko) * 2018-06-13 2021-02-25 지모아브 모노클로널스 게엠베하 다양한 다중 항원의 표적화를 위한 역방향 범용 키메라 항원 수용체 발현 면역 세포, 이의 제조 방법 및 암, 감염증 및 자가면역 장애의 치료를 위한 이의 용도

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20200289561A1 (en) * 2016-06-20 2020-09-17 Shanghai Cell Therapy Research Institute Killer cell capable of efficiently and stably expressing antibody, and uses thereof
US20200354676A1 (en) * 2017-11-10 2020-11-12 Chineo Medical Technology Co., Ltd. Modified immune cells and uses thereof
KR20190055008A (ko) * 2017-11-14 2019-05-22 앱클론(주) 항-her2 항체 또는 그의 항원 결합 단편, 및 이를 포함하는 키메라 항원 수용체
EP3733839A1 (en) * 2017-12-28 2020-11-04 Shanghai Cell Therapy Group Co., Ltd Antibody-modified chimeric antigen receptor modified t cell and uses thereof
KR20210021347A (ko) * 2018-06-13 2021-02-25 지모아브 모노클로널스 게엠베하 다양한 다중 항원의 표적화를 위한 역방향 범용 키메라 항원 수용체 발현 면역 세포, 이의 제조 방법 및 암, 감염증 및 자가면역 장애의 치료를 위한 이의 용도

Also Published As

Publication number Publication date
AR125935A1 (es) 2023-08-23
KR20220159507A (ko) 2022-12-05
TW202246311A (zh) 2022-12-01

Similar Documents

Publication Publication Date Title
WO2019112347A2 (ko) 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도
WO2020032784A1 (ko) Hla-dr에 결합하는 키메라 항원 수용체 및 car-t 세포
WO2021256724A1 (ko) Bcma를 표적으로 하는 키메라 항원 수용체 및 이의 용도
WO2014025198A2 (ko) Lfa3 변이체 및 상기 변이체 또는 lfa3 cd2 결합영역과 이에 표적 특이적 폴리펩타이드가 연결된 융합단백질 및 그 용도
WO2020005003A1 (ko) Lag-3에 특이적으로 결합하는 단클론항체 및 이의 용도
WO2017030370A1 (ko) 항-코티닌 항체가 연결된 키메라 항체 수용체 및 이의 용도
WO2018222019A1 (ko) 신규한 항-ｃｄ40 항체 및 이의 용도
WO2021235696A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2019132533A1 (ko) 항-pd-l1 항체 및 이의 용도
WO2019078699A2 (ko) 항-vista 항체 및 이의 용도
WO2022250440A1 (ko) Erbb3 특이적인 키메라 항원 수용체 및 이를 발현하는 면역세포 치료제
WO2022025638A1 (ko) 면역시냅스를 안정화시키는 키메라 항원 수용체(car) t 세포
WO2019125070A1 (ko) 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이의 용도
WO2024049161A1 (ko) 신규한 항-pd-l1 키메릭 항원 수용체 및 이를 발현하는 면역세포
WO2023003404A1 (ko) 신규한 키메릭 항원 수용체 및 이를 발현하는 면역세포
WO2023277361A1 (ko) 메소텔린 특이적 항체 및 이의 용도
WO2021235697A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2021210939A1 (ko) 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체
CN115725503A (zh) 工程化免疫细胞
WO2023014182A1 (ko) 신규한 항-epha2 키메릭 항원 수용체 및 이를 발현하는 면역세포
WO2023027471A1 (ko) 기능이 강화된 신규 키메라 항원 수용체(car)
WO2022186682A1 (ko) Rank 리간드(rank ligand)에 특이적으로 결합하는 키메릭 항원 수용체 및 이의 용도
WO2022231298A1 (ko) 신규한 항-cd5 키메릭 항원 수용체 및 이를 발현하는 면역세포
WO2023068584A1 (ko) Cd138에 특이적으로 결합하는 키메릭 항원 수용체 및 이의 용도
WO2023075177A1 (ko) Cadm1에 특이적으로 결합하는 키메릭 항원 수용체 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22811633

Country of ref document: EP

Kind code of ref document: A1

NENP Non-entry into the national phase

Ref country code: DE