WO2022231298A1 - 신규한 항-cd5 키메릭 항원 수용체 및 이를 발현하는 면역세포 - Google Patents

신규한 항-cd5 키메릭 항원 수용체 및 이를 발현하는 면역세포 Download PDF

Info

Publication number
WO2022231298A1
WO2022231298A1 PCT/KR2022/006009 KR2022006009W WO2022231298A1 WO 2022231298 A1 WO2022231298 A1 WO 2022231298A1 KR 2022006009 W KR2022006009 W KR 2022006009W WO 2022231298 A1 WO2022231298 A1 WO 2022231298A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
cells
amino acid
acid sequence
car
Prior art date
Application number
PCT/KR2022/006009
Other languages
English (en)
French (fr)
Inventor
김태돈
조선아
이수연
Original Assignee
한국생명공학연구원
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 한국생명공학연구원 filed Critical 한국생명공학연구원
Priority to EP22796130.7A priority Critical patent/EP4332118A1/en
Priority to JP2023566973A priority patent/JP2024516263A/ja
Publication of WO2022231298A1 publication Critical patent/WO2022231298A1/ko

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/0005—Vertebrate antigens
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/461—Cellular immunotherapy characterised by the cell type used
    • A61K39/4613—Natural-killer cells [NK or NK-T]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/463—Cellular immunotherapy characterised by recombinant expression
    • A61K39/4631—Chimeric Antigen Receptors [CAR]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464402—Receptors, cell surface antigens or cell surface determinants
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K39/46—Cellular immunotherapy
    • A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643—Vertebrate antigens
    • A61K39/4644—Cancer antigens
    • A61K39/464402—Receptors, cell surface antigens or cell surface determinants
    • A61K39/464429—Molecules with a "CD" designation not provided for elsewhere
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503—Immunoglobulin superfamily
    • C07K14/7051—T-cell receptor (TcR)-CD3 complex
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596—Molecules with a "CD"-designation not provided for elsewhere
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06—Animal cells or tissues; Human cells or tissues
    • C12N5/0602—Vertebrate cells
    • C12N5/0634—Cells from the blood or the immune system
    • C12N5/0646—Natural killers cells [NK], NKT cells
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
    • A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the structure of the chimeric antigen receptor [CAR]
    • A61K2239/23—On/off switch
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2319/00—Fusion polypeptide
    • C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • C—CHEMISTRY; METALLURGY
    • C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00—Genetically modified cells

Definitions

  • the present invention relates to a novel antibody or antigen-binding fragment thereof that specifically binds to CD5, a chimeric antigen receptor comprising the antigen-binding fragment of the antibody, and an immune cell expressing the chimeric antigen receptor.
  • TIL tumor infiltrating lymphocytes
  • CAR Chimeric antigen receptor
  • TCR T-cell receptor
  • the CD5 is a kind of differentiation cluster expressed in T cells and B cells, is mainly found in bone marrow or lymphoid tissues, and is mainly used as a marker of T cells because it is overexpressed in T cells rather than B cells.
  • CD5 since CD5 is expressed not only in most T cell tumors but also in normal T cells, anti-CD5 CAR-T cells attack not only T cell tumors but also normal T cells, or even inject anti-CD5 CAR- There was a problem of self-cross-reaction, which also attacks the T cell itself (Ref. 1). As a result, there is a problem in that normal T cells and anti-CD5 CAR-T cells are reduced, and eventually even the anticancer effect is reduced.
  • Patent Document 1 Korean Patent Publication No. 2018-0002604
  • Patent Document 2 Korean Patent Publication No. 2,122,546
  • An object of the present invention is to provide an antibody or antigen-binding fragment thereof capable of specifically binding to CD5.
  • Another object of the present invention is to provide a novel chimeric antigen receptor capable of amplifying cytotoxic or cytolytic activity against cancer cells when expressed in immune cells.
  • Another object of the present invention is to provide a polynucleotide and an expression vector for expressing the chimeric antigen receptor.
  • Another object of the present invention is to provide immune cells having excellent therapeutic effects on cancer by expressing the chimeric antigen receptor on the surface.
  • Another object of the present invention is to provide a pharmaceutical composition for treating cancer using the immune cells.
  • one aspect of the present invention is i) a heavy chain CDR1 having any one amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 10, SEQ ID NO: 18 and SEQ ID NO: 26, ii) SEQ ID NO: 3, a heavy chain CDR2 having any one amino acid sequence selected from the group consisting of SEQ ID NO: 11, SEQ ID NO: 19 and SEQ ID NO: 27, and iii) from the group consisting of SEQ ID NO: 4, SEQ ID NO: 12, SEQ ID NO: 20 and SEQ ID NO: 28 a heavy chain variable region comprising a heavy chain CDR3 having any one selected amino acid sequence; And iv) a light chain CDR1 having any one amino acid sequence selected from the group consisting of SEQ ID NO: 6, SEQ ID NO: 14, SEQ ID NO: 22 and SEQ ID NO: 30, v) SEQ ID NO: 7, SEQ ID NO: 15, SEQ ID NO: 23 and SEQ ID NO: A light chain CDR2
  • the heavy chain variable region may be any one selected from the group consisting of SEQ ID NO: 5, SEQ ID NO: 13, SEQ ID NO: 21 and SEQ ID NO: 29.
  • the light chain variable region may be any one selected from the group consisting of SEQ ID NO: 9, SEQ ID NO: 17, SEQ ID NO: 25 and SEQ ID NO: 33.
  • Another aspect of the present invention is an extracellular domain comprising an antigen binding site that specifically binds to CD5 (extracellular binding domain); transmembrane domain; and an intracellular signaling domain; a chimeric antigen receptor (CAR), wherein the antigen binding site specifically binding to CD5 is i) SEQ ID NO: 2, SEQ ID NO: Heavy chain CDR1 having any one amino acid sequence selected from the group consisting of 10, SEQ ID NO: 18 and SEQ ID NO: 26, ii) any one selected from the group consisting of SEQ ID NO: 3, SEQ ID NO: 11, SEQ ID NO: 19 and SEQ ID NO: 27 iv) a heavy chain variable region comprising a heavy chain CDR2 having an amino acid sequence of Light chain CDR1 having any one amino acid sequence selected from the group consisting of number 6, SEQ ID NO: 14, SEQ ID NO: 22 and SEQ ID NO: 30, v) the group consisting of SEQ ID NO: 7, SEQ ID NO: 15, SEQ ID NO: 23 and SEQ ID NO: 31 A
  • Another aspect of the present invention provides a polynucleotide comprising a nucleotide sequence encoding the chimeric antigen receptor, and an expression vector comprising the polynucleotide.
  • the immune cells may be natural killer cells, T cells, natural killer T cells, cytokine-induced killer cells, macrophages, or dendritic cells. Another aspect of the present invention is to prevent cancer or A therapeutic pharmaceutical composition is provided.
  • the cancer may be a hematologic cancer including leukemia or lymphoma, and the cancer is thymic carcinoma, non-Hodgkin lymphoma, diffuse large cell lymphoma, small lymphocytic cell lymphoma. lymphocytic lymphoma, T-cell neoplasma, peripheral T-cell lymphoma, mantle cell lymphoma, T-cell acute lymphobalstic lymphoma ) or chronic lymphoblastic lymphoma.
  • the antibody, antigen-binding fragment thereof, and chimeric antigen receptor using the same of the present invention can specifically bind to CD5 expressed in cancer cells, and thus signal transduction in immune cells expressing the chimeric antigen receptor As it occurs, it significantly improves the cytotoxicity or cytolytic activity of immune cells and has the effect of promoting the secretion of cytokines. In addition, there is an effect of increasing the degranulation of cancer cells co-cultured with the immune cells, and in the case of immune cells expressing the chimeric antigen receptor, the reactivity is reduced with respect to normal cells expressing CD5. indicates
  • the antibody of the present invention or a chimeric antigen receptor comprising the same, and immune cells expressing the same can be used for treating cancer.
  • CD5-CAR chimeric antigen receptor
  • ScFv single chain variable fragment
  • CD5#1-CAR-NK cell CD5#4-CAR-NK cell, CD5#11-CAR-NK cell and CD5#14-CAR-NK cells
  • CD5#1-CAR, CD5#4-CAR, CD5#11-CAR and CD5#14-CAR-NK cells the expression of the chimeric antigen receptors (CD5#1-CAR, CD5#4-CAR, CD5#11-CAR and CD5#14-CAR) of the present invention was confirmed. the results are shown.
  • CD5#1-CAR-NK cells shows natural killer cells (CD5#1-CAR-NK cells, CD5#4-CAR-NK cells, CD5#11-CAR-NK cells and CD5#14-CAR-NK cells), the cytotoxicity (cytolytic activity) of MOLT4 cells expressing CD5 and U937 cells not expressing CD5 was measured and compared.
  • CD5#11-CAR-NK cells and CD5#14-CAR-NK cells are natural killer cells into which the genes of the chimeric antigen receptors CD5#11-CAR and CD5#14-CAR of the present invention were introduced and expressed. of, shows the results of measuring and comparing the cytotoxicity (cytolytic activity) to CCRF-CEM cells expressing CD5 and Jurkat cells and Daudi cells not expressing CD5.
  • 5A and 5B to 5E show natural killer cells (CD5#1-CAR-NK cells, CD5#4-CAR-NK cells, CD5#11) into which four genes of the chimeric antigen receptor of the present invention were introduced and expressed.
  • -CAR-NK cells and CD5#14-CAR-NK cells secreted by natural killer cells (IFN- ⁇ ) when co-cultured with MOLT4 cells expressing CD5 or U937 cells not expressing CD5
  • IFN- ⁇ natural killer cells
  • Figure 6 shows natural killer cells (CD5#11-CAR-NK cells and CD5#14-CAR-NK cells) into which the genes of the chimeric antigen receptors CD5#11-CAR and CD5#14-CAR of the present invention were introduced and expressed. of, shows the results of measuring and comparing the cytotoxicity (cytolytic activity) to MNC (mononuclear cells) including normal cells expressing CD5.
  • cytotoxicity cytolytic activity
  • Figure 7a shows the chimeric antigen receptors CD5#11-CAR and CD5#14-CAR genes of the present invention introduced and expressed in natural killer cells (CD5#11-CAR-NK cells and CD5#14-CAR-NK cells) It shows the results of confirming the expression level of CD5-CAR in single cell lines in which they were isolated and propagated into single cells, and FIG. 7b shows the cytotoxicity (cytolytic activity) of each of the established single cell lines to MOLT4 cells and MNCs. to show the comparison results, and FIG. 7c shows the process of selecting a leader cell line from among the single cell lines established as described above.
  • FIG. 8 is a schematic diagram showing the structure of an mRNA construct designed to transiently express the chimeric antigen receptor (CD5-CAR) of the present invention.
  • Figure 11a is the result of confirming the expression level of ligands involved in the activation of natural killer cells in normal cells and cancer cell lines expressing CD5
  • Figure 11b is the expression level of B7-H6 for each leukocyte using MNC The measurement results are shown.
  • FIG. 12 shows the CD5#11-CAR-NK of the present invention for the cancer cell lines when the expression of B7-H6 was knocked down in MOLT4 cells and Jurkat cells, which are cancer cell lines expressing CD5. It is the result of confirming the change of cytotoxicity of cells.
  • FIG. 13 shows the results of measuring the expression levels of B7-H6 and CD5 over time after the CD5#11-CARNK cells of the present invention were treated in MOLT4 and MNC, which are cancer cell lines expressing CD5.
  • Novel anti-CD5 antibody, antigen-binding fragment thereof, and chimeric antigen receptor (CAR) comprising same, polynucleotide and expression vector for expressing the same
  • One aspect of the present invention provides an anti-CD5 antibody and antigen-binding fragment thereof capable of specifically binding to CD5.
  • the term “antibody” refers to an immunoglobulin molecule having reactivity by specific binding to an epitope of an antigen immunologically.
  • the antibody may include a monoclonal antibody, a polyclonal antibody, an antibody having a full-length chain structure (full-length antibody), a functional fragment having at least an antigen-binding function (antigen-binding fragment), and a recombinant antibody.
  • the antibody of the present invention may be a monoclonal antibody or an antigen-binding fragment thereof.
  • the monoclonal antibody refers to an antibody molecule of a single molecular composition obtained from a population of substantially identical antibodies, and the monoclonal antibody exhibits a single binding specificity and affinity for a specific epitope.
  • the full-length antibody has a structure having two full-length light chains and two full-length heavy chains, and each light chain may be linked to a heavy chain by a disulfide bond.
  • the antibody includes a heavy chain (HC) and light chain (LC) polypeptide, and the heavy chain and light chain may include a variable region and a constant region.
  • the constant region is a region mediating the binding of the antibody to various types of cells of the immune system (such as T-cells), host tissues including components of the complement system, and the like. If the constant region is the same type of antibody derived from the same species, it functions the same regardless of the type of antigen, and the amino acid sequence constituting it also has the same or high similarity for each antibody.
  • the constant region may be divided into a heavy chain constant region (which may be abbreviated as CH) and a light chain constant region (which may be abbreviated as CL).
  • the heavy chain constant region has a gamma ( ⁇ ), mu ( ⁇ ), alpha ( ⁇ ), delta ( ⁇ ) and / or epsilon ( ⁇ ) type, and subclasses gamma 1 ( ⁇ 1), gamma 2 ( ⁇ 2), gamma3 ( ⁇ 3), gamma 4 ( ⁇ 4), alpha1 ( ⁇ 1) and/or alpha2 ( ⁇ 2).
  • the light chain constant region has kappa ( ⁇ ) and lambda ( ⁇ ) types.
  • IgG is a subtype and includes IgG1, IgG2, IgG3 and IgG4.
  • variable region is an antigen-specific antibody region, and may be divided into a heavy chain variable region (which may be abbreviated as VH) and a light chain variable region (which may be abbreviated as VL).
  • the variable region may include three CDRs (complementary-determining regions, or complementarity determining regions) and four FRs (framework regions).
  • the CDR may be a ring-shaped region involved in antigen recognition, and specificity for the antigen may be determined according to the amino acid sequence of the CDR.
  • the CDRs may be referred to as CDR1, CDR2, or CDR3 according to their order, and depending on whether the CDR of any polypeptide of the heavy chain and light chain is CDR-H1, CDR-H2, CDR-H3 in the case of a heavy chain variable region, In the case of a light chain variable region, it may be referred to as CDR-L1, CDR-L2, CDR-L3.
  • FR can be referred to as FR-H1, FR-H2, FR-H3, FR-H4 in the case of a heavy chain variable region, and FR-L1, FR-L2, FR-L3, FR-L4 in the case of a light chain variable region. have.
  • the CDRs and FRs may be arranged in the following order in each variable region.
  • antigen-binding fragment refers to any fragment of a humanized antibody of the present invention that retains the antigen-binding function of the antibody.
  • the antigen-binding fragment may be referred to interchangeably with terms such as “fragment” and "antibody fragment”, and the antigen-binding fragment may be Fab, Fab', F(ab') 2 , Fv, etc., but is not limited thereto. .
  • the Fab has a structure having a light chain and heavy chain variable regions, a light chain constant region and a first constant region (CH1 domain) of the heavy chain, and has one antigen-binding site.
  • the Fab' is different from the Fab in that it has a hinge region including one or more cysteine residues at the C terminus of the heavy chain CH1 domain.
  • the F(ab') 2 is generated when a cysteine residue in the hinge region of Fab' forms a disulfide bond.
  • the Fv refers to a minimal antibody fragment having only a heavy chain variable region and a light chain variable region.
  • the heavy chain variable region and the light chain variable region are connected by a non-covalent bond
  • the heavy chain variable region and the light chain variable region are generally covalently bonded through a peptide linker. or directly linked at the C-terminus to form a dimer-like structure like a double-stranded Fv.
  • the antigen-binding fragment can be prepared by using a proteolytic enzyme (for example, by restriction digestion of the whole antibody with papain, Fab can be obtained, and when digested with pepsin, a F(ab')2 fragment can be obtained), or It may be produced through genetic recombination technology, but is not limited thereto.
  • a proteolytic enzyme for example, by restriction digestion of the whole antibody with papain, Fab can be obtained, and when digested with pepsin, a F(ab')2 fragment can be obtained
  • It may be produced through genetic recombination technology, but is not limited thereto.
  • the linker may be a peptide linker, and may have a length of about 10 to 25 amino acids.
  • the linker may include a hydrophilic amino acid such as glycine (G) and/or serine (S).
  • the linker may include, for example, (GS)n, (GGS)n, (GSGGS)n or (GnS)m (n and m are each 1 to 10), for example, (GnS)m( Each of n and m may be 1 to 10), but is not limited thereto.
  • epitope refers to a specific site on an antigen that can be specifically recognized and bound to an immunoglobulin, an antibody, or an antigen-binding fragment thereof.
  • the epitope may be formed from contiguous amino acids or from discontinuous amino acids juxtaposed by tertiary folding of the protein.
  • the "specifically binds" may refer to binding to another molecule with a binding affinity greater than background binding, for example, the extracellular domain has an affinity for a target antigen of about 10 -5 M or greater or a Ka (equilibrium dissociation constant of a specific binding interaction with units of 1/M) may be binding to the target antigen.
  • the affinity may be such that the equilibrium dissociation constant (Kd) of a specific binding interaction with units of M is 10 -5 M to 10 -13 M or less than or equal to the above range.
  • the antibody or antigen-binding fragment thereof of the present invention is i) a heavy chain CDR1 having any one amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 10, SEQ ID NO: 18 and SEQ ID NO: 26, ii) SEQ ID NO: 3, Heavy chain CDR2 having any one amino acid sequence selected from the group consisting of SEQ ID NO: 11, SEQ ID NO: 19 and SEQ ID NO: 27, and iii) selected from the group consisting of SEQ ID NO: 4, SEQ ID NO: 12, SEQ ID NO: 20 and SEQ ID NO: 28 a heavy chain variable region comprising a heavy chain CDR3 having any one amino acid sequence; And iv) a light chain CDR1 having any one amino acid sequence selected from the group consisting of SEQ ID NO: 6, SEQ ID NO: 14, SEQ ID NO: 22 and SEQ ID NO: 30, v) SEQ ID NO: 7, SEQ ID NO: 15, SEQ ID NO: 23 and SEQ ID NO: A light chain CDR2 having
  • the heavy chain variable region may have the amino acid sequence of SEQ ID NO: 5, SEQ ID NO: 13, SEQ ID NO: 21 or SEQ ID NO: 29.
  • the light chain variable region may have the amino acid sequence of SEQ ID NO: 9, SEQ ID NO: 17, SEQ ID NO: 25 or SEQ ID NO: 33.
  • the light chain variable region may have the amino acid sequence of SEQ ID NO: 8 or SEQ ID NO: 16.
  • the antibody or antigen-binding fragment thereof of the present invention may further include a heavy chain constant region and/or a light chain constant region of, for example, a human-derived antibody, wherein the antibody or antigen-binding fragment thereof specifically binds to CD5.
  • the heavy chain constant region and/or the light chain constant region of the human-derived antibody may be used without limitation on its type or amino acid sequence, as long as the properties are not impaired.
  • amino acid sequences described above may include variants having different sequences by deletion, insertion, substitution, or a combination of amino acid residues within the range that does not affect the structure, function, activity, etc. of the polypeptide comprising the same.
  • amino acid sequences may include amino acids that have undergone conventional modifications known in the art, and the amino acid modifications are, for example, phosphorylation, sulfation, acrylation, glycosylation, methylation ( methylation), farnesylation, and the like.
  • the humanized antibody or antigen-binding fragment thereof of the present invention includes not only the amino acid sequences described above, but also those having substantially the same amino acid sequence or variants thereof.
  • the meaning of having the substantially identical amino acid sequence is 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more as the amino acid sequence described above. % or more, 99% or more, or may include an amino acid sequence having homology of 99.5% or more, but is not limited thereto.
  • chimeric antigen receptor is a synthetic complex designed to induce an immune response against a target antigen and a cell expressing the antigen when it is recognized and bound.
  • a chimeric antigen receptor may include an extracellular binding domain, a transmembrane domain, and an intracellular signaling domain.
  • the chimeric antigen receptor is expressed on the surface of immune cells and binds to a specific antigen, such as an antigen specifically expressed on the surface of a cancer cell, through an antigen binding site contained in the extracellular domain, thereby signaling within the immune cell. Since it can change the activity of immune cells by causing delivery, it is possible to induce an immune response by targeting only a specific antigen.
  • the chimeric antigen receptor (CAR) of the present invention includes an extracellular binding domain comprising an antigen binding site that specifically binds to CD5 (ephrin type-A receptor 2); transmembrane domain; and an intracellular signaling domain.
  • CD5 ephrin type-A receptor 2
  • transmembrane domain ephrin type-A receptor 2
  • intracellular signaling domain ephrin type-A receptor 2
  • the antigen binding site specifically binding to CD5 is, i) a heavy chain CDR1 having any one amino acid sequence selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 10, SEQ ID NO: 18 and SEQ ID NO: 26, ii) SEQ ID NO: 3, a heavy chain CDR2 having any one amino acid sequence selected from the group consisting of SEQ ID NO: 11, SEQ ID NO: 19 and SEQ ID NO: 27, and iii) from the group consisting of SEQ ID NO: 4, SEQ ID NO: 12, SEQ ID NO: 20 and SEQ ID NO: 28
  • a heavy chain variable region comprising a heavy chain CDR3 having any one selected amino acid sequence and iv) a light chain CDR1 having any one amino acid sequence selected from the group consisting of SEQ ID NO: 6, SEQ ID NO: 14, SEQ ID NO: 22 and SEQ ID NO: 30 , v) a light chain CDR2 having any one amino acid sequence selected from the group consisting of SEQ ID NO: 7, SEQ ID NO
  • the chimeric antigen receptor of the present invention When the chimeric antigen receptor of the present invention is expressed on the surface of an immune cell, when CD5, a target antigen, binds to the receptor, a signal transduction occurs within the immune cell, and the cytotoxicity (or cytolysis) of the immune cell occurs. activity) and/or promotion of cytokine secretion of the immune cells may be induced.
  • the improvement of the cytotoxicity (or cytolytic activity) or the promotion of cytokine secretion is cytotoxicity (or cytolysis) at a higher level than the cytotoxicity (or cytolytic activity) or cytokine secretion exhibited by immune cells in the absence of antigen. activity) or secreting cytokines at high levels.
  • the extracellular domain may further include at least one selected from the group consisting of a hinge domain and a spacer domain.
  • the antigen binding site of the extracellular domain may be linked to the transmembrane domain via a hinge domain and/or a spacer domain.
  • the hinge domain is, to enable proper cell/cell contact, binding of an appropriate antigen/antigen binding site, and activation of an appropriate chimeric antigen receptor, the antigen binding site from the surface of an immune cell expressing the chimeric antigen receptor. As a part that allows physically spaced apart, it may play an important role in the positioning of the extracellular domain.
  • the chimeric antigen receptor may comprise one or more hinge domains between the extracellular domain and the transmembrane domain.
  • the hinge domain may be derived from natural, synthetic, semi-synthetic or recombinant sources.
  • the hinge domain may comprise the amino acid sequence of a naturally occurring immunoglobulin hinge region or an altered immunoglobulin hinge region.
  • the altered hinge region comprises (a) a naturally occurring hinge region having at most 30% amino acid change (eg, at most 25%, 20%, 15%, 10% or 5% amino acid substitutions or deletions), (b) at most 30 a native of at least 10 amino acids (e.g., at least 12, 13, 14 or 15 amino acids) in length with % amino acid change (e.g., amino acid substitutions or deletions of up to 25%, 20%, 15%, 10% or 5%) part of a developing hinge region, or (c) a core hinge region, which is 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15, or at least 4, 5, 6, 7, 8 , 9, 10, 11, 12, 13, 14 or 15 amino acids in length).
  • one or more cysteine residues in the naturally occurring immunoglobulin hinge region may be substituted with one or more other amino acid residues (eg, one or more serine residues).
  • the altered immunoglobulin hinge region may alternatively or additionally have a proline residue of the wild-type immunoglobulin hinge region substituted with another amino acid residue, such as cysteine.
  • the hinge domain may be a hinge region derived from the extracellular domain of a type 1 membrane protein such as CD8, CD4, CD28 and CD7, but if it is capable of connecting the antigen-binding site, the transmembrane domain, and the intracellular signaling domain between the cell membranes Any of them may be used without limitation. It can also be a wild-type hinge region from these molecules or it can be changed.
  • the spacer domain may be referred to as a linking domain, for example, it may include a hinge domain derived from CD28 and/or a hinge domain derived from CD8, and the entire or It may include some.
  • the hinge domain and/or spacer domain may be at least one selected from the group consisting of Myc epitope, CD8 hinge domain, and Fc, and specifically may include Myc epitope and CD8 hinge domain.
  • the transmembrane domain refers to a partial region that connects and fuses the extracellular domain and the intracellular signaling domain with each other and serves to fix the chimeric antigen receptor to the plasma membrane of an immune cell.
  • the transmembrane domain may be derived from a natural, synthetic, semi-synthetic or recombinant source.
  • the transmembrane domain is the alpha ( ⁇ ), beta ( ⁇ ) or zeta ( ⁇ ) chain of T-cell receptor (TCR), CD28, CD3 epsilon ( ⁇ ), CD45, CD4, CD5, CD8, CD9, CD16, CD22 , CD33, CD37, CD64, CD80, CD86, CD134, CD137 and CD154 may be any one selected from the group consisting of, but is not limited thereto.
  • the transmembrane domain may be attached to the extracellular domain via a linker.
  • the linker may be a short oligopeptide or polypeptide linker of 2 to 10 amino acids in length, such as, but not limited to, a glycine (G)-serine (S) doublet.
  • the intracellular signaling domain is an immune cell function (eg, activation, including release of a cytotoxic (or cytolytic activity) factor to a target cell to which the chimeric antigen receptor and antigen are bound, cytokine production, To induce proliferation and cytotoxic or cytolytic activity, or other cellular responses induced by the antigen binding) corresponds to the part.
  • the intracellular signaling domain may be part of a protein that transmits an operative function signal and directs the cell to perform a specific function.
  • an intracellular signaling domain previously used in the development of a chimeric antigen receptor may be used. Specifically, it may include only CD3 ⁇ , which was used in the first generation CAR (chimeric antigen receptor). And, as used in the second-generation CAR, a form in which a costimulatory domain (CD28 or CD137/4-1BB) and CD3 ⁇ are combined can be used to improve responsiveness to immune cells. In addition, two or more co-stimulatory domains can be used as used in the third-generation CAR, and in this case, the co-stimulatory domain is 4-1BB, CD28 or OX40, etc. can be combined.
  • the CAR-based immunoprotein of the cytokine can be further expressed, and the 5th generation CAR
  • an interleukin receptor chain for example, IL-2R ⁇ , may be further included to enhance immune cells.
  • the intracellular signaling domain includes T-cell receptor (TCR) zeta ( ⁇ ), FcR gamma ( ⁇ ), FcR beta ( ⁇ ), CD3 gamma ( ⁇ ), CD3 delta ( ⁇ ), CD3 epsilon ( ⁇ ), CD3 It may include at least one selected from the group consisting of zeta ( ⁇ ), CD5, CD22, CD79a, CD79b, and CD66d.
  • activation of the immune cell by the intracellular signaling domain may be mediated by two different classes of intracellular signaling domains.
  • immune cell activation can be mediated by a primary signaling domain that initiates antigen-dependent primary activation and a costimulatory signaling domain that acts in an antigen-independent manner to provide a secondary signal.
  • the intracellular signaling domain may include a primary signaling domain and a co-stimulatory signaling domain.
  • the primary signaling domain refers to a signaling domain that regulates immune cell activation in a stimulating or inhibitory manner.
  • a primary signaling domain that acts in a stimulatory manner may contain a signaling motif known as an immunoreceptor tyrosine-based activation motif or ITAM.
  • ITAM containing the primary signaling domain may be, but is not limited to, TCR ⁇ , FcR ⁇ , FcR ⁇ , CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , CD5, CD22, CD79a, CD79b, CD66d, and the like. More specifically, the primary signaling domain may be CD3 ⁇ (zeta), but is not limited thereto.
  • the co-stimulatory signaling domain refers to an intracellular signaling domain of a co-stimulatory molecule.
  • the costimulatory signaling domains are CD2, CD7, CD27, CD28, CD30, CD40, 4-1BB (CD137), OX40 (CD134), CDS, ICAM-1, ICOS (CD278), LFA-1 (CD11a/CD18) , GITR, MyD88, DAP10, DAP12, PD-1, LIGHT, NKG2C, CD5, CD83, and the like may include a co-stimulatory signaling domain selected from the group consisting of, but is not limited thereto. .
  • the costimulatory molecule may be DAP10, but is not limited thereto.
  • the chimeric antigen receptor may include two or more intracellular signaling domains, and when it includes two or more intracellular signaling domains, the intracellular signaling domains may be connected in series with each other. Alternatively, it may be linked through a polypeptide linker consisting of 2 to 10 amino acids, and the linker sequence may be, for example, a glycine-serine sequence.
  • the linker may include, for example, (GS)n, (GGS)n, (GSGGS)n or (GnS)m (n and m are each 1 to 10), for example, (GnS)m( Each of n and m may be 1 to 10), but is not limited thereto.
  • the chimeric antigen receptor may further include a signal (signal) peptide for domain exposure.
  • the signal (signal) peptide may be any type of secreted or transmembrane protein, which may direct the transport of the chimeric antigen receptor to the cell membrane or cell surface and provide precise localization.
  • a specific type may be CD8 alpha or mouse light kappa signal peptide, but is not limited thereto.
  • the chimeric antigen receptor of the present invention when expressed on the surface of immune cells to recognize and bind to CD5, it is possible to improve the cytotoxicity or cytolytic activity of immune cells or induce cytokine secretion of immune cells. can Therefore, when the antigen-binding site of the chimeric antigen receptor recognizes and binds to an antigen in the presence of cancer cells expressing CD5, the cytotoxicity or cytolytic activity of immune cells is enhanced by signal transduction and/or cytokine secretion is promoted This can be induced, so it can be usefully used as a chimeric antigen receptor with excellent cytotoxic or cytolytic efficacy against cancer cells.
  • Another aspect of the present invention provides a polynucleotide and an expression vector for expressing the chimeric antigen receptor.
  • the polynucleotide includes a nucleotide sequence encoding the chimeric antigen receptor.
  • polynucleotide comprehensively includes DNA (gDNA and cDNA) and RNA molecules, and the basic structural unit nucleotide includes not only natural nucleotides, but also analogs in which sugar or base sites are modified. do.
  • the polynucleotide of the present invention may include a nucleotide sequence encoding an antigen-binding fragment of the anti-CD5 antibody that specifically binds to CD5.
  • polynucleotide of the present invention may include not only the nucleotide sequence encoding the antigen-binding fragment, but also a nucleotide sequence encoding other extracellular domain portions linked thereto, the transmembrane domain and/or the intracellular signaling domain. have.
  • chimeric antigen receptor such as the antibody, the antigen-binding fragment, the extracellular domain, the transmembrane domain, and the intracellular signaling domain, is the same as those described above.
  • the polynucleotide of the present invention may include a nucleotide sequence substantially identical to the nucleotide sequence listed above.
  • the substantially identical nucleotide sequence includes, for example, a case in which the same amino acid can be synthesized when transcribed and translated, and is 90% or more, 91% or more, 92% or more, 93% or more, 94% or more of the nucleotide sequences listed above. It may be a nucleotide sequence having homology of at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5%, but is not limited thereto.
  • the polynucleotide encoding the chimeric antigen receptor may include a nucleotide sequence optimized according to the type of organism to be introduced and expressed and the expression system such as transcription and translation of the organism. This is due to the degeneracy of codons. Accordingly, various combinations of nucleotide sequences that can encode the expressed protein may exist, all of which are included in the scope of the present invention. Modification of the polynucleotide according to the codon optimization may be determined according to the type of organism to be applied by expressing the chimeric antigen receptor of the present invention. For example, the polynucleotide of the present invention is optimized for codon selection in mammals and primates. It may be a modified polynucleotide, and more specifically, it may be modified and optimized to be suitable for expression from a human.
  • the expression vector of the present invention includes the polynucleotide.
  • the expression vector including the same can be used to express and prepare the chimeric antigen receptor, and the chimeric antigen receptor is It may serve to move the polynucleotide to a specific cell or organism so that it can be expressed, or it may be used to store and store the polynucleotide.
  • vector is meant a DNA preparation containing a DNA sequence operably linked to suitable regulatory sequences capable of expressing the DNA in a suitable host.
  • a vector can be a plasmid, a phage particle, or simply a potential genomic insert. Once transformed into an appropriate host, the vector can replicate and function independently of the host genome, or in some cases can be integrated into the genome itself.
  • expression vector generally refers to a double-stranded DNA fragment as a recombinant carrier into which a heterologous DNA fragment is inserted.
  • heterologous DNA refers to heterologous DNA, which is DNA not found naturally in a host cell.
  • An expression vector once in the host cell, can replicate independently of the host chromosomal DNA and several copies of the vector and its inserted (heterologous) DNA can be produced.
  • the expression vector can be constructed using a prokaryotic cell or a eukaryotic cell as a host.
  • a strong promoter capable of propagating transcription eg, tac promoter, lac promoter, lacUV5 promoter, lpp promoter, pL ⁇ promoter, pR ⁇ promoter, rac5 promoter, amp promoter, recA promoter, SP6 promoter, trp promoter and T7 promoter, etc.
  • a ribosome binding site for initiation of translation e.g., amp promoter, recA promoter, SP6 promoter, trp promoter and T7 promoter, etc.
  • E. coli eg, HB101, BL21, DH5 ⁇ , etc.
  • promoter and operator regions of the E eg, HB101, BL21, DH5 ⁇ , etc.
  • coli tryptophan biosynthesis pathway (Yanofsky, C, J Bacteriol, (1984) 158:1018-1024)
  • the left-handed promoter of phage ⁇ (pL ⁇ promoter, Herskowitz, I and Hagen, D, Ann Rev Genet, (1980) 14:399-445) can be used as regulatory regions.
  • the promoter of the toxin protein gene of Bacillus thuringiensis (Appl Environ Microbiol (1998) 64:3932-3938; Mol Gen Genet (1996) 250:734-741) or expressed in Bacillus bacteria Any possible promoter can be used as a regulatory region.
  • the expression vectors are plasmids often used in the art (e.g., pCL, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8/9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14, pGEX series. , pET series and pUC19, etc.), phage (eg, ⁇ gt4 ⁇ B, ⁇ -Charon, ⁇ z1 and M13, etc.) or viruses (eg, SV40, etc.).
  • plasmids often used in the art (e.g., pCL, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8/9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14,
  • a promoter derived from the genome of a mammalian cell eg, metallotionine promoter, ⁇ -actin promoter, human heglobin promoter and human muscle creatine promoter
  • mammalian Promoters derived from animal viruses e.g., adenovirus late promoter, vaccinia virus 75K promoter, SV40 promoter, cytomegalovirus (CMV) promoter, tk promoter of HSV, mouse mammary tumor virus (MMTV) promoter, LTR of HIV promoter, the promoter of Moloney virus, the promoter of Epstein Barr virus (EBV) and the promoter of Loose Sacoma virus (RSV)
  • the expression vector may have a CMV promoter.
  • the expression vector may be fused with other sequences to facilitate purification of the antibody expressed therefrom.
  • Sequences to be fused include, for example, glutathione S-transferase (Pharmacia, USA), maltose binding protein (NEB, USA), FLAG (IBI, USA) and 6x His (hexahistidine; Quiagen, USA).
  • the protein expressed by the expression vector of the present invention is a chimeric antigen receptor, considering its characteristics, the expressed protein may be easily purified through a protein A column or the like without an additional sequence for purification.
  • the expression vector includes an antibiotic resistance gene commonly used in the art as a selection marker, for example, ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin and tetracycline. It may contain a resistance gene for example, ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin and tetracycline. It may contain a resistance gene for example, ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin and tetracycline. It may contain a resistance gene for example, ampicillin, gentamicin, carbenicillin, chloramphenicol, streptomycin, kanamycin, geneticin, neomycin and tetracycline. It may contain a resistance gene for example, ampicillin, gentamicin, carbenicillin
  • the expression vector may further include a promoter that promotes the expression of a gene to be transfected and a basic element necessary for transcription, as well as an enhancer that can be used for promotion and regulation of expression.
  • Another aspect of the present invention provides immune cells characterized by exhibiting enhanced cytotoxicity or cytolytic activity against cancer cells expressing CD5.
  • the immune cells express the above-described chimeric antigen receptor of the present invention on their surface.
  • the chimeric antigen receptor is described above in " 1. Novel anti-CD5 antibody, antigen-binding fragment thereof, and chimeric antigen comprising the same.
  • the chimeric antigen receptor may include an antigen binding site capable of specifically binding to a CD5 antigen expressed in cancer cells.
  • expressing the chimeric antigen receptor on the surface of an immune cell is meant any immune cell engineered by addition or modification of a nucleic acid encoding the chimeric antigen receptor. Therefore, in order to express the chimeric antigen receptor on the surface of immune cells as described above, a polynucleotide encoding the chimeric antigen receptor or an expression vector comprising the same is transfected (transfection) or transfected into the immune cells. can be introduced (transduction).
  • the transfection is calcium phosphate-DNA co-precipitation method, DEAE-dextran-mediated transfection method, polybrene-mediated transfection method, electroshock method, microinjection method, liposome fusion method, lipofectamine and protoplast fusion method, etc.
  • the transfection means transferring a gene into a cell using a virus or viral vector particle by means of infection.
  • transfection and transduction may be used interchangeably, but it is preferable to be interpreted as transformation (transformation) of delivery of a foreign gene to a host cell in a larger sense, and a cell into which a foreign gene is introduced by transfection or transduction. are called transformants.
  • the immune cells may be used without limitation as long as they are cells capable of inducing a desired therapeutic effect by inducing immunity, and may be obtained from peripheral blood, umbilical cord blood, bone marrow, tumor-infiltrating lymphocytes, lymph node tissue or thymus tissue, placental cells, It can be obtained by differentiation from embryonic stem cells, induced pluripotent stem cells or hematopoietic stem cells.
  • the immune cells can be obtained from human, monkey, chimpanzee, dog, cat, mouse, rat and transgenic species thereof as well as established cell lines.
  • the method for obtaining immune cells may use any means known in the art, and may be obtained from autologous, allogeneic or xenogeneic.
  • Autologous means all cells derived from the same individual to be subsequently reintroduced into the individual
  • allogeneic means all cells derived from another animal of the same species as the individual into which the cells are introduced
  • heterologous means a cell derived from an animal of a different species.
  • the immune cells are natural killer cells (Natural Killer cells, NK cells), T cells, natural killer T cells (NKT cells), cytokine-induced killer cells (CIK), macrophages , may be any one selected from dendritic cells, etc., but is not limited thereto. Therefore, the immune cells expressing the chimeric antigen receptor according to the present invention on the cell surface are CAR-NK cells (Chimeric Antigen Receptor Natural Killer Cells), CAR-T cells (Chimeric Antigen Receptor T Cells), CAR-NKT cells (Chimeric Antigen Cells). Receptor Natural killer T Cell), CAR-macrophage (Chimeric Antigen Receptor Macrophage), and the like.
  • CAR-NK cells Chimeric Antigen Receptor Natural Killer Cells
  • CAR-T cells Chimeric Antigen Receptor T Cells
  • CAR-NKT cells Chomeric Antigen Cells
  • Receptor Natural killer T Cell CAR-macrophage (Chimeric Anti
  • Immune cells provided in the present invention can regulate the onset (on) / stop (off) of a response to a target cell of a conventional chimeric antigen receptor, so that subsequent cell therapy, the activity of the treated cell needs to be increased or decreased Includes safety switches which can be very beneficial in situations.
  • safety switches which can be very beneficial in situations.
  • immune cells expressing a chimeric antigen receptor are provided to a patient, there may be side effects, such as off-target toxicity, in some circumstances.
  • the therapeutic cell may act to reduce the number or tumor size of the tumor cells and may no longer be needed. In this situation, it can be controlled so that the therapeutic cells are no longer activated.
  • the CAR-NK cells in which the chimeric antigen receptor is introduced into natural killer cells, have problems due to the continuous toxicity of cancer immunotherapy when using the existing T-cell-based CAR-T therapeutics,
  • the risk of immune disease, the problem of graft-versus-host disease (GVHD) for xenogeneic cell transplantation, and the problem of off-target toxicity can be solved through the switch on/off of the reaction, as well as various cancer cells. It has the advantage that it can be used as a general-purpose therapeutic agent by allowing it to be targeted.
  • Immune cells of the present invention include a chimeric antigen receptor comprising an antigen-binding variable fragment (scFv) of an antibody capable of specifically recognizing and binding to CD5, which can be specifically expressed in cancer cells, as an extracellular domain, expressed on the cell surface. Therefore, when the CD5-expressing cancer cells are present, signal transduction may occur by the chimeric antigen receptor, thereby further improving the cytotoxicity or cytolytic activity of immune cells and increasing the secretion of cytokines. . Therefore, the immune cells of the present invention may have an activity of attacking and treating cancer cells.
  • scFv antigen-binding variable fragment
  • a chimeric antigen receptor comprising the antigen-binding variable fragments of four types of CD5-specific antibodies of the present invention as extracellular domains was expressed on the surface of natural killer cells.
  • CD5-expressing cancer cell lines such as MOLT4 cells, CCRF-CEM, and Jurkat cells
  • cytotoxicity or cytolytic activity
  • cytokine secretion and degranulation was not only significantly increased, but also showed reduced cytotoxicity against MNCs containing normal cells expressing CD5. It was confirmed that there was a therapeutic effect.
  • Another aspect of the present invention provides a pharmaceutical composition for preventing or treating cancer comprising the immune cells as an active ingredient.
  • the description of the immune cells, the chimeric antigen receptor expressed therefrom, etc. is, " 1. Novel anti-CD5 antibody, antigen-binding fragment thereof, and a chimeric antigen receptor (CAR) comprising the same, and the expression thereof Polynucleotides and expression vectors for making these are the same as those described in the sections “ 2. Immune cells expressing a chimeric antigen receptor for CD5 on their surface ” and, therefore, descriptions are omitted in order to avoid repeated explanations.
  • cancer is used interchangeably with “tumor”, and refers to or refers to a physiological condition in mammals that is typically characterized by unregulated cell growth/proliferation.
  • the pharmaceutical composition of the present invention may include 1 to 10 times, 2 to 10 times, or 5 to 8 times the number of immune cells compared to the number of tumor cells of the subject to be treated, but limited thereto it's not going to be
  • Anticancer drugs used in chemotherapy induce apoptosis of cells with active proliferation, and irradiation to increase the therapeutic effect of anticancer drugs increases such apoptosis.
  • cells induced by apoptosis by anticancer agents and radiation are not limited to cancer cells, and may also affect immune cell therapy agents administered to an individual for immunotherapy.
  • Chemotherapy includes, but is not limited to, CHOP (cyclophosphamide, doxorubicin, vincristine, prednisone), EPOCH (etoposide, vincristine, doxorubicin, cyclophosphamide, prednisone), or any other multidrug therapy.
  • cell therapy agent refers to cells and tissues manufactured through separation, culture, and special manipulation from an individual, and is a drug (US FDA regulation) used for the purpose of treatment, diagnosis, and prevention, restoring the function of cells or tissues. It refers to a drug used for the purpose of treatment, diagnosis, and prevention through a series of actions such as proliferating and selecting living autologous, allogeneic, or xenogeneic cells in vitro or changing the biological properties of cells in other ways.
  • the pharmaceutical composition of the present invention may additionally include a pharmaceutically or pharmaceutically acceptable carrier.
  • a pharmaceutically or pharmaceutically acceptable carrier is that it does not inhibit the activity of the active ingredient and does not have more toxicity than that applicable to the application (prescription) target, and the 'carrier' facilitates the addition of the compound into cells or tissues. It is defined as a compound that causes
  • the pharmaceutical composition of the present invention may be administered alone or in admixture with any convenient carrier, and the dosage form may be a single administration or repeated administration.
  • the pharmaceutical composition may be a solid formulation or a liquid formulation.
  • Solid preparations include, but are not limited to, powders, granules, tablets, capsules, suppositories, and the like.
  • Solid formulations may include, but are not limited to, carriers, flavoring agents, binders, preservatives, disintegrants, lubricants, fillers, and the like.
  • Liquid formulations include, but are not limited to, solutions such as water and propylene glycol solutions, suspensions, and emulsions, and may be prepared by adding suitable colorants, flavoring agents, stabilizers, and viscosifying agents.
  • the powder can be prepared by simply mixing the tri-hydroxy derivative of polyunsaturated fatty acid, which is the active ingredient of the present invention, with a suitable pharmaceutically acceptable carrier such as lactose, starch, microcrystalline cellulose.
  • the granules are prepared by mixing the tri-hydroxy derivative of the polyunsaturated fatty acid of the present invention, a suitable pharmaceutically acceptable carrier and a suitable pharmaceutically acceptable binder such as polyvinylpyrrolidone and hydroxypropylcellulose, followed by water, It may be prepared using a wet granulation method using a solvent such as ethanol or isopropanol or a dry granulation method using a compression force.
  • tablets may be prepared by mixing the granules with a suitable pharmaceutically acceptable lubricant such as magnesium stearate, and then tableting the granules using a tablet press.
  • the pharmaceutical composition of the present invention is an oral agent, an injection (eg, intramuscular injection, intraperitoneal injection, intravenous injection, infusion, subcutaneous injection, implant), inhalant, nasal administration depending on the disease to be treated and the condition of the individual It may be administered as an oral preparation, vaginal preparation, rectal administration preparation, sublingual preparation, transdermal preparation, topical preparation, and the like, but is not limited thereto. Depending on the route of administration, it may be formulated into suitable dosage unit formulations containing commonly used, non-toxic, pharmaceutically acceptable carriers, excipients, and vehicles.
  • the pharmaceutical composition of the present invention can be used through an ampoule for injection.
  • the injection ampoule may be prepared by mixing with an injection solution immediately before use, and physiological saline, glucose, mannitol, Ringer's solution, etc. may be used as the injection solution.
  • the pharmaceutical composition or formulation of the present invention thus prepared may be administered in the form of a mixture together with cells used for transplantation and other uses using administration methods commonly used in the art.
  • the actual dosage of the active ingredient should be determined in light of several related factors such as the disease to be treated, the severity of the disease, the route of administration, and the weight, age and sex of the patient.
  • the preferred dosage of the pharmaceutical composition of the present invention varies depending on the condition and weight of the patient, the degree of disease, the drug form, the route of administration, and the period, but may be appropriately selected by those skilled in the art.
  • the pharmaceutical composition may be administered in a daily dose of about 0.0001 mg/kg to about 10 g/kg, and a daily dose of about 0.001 mg/kg to about 1 g/kg.
  • the dosage may vary depending on the degree of purification of the mixture, the patient's condition (age, sex, weight, etc.), and the severity of the condition being treated. If necessary, for convenience, the total daily dose may be divided and administered several times during the day.
  • the composition may be in the form of a quasi-drug composition, a composition for health food, etc. in addition to the pharmaceutical composition.
  • another aspect of the present invention provides a method for preventing or treating cancer, comprising administering the immune cells to an individual in need of treatment.
  • the immune cells may be in the form of the above-described pharmaceutical composition, and a person skilled in the art to which the present invention pertains may determine an appropriate administration route and dose of the pharmaceutical composition.
  • a heavy chain comprising a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 2, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 3, and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 4 It was designed to include a variable region and a light chain variable region comprising a light chain CDR1 having the amino acid sequence of SEQ ID NO: 6, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 7, and a light chain CDR3 having the amino acid sequence of SEQ ID NO: 8.
  • a heavy chain variable region comprising a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 10, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 11 and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 12, and SEQ ID NO: 14 It was designed to include a light chain variable region comprising a light chain CDR1 having an amino acid sequence, a light chain CDR2 having an amino acid sequence of SEQ ID NO: 15, and a light chain CDR3 having an amino acid sequence of SEQ ID NO: 16.
  • a heavy chain variable region comprising a heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 18, a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 19 and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 20, and SEQ ID NO: 22 It was designed to include a light chain variable region comprising a light chain CDR1 having an amino acid sequence, a light chain CDR2 having an amino acid sequence of SEQ ID NO: 23, and a light chain CDR3 having an amino acid sequence of SEQ ID NO: 24.
  • CD5 ScFv order #One SEQ ID NO: 35
  • Chimeric antigen receptor to be introduced into natural killer cells by using the extracellular domain comprising the four scFvs designed as described above as antigen-binding sites, and using the CAR region of the sequence shown in Table 2 below; CAR) was designed.
  • the extracellular domain containing the above four scFvs as antigen-binding sites, and CD28 as a transmembrane domain were linked to Myc and hinge domains, and CD3-zeta and CD3-zeta as an intracellular signaling domain to the transmembrane domain.
  • the chimeric antigen receptor of the present invention was designed to have an intracellular signaling domain of a chimeric antigen receptor classified as a so-called third-generation CAR by adding and linking CD28 DAP10 as a costimulatory molecule ('CD5#1-CAR', respectively) ', 'CD5#4-CAR', 'CD5#11-CAR' and 'CD5#14-CAR', which are collectively referred to as 'CD5-CAR'). Then, the nucleotide sequence of the gene construct encoding it was inserted into a lenti-viral vector (Clontech, 632155) (FIG. 1).
  • the lenti-viral vector prepared in Example 1-2 was transformed into HEK293T cells together with a viral packaging vector (PMDLg/RRE, RSV/REV, VSVG), and the lentivirus expressing CD5-CAR therefrom. got The lentivirus was concentrated using an ultra-high speed centrifuge, and the concentrated lentivirus was infected with HEK293T cells, and the amount of the Myc epitope of CD5-CAR was checked by flow cytometry to Infection Unit. was calculated.
  • a viral packaging vector PMDLg/RRE, RSV/REV, VSVG
  • the number of natural killer cells and the amount of lentivirus were calculated so that the multiplicity of infection (MOI) was 30, and the lentivirus expressing CD5-CAR was applied to the natural killer cells (NK92 cells) by spinoculation method (360g, 90min). , RT). After culturing the infected natural killer cells as described above for 5 hours at 37° C., 5% CO 2 condition, they are replaced with fresh culture medium, and after 3 days, puromycin at a concentration of 3ug/ml for selection of properly infected natural killer cells. (puromycin) was treated to continue the culture.
  • uninfected natural killer cells were also treated with puromycin, and culture was continued using a puromycin-treated medium until all the natural killer cells in the control were killed by puromycin.
  • the infected natural killer cells were selected, and the selected natural killer cells were re-cultured in a medium without puromycin to proliferate or expand.
  • the proliferation or expansion of the selected natural killer cells includes Alpha-MEM containing 12.5% fetal bovine serum, 12.5% horse serum, 0.2 mM inositol, 0.1 mM 2-mercaptoethanol, 0.02 mM folic acid, and 200 U/ml recombinant IL- 2 was used.
  • Natural killer cells expressing CD5#1-CAR, CD5#4-CAR, CD5#11-CAR and CD5#14-CAR produced and selected as described above ('CD5#1-CAR-NK cells', ' CD5#4-CAR-NK cells', 'CD5#11-CAR-NK cells' and 'CD5#14-CAR-NK cells', which are collectively referred to as 'CD5-CAR-NK cells');
  • the expression of CD5-CAR was checked by treating the anti-myc antibody (CST; 9B11) that specifically binds to myc of CD5-CAR (4°C, 30 min in the dark), and confirming the expression of Myc through flow cytometry. Confirmed. In this case, as a control, the original natural killer cells that do not express CD5-CAR were used.
  • CD5-CAR was properly expressed in all four types of CD5-CAR-NK cells compared to the control group.
  • the cytotoxicity was confirmed by the calcein AM assay. Specifically, after reacting MOLT4 cells and U937 cells with calcein-AM (life technologies; C1430) at a concentration of 5ug/ml (37°C, 5% CO2, 1 hour in the dark), the cells were stained with calcein.
  • MOLT4 cells and U937 cells were treated with each of the four CD5-CAR-NK cells in a ratio of 2:1, 1:1, 0.5:1 (natural killer cells: cancer cells), and 200ul of RPMI1640 (10% FBS) ) after the reaction (at 37° C., 5% CO 2 for 2 hours), 100 ul of the supernatant was taken and the amount of calcein present in the supernatant was checked, and the cytotoxicity according to each condition was calculated in the following way.
  • Cytotoxicity (%) (calcein release value-spontaneous value according to conditions) / (maximum value-spontaneous value) x 100
  • an empty lenti-viral vector that does not contain the gene construct encoding the CD5-CAR of the present invention or a gene construct in which the extracellular domain has been removed from the CD5-CAR of the present invention was included.
  • the lenti-viral vector was introduced into natural killer cells in the same manner as in Example [1-3], and natural killer cells obtained through the process of selection with puromycin were used, and these were used as 'PURO NK cells' and 'dEcto', respectively. -NK cells.
  • CD5#11-CAR-NK cells two types confirmed to have the best cytotoxicity among the four types of CD5-CAR-NK cells as described above were selected.
  • CD5#11-CAR-NK cells two types confirmed to have the best cytotoxicity among the four types of CD5-CAR-NK cells as described above were selected.
  • CD5#14-CAR-NK cells two types confirmed to have the best cytotoxicity among the four types of CD5-CAR-NK cells as described above were selected
  • CD5-CAR-NK cells two types confirmed to have the best cytotoxicity among the four types of CD5-CAR-NK cells as described above were selected.
  • CD5-CAR-NK cells two types confirmed to have the best cytotoxicity among the four types of CD5-CAR-NK cells as described above were selected
  • CD5-CAR-NK cells two types confirmed to have the best cytotoxicity among the four types of CD5-CAR-NK cells as described above were selected
  • CD5-CAR-NK cells two types confirmed to have the best cyto
  • both CD5-CAR-NK cells were significantly higher than the control group (PURO NK cells or dEcto-NK cells) for CD5-expressing CCRF-CEM cells and Jurkat cells. While it was confirmed that high cytotoxicity was shown, it was confirmed that neither the control nor the two CD5-CAR-NK cells showed little cytotoxicity against Daudi cells that do not express CD5.
  • cytokines and granules were confirmed for the four types of CD5-CAR-NK cells. Specifically, MOLT4 cells and U937 cells were treated with Puro NK cells, dEcto-NK cells, or each of the four CD5-CAR-NK cells prepared in Example 1-3 at a 1:1 ratio to receive RPMI1640 (10% FBS). After the reaction at (37° C., 5% CO 2 condition for 12 hours), the supernatant was collected and IFN- ⁇ , a cytokine present in the supernatant, was confirmed through ELISA. At this time, the amount of cytokines secreted from Puro NK cells, dEcto-NK cells and CD5-CAR-NK cells alone was used as a control.
  • MOLT4 cells and U937 cells were treated with Puro NK cells, dEcto-NK cells, or each of the four CD5-CAR-NK cells prepared in Example 1-3 at a 1:1 ratio in RPMI1640 (10% FBS). After reaction (4 hours at 37° C., 5% CO 2 condition), anti-CD56 antibody was treated and stained to select natural killer cells, and Puro NK cells, dEcto-NK cells and The expression level of CD107a in the four types of CD5-CAR-NK cells was analyzed.
  • CD107a expression was significantly improved only in CD5-CAR-NK cells treated with CD5-expressing MOLT4 cells, as in the case of INF- ⁇ .
  • NMC from umbilical cord blood using the Ficoll-Paque ® Gradient method. (mononuclear cells) were isolated. Specifically, the umbilical cord blood was carefully placed on the ficoll and centrifuged for 30 minutes at 2000 rpm at room temperature, and then a buffy coat (enriched MNC fraction) containing leukocytes and platelets was separated. The fraction separated as described above was treated with 1X ACK (Ammonium-Chloride-Potassium) lysis buffer at 37° C. for 10 minutes to break up the remaining red blood cells and only pure MNCs were separated.
  • 1X ACK Ammonium-Chloride-Potassium
  • the CD5#11-CAR-NK cells and CD5#14-CAR-NK cells prepared in Example 1-3 were each in a ratio of 1:1 (Natural Killer Cells: MNC) cytotoxicity of CD5-CAR-NK cells was confirmed in the same manner as in Example [2-1].
  • both CD5#11-CAR-NK cells and CD5#14-CAR-NK cells showed reduced cytotoxicity to MNC compared to MOLT4, a cancer cell expressing CD5. Confirmed.
  • each of the CD5#11-CAR-NK cells and CD5#14-CAR-NK cells prepared in Example 1-3 was isolated as single cells in a 96-well plate. . Then, the cells proliferating at a similar rate were repeatedly selected and propagated in the order of a 48-well plate, a 24-well plate, a 6-well plate, and a 25T flask.
  • CD5-CAR was confirmed in each of the single cells of the CD5#11-CAR-NK cells and the CD5#14-CAR-NK cells isolated as described above, and based on this, the CD5-CAR Cell lines with different expression levels were constructed (Fig. 7a).
  • CD5#11-CAR-NK cells and CD5#14-CAR-NK cells constructed as described above were targeted for MOLT4, a cancer cell line expressing CD5, and MNCs isolated in Example [2-2].
  • the cytotoxicity of individual single cell lines of CD5-CAR-NK cells was evaluated in the same manner as in Example [2-1] by treating single cell lines of each at a ratio of 1:1 (natural killer cells: cancer cells or MNC). Confirmed.
  • CD5-CAR-NK cells among the two types of CD5-CAR-NK cells, individual single cell lines of CD5#11-CAR-NK cells, which show lower cytotoxicity to normal T cells, were CD5-expressing cancer cells.
  • a single cell line showing high cytotoxicity to MOLT4 but low cytotoxicity to MNC containing normal T cells was selected.
  • CD5-CAR-NK cells of the present invention were prepared using primary natural killer cells instead of NK92 cells, they exhibit excellent activity as confirmed in Examples [2-1] to [2-3]. I checked if it can.
  • the mRNA constructs of CD5#11-CAR and CD5#14-CAR were designed and manufactured by combining the UTR of mRNA to improve protein expression and mRNA safety.
  • the base sequence of the same mRNA construct was inserted into a lenti-viral vector (Clontech, 632155).
  • the mRNA synthesis kit EZTM High Yield In Vitro Transcription kit
  • the mRNA of CD5-CAR having the structure shown in FIG. 8 was synthesized using the gene construct as a template.
  • CD5-CAR The mRNA of CD5-CAR synthesized as described above was introduced into primary NK cells by electroporation, and after 7 hours, an anti-Myc antibody (CST; 9B11) that specifically binds to Myc of CD5-CAR was prepared. After treatment (4°C, 30 minutes in the dark), the expression of Myc was confirmed by flow cytometry. As a result, as shown in FIG. 9 , CD5-CAR in primary natural killer cells It was confirmed that the CAR was properly expressed.
  • CST anti-Myc antibody
  • Example [2-2] two types of CD5- CAR-NK cells were treated at a ratio of 0.5:1 and 1:1, respectively (primary natural killer cells: cancer cells), and in the same manner as in Example [2-1], primary natural killer cell-based CD5-CAR- Cytotoxicity of NK cells was confirmed.
  • the CD5-CAR-NK cells based on the two primary natural killer cells were all control (PURO NK cells) for MOLT4 cells and CCRF-CEM cells, which are cancer cells expressing CD5. or dEcto-NK cells), as well as exhibiting much higher cytotoxicity, and this cytotoxicity was confirmed to be concentration-dependent on the treated CD5-CAR-NK cells. On the other hand, it was confirmed to show a more reduced cytotoxicity to MNCs containing normal T cells expressing CD5.
  • the CD5-CAR-NK cells of the present invention exhibited toxic high cytotoxicity to CD5-expressing cancer cells.
  • the expression of ligands involved in the activation of natural killer cells in MOLT4, CCRF-CEM, and Jurkat which are cancer cells expressing MNC and CD5 isolated in Example [2-2], which are normal cells, were examined. Confirmed. Each of the cells was treated with an antibody that specifically binds to each ligand, and the expression level of the corresponding ligand was analyzed by flow cytometry.
  • B7-H6 was significantly highly expressed in all three types of cancer cells, and HLA class1, an inhibitory ligand, was expressed in normal cells. was found to be highly expressed.
  • CD3 as a marker for T cells
  • CD34 as a marker for hematopoietic stem cells (HSC)
  • markers for myeloid cells As a result of treatment with an antibody that specifically binds to CD33 and CD56, a marker for natural killer cells, respectively, and measuring the expression level of B7-H6 for each type of leukocyte by flow counting method, as shown in FIG. 11b , most It was confirmed that B7-H6 was not expressed in normal leukocytes of
  • siRNA having a sequence complementary to the gene of B7-H6 was introduced into MOLT4 cells and Jurkat cells, which are cancer cell lines expressing CD5, to temporarily knock-down the expression of B7-H6. . Then, for the cancer cells with reduced expression of B7-H6 as described above, CD5#11-CAR-NK cells were treated at a ratio of 1:1 (natural killer cells: cancer cells), respectively, and 2-1], the cytotoxicity of CD5#11-CAR-NK cells was confirmed.
  • CD5#11-CARNK cells were each in a 1:1 ratio (natural killer cells: cancer cells or MNCs). ), and the expression levels of B7-H6 and CD5 in live MOLT4 cells and MNCs were measured every 2 hours by flow cytometry.
  • CD5-CAR-NK cells of the present invention not only exhibit concentration-dependently enhanced cytotoxicity against CD5-expressing cancer cells, but also increase IFN- ⁇ secretion and degranulation. It can be seen that the CD5-CAR-NK cells of the present invention respond specifically to cancer cells expressing CD5.
  • CD5 is expressed in most T cell malignancies, it is also expressed in normal T cells, and it has been reported that all CD5-CARs developed to date have adverse effects on normal T cells.
  • CD5-CAR-NK cells of the present invention it was confirmed that they showed a more reduced cytotoxicity to MNCs isolated from umbilical cord blood, and in particular, CD5#11-CAR-NK cells were CD5#14-CAR-NK cells. It was confirmed to exhibit a lower cytotoxicity compared to cells.
  • the difference between the CD5#11-CAR-NK cells and the CD5#14-CAR-NK cells as described above is thought to be due to the difference in the structure of the single chain variable fragment, and the heavy chain CDR1 having the amino acid sequence of SEQ ID NO: 18, SEQ ID NO: A heavy chain variable region comprising a heavy chain CDR2 having the amino acid sequence of SEQ ID NO: 19 and a heavy chain CDR3 having the amino acid sequence of SEQ ID NO: 20, a light chain CDR1 having the amino acid sequence of SEQ ID NO: 22, a light chain CDR2 having the amino acid sequence of SEQ ID NO: 23 and a sequence #11 ScFv comprising a light chain variable region comprising a light chain CDR3 having the amino acid sequence of No.
  • CD5#11-CAR-NK cells were found to be effective against CD5-expressing cancer cells. It was confirmed that the cytotoxicity against the control group was about 10 times higher than that of the control, whereas the cytotoxicity against the normal cells expressing CD5 was only about 2 times higher than that of the control group. From the above results, it is judged that the CD5#11-CAR-NK cells of the present invention have much higher safety than previously reported CD5-CARs.
  • CD5-CAR permanently expressed in NK92 cells
  • CD5-CAR-NK cells based on primary NK cells that transiently expressed CD5-CAR by introducing CD5-CAR mRNA into primary NK cells also expressed CD5.
  • CD5-CAR-NK cells of the present invention respond differently to CD5-expressing cancer cells and normal cells.
  • the expression level of B7-H6 was regulated in cancer cells expressing CD5, it was confirmed that the cytotoxicity of the CD5-CAR-NK cells of the present invention changed according to the expression level of B7-H6, and from this, it was confirmed that B7 Since -H6 acts as a major factor in the activity of the CD5-CAR-NK cells of the present invention and is relatively highly expressed in CD5-expressing cancer cells, the CD5-CAR-NK cells of the present invention are more effective in cancer cells than normal cells. It can be seen that it is the first to react.
  • the cytotoxicity to CD5-expressing cancer cells and normal cells can be completely differentiated due to the difference in CD5-CAR activity due to the difference in the CDR sequence of the antibody against CD5.
  • Using a single cell line with cytotoxicity it is expected that it will be possible to develop a new therapeutic agent for T-cell hematologic malignancies that show high anticancer effects on cancer cells and have low responsiveness to normal cells.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Cell Biology (AREA)
  • Microbiology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Engineering & Computer Science (AREA)
  • Genetics & Genomics (AREA)
  • Mycology (AREA)
  • Epidemiology (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Biochemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Biotechnology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Hematology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Engineering & Computer Science (AREA)
  • Oncology (AREA)
  • Peptides Or Proteins (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)

Abstract

본 발명은 CD5 항체 및 이를 포함하는 키메릭 항원 수용체(chimeric antigen receptor, CAR)에 관한 것으로, 본 발명의 키메릭 항원 수용체는 면역세포에 발현되어 정상 T세포에 대한 독성이 감소된 항암면역요법에 유용하게 활용될 수 있다.

Description

신규한 항-CD5 키메릭 항원 수용체 및 이를 발현하는 면역세포
본 발명은 CD5에 대해 특이적으로 결합하는 신규한 항체 또는 이의 항원 결합 단편, 상기 항체의 항원 결합 단편을 포함하는 키메릭 항원 수용체, 상기 키메릭 항원 수용체를 발현하는 면역세포에 관한 것이다.
암을 치료하기 위한 방법은 꾸준한 발전과 변화 과정을 거쳐 왔으며, 외과적 수술, 화학요법, 방사선 요법 등의 방법이 현재까지 계속 이용되고 있으나 이러한 기존의 암 치료 방법들은 암이 전이되지 않은 초기 상태에만 효과가 있는 경우가 대부분이며, 이미 전이가 진행된 상태에서는 예컨대 외과적 수술을 하더라도 추후 재발의 가능성이 높다는 문제점이 있다. 이에, 최근 암을 치료하기 위해 면역 반응을 이용하는 방법에 대한 연구가 계속되어 오고 있다.
그 중에서도, 면역세포를 이용하여 이를 강화시키거나 유전공학적으로 변형하여 다시 환자에게 주입하는 세포치료 방법에 대한 관심이 높아지고 있으며, 예를 들어 종양 침윤 림프구(Tumor infiltrating lymphocytes, TIL), 키메릭 항원 수용체(Chimeric antigen receptor, CAR) 및 T 세포 수용체(T-cell receptor, TCR) 기술 등이 연구되고 있다. 특히, 항원 특이성을 전달하도록 설계된 인공 수용체인 키메릭 항원 수용체(chimeric antigen receptor, CAR)가 도입된 T 세포인 CAR-T 세포의 경우, 2017년에 CD19를 표적으로 하는 CAR-T 세포가 항암제로서 FDA 승인을 받은 이후로 그 연구가 활발하게 진행되어 왔으나, 대부분 시험관 내(in vitro)에서만 효과를 나타낼 뿐, 실제로 생체 내(in vivo)에서는 유의미한 치료 효과를 나타내지 못하는 문제가 있었다.
한편, CAR-T 세포의 경우 종양에 대해서는 효과적이지만, 일부 경우에 건강한 조직에 대해서도 비특이적으로 공격하는 부작용도 있었다. 상기 CD5는 T 세포 및 B 세포에서 발현되는 분화 클러스터의 일종으로, 골수나 림프조직에서 주로 발견되고, B 세포보다 T 세포에서 과발현되어 있기 때문에 T 세포의 마커로 주로 활용된다. 특히, CD5는 대부분의 T 세포 종양뿐만 아니라, 정상 T 세포에서도 발현되고 있기 때문에, 항-CD5 CAR-T 세포의 경우 T 세포 종양뿐만 아니라 정상 T 세포를 공격하거나, 심지어 주입된 항-CD5 CAR-T 세포 자체를 공격하기도 하는 자체 교차반응의 문제가 있었다(참고문헌 1). 그로 인해, 정상 T 세포와 항-CD5 CAR-T 세포가 감소되고, 결국에는 항암 효과까지도 저하되는 문제가 있었다.
이에, CD5를 발현하는 암 세포에 대한 항암 활성을 그대로 유지하면서도, 항-CD5 CAR-T 세포가 지니는 상기와 같은 문제점을 보완할 수 있는, 면역세포를 연구·개발이 필요한 실정이다.
[선행기술문헌]
[특허문헌]
(특허문헌 1) 한국 공개특허공보 제2018-0002604호
(특허문헌 2) 한국 등록특허공보 제2,122,546호
본 발명은 CD5에 특이적으로 결합할 수 있는 항체 또는 이의 항원 결합 단편을 제공하는 것을 목적으로 한다.
또한, 본 발명은 면역세포에서 발현되었을 때, 암 세포에 대한 세포독성 또는 세포용해 활성을 증폭시킬 수 있도록 하는 신규한 키메릭 항원 수용체를 제공하는 것을 목적으로 한다.
또한, 본 발명은 상기 키메릭 항원 수용체를 발현시키기 위한 폴리뉴클레오티드 및 발현 벡터를 제공하는 것을 목적으로 한다.
또한, 본 발명은 상기 키메릭 항원 수용체를 표면에 발현시킴으로써 암에 대한 치료 효과가 우수한 면역세포를 제공하는 것을 목적으로 한다.
또한, 본 발명은 상기 면역세포를 이용하여 암을 치료하기 위한 약학적 조성물을 제공하는 것을 목적으로 한다.
상기 목적을 달성하기 위하여, 본 발명의 일 측면은 i) 서열번호 2, 서열번호 10, 서열번호 18 및 서열번호 26으로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR1, ii) 서열번호 3, 서열번호 11, 서열번호 19 및 서열번호 27로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR2 및 iii) 서열번호 4, 서열번호 12, 서열번호 20 및 서열번호 28로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄가변영역; 및 iv) 서열번호 6, 서열번호 14, 서열번호 22 및 서열번호 30으로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR1, v) 서열번호 7, 서열번호 15, 서열번호 23 및 서열번호 31로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR2 및 vi) 서열번호 8, 서열번호 16, 서열번호 24 및 서열번호 32로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄가변영역;을 포함하는 CD5에 특이적으로 결합하는, 항체 또는 이의 항원 결합 단편을 제공한다.
상기 중쇄가변영역은 서열번호 5, 서열번호 13, 서열번호 21 및 서열번호 29로 이루어지는 군에서 선택되는 어느 하나일 수 있다.
상기 경쇄가변영역은 서열번호 9, 서열번호 17, 서열번호 25 및 서열번호 33으로 이루어지는 군에서 선택되는 어느 하나일 수 있다.
본 발명의 다른 측면은 CD5에 특이적으로 결합하는 항원 결합 부위를 포함하는 세포외 도메인(extracellular binding domain); 막통과 도메인(transmembrane domain); 및 세포내 신호전달 도메인(intracellular signaling domain);을 포함하는, 키메릭 항원 수용체(Chimeric antigen receptor, CAR)로서, 상기 CD5에 특이적으로 결합하는 항원 결합 부위는, i) 서열번호 2, 서열번호 10, 서열번호 18 및 서열번호 26으로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR1, ii) 서열번호 3, 서열번호 11, 서열번호 19 및 서열번호 27로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR2 및 iii) 서열번호 4, 서열번호 12, 서열번호 20 및 서열번호 28로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄가변영역과 iv) 서열번호 6, 서열번호 14, 서열번호 22 및 서열번호 30으로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR1, v) 서열번호 7, 서열번호 15, 서열번호 23 및 서열번호 31로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR2 및 vi) 서열번호 8, 서열번호 16, 서열번호 24 및 서열번호 32로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는 항-CD5 항체의 단일 사슬 가변 단편(single chain variable fragment; scFv)인 것인, 키메릭 항원 수용체를 제공한다.
본 발명의 다른 측면은 상기 키메릭 항원 수용체를 암호화하는 염기서열을 포함하는 폴리뉴클레오티드 그리고 상기 폴리뉴클레오티드를 포함하는 발현 벡터를 제공한다.
본 발명의 다른 측면은 상기 키메릭 항원 수용체를 표면에 발현하는 면역세포를 제공한다.
상기 면역세포는 자연살해 세포, T 세포, 자연살해 T 세포, 사이토카인 유도 살해세포, 마크로파지 또는 수지상세포일 수 있다.본 발명의 또 다른 측면은 상기 면역세포를 유효성분으로 포함하는 암의 예방 또는 치료용 약학적 조성물을 제공한다.
상기 암은 백혈병 또는 림프종을 포함하는 혈액암일 수 있고, 암은 흉선 암종(thymic carcinoma), 비호지킨 림프종(non-Hodgkin lymphoma), 광범위큰세포림프종(diffuse large cell lymphoma), 소림프구성세포 림프종(small lymphocytic lymphoma), T-세포 종양(T-cell neoplasma), 말초 T세포 림프종(peripheral T-cell lymphoma), 외투세포림프종(mantle cell lymphoma), T-세포 급성림프구성백혈병(T-cell acute lymphobalstic lymphoma) 또는 만성림프성백혈병(chronic lymphoblastic lymphoma) 일 수 있다.
본 발명의 항체, 이의 항원 결합 단편, 그리고 이를 이용한 키메릭 항원 수용체는 암 세포에서 발현되는 CD5에 대해 특이적으로 결합할 수 있으며, 이에 따라 상기 키메릭 항원 수용체가 발현된 면역세포에서 신호전달이 발생함에 따라 면역세포의 세포독성 또는 세포용해 활성을 현저하게 향상시키며 사이토카인의 분비를 촉진하는 효과를 나타낸다. 또한, 이에 따라 상기 면역세포와 공배양된 암 세포의 탈과립(degranulation)을 증가시키는 효과가 있을 뿐만 아니라, 상기 키메릭 항원 수용체가 발현된 면역세포의 경우 CD5가 발현되는 정상세포에 대해서는 감소된 반응성을 나타낸다.
따라서, 본 발명의 항체나 이를 포함하는 키메릭 항원 수용체, 그리고 이를 발현시킨 면역세포는 암을 치료하기 위한 용도로 이용될 수 있다.
다만, 본 발명의 효과는 상기에서 언급한 효과로 제한되지 아니하며, 언급되지 않은 또 다른 효과들은 하기의 기재로부터 당업자에게 명확히 이해될 수 있을 것이다.
도 1은 CD5에 특이적으로 결합하는 단일 사슬 가변 단편(ScFv)을 세포외 도메인으로 포함하는 본 발명의 키메릭 항원 수용체(CD5-CAR)의 구조를 나타낸 모식도이다.
도 2는 본 발명의 키메릭 항원 수용체 4종의 유전자를 도입 및 발현시킨 자연살해 세포(CD5#1-CAR-NK 세포, CD5#4-CAR-NK 세포, CD5#11-CAR-NK 세포 및 CD5#14-CAR-NK 세포)를 대상으로, 본 발명의 키메릭 항원 수용체(CD5#1-CAR, CD5#4-CAR, CD5#11-CAR 및 CD5#14-CAR)의 발현 여부를 확인한 결과를 나타낸 것이다.
도 3은 본 발명의 키메릭 항원 수용체 4종의 유전자를 도입 및 발현시킨 자연살해 세포(CD5#1-CAR-NK 세포, CD5#4-CAR-NK 세포, CD5#11-CAR-NK 세포 및 CD5#14-CAR-NK 세포)의, CD5를 발현하는 MOLT4 세포와 CD5를 발현하지 않는 U937 세포에 대한 세포독성(세포용해 활성)을 측정하여 비교한 결과를 나타낸 것이다.
도 4는 본 발명의 키메릭 항원 수용체 CD5#11-CAR 및 CD5#14-CAR의 유전자를 도입 및 발현시킨 자연살해 세포(CD5#11-CAR-NK 세포 및 CD5#14-CAR-NK 세포)의, CD5를 발현하는 CCRF-CEM 세포 및 Jurkat 세포와 CD5를 발현하지 않는 Daudi 세포에 대한 세포독성(세포용해 활성)을 측정하여 비교한 결과를 나타낸 것이다.
도 5a와 도 5b 내지 도 5e는 본 발명의 키메릭 항원 수용체 4종의 유전자를 도입 및 발현시킨 자연살해 세포(CD5#1-CAR-NK 세포, CD5#4-CAR-NK 세포, CD5#11-CAR-NK 세포 및 CD5#14-CAR-NK 세포)를 CD5를 발현하는 MOLT4 세포 또는 CD5를 발현하지 않는 U937 세포와 공배양하였을 때, 자연살해 세포들에서 분비하는 사이토카인(IFN-γ)의 양(도 5a)과 탈과립(degranulation) 지표인 CD107α의 발현량(도 5b 내지 도 5e)을 각각 측정하여 비교한 결과를 나타낸 것이다.
도 6은 본 발명의 키메릭 항원 수용체 CD5#11-CAR 및 CD5#14-CAR의 유전자를 도입 및 발현시킨 자연살해 세포(CD5#11-CAR-NK 세포 및 CD5#14-CAR-NK 세포)의, CD5를 발현하는 정상세포를 포함하는 MNC(mononuclear cells)에 대한 세포독성(세포용해 활성)을 측정하여 비교한 결과를 나타낸 것이다.
도 7a는 본 발명의 키메릭 항원 수용체 CD5#11-CAR 및 CD5#14-CAR의 유전자를 도입 및 발현시킨 자연살해 세포(CD5#11-CAR-NK 세포 및 CD5#14-CAR-NK 세포)들을 단일세포로 분리 및 증식시킨 단일세포주들의 CD5-CAR의 발현양을 확인한 결과를 나타낸 것이고, 도 7b는 상기 확립된 각각의 단일세포주들의 MOLT4 세포 및 MNC에 대한 세포독성(세포용해 활성)을 측정하여 비교한 결과를 나타낸 것이며, 도 7c는 상기와 같이 확립된 단일세포주들 중에서 선도세포주를 선별하는 과정을 나타낸 것이다.
도 8은 본 발명의 키메릭 항원 수용체(CD5-CAR)를 일시적으로 발현시키기 위하여 설계된 mRNA 구조체의 구조를 나타낸 모식도이다.
도 9는 본 발명의 키메릭 항원 수용체 CD5#11-CAR 및 CD5#14-CAR의 유전자를 도입 및 발현시킨 primary 자연살해 세포를 대상으로, 본 발명의 키메릭 항원 수용체(CD5#11-CAR 및 CD5#14-CAR)의 발현 여부를 확인한 결과를 나타낸 것이다.
도 10은 본 발명의 키메릭 항원 수용체 CD5#11-CAR 및 CD5#14-CAR의 유전자를 도입 및 발현시킨 primary 자연살해 세포의, CD5를 발현하는 MOLT4 세포와 CCRF-CEM 세포에 대한 세포독성(세포용해 활성)을 측정하여 비교한 결과를 나타낸 것이다.
도 11a는 정상세포와 CD5를 발현하는 암 세포주들에서, 자연살해 세포의 활성화에 관여하는 리간드들의 발현양을 확인한 결과이고, 도 11b는 MNC를 이용하여 각 백혈구 세포마다 B7-H6의 발현 정도를 측정한 결과를 나타낸 것이다.
도 12는 CD5를 발현하는 암 세포주인 MOLT4 세포와 Jurkat 세포에서 B7-H6의 발현을 녹-다운(knock-down)시킨 경우에, 상기 암 세포주들에 대한 본 발명의 CD5#11-CAR-NK 세포의 세포독성의 변화를 확인한 결과이다.
도 13은 CD5를 발현하는 암 세포주인 MOLT4와 MNC에 본 발명의 CD5#11-CARNK 세포를 처리한 이후, 시간의 경과에 따라 B7-H6와 CD5의 발현 정도를 측정한 결과를 나타낸 것이다.
본 발명은 다양한 변환을 가할 수 있고 여러 가지 실시예를 가질 수 있는 바, 이하 특정 실시예들을 도면에 예시하고 상세한 설명에 상세하게 설명하고자 한다. 그러나, 이는 본 발명을 특정한 실시 형태에 대해 한정하려는 것이 아니며, 본 발명의 사상 및 기술 범위에 포함되는 모든 변환, 균등물 내지 대체물을 포함하는 것으로 이해되어야 한다. 본 발명을 설명함에 있어서 관련된 공지 기술에 대한 구체적인 설명이 본 발명의 요지를 흐릴 수 있다고 판단되는 경우 그 상세한 설명을 생략한다.
1. 신규한 항-CD5 항체, 이의 항원 결합 단편, 그리고 이를 포함하는 키메릭 항원 수용체(Chimeric antigen receptor; CAR) 및 이를 발현시키기 위한 폴리뉴클레오티드 및 발현 벡터
본 발명의 일 측면은 CD5에 대해 특이적으로 결합할 수 있는 항-CD5 항체 및 이의 항원 결합 단편을 제공한다.
본 발명에서 용어 "항체(antibody)"는 면역학적으로 항원의 에피토프(epitope)와 특이적 결합하여 반응성을 갖는 면역글로불린 분자를 의미한다. 상기 항체는 단일클론항체, 다클론항체, 전체 길이의 사슬 구조를 가진 항체(전장항체, full-length antibody), 적어도 항원 결합 기능을 갖는 기능적인 단편(항원 결합 단편) 및 재조합 항체를 모두 포함할 수 있으며, 구체적으로 본 발명의 항체는 단일클론항체 또는 이의 항원 결합 단편일 수 있다. 상기 단일클론항체는 실질적으로 동일한 항체 집단에서 수득한 단일 분자 조성의 항체 분자를 지칭하고, 이러한 단일클론항체는 특정 에피토프에 대해 단일 결합 특이성 및 친화도를 나타낸다. 상기 전장 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며, 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결될 수 있다. 상기 항체는 중쇄(heavy chain, HC) 및 경쇄(light chain, LC) 폴리펩타이드를 포함하며, 상기 중쇄 및 경쇄는 가변영역 및 불변영역을 포함할 수 있다.
상기 불변영역은 면역계의 다양한 종류의 세포(T-세포 등), 보체계의 성분을 포함하는 숙주 조직 등에, 상기 항체가 결합할 수 있도록 매개하는 부위이다. 상기 불변영역은, 같은 종으로부터 유래하는 같은 종류의 항체라면 항원의 종류와 무관하게 동일한 기능을 하며, 이를 이루는 아미노산 서열 역시 항체마다 동일하거나 높은 유사도를 갖는다. 상기 불변영역은 중쇄의 불변영역(CH로 약칭될 수 있음)과 경쇄 불변영역(CL로 약칭될 수 있음)으로 나뉠 수 있다. 상기 중쇄불변영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 및/또는 엡실론(ε) 타입을 가지며, 서브클래스로 감마1(γ1), 감마2(γ2), 감마3(γ3), 감마4(γ4), 알파1(α1) 및/또는 알파2(α2)를 가진다. 경쇄불변영역은 카파(κ) 및 람다(λ) 타입을 가진다. IgG는 아형(subtype)으로, IgG1, IgG2, IgG3 및 IgG4를 포함한다.
상기 가변영역은 항원에 대해 특이성을 가지는 항체 부위로, 중쇄의 가변영역(VH로 약칭될 수 있음)과 경쇄의 가변영역(VL로 약칭될 수 있음)으로 나뉠 수 있다. 상기 가변영역에는 3개의 CDR(complementary-determining regions, 또는 상보성 결정 영역)과 4개의 FR(framework regions)이 포함될 수 있다. 상기 CDR은 항원의 인식에 관여하는 고리 형태의 부위일 수 있으며, 상기 CDR의 아미노산 서열에 따라 항원에 대한 특이성이 결정될 수 있다. 상기 CDR은 그 순서에 따라 CDR1, CDR2, CDR3로 지칭될 수 있으며, 중쇄 및 경쇄 중 어느 폴리펩타이드의 CDR인지 여부에 따라, 중쇄가변영역의 경우 CDR-H1, CDR-H2, CDR-H3로, 경쇄가변영역의 경우 CDR-L1, CDR-L2, CDR-L3로 지칭될 수 있다. FR도 마찬가지로, 중쇄가변영역의 경우 FR-H1, FR-H2, FR-H3, FR-H4로, 경쇄가변영역의 경우 FR-L1, FR-L2, FR-L3, FR-L4로 지칭될 수 있다. 또한, 상기 CDR 및 FR은 각각의 가변영역에서 다음과 같은 순서로 배열될 수 있다.
본 발명에서 용어 "항원 결합 단편"은, 항체의 항원 결합 기능을 보유하는, 본 발명 인간화 항체의 임의의 단편을 의미한다. 상기 항원 결합 단편은 "단편", "항체 단편" 등의 용어와 호환되어 지칭될 수 있으며, 상기 항원 결합 단편은 Fab, Fab', F(ab')2, Fv 등일 수 있으나 이에 제한되는 것은 아니다.
상기 Fab는 경쇄 및 중쇄의 가변영역과 경쇄의 불변영역 및 중쇄의 첫 번째 불변영역(CH1 도메인)을 가지는 구조로 1 개의 항원 결합 부위를 가진다. 상기 Fab'는 중쇄 CH1 도메인의 C 말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 상기 Fab와 차이가 있다. 상기 F(ab')2는 Fab'의 힌지 영역의 시스테인 잔기가 디설파이드 결합을 이루면서 생성된다. 상기 Fv는 중쇄가변영역 및 경쇄가변영역만을 가지고 있는 최소의 항체 조각을 의미한다. 이중쇄 Fv(two-chain Fv)는 비공유 결합으로 중쇄가변영역과 경쇄가변영역이 연결되어 있고, 단쇄 Fv(single-chain Fv)는 일반적으로 펩타이드 링커를 통해 중쇄가변영역과 경쇄가변영역이 공유결합으로 연결되거나 또는 C-말단에서 바로 연결되어 있어서 이중쇄 Fv와 같이 다이머와 같은 구조를 이룰 수 있다. 상기 항원 결합 단편은, 단백질 가수분해 효소를 이용하거나(예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다.), 또는 유전자 재조합 기술을 통하여 제작할 수 있으나, 이에 제한되는 것은 아니다.
상기 링커는 펩타이드 링커일 수 있으며, 약 10 내지 25개 아미노산 길이를 가지는 것일 수 있다. 예를 들어, 상기 링커에는 글리신(G) 및/또는 세린(S)과 같은 친수성 아미노산이 포함될 수 있다. 상기 링커는 예를 들어, (GS)n, (GGS)n, (GSGGS)n 또는 (GnS)m(n, m은 각각 1 내지 10)을 포함할 수 있으며, 예를 들어 (GnS)m(n, m은 각각 1 내지 10)일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서 용어, "에피토프(epitope)"는 면역글로불린, 항체 또는 이의 항원 결합 단편이 특이적으로 인식하고 결합할 수 있는 항원 상의 특정 부위를 의미한다. 상기 에피토프는 연속 아미노산으로부터 또는 단백질의 3차 접힘에 의해 병치된 불연속 아미노산으로부터 형성될 수 있다
상기 "특이적으로 결합하는" 것은, 배경 결합보다 큰 결합 친화성으로 다른 분자에 대해 결합하는 것을 의미할 수 있으며, 예컨대 상기 세포외 도메인은 표적 항원에 대해 약 10-5 M 이상의 친화성 또는 Ka(1/M의 단위를 갖는 특정 결합 상호작용의 평형 해리 상수)로 표적 항원에 결합하는 것일 수 있다. 상기 친화성은 M의 단위를 갖는 특정 결합 상호작용의 평형 해리 상수(Kd)가 10-5 M 내지 10-13 M 또는 상기 범위 이하인 것일 수 있다.
본 발명의 상기 항체 또는 이의 항원 결합 단편은 i) 서열번호 2, 서열번호 10, 서열번호 18 및 서열번호 26으로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR1, ii) 서열번호 3, 서열번호 11, 서열번호 19 및 서열번호 27로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR2 및 iii) 서열번호 4, 서열번호 12, 서열번호 20 및 서열번호 28로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄가변영역; 및 iv) 서열번호 6, 서열번호 14, 서열번호 22 및 서열번호 30으로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR1, v) 서열번호 7, 서열번호 15, 서열번호 23 및 서열번호 31로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR2 및 vi) 서열번호 8, 서열번호 16, 서열번호 24 및 서열번호 32로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄가변영역;을 포함하고, CD5에 특이적으로 결합한다.
상기 중쇄가변영역은 서열번호 5, 서열번호 13, 서열번호 21 또는 서열번호 29의 아미노산 서열을 갖는 것일 수 있다.
상기 경쇄가변영역은 서열번호 9, 서열번호 17, 서열번호 25 또는 서열번호 33 의 아미노산 서열을 갖는 것일 수 있다.
상기 경쇄가변영역은 서열번호 8 또는 서열번호 16의 아미노산 서열을 갖는 것일 수 있다.
본 발명의 항체 또는 이의 항원 결합 단편은, 예컨대 인간으로부터 유래하는 항체의 중쇄불변영역 및/또는 경쇄불변영역을 더 포함할 수 있으며, 상기 항체 또는 이의 항원 결합 단편이 CD5에 대해 특이적으로 결합하는 특성을 저해하지 않는 것이라면, 상기 인간으로부터 유래하는 항체의 중쇄불변영역 및/또는 경쇄불변영역은 그 종류나 아미노산 서열에 제한없이 이용될 수 있다.
앞서 설명한 아미노산 서열들은, 이를 포함하는 폴리펩타이드의 구조, 기능, 활성 등에 영향을 미치지 않는 범위 내에서, 아미노산 잔기의 결실, 삽입, 치환 또는 이들의 조합에 의해 상이한 서열을 가지는 변이체를 포함할 수 있다. 또한, 상기 아미노산 서열들은 당업계에 알려진 통상적인 변형이 일어난 아미노산을 포함하는 것일 수 있으며, 상기 아미노산 변형은 예컨대 인산화(phosphorylation), 황화(sulfation), 아크릴화(acrylation), 당화(glycosylation), 메틸화(methylation), 파네실화(farnesylation) 등일 수 있다. 본 발명의 인간화 항체 또는 이의 항원 결합 단편은, 앞서 설명한 아미노산 서열들을 포함하는 것뿐만 아니라, 이와 실질적으로 동일한 아미노산 서열을 갖는 것이나 이의 변이체를 포함한다. 상기 실질적으로 동일한 아미노산 서열을 갖는 것의 의미는, 앞서 설명한 아미노산 서열과 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상의 상동성을 가지는 아미노산 서열을 포함하는 것일 수 있으나, 이에 제한되는 것은 아니다.
본 발명에서 용어 "키메릭 항원 수용체(Chimeric antigen receptor; CAR)"는 표적 항원 및 상기 항원을 발현하는 세포를 인식하여 결합하였을 때 이에 대하여 면역반응을 유도할 수 있도록 설계된 합성 복합체이다. 키메릭 항원 수용체는 세포외 도메인(extracellular binding domain), 막통과 도메인(transmembrane domain), 및 세포내 신호전달 도메인(intracellular signaling domain)을 포함할 수 있다. 키메릭 항원 수용체는 면역세포의 표면에 발현되어 세포외 도메인에 포함된 항원 결합 부위를 통해, 특정 항원, 예컨대 암 세포의 표면에 특이적으로 발현되는 항원을 인식하여 결합됨으로써, 면역세포 내에서 신호전달을 일으켜 면역세포의 활성을 변화시킬 수 있는바, 특정 항원만을 표적으로 하여 면역반응을 유발시킬 수 있다.
본 발명의 키메릭 항원 수용체(Chimeric antigen receptor; CAR)는, CD5(ephrin type-A receptor 2)에 특이적으로 결합하는 항원 결합 부위를 포함하는 세포외 도메인(extracellular binding domain); 막통과 도메인(transmembrane domain); 및 세포내 신호전달 도메인(intracellular signaling domain);을 포함한다.
상기 CD5에 특이적으로 결합하는 항원 결합 부위는, i) 서열번호 2, 서열번호 10, 서열번호 18 및 서열번호 26으로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR1, ii) 서열번호 3, 서열번호 11, 서열번호 19 및 서열번호 27로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR2 및 iii) 서열번호 4, 서열번호 12, 서열번호 20 및 서열번호 28로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄가변영역과 iv) 서열번호 6, 서열번호 14, 서열번호 22 및 서열번호 30으로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR1, v) 서열번호 7, 서열번호 15, 서열번호 23 및 서열번호 31로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR2 및 vi) 서열번호 8, 서열번호 16, 서열번호 24 및 서열번호 32로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는 항-CD5 항체의 단일 사슬 가변 단편(single chain variable fragment; scFv)일 수 있다.
본 발명의 상기 키메릭 항원 수용체가 면역세포의 표면에 발현되었을 때, 표적 항원인 CD5가 상기 수용체에 결합하게 되면 면역세포 내에서 신호전달이 발생하게 되고, 상기 면역세포의 세포독성(또는 세포용해 활성)의 향상 및/또는 상기 면역세포의 사이토카인 분비 촉진이 유도될 수 있다. 상기 세포독성(또는 세포용해 활성)의 향상 또는 사이토카인 분비 촉진은 항원이 존재하지 않는 상태의 면역세포가 나타내는 세포독성(또는 세포용해 활성)이나 사이토카인 분비보다 높은 수준으로 세포독성(또는 세포용해 활성)을 나타내거나 높은 수준으로 사이토카인을 분비하는 것일 수 있다.
상기 세포외 도메인은, 힌지 도메인(hinge domain) 및 스페이서 도메인(spacer domain)으로 이루어진 군으로부터 선택되는 적어도 하나를 더 포함할 수 있다. 상기 세포외 도메인의 항원 결합 부위는, 힌지 도메인 및/또는 스페이서 도메인을 통해 막통과 도메인과 연결될 수 있다.
상기 힌지 도메인은, 적절한 세포/세포 접촉, 적절한 항원/항원 결합 부위의 결합 결합 및 적절한 키메릭 항원 수용체의 활성화를 가능하게 하도록, 상기 키메릭 항원 수용체가 발현되는 면역세포의 표면으로부터 상기 항원 결합 부위가 물리적으로 이격될 수 있게 하는 부분으로, 세포외 도메인의 위치결정에 중요한 역할을 담당할 수 있다. 상기 키메릭 항원 수용체는 상기 세포외 도메인과 막통과 도메인 사이에 하나 이상의 힌지 도메인을 포함할 수 있다. 힌지 도메인은 천연, 합성, 반-합성 또는 재조합 공급원으로부터 유래될 수 있다. 힌지 도메인은 천연 발생 면역글로불린 힌지 영역 또는 변화된 면역글로불린 힌지 영역의 아미노산 서열을 포함할 수 있다. 상기 변화된 힌지 영역은 (a) 최대 30%의 아미노산 변화(예: 최대 25%, 20%, 15%, 10% 또는 5%의 아미노산 치환 또는 결실)을 갖는 천연 발생 힌지 영역, (b) 최대 30% 아미노산 변화(예: 최대 25%, 20%, 15%, 10% 또는 5%의 아미노산 치환 또는 결실)을 갖는 적어도 10개 아미노산(예: 적어도 12, 13, 14 또는 15개 아미노산) 길이의 천연 발생 힌지 영역의 일부, 또는 (c) 코어 힌지 영역(이는 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 또는 15, 또는 적어도 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 또는 15개 아미노산 길이일 수 있다)을 포함하는 천연 발생 힌지 영역의 일부를 지칭한다. 특정 실시형태에서, 천연 발생 면역글로불린 힌지 영역에서 하나 이상의 시스테인 잔기는 하나 이상의 다른 아미노산 잔기(예: 하나 이상의 세린 잔기)로 치환될 수 있다. 변화된 면역글로불린 힌지 영역은 대안적으로 또는 추가적으로 또 다른 아미노산 잔기, 예컨대 시스테인으로 치환된 야생형 면역글로불린 힌지 영역의 프롤린 잔기를 가질 수 있다. 힌지 도메인은 CD8, CD4, CD28 및 CD7 등의 유형 1 막단백질의 세포외 도메인으로부터 유래하는 힌지 영역일 수 있으나, 상기 항원 결합 부위와 막통과 도메인, 그리고 세포내 신호전달 도메인을 세포막 사이로 연결 가능한 것이라면 어느 것이든 제한없이 이용될 수 있다. 또한, 이는 이들 분자로부터의 야생형 힌지 영역일 수 있거나 변화될 수 있다.
상기 스페이서 도메인은 연결 도메인으로 지칭될 수 있으며, 예컨대 CD28 유래의 힌지 도메인 및/또는 CD8 유래의 힌지 도메인을 포함하는 것일 수 있으며, 상기 CD28 유래의 힌지 도메인 및/또는 CD8 유래의 힌지 도메인의 전체 또는 일부를 포함하는 것일 수 있다.
상기 힌지 도메인 및/또는 스페이서 도메인은, Myc 에피토프, CD8 힌지 도메인 및 Fc로 이루어진 군으로부터 선택되는 적어도 하나일 수 있으며, 구체적으로 Myc 에피토프 및 CD8 힌지 도메인을 포함하는 것일 수 있다.
상기 막통과 도메인(transmembrane domain)은, 세포외 도메인 및 세포내 신호전달 도메인을 서로 연결하여 융합시키고 면역 세포의 원형질 막에 키메릭 항원 수용체를 고정시키는 역할을 하는 일부 영역을 의미한다. 상기 막통과 도메인은 천연, 합성, 반합성 또는 재조합 공급원으로부터 유래하는 것일 수 있다. 상기 막통과 도메인은 T-세포 수용체(TCR)의 알파(α), 베타(β) 또는 제타(ζ) 사슬, CD28, CD3 엡실론(ε), CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 및 CD154로 이루어진 군으로부터 선택되는 어느 하나일 수 있으나, 이에 제한되는 것은 아니다.
상기 막통과 도메인은 링커(linker)를 통해 상기 세포외 도메인에 부착될 수 있다. 예를 들어, 링커는 2 내지 10개 아미노산 길이의 짧은 올리고펩타이드 또는 폴리펩타이드 링커일 수 있으며, 예컨대 글리신(G)-세린(S) 이중체(doublet)일 수 있으나, 이에 제한되는 것은 아니다.
상기 세포내 신호전달 도메인은, 면역세포의 기능(예를 들어, 키메릭 항원 수용체와 항원이 결합된 표적 세포에 대한 세포독성(또는 세포용해 활성) 인자의 방출을 포함하는 활성화, 사이토카인 생성, 증식 및 세포독성 또는 세포용해 활성, 또는 상기 항원 결합으로 유발된 기타 세포 반응)을 유발하기 위해, 상기 키메릭 항원 수용체와 항원의 결합에 따라 발생하는 신호를 면역세포의 내부로 전달하는 역할을 하는 부분에 해당한다. 상기 세포내 신호전달 도메인은 작동 기능 신호를 전달하고 세포가 특수한 기능을 수행하도록 지시하는 단백질의 일부일 수 있다.
상기 세포내 신호전달 도메인은, 기존에 키메릭 항원 수용체의 발전 과정에서 이용되었던 세포내 신호전달 도메인이 이용될 수 있다. 구체적으로, 1세대 CAR(키메릭 항원 수용체)에서 이용되었던 CD3ζ만을 포함할 수 있다. 그리고 2세대 CAR에서 이용되었던 것처럼, 면역세포에 대한 반응성 향상을 위하여 공자극 도메인(CD28 또는 CD137/4-1BB)과 CD3ζ를 결합한 형태가 이용될 수 있다. 또한, 3세대 CAR에서 이용되었던 것처럼 두 가지 이상의 공자극 도메인이 이용될 수 있으며, 이 때 생체 내 CAR을 포함하는 면역세포의 확장 및 지속성 달성을 위해 공자극 도메인을 4-1BB, CD28 또는 OX40 등과 결합시킬 수 있다. 나아가, 4세대 CAR에서 이용하였던 것처럼 IL-12 또는 IL-15와 같은 사이토카인을 암호화하는 추가 유전자를 포함하여, 사이토카인의 CAR 기반 면역단백질이 추가로 발현될 수 있도록 할 수 있으며, 5세대 CAR에서 이용하였던 것처럼 면역세포 강화를 위해 인터루킨 리셉터 체인, 예를 들어, IL-2Rβ를 추가로 포함할 수 있다.
상기 세포내 신호전달 도메인은 T-세포 수용체(TCR) 제타(ζ), FcR 감마(γ), FcR 베타(β), CD3 감마(γ), CD3 델타(δ), CD3 엡실론(ε), CD3 제타(ζ), CD5, CD22, CD79a, CD79b 및 CD66d로 이루어진 군으로부터 선택되는 적어도 하나를 포함할 수 있다
보다 구체적으로, 상기 세포내 신호전달 도메인에 의한 상기 면역세포의 활성화는, 세포내 신호전달 도메인의 2개 상이한 부류에 의해 매개될 수 있다. 예를 들면, 항원-의존성 일차 활성화를 개시하는 1차 신호전달 도메인 및 2차 신호를 제공하기 위해 항원-독립적 방식으로 작용하는 공자극 신호전달 도메인에 의해 면역세포 활성화가 매개될 수 있다. 따라서, 상기 세포내 신호전달 도메인은 1차 신호전달 도메인(primary signaling domain) 및 공자극 신호전달 도메인(co-stimulatory signaling domain)을 포함할 수 있다.
상기 1차 신호전달 도메인(primary signaling domain)이란, 면역세포 활성화를 자극 또는 억제 방식으로 조절하는 신호전달 도메인을 의미한다. 자극 방식으로 작용하는 1차 신호전달 도메인은 면역수용체 티로신-기반 활성화 모티브 또는 ITAM으로 공지되어 있는 신호전달 모티브를 함유할 수 있다. 1차 신호전달 도메인을 함유하는 ITAM은 TCRζ, FcRγ, FcRβ, CD3γ, CD3δ, CD3ε, CD3ζ, CD5, CD22, CD79a, CD79b, CD66d 등일 수 있으나, 이에 제한되는 것은 아니다. 보다 구체적으로, 상기 1차 신호전달 도메인은 CD3ζ(zeta)일수 있으나, 이에 제한되는 것은 아니다.
상기 공자극 신호전달 도메인(co-stimulatory signaling domain)이란, 공자극 분자의 세포내 신호전달 도메인을 의미한다. 상기 공자극 신호전달 도메인은 CD2, CD7, CD27, CD28, CD30, CD40, 4-1BB(CD137), OX40(CD134), CDS, ICAM-1, ICOS(CD278), LFA-1(CD11a/CD18), GITR, MyD88, DAP10, DAP12, PD-1, LIGHT, NKG2C, CD5, CD83 등으로 이루어진 군으로부터 선택되는 공자극 신호전달 도메인(co-stimulatory signaling domain)을 포함할 수 있으나, 이에 제한되는 것은 아니다. 구체적으로, 상기 공자극 분자는 DAP10일 수 있으나, 이에 제한되는 것은 아니다.
상기 키메라 항원 수용체는 2개 이상의 세포내 신호전달 도메인을 포함할 수 있으며, 2개 이상의 세포내 신호전달 도메인을 포함하는 경우에는 세포내 신호전달 도메인들이 서로 직렬로 연결될 수 있다. 또는 2 내지 10개의 아미노산으로 이루어지는 폴리펩티드 링커를 통해 연결될 수도 있고, 상기 링커 서열은 예컨대 글리신-세린 연속 서열일 수 있다. 상기 링커는 예를 들어, (GS)n, (GGS)n, (GSGGS)n 또는 (GnS)m(n, m은 각각 1 내지 10)을 포함할 수 있으며, 예를 들어 (GnS)m(n, m은 각각 1 내지 10)일 수 있으나, 이에 제한되는 것은 아니다.
상기 키메라 항원 수용체는 면역세포의 면역 기능 촉진 인자를 추가로 포함할 수 있으며, 예를 들어 상기 면역세포의 면역 기능 촉진 인자는 인터루킨 신호 서열(interleukin signal sequence)일 수 있다. 상기 인터루킨 신호 서열은 IL(interleukin)-12, IL-8, IL-2 등의 발현을 유도하는 것을 특징으로 할 수 있으나, 이에 제한되는 것은 아니다. 또한, 상기 면역세포가 T 세포일 경우, 상기 면역 기능 촉진 인자는 IL-7, CCL19 등일 수 있으나, 이에 제한되는 것은 아니다.
한편, 상기 키메라 항원 수용체는 도메인 노출을 위한 시그널(신호) 펩티드를 더 포함할 수 있다. 상기 시그널(신호) 펩티드는 임의의 분비된 또는 막통과 단백질의 일종일 수 있고, 이는 키메릭 항원 수용체가 세포막 또는 세포 표면으로 수송되도록 지시하고, 정확한 위치 선정을 제공할 수 있다. 구체적인 종류는 CD8 알파 또는 마우스 경쇄 카파 신호 펩타이드(mouse light kappa signal peptide)일 수 있으나, 이에 제한되는 것은 아니다.
본 발명의 구체적인 일 실시예에서는, 앞서 설명한 것과 같은 아미노산 서열을 갖는 4종(#1, #4, #11 및 #14)의 항-CD5 항체의 scFv를 세포외 도메인에 포함하고, 이와 Myc 및 힌지 도메인으로 연결된 CD28을 막통과 도메인 및 세포내 신호전달 도메인으로 포함하며, CD3-zeta 및 DAP10을 세포내 신호전달 도메인으로 연결한 형태의 키메릭 항원 수용체를 설계하여 본 발명의 키메릭 항원 수용체를 제조하였다(CD5-CAR).
앞서 설명한 것처럼, 본 발명의 키메릭 항원 수용체는 면역세포의 표면에서 발현하여 CD5를 인식해 결합하게 되면 면역세포의 세포독성 또는 세포용해 활성을 향상시키거나 면역세포의 사이토카인 분비를 촉진하도록 유도할 수 있다. 따라서, CD5를 발현하는 암 세포가 존재할 때 상기 키메릭 항원 수용체의 항원 결합 부위가 항원을 인식하여 결합할 경우, 신호전달에 의해 면역세포의 세포독성 또는 세포용해 활성 향상 및/또는 사이토카인 분비 촉진이 유도될 수 있어, 암 세포를 공격하는 세포독성 효능 또는 세포용해 효능이 우수한 키메릭 항원 수용체로 유용하게 이용될 수 있다.
본 발명의 다른 측면은, 상기 키메릭 항원 수용체를 발현시키기 위한 폴리뉴클레오티드 및 발현 벡터를 제공한다.
상기 폴리뉴클레오티드는 상기 키메릭 항원 수용체를 암호화하는 염기서열을 포함한다.
본 발명에서 용어 "폴리뉴클레오티드"는 DNA(gDNA 및 cDNA) 및 RNA 분자를 포괄적으로 포함하는 것으로, 기본 구성단위인 뉴클레오티드는 자연의 뉴클레오티드 뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다.
상기 키메릭 항원 수용체를 암호화한다는 것은, 상기 폴리뉴클레오티드가 전사, 번역 등의 통상적인 단백질 발현 과정을 거쳐, 본 발명의 키메릭 항원 수용체의 아미노산 서열을 갖는 단백질이 합성될 수 있는 유전 정보가 암호화되어 있다는 것을 의미한다. 이 때 상기 키메릭 항원 수용체와 완전히 동일한 아미노산 서열을 갖는 단백질뿐만 아니라, 앞서 설명한 것과 같이 상기 단백질과 실질적으로 동일한 아미노산 서열을 갖는 단백질이나, 상기 단백질과 동일 및/또는 유사한 활성을 갖는 단백질을 암호화하는 폴리뉴클레오티드까지 본 발명의 범위에 포함될 수 있다.
구체적으로, 본 발명의 폴리뉴클레오티드는 상기 CD5에 특이적으로 결합하는 항-CD5 항체의 항원 결합 단편을 암호화하는 염기서열을 포함하는 것일 수 있다.
또한, 본 발명의 폴리뉴클레오티드는 상기 항원 결합 단편을 암호화하는 염기서열뿐만 아니라 이와 연결된 다른 세포외 도메인 부분, 상기 막통과 도메인 및/또는 상기 세포내 신호전달 도메인을 암호화하는 염기서열을 포함하는 것일 수 있다.
상기 항체, 항원 결합 단편, 세포외 도메인, 막통과 도메인, 세포내 신호전달 도메인 등 상기 키메릭 항원 수용체에 대한 설명은 앞서 이들에 대해 설명한 것과 동일하다.
본 발명의 폴리뉴클레오티드는 상기 나열된 염기서열과 실질적으로 동일한 염기서열을 포함할 수 있다. 상기 실질적으로 동일한 염기서열이란, 예컨대 전사 및 번역되었을 때 동일한 아미노산이 합성될 수 있는 경우를 포함하며, 상기 나열된 염기서열들과 90% 이상, 91% 이상, 92% 이상, 93% 이상, 94% 이상, 95% 이상, 96% 이상, 97% 이상, 98% 이상, 99% 이상, 또는 99.5% 이상의 상동성을 가지는 염기서열일 수 있으나, 이에 제한되는 것은 아니다.
상기 키메라 항원 수용체를 암호화하는 폴리뉴클레오티드는 이를 도입시켜 발현시키고자 하는 생물의 종류와 상기 생물의 전사, 번역 등 발현 시스템에 따라, 최적화된 염기서열을 포함할 수 있다. 이는 코돈의 축퇴성(degeneracy)에서 기인한 것으로, 이에 따라 발현되는 단백질을 암호화할 수 있는 다양한 조합의 뉴클레오티드 서열이 존재할 수 있으며 이들은 모두 본 발명의 범위에 포함된다. 상기 코돈 최적화에 따른 폴리뉴클레오티드의 변형은, 본 발명의 키메릭 항원 수용체를 발현시켜 적용시키고자 하는 생물의 종류에 따라 결정될 수 있으며, 예컨대 본 발명의 폴리뉴클레오티드는 포유동물, 영장류의 코돈 선택에 최적화하여 변형된 폴리뉴클레오티드일 수 있고, 더욱 구체적으로는 인간으로부터 발현시켜 작용하기에 적합하도록 최적화되어 변형된 것일 수 있다.
본 발명의 발현 벡터는 상기 폴리뉴클레오티드를 포함한다.
상기 폴리뉴클레오티드는 본 발명의 상기 키메릭 항원 수용체를 암호화하는 염기서열을 포함하므로, 이를 포함하는 상기 발현 벡터는 상기 키메릭 항원 수용체를 발현시켜 제조하기 위해 이용될 수 있으며, 상기 키메릭 항원 수용체가 발현될 수 있도록 상기 폴리뉴클레오티드를 특정 세포 또는 생물로 이동시켜주는 역할을 하거나 상기 폴리뉴클레오티드를 보관, 저장하기 위해 이용될 수 있다.
상기 "벡터(vector)"는 적합한 숙주 내에서 DNA를 발현시킬 수 있는 적합한 조절 서열에 작동가능하게 연결된 DNA 서열을 함유하는 DNA 제조물을 의미한다. 벡터는 플라스미드, 파지 입자, 또는 간단하게 잠재적 게놈 삽입물일 수 있다. 적당한 숙주로 형질전환되면, 벡터는 숙주 게놈과 무관하게 복제하고 기능할 수 있거나, 또는 일부 경우에 게놈 그 자체에 통합될 수 있다. 또한, 상기 "발현 벡터"는 통상 이종의 DNA의 단편이 삽입된 재조합 캐리어(recombinant carrier)로서 일반적으로 이중 가닥의 DNA의 단편을 의미한다. 여기서, 이종 DNA는 숙주 세포에서 천연적으로 발견되지 않는 DNA인 이형 DNA를 의미한다. 발현 벡터는 일단 숙주 세포내에 있으면 숙주 염색체 DNA와 무관하게 복제할 수 있으며 벡터의 수 개의 카피 및 그의 삽입된(이종) DNA가 생성될 수 있다.
상기 발현 벡터는 원핵 세포 또는 진핵 세포를 숙주로 하여 구축될 수 있다.
예를 들어, 상기 발현 벡터가 원핵 세포를 숙주로 하는 경우에는, 전사를 진행시킬 수 있는 강력한 프로모터(예컨대, tac 프로모터, lac 프로모터, lacUV5 프로모터, lpp 프로모터, pLλ 프로모터, pRλ 프로모터, rac5 프로모터, amp 프로모터, recA 프로모터, SP6 프로모터, trp 프로모터 및 T7 프로모터 등), 번역의 개시를 위한 리보솜 결합 자리 및 전사/번역 종결 서열을 포함하는 것이 일반적이다. 숙주 세포로서 E.coli(예를 들어, HB101, BL21, DH5α 등)가 이용되는 경우, E. coli 트립토판 생합성 경로의 프로모터 및 오퍼레이터 부위(Yanofsky, C, J Bacteriol, (1984) 158:1018-1024), 그리고 파지 λ의 좌향 프로모터(pLλ 프로모터, Herskowitz, I and Hagen, D, Ann Rev Genet, (1980) 14:399-445)가 조절부위로서 이용될 수 있다. 숙주 세포로서 바실러스 균이 이용되는 경우, 바실러스 츄린겐시스의 독소단백질 유전자의 프로모터(Appl Environ Microbiol (1998) 64:3932-3938; Mol Gen Genet (1996) 250:734-741) 또는 바실러스균에서 발현 가능한 어떠한 프로모터라도 조절부위로 이용될 수 있다. 상기 발현 벡터는 당업계에서 종종 사용되는 플라스미드(예를 들어, pCL, pSC101, pGV1106, pACYC177, ColE1, pKT230, pME290, pBR322, pUC8/9, pUC6, pBD9, pHC79, pIJ61, pLAFR1, pHV14, pGEX 시리즈, pET 시리즈 및 pUC19 등), 파지(예를 들어, λgt4λB, λ-Charon, λΔz1 및 M13 등) 또는 바이러스(예를 들어, SV40 등)를 조작하여 제작될 수 있다.
상기 발현 벡터가 진핵 세포를 숙주로 하는 경우에는, 포유동물 세포의 지놈으로부터 유래된 프로모터(예를 들어, 메탈로티오닌 프로모터, β-액틴 프로모터, 사람 헤로글로빈 프로모터 및 사람 근육 크레아틴 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터(예를 들어, 아데노바이러스 후기 프로모터, 백시니아 바이러스 75K 프로모터, SV40 프로모터, 사이토메갈로바이러스(CMV) 프로모터, HSV의 tk 프로모터, 마우스 유방 종양 바이러스(MMTV) 프로모터, HIV의 LTR 프로모터, 몰로니 바이러스의 프로모터 엡스타인바 바이러스(EBV)의 프로모터 및 로우스 사코마 바이러스(RSV)의 프로모터)가 이용될 수 있으며, 전사 종결 서열로서 폴리아데닐화 서열을 일반적으로 가질 수 있다. 상기 발현 벡터는 CMV 프로모터를 갖는 것일 수 있다.
또한, 상기 발현 벡터는, 이로부터 발현되는 항체의 정제를 용이하게 하기 위하여 다른 서열과 융합될 수 있다. 융합되는 서열은, 예컨대 글루타티온 S-트랜스퍼라제(Pharmacia, USA), 말토스 결합 단백질(NEB, USA), FLAG(IBI, USA) 및 6x His(hexahistidine; Quiagen, USA) 등이 있다. 또한, 본 발명의 발현 벡터에 의해 발현되는 단백질이 키메릭 항원 수용체이므로 이의 특성을 고려할 때, 정제를 위한 추가적인 서열 없이도 발현된 단백질을 단백질 A 컬럼 등을 통하여 용이하게 정제할 수도 있다.
상기 발현 벡터는 선택표지로서 당업계에서 통상적으로 이용되는 항생제 내성 유전자를 포함하며, 예를 들어 암피실린, 겐타마이신, 카베니실린, 클로람페니콜, 스트렙토마이신, 카나마이신, 게네티신, 네오마이신 및 테트라사이클린에 대한 내성 유전자를 포함할 수 있다.
또한, 상기 발현 벡터는 형질주입하고자 하는 유전자의 발현을 촉진시키는 프로모터(promoter)와 전사에 필요한 기본 인자(Basal element)뿐만 아니라, 발현의 촉진 및 조절에 사용될 수 있는 인핸서(enhancer)를 더 포함할 수 있다.
2. CD5에 대한 키메릭 항원 수용체를 표면에 발현하는 면역세포
본 발명의 다른 측면은 CD5를 발현하는 암 세포에 대해 향상된 세포독성 또는 세포용해 활성을 나타내는 특징이 있는 면역세포를 제공한다.
상기 면역세포는, 앞서 설명한 본 발명의 상기 키메릭 항원 수용체를 표면에 발현한다.상기 키메릭 항원 수용체는 앞서 " 1. 신규한 항-CD5 항체, 이의 항원 결합 단편, 그리고 이를 포함하는 키메릭 항원 수용체(Chimeric antigen receptor; CAR) 및 이를 발현시키기 위한 폴리뉴클레오티드 및 발현 벡터 "에서 이에 대해 설명한 것과 동일하다. 구체적으로, 상기 키메릭 항원 수용체는 암 세포에서 발현되는 CD5 항원에 대해 특이적으로 결합할 수 있는 항원 결합 부위를 포함할 수 있다.
상기 키메릭 항원 수용체가 면역세포의 표면에 "발현"된다는 것은 키메릭 항원 수용체를 암호화하는 핵산의 첨가 또는 변형에 의해 조작된 임의의 면역세포를 의미한다. 따라서, 상기와 같이 면역세포의 표면에 키메릭 항원 수용체를 발현시키기 위하여, 상기 키메릭 항원 수용체를 암호화하는 폴리뉴클레오티드 또는 이를 포함하는 발현 벡터를 상기 면역세포에 형질주입(트렌스펙션; transfection) 또는 형질도입(트렌스덕션; transduction)할 수 있다. 상기 형질주입은 칼슘 포스페이트-DNA 공침전법, DEAE-덱스트란-매개 형질감염법, 폴리브렌-매개 형질감염법, 전기충격법, 미세주사법, 리포좀 융합법, 리포펙타민 및 원형질체 융합법 등의 해당분야에 공지된 여러 방법에 의해 수행될 수 있다. 또한, 상기 형질주입은 감염(infection)을 수단으로 하여 바이러스 또는 바이러스 벡터 입자를 사용하여 세포 내로 유전자를 전달시키는 것을 의미한다. 본 명세서에서 형질주입과 형질도입은 혼용될 수 있으나, 양자 큰 의미로 숙주세포에 외래 유전자 전달의 형질전환(transformation)으로 해석됨이 바람직하고, 형질주입 또는 형질도입에 의해 외래 유전자가 도입된 세포는 형질전환체라고 한다.
상기 면역세포는 면역을 유도하여 목적하는 치료 효과를 유발할 수 있는 세포라면 제한 없이 이용될 수 있으며, 말초혈액, 제대혈, 골수, 종양침윤 림프구, 림프절조직 또는 흉선 조직으로부터 획득될 수 있고, 태반세포, 배아줄기세포, 유도만능줄기세포 또는 조혈줄기세포로부터 분화시켜 획득할 수 있다. 또한, 상기 면역세포는 인간, 원숭이, 침팬지, 개, 고양이, 마우스, 래트 및 그의 유전자삽입 종뿐만 아니라 확립세포주로부터 획득할 수 있다.
면역세포 획득방법은 임의의 당업계에 알려진 수단을 사용할 수 있고, 자가, 동종 또는 이종으로부터 획득할 수 있다. "자가"는 이후에 개체에게 재도입될 동일한 개체로부터 파생된 모든 세포를 의미하고, "동종"은 세포가 도입되는 개체와 동일한 종의 다른 동물로부터 유래된 모든 세포를 의미하는 것이며, "이종"은 다른 종의 동물에서 유래된 세포를 의미한다.
특히, 상기 면역세포는 자연살해 세포(Natural Killer cell, NK cell), T 세포, 자연살해 T 세포(natural killer T cell, NKT cell), 사이토카인 유도 살해세포(Cytokine Induced Killer cell; CIK), 마크로파지, 수지상세포 등에서 선택되는 어느 하나일 수 있으나, 이에 제한되는 것은 아니다. 따라서, 본 발명에 따른 키메라 항원 수용체를 세포 표면에 발현하는 면역세포는 CAR-NK 세포(Chimeric Antigen Receptor Natural Killer Cell), CAR-T 세포(Chimeric Antigen Receptor T Cell), CAR-NKT 세포(Chimeric Antigen Receptor Natural killer T Cell), CAR-대식세포(Chimeric Antigen Receptor Macrophage) 등일 수 있다.
본 발명에서 제공되는 면역세포는 통상적인 키메릭 항원 수용체의 표적 세포에 대한 반응 개시(on)/중지(off)를 조절할 수 있으므로, 후속 세포 요법, 치료 세포의 활성이 증가 또는 감소될 필요가 있는 상황에서 매우 유익할 수 있는 안전성 스위치를 포함한다. 예를 들어, 키메릭 항원 수용체를 발현하는 면역세포가 환자에게 제공되는 경우, 어떤 상황에서는 부작용, 예를 들어 탈표적(off-target) 독성이 있을 수 있다. 또는 예를 들어, 치료 세포가 종양 세포의 수 또는 종양 크기를 감소시키는 작용을 할 수 있고, 더 이상 필요하지 않을 수 있다. 이러한 상황에서는 치료세포가 더 이상 활성화되지 않도록 조절할 수 있다. 특히, 자연살해 세포에 키메릭 항원 수용체가 도입된 상기 CAR-NK 세포는, 기존의 T 세포를 기반으로 한 CAR-T 치료제를 이용하였을 때의 암 면역치료가 가지고 있는 지속적인 독성에 의한 문제점, 자가면역 질환의 위험, 이종세포 이식에 대한 이식편대숙주질환(GVHD)의 문제점, 비표적 독성 문제 등을 반응 개시(on)/중지(off)의 스위치를 통해 해결할 수 있을 뿐만 아니라, 다양한 암 세포를 표적할 수 있도록 하여 범용의 치료제로 활용가능한 장점이 있다.
본 발명의 면역세포는, 암 세포에서 특이적으로 발현될 수 있는 CD5를 특이적으로 인식하여 결합할 수 있는 항체의 항원 결합 가변 단편(scFv)를 세포외 도메인으로 포함하는 키메릭 항원 수용체를, 세포 표면에 발현하고 있다. 따라서, 상기 CD5가 발현된 암 세포가 존재하는 경우 상기 키메릭 항원 수용체에 의해 신호전달이 발생할 수 있으며, 이를 통해 면역세포의 세포독성 또는 세포용해 활성이 더욱 향상되고 사이토카인의 분비량이 증가하게 된다. 그러므로, 본 발명의 면역세포는 암 세포를 공격해 이를 치료하는 활성을 가질 수 있다.
본 발명의 구체적인 실시예에서는, 본 발명의 CD5 특이적 항체 4종의 항원 결합 가변 단편을 세포외 도메인으로 포함하는 키메릭 항원 수용체를 자연살해 세포의 표면에 발현시켰다. 상기 각각의 4종의 자연살해 세포는 CD5를 발현하는 암 세포주인 MOLT4 세포나 CCRF-CEM, Jurkat 세포 등과 공배양되었을 때 세포독성(또는 세포용해 활성)이 향상되었고, 사이토카인의 분비량과 탈과립(degranulation) 정도가 현저하게 증가할 뿐만 아니라, CD5를 발현하는 정상세포가 포함된 MNC에 대해서는 감소된 세포독성을 나타내는 것으로 확인되어, 본 발명의 면역세포는 CD5를 발현하는 암 세포에 대해 선택적으로 탁월한 치료 효과가 있음을 확인할 수 있었다.
3. 본 발명 면역세포의 암에 대한 예방 또는 치료 용도
본 발명의 또 다른 측면은 상기 면역세포를 유효성분으로 포함하는 암의 예방 또는 치료용 약학적 조성물을 제공한다.
상기 면역세포, 이로부터 발현되는 키메릭 항원 수용체 등에 관한 설명은, " 1. 신규한 항-CD5 항체, 이의 항원 결합 단편, 그리고 이를 포함하는 키메릭 항원 수용체(Chimeric antigen receptor; CAR) 및 이를 발현시키기 위한 폴리뉴클레오티드 및 발현 벡터 " 및 " 2. CD5에 대한 키메릭 항원 수용체를 표면에 발현하는 면역세포 " 항목에서 이들에 대해 설명한 것과 동일하므로, 반복 설명을 피하기 위해 기재를 생략한다.
본 발명에서 용어 "암"은 "종양"은 동일한 의미로 사용되며, 전형적으로 조절되지 않은 세포 성장/증식을 특징으로 하는 포유동물의 생리학적 상태를 지칭하거나 의미한다.
본 발명의 상기 약학적 조성물로 치료할 수 있는 암 또는 암종은 특별히 제한되지 않으며, 고형암 및 혈액암을 모두 포함한다. 특히, 상기 백혈병 또는 림프종 등과 같은 혈액암일 수 있고, 구체적으로 흉선 암종(thymic carcinoma), 비-호지킨 림프종(non-Hodgkin lymphoma), 광범위큰세포림프종(diffuse large cell lymphoma), 소림프구성세포 림프종(small lymphocytic lymphoma), T-세포 종양(T-cell neoplasma), 말초 T-세포 림프종(peripheral T-cell lymphoma), 외투세포림프종(mantle cell lymphoma), T-세포 급성림프구성백혈병(T-cell acute lymphobalstic lymphoma), 만성림프성백혈병(chronic lymphoblastic lymphoma) 등에서 선택된 것일 수 있다.
또한, 본 발명의 상기 약학적 조성물은, 치료 대상인 개체의 종양 세포의 수에 비해 상기 면역세포의 수가 1배 내지 10배, 2배 내지 10배, 또는 5배 내지 8배로 포함될 수 있으나, 이에 제한되는 것은 아니다.
한편, 암의 치료에는 화학요법 및 방사선 요법을 병행하는 것이 일반적이다. 화학요법에 이용되는 항암제는 증식이 활발한 세포의 세포사멸을 유도하고 항암제의 치료 효과를 높이기 위한 방사선 조사는 이러한 세포사멸을 증가시킨다. 이때 항암제 및 방사선에 의해 세포사멸이 유도되는 세포는 암세포에 한정되는 것이 아니며, 면역치료를 위해 개체에 투여된 면역세포치료제에도 영향을 미칠 수 있다.
화학요법은 CHOP(cyclophosphamide, doxorubicin, vincristine, prednisone), EPOCH(etoposide, vincristine, doxorubicin, cyclophosphamide, prednisone) 또는 임의의 다른 여러약물 요법을 포함하지만 이에 한정되지 않는다.
본 발명에서 "세포치료제"는 개체로부터 분리, 배양 및 특수한 조작을 통해 제조된 세포 및 조직으로 치료, 진단 및 예방의 목적으로 사용되는 의약품(미국 FDA규정)으로서, 세포 혹은 조직의 기능을 복원시키기 위하여 살아있는 자가, 동종, 또는 이종 세포를 체외에서 증식 선별하거나 다른 방법으로 세포의 생물학적 특성을 변화시키는 등의 일련의 행위를 통하여 치료, 진단 및 예방의 목적으로 사용되는 의약품을 의미한다.
한편, 본 발명의 약학적 조성물은 약학적 또는 약제학적으로 허용되는 담체를 추가적으로 포함할 수 있다. 상기 '약학적으로 허용 가능한'의 의미는 유효성분의 활성을 억제하지 않으면서 적용(처방) 대상이 적응 가능한 이상의 독성을 지니지 않는다는 것이며, 상기 '담체'는 세포 또는 조직 내로의 화합물의 부가를 용이하게 하는 화합물로 정의된다.
본 발명의 상기 약학적 조성물은 단독으로 또는 어떤 편리한 담체 등과 함께 혼합하여 투여될 수 있고, 그러한 투여 제형은 단회 투여 또는 반복 투여 제형일 수 있다. 상기 약학 조성물은 고형 제제 또는 액상 제제일 수 있다. 고형 제제는 산제, 과립제, 정제, 캅셀제, 좌제 등이 있으나, 이에 한정되는 것은 아니다. 고형 제제에는 담체, 착향제, 결합제, 방부제, 붕해제, 활택제, 충진제 등이 포함될 수 있으나 이에 제한되는 것은 아니다. 액상 제제로는 물, 프로필렌 글리콜 용액 같은 용액제, 현탁액제, 유제 등이 있으나, 이에 한정되는 것은 아니며, 적당한 착색제, 착향제, 안정화제, 점성화제 등을 첨가하여 제조할 수 있다. 예를 들어, 산제는 본 발명의 유효 성분인 다중불포화지방산의 트리-하이드록시 유도체와 유당, 전분, 미결정셀룰로오스 등 약제학적으로 허용 가능한 적당한 담체를 단순 혼합함으로써 제조될 수 있다. 과립제는 본 발명의 상기 다중불포화지방산의 트리-하이드록시 유도체, 약학적으로 허용 가능한 적당한 담체 및 폴리비닐피롤리돈, 히드록시프로필셀룰로오스 등의 약학적으로 허용가능한 적당한 결합제를 혼합한 후, 물, 에탄올, 이소프로판올 등의 용매를 이용한 습식 과립법 또는 압축력을 이용한 건식 과립법을 이용하여 제조될 수 있다. 또한 정제는 상기 과립제를 마그네슘스테아레이트 등의 약학적으로 허용 가능한 적당한 활택제와 혼합한 후, 타정기를 이용하여 타정함으로써 제조될 수 있다.
본 발명의 약학적 조성물은 치료해야 할 질환 및 개체의 상태에 따라 경구제, 주사제(예를 들어, 근육주사, 복강주사, 정맥주사, 주입(infusion), 피하주사, 임플란트), 흡입제, 비강투여제, 질제, 직장투여제, 설하제, 트랜스더말제, 토피칼제 등으로 투여될 수 있으나, 이에 제한되는 것은 아니다. 투여 경로에 따라 통상적으로 사용되고 비독성인, 약학적으로 허용 가능한 운반체, 첨가제, 비히클을 포함하는 적당한 투여 유닛 제형으로 제제화될 수 있다.
특히, 본 발명의 약학적 조성물은 주사용 앰플을 통해 사용될 수 있다. 상기 주사용 앰플은 사용 직전에 주사액과 혼합 조제할 수 있으며, 주사액으로는 생리 식염수, 포도당, 만니톨, 링거액 등을 사용할 수 있다. 이렇게 제조된 본 발명의 약학적 조성물 또는 제제는 당업계에서 통상적으로 사용하는 투여방법을 이용하여 이식 및 기타 용도에 사용되는 세포와 함께 혼합물의 형태로 투여될 수 있다. 유효성분의 실제 투여량은 치료하고자 하는 질환, 질환의 중증도, 투여경로, 환자의 체중, 연령 및 성별 등의 여러 관련 인자에 비추어 결정되어야 한다.
또한, 본 발명의 약학적 조성물의 바람직한 투여량은 환자의 상태 및 체중, 질병의 정도, 약물 형태, 투여경로, 및 기간에 따라 다르지만, 당업자에 의해 적절하게 선택될 수 있다. 예컨대, 상기 약학적 조성물은 매일 약 0.0001 mg/kg 내지 약 10 g/kg이 투여될 수 있으며, 약 0.001 mg/kg 내지 약 1 g/kg의 1일 투여 용량으로 투여될 수 있다. 그러나 상기 투여량은 상기 혼합물의 정제 정도, 환자의 상태(연령, 성별, 체중 등), 치료하고 있는 상태의 심각성 등에 따라 다양할 수 있다. 필요에 따라 편리성을 위하여 1일 총 투여량을 하루 동안 여러 번 나누어 투여될 수 있다.
한편, 상기 조성물은 약학적 조성물 이외에도, 의약외품 조성물, 건강식품용 조성물 등의 형태일 수 있다.
또한, 본 발명의 또 다른 측면은 상기 면역세포를 치료가 필요한 개체에 투여하는 단계를 포함하는, 암의 예방 또는 치료 방법을 제공한다.
상기 면역세포는 상술한 약학적 조성물의 형태일 수 있고, 본 발명이 속하는 기술분야의 통상의 기술자가 상기 약학적 조성물의 적절한 투여 경로와 용량을 결정할 수 있다.
이하, 실시예를 통하여 본 발명을 보다 상세히 설명한다.
다만, 하기의 실시예는 본 발명을 예시하기 위한 것으로서 본 발명의 범위가 하기의 실시예에 한정되는 것은 아니다.
[실시예 1]
CD5에 대한 키메릭 항원 수용체를 표면에 발현하는 면역세포의 제조
[1-1] CD5 에 특이적으로 결합하는 항체의 단일 사슬 가변 단편 제작
CD5에 대해 특이적으로 결합할 수 있는 항-CD5 항체 서열 중에서, 특이적 결합에 중요한 역할을 하는 서열을 이용해 단일 사슬 가변 단편(single chain variable fragment; scFv) 4종(#1, #4, #11, #14)을 제조하였다.
하기 표 1에 기재된 바와 같이, #1 scFv의 경우, 서열번호 2의 아미노산 서열을 갖는 중쇄 CDR1, 서열번호 3의 아미노산 서열을 갖는 중쇄 CDR2 및 서열번호 4의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 6의 아미노산 서열을 갖는 경쇄 CDR1, 서열번호 7의 아미노산 서열을 갖는 경쇄 CDR2 및 서열번호 8의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하도록 설계하였다. #4 scFv의 경우, 서열번호 10의 아미노산 서열을 갖는 중쇄 CDR1, 서열번호 11의 아미노산 서열을 갖는 중쇄 CDR2 및 서열번호 12의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 14의 아미노산 서열을 갖는 경쇄 CDR1, 서열번호 15의 아미노산 서열을 갖는 경쇄 CDR2 및 서열번호 16의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하도록 설계하였다. #11 scFv의 경우, 서열번호 18의 아미노산 서열을 갖는 중쇄 CDR1, 서열번호 19의 아미노산 서열을 갖는 중쇄 CDR2 및 서열번호 20의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 22의 아미노산 서열을 갖는 경쇄 CDR1, 서열번호 23의 아미노산 서열을 갖는 경쇄 CDR2 및 서열번호 24의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하도록 설계하였다. 그리고 #14 scFv의 경우, 서열번호 26의 아미노산 서열을 갖는 중쇄 CDR1, 서열번호 27의 아미노산 서열을 갖는 중쇄 CDR2 및 서열번호 28의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 30의 아미노산 서열을 갖는 경쇄 CDR1, 서열번호 31의 아미노산 서열을 갖는 경쇄 CDR2 및 서열번호 32의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하도록 설계하였다.
CD5 ScFv 서열
#1
(서열번호 35)		 MKYLLPTAAAGLLLLAAQPAMAEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYGMHWVRQAPGKGLEWVSAISGSGSSTHYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGSSSVYSEAMDLWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQDISSYLNWYQQKPGKAPKLLIYATSNLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYTYPWTFGQGTKVEIKASTGPGGQHHHHHHGAWSHPQFEK
CDR1-VH (서열번호 2): DYGMH
CDR2-VH (서열번호 3): AISGSGSSTHYADSVKG
CDR3-VH (서열번호 4): GSSSVYSEAMDL
CDR1-VL (서열번호 6): RASQDISSYLN
CDR2-VL (서열번호 7): ATSNLQS
CDR3-VL (서열번호 8): QQSYTYPWT
#4
(서열번호 36)		 MKYLLPTAAAGLLLLAAQPAMAEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMSWVRQAPGKGLEWVSAISQSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDLASVYGAAFDVWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQTIASYLNWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSFPWTFGQGTKVEIKASTGPGGQHHHHHHGAWSHPQFEK
CDR1-VH (서열번호 10): DYAMS
CDR2-VH (서열번호 11): AISQSGGSTYYADSVKG
CDR3-VH (서열번호 12): DLASVYGAAFDV
CDR1-VL (서열번호 14): RASQTIASYLN
CDR2-VL (서열번호 15): AASTLQS
CDR3-VL (서열번호 16): QQSYSFPWT
#11
(서열번호 37)		 MKYLLPTAAAGLLLLAAQPAMAEVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISSSGGSKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKRSYAGEYFDHWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSISNWLNWYQQKPGKAPKLLIYDASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSFPWTFGQGTKVEIKASTGPGGQHHHHHHGAWSHPQFEK
CDR1-VH (서열번호 18): SYAMS
CDR2-VH (서열번호 19): AISSSGGSKYYADSVKG
CDR3-VH (서열번호 20): RSYAGEYFDH
CDR1-VL (서열번호 22): RASQSISNWLN
CDR2-VL (서열번호 23): DASSLQS
CDR3-VL (서열번호 24): QQSYSFPWT
#14
(서열번호 38)		 MKYLLPTAAAGLLLLAAQPAMAEVQLVESGGGLVQPGGSLRLSCAASGFTFSDYAMHWVRQAPGKGLEWVSAISSSGSYTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKGSYYGYYFDIWGQGTLVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLSASVGDRVTITCRASQSISNDLNWYQQKPGKAPKLLIYDTSRLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSFPWTFGQGTKVEIKASTGPGGQHHHHHHGAWSHPQFEK
CDR1-VH (서열번호 26): DYAMH
CDR2-VH (서열번호 27): AISSSGSYTYYADSVKG
CDR3-VH (서열번호 28): GSYYGYYFDI
CDR1-VL (서열번호 30): RASQSISNDLN
CDR2-VL (서열번호 31): DTSRLQS
CDR3-VL (서열번호 32): QQSYSFPWT
[1-2] 키메라 항원 수용체의 설계
상기와 같이 설계된 4종의 scFv를 항원 결합 부위로 포함하는 세포외 도메인으로 하고, 하기 표 2에 기재된 바와 같은 서열의 CAR 영역을 이용하여 자연살해 세포에 도입할 키메릭 항원 수용체(Chimeric antigen receptor; CAR)를 설계하였다. 구체적으로, 상기 4종의 scFv를 항원 결합 부위로 포함하는 세포외 도메인과, CD28을 막통과 도메인으로 하여 Myc 및 힌지 도메인으로 연결시켰고, 상기 막통과 도메인에 세포내 신호전달 도메인으로 CD3-zeta와 공자극 분자로 CD28 DAP10을 추가하여 연결함으로써, 소위 3세대 CAR로 분류되는 키메릭 항원 수용체의 세포내 신호전달 도메인을 갖도록, 본 발명의 키메릭 항원 수용체를 설계하였다(각각 'CD5#1-CAR', 'CD5#4-CAR', 'CD5#11-CAR' 및 'CD5#14-CAR'라 하고, 이들을 통칭하여 'CD5-CAR'라고 함). 그리고, 이를 암호화하는 유전자 컨스트럭트의 염기서열을 렌티-바이러스 벡터(Clontech사, 632155)에 삽입하였다(도 1).
CAR 영역 서열
Signal peptide
(서열번호 43)		 ACCATGGCCTTACCAGTGACCGCCTTGCTCCTGCCGCTGGCCTTACTGCTCCACGCCGCCAGGCCGGC
Myc
(서열번호 44)		 GCGAACAAAAACTCATCTCAGAAGAGGATCTG
Hinge
(서열번호 45)		 GGGGTCACCGTCTCTTCAGCGCTGAGCAACTCCATCATGTACTTCAGCCACTTCGTGCCGGTCTTCCTGCCAGCGAAGCCCACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTCGCAGCCCCTGTCCCTGCGCCCAGAGGCATGCCGGCCAGCGGCGGGGGGCGCAGTGCACACGAGGGGGCTGGAT
Transmembrane
(서열번호 46)		 GTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTCCCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTGGCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAGGAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTAT
DAP10
(서열번호 47)		 CTGTGCGCACGCCCACGCCGCAGCCCCGCCCAAGAAGATGGCAAAGTCTACATCAACATGCCAGGCAGGGGC
CD3ζ
(서열번호 48)		 TAGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCAGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATGTTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCAAGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCTAA
[1-3] CD5-CAR를 발현하는 자연살해 세포의 제조
상기 실시예 1-2에서 준비한 렌티-바이러스 벡터를, 바이러스 패키징 벡터(viral packaging vector; PMDLg/RRE, RSV/REV, VSVG)와 함께 HEK293T 세포에 형질전환시키고, 그로부터 CD5-CAR를 발현하는 렌티바이러스를 얻었다. 상기 렌티바이러스를 초고속원심분리기를 이용하여 농축시키고, 농축된 상기 렌티바이러스를 HEK293T 세포에 감염시킨 뒤, CD5-CAR의 Myc 에피토프 양을 유동세포계수법(Flow cytometry)으로 확인하여 감염 단위(Infection Unit)을 계산하였다. 감염다중도(Multiplicity of infection; MOI)가 30이 되도록 자연살해 세포 수 및 렌티바이러스의 양을 계산하고, CD5-CAR를 발현하는 렌티바이러스를 자연살해 세포(NK92 세포)에 spinoculation 방법(360g, 90min, RT)으로 감염시켰다. 상기와 같이 감염된 자연살해 세포를 37℃, 5% CO2 조건에서 5시간 동안 배양한 후, 신선한 배양배지로 갈아주고, 3일 후에 제대로 감염된 자연살해 세포의 선별을 위하여 3ug/ml 농도의 퓨로마이신(puromycin)을 처리하여 배양을 계속 진행하였다.
대조군으로, 감염되지 않은 자연살해 세포에도 퓨로마이신을 처리하고, 대조군에서 자연살해 세포가 퓨로마이신에 의해 모두 사멸할 때까지 퓨로마이신이 처리된 배지를 이용하여 배양을 계속하였다. 대조군의 자연살해 세포가 모두 사멸한 시점에서 감염된 자연살해 세포를 선별하고, 상기 선별된 자연살해 세포를 퓨로마이신이 없는 배지로 다시 배양하여 증식 또는 확장 시켰다. 상기 선별된 자연살해 세포의 증식 또는 확장에는 Alpha-MEM 함유 12.5% 우태아 혈청, 12.5% 말혈청, 0.2 mM 이노시톨, 0.1 mM 2-머캅토에탄올, 0.02 mM 폴릭산 및 200 U/ml 재조합 IL-2를 이용한 배지를 이용하하였다.
상기와 같이 제작 및 선별된 CD5#1-CAR, CD5#4-CAR, CD5#11-CAR 및 CD5#14-CAR를 발현하는 자연살해 세포(각각 'CD5#1-CAR-NK 세포', 'CD5#4-CAR-NK 세포', 'CD5#11-CAR-NK 세포' 및 'CD5#14-CAR-NK 세포'라고 하고, 이들을 통칭하여 'CD5-CAR-NK 세포'라고 함)에, CD5-CAR의 myc에 특이적으로 결합하는 항-myc 항체(CST; 9B11)를 처리하고(4℃, 암소에서 30분), 유동세포계수법을 통하여 Myc의 발현을 확인함으로써 CD5-CAR의 발현을 확인하였다. 이때, 대조군으로는 CD5-CAR를 발현하지 않는 본래의 자연살해 세포를 사용하였다.
그 결과, 도 2에 도시된 바와 같이, 대조군에 비해 4종의 CD5-CAR-NK 세포 모두에서 CD5-CAR가 제대로 발현되고 있음을 확인하였다.
[실시예 2]
CD5를 발현하는 암 세포에 대한, CD5-CAR를 발현하는 면역세포의 활성 확인
[2-1] CD5를 발현하는 암 세포에 대한, CD5-CAR-NK 세포의 활성 확인
CD5를 발현하는 것으로 알려진 암 세포주인 MOLT4와 CD5를 발현하지 않는 것으로 알려진 암 세포주 U937에 대하여, 상기 실시예 1-3에서 제조한 4종의 CD5-CAR-NK 세포들의 세포독성(cytotoxicity)(또는 세포살상능, 세포용해 활성)을 칼세인 AM 분석법으로 확인하였다. 구체적으로, MOLT4 세포와 U937 세포에 칼세인-AM(life technologies; C1430)을 5ug/ml의 농도로 처리하여 반응시킨 후(37℃, 5% CO2, 암소에서 1시간), 칼세인으로 염색된 MOLT4 세포와 U937 세포에 상기 4종의 각 CD5-CAR-NK 세포를 각각 2:1, 1:1, 0.5:1의 비율(자연살해 세포 : 암 세포)로 처리하여 200ul의 RPMI1640(10% FBS)에서 반응시킨 다음(37℃, 5% CO2에서 2시간) 상등액 100ul를 취하여 상등액 내에 존재하는 칼세인의 양을 확인하여, 각 조건에 따른 세포독성을 아래와 같은 방법으로 계산하였다.
세포독성(%) = (조건에 따른 칼세인 release value-spontaneous value) / (maximum value-spontaneous value) x 100
대조군으로는, 본 발명의 CD5-CAR를 암호화하는 유전자 컨스트럭트가 포함되지 않은 빈(empty) 렌티-바이러스 벡터 또는 본 발명의 CD5-CAR에서 세포외 도메인이 제거된 유전자 컨스트럭트가 포함된 렌티-바이러스 벡터를, 상기 실시예 [1-3]과 같은 방법으로 자연살해 세포에 도입하고 퓨로마이신으로 선별하는 과정을 거쳐 얻은 자연살해 세포를 이용하였고, 이들을 각각 'PURO NK 세포' 및 'dEcto-NK 세포'라고 한다.
그 결과, 도 3에 도시된 바와 같이, CD5를 발현하는 MOLT4 세포에 대해서는 상기 4종의 CD5-CAR-NK 세포가 모두 대조군(PURO NK 세포 또는 dEcto-NK 세포)에 비해 훨씬 높은 세포독성을 나타내는 낼 뿐만 아니라, 이러한 세포독성이, 처리된 CD5-CAR-NK 세포에 농도의존적인 것으로 확인되었다. 그에 반해, CD5를 발현하지 않는 U937 세포에 대해서는 대조군과 상기 4종의 CD5-CAR-NK 세포 모두 세포독성을 거의 나타내지 못하는 것으로 확인되었다.
또한, 상기와 같은 4종의 CD5-CAR-NK 세포 중 세포독성이 가장 우수한 것으로 확인된 2종(CD5#11-CAR-NK 세포, CD5#14-CAR-NK 세포)을 선별하여, CD5를 발현하는 것으로 알려진 다른 암 세포주인 CCRF-CEM, Jurkat와 CD5를 발현하지 않는 것으로 알려진 다른 암 세포주인 Daudi를 대상으로, 상기 2종의 각 CD5-CAR-NK 세포를 각각 2:1의 비율(자연살해 세포 : 암 세포)로 처리하여 상기와 동일한 방법으로 CD5-CAR-NK 세포의 세포 독성을 다시 한번 확인하였다.
그 결과, 도 4에 도시된 바와 같이, CD5를 발현하는 CCRF-CEM 세포와 Jurkat 세포에 대해서는 상기 2종의 CD5-CAR-NK 세포가 모두 대조군(PURO NK 세포 또는 dEcto-NK 세포)에 비해 훨씬 높은 세포독성을 나타낸 것으로 확인된데 반해, CD5를 발현하지 않는 Daudi 세포에 대해서는 대조군과 상기 2종의 CD5-CAR-NK 세포 모두 세포독성을 거의 나타내지 못하는 것으로 확인되었다.
나아가, 상기 4종의 CD5-CAR-NK 세포에 대하여 사이토카인(cytokine)과 그래뉼(granule)의 분비를 확인하였다. 구체적으로, MOLT4 세포와 U937 세포에 Puro NK 세포, dEcto-NK 세포 또는 상기 실시예 1-3에서 제조한 4종의 CD5-CAR-NK 세포 각각을 1:1로 처리하여 RPMI1640(10% FBS)에서 반응시킨 다음(37℃, 5% CO2 조건에서 12시간), 상등액을 모아서 상등액 내에 존재하는 사이토카인인 IFN-γ를 ELISA를 통해 확인하였다. 이때, Puro NK 세포, dEcto-NK 세포 및 CD5-CAR-NK 세포의 단독에서 분비되는 사이토카인의 양을 대조군으로 사용하였다.
그 결과, 도 5a에 도시된 바와 같이, CD5를 발현하는 MOLT4 세포에 처리한 CD5-CAR-NK 세포에서만 INF-γ의 분비량이 현저히 향상된 것으로 확인되었다.
또한, MOLT4 세포와 U937 세포에 Puro NK 세포, dEcto-NK 세포 또는 상기 실시예 1-3에서 제조한 4종의 CD5-CAR-NK 세포 각각을 1:1로 처리하여 RPMI1640(10% FBS)에서 반응시킨 다음(37℃, 5% CO2 조건에서 4시간), 자연살해 세포를 선별할 수 있도록 항-CD56 항체를 처리하여 염색하고, 유동세포계수법을 이용하여 Puro NK 세포, dEcto-NK 세포 및 상기 4종의 CD5-CAR-NK 세포들에서 의 CD107a가 발현되는 정도를 분석하였다.
그 결과, 도 5b 내지 도 5e에 도시된 바와 같이, INF-γ의 경우와 마찬가지로, CD5를 발현하는 MOLT4 세포에 처리한 CD5-CAR-NK 세포에서만 CD107a의 발현이 현저히 향상되어 있는 것으로 확인되었다.
[2-2] CD5를 발현하는 정상 T 세포에 대한, CD5-CAR-NK 세포의 활성 확인
본 발명의 CD5-CAR-NK 세포가, CD5를 발현하는 암 세포가 아닌 CD5를 발현하는 정상 T 세포에 대해서는 어떠한 활성을 나타내는지 확인하기 위하여, 먼저 Ficoll-Paque® Gradient 방법을 이용하여 제대혈로부터 NMC(mononuclear cells)를 분리하였다. 구체적으로, 피콜(ficoll) 위에 제대혈이 섞이지 않도록 조심스럽게 넣고 상온에서 2000rpm으로 30분 동안 원심분리한 다음, 백혈구와 혈소판을 포함하는 버피코트(buffy coat)(Enriched MNC fraction)를 분리하였다. 상기와 같이 분리한 분획에 1X ACK(Ammonium-Chloride-Potassium) 용해 완충용액을 37℃에서 10분간 처리하여 남아있는 적혈구를 깨어 순수한 MNC만을 분리해내었다.
상기와 같이 분리된 MNC를 대상으로, 상기 실시예 1-3에서 제조한 CD5#11-CAR-NK 세포 및 CD5#14-CAR-NK 세포를 각각 1:1의 비율(자연살해 세포 : MNC)로 처리하여 상기 실시예 [2-1]에서와 동일한 방법으로 CD5-CAR-NK 세포의 세포독성을 확인하였다.
그 결과, 도 6에 도시된 바와 같이, CD5#11-CAR-NK 세포와 CD5#14-CAR-NK 세포 모두, MNC에 대해서는 CD5를 발현하는 암 세포인 MOLT4에 비해 감소된 세포독성을 나타내는 것으로 확인되었다.
[2-3] CD5-CAR의 발현량에 따른 CD5-CAR-NK 세포의 활성 확인
초고속유세포분리기(BD FACS Aria Fusion)를 이용하여, 상기 실시예 1-3에서 제조한 CD5#11-CAR-NK 세포 및 CD5#14-CAR-NK 세포 각각을 96웰 플레이트에 단일세포로 분리하였다. 그리고, 이중 서로 비슷한 속도로 증식하는 세포들을 반복적으로 선별하여 48웰 플레이트, 24웰 플레이트, 6웰 플레이트 및 25T 플라스크의 순으로 증식시켰다.
그런 다음, 상기와 같이 분리된 CD5#11-CAR-NK 세포 및 CD5#14-CAR-NK 세포의 단일세포들 각각을 대상으로 CD5-CAR의 발현량을 확인하였고, 이를 기반으로 CD5-CAR의 발현 정도가 다른 세포주들을 구축 하였다(도 7a).
그런 다음, CD5가 발현되는 암 세포주인 MOLT4와 상기 실시예 [2-2]에서 분리한 MNC를 대상으로, 상기와 같이 구축된 CD5#11-CAR-NK 세포 및 CD5#14-CAR-NK 세포의 단일세포주들을 각각 1:1의 비율(자연살해 세포 : 암 세포 또는 MNC)로 처리하여 상기 실시예 [2-1]에서와 동일한 방법으로 CD5-CAR-NK 세포의 개별 단일세포주들의 세포독성을 확인하였다.
그 결과, 도 7b에 도시된 바와 같이, 비록 CD5-CAR-NK 세포의 개별 단일세포주들이 CD5를 발현하는 암 세포인 MOLT4에 대하여 향상된 세포독성을 나타내기는 하나, 세포독성 자체가 CD5-CAR의 발현량에 비례하지는 않는 것으로 확인되었다. 또한, 정상 T 세포가 포함된 MNC에 대해서는, CD5#11-CAR-NK 세포의 개별 단일세포주들은 모두 감소된 세포독성을 나타내었으나, CD5#14-CAR-NK 세포의 개별 단일세포주들은 세포독성이 그다지 감소하지 않은 것으로 확인되었다.
상기와 같은 결과로부터, 상기 2종의 CD5-CAR-NK 세포 중 정상 T 세포에 보다 낮은 세포독성을 나타내는 CD5#11-CAR-NK 세포의 개별 단일세포주들을 대상으로, CD5를 발현하는 암 세포인 MOLT4에 대해서는 높은 세포독성을 나타내면서도 정상 T 세포가 포함된 MNC에 대해서는 낮은 세포독성을 나타내는 단일세포주를 선별하였고, 그 결과 도 7c에 도시된 바와 같이 L4 단일세포주를 선도세포주로 선택하였다.
[2-4] primary 자연살해 세포 기반의 CD5-CAR-NK 세포의 활성 확인
나아가, 본 발명의 CD5-CAR-NK 세포를 NK92 세포가 아닌 primary 자연살해 세포를 이용하여 제작하였을 때도, 상기 실시예 [2-1] 내지 [2-3]에서 확인된 바와 같은 우수한 활성을 나타낼 수 있는지 확인하였다.
이를 위하여, 먼저 도 8에 도시된 바와 같이 mRNA의 UTR을 조합하여 단백질 발현 및 mRNA 안전성을 향상시키는 구조를 갖는 CD5#11-CAR와 CD5#14-CAR의 mRNA 구조체를 설계 및 제작하였고, 상기와 같은 mRNA 구조체의 염기서열을 렌티-바이러스 벡터(Clontech사, 632155)에 삽입하였다. 그런 다음, mRNA 합성 Kit(EZ™ High Yield In Vitro Transcription kit)를 이용하여 상기 유전자 컨스트럭트를 주형으로 하여 도 8에 도시된 구조를 갖는 CD5-CAR의 mRNA를 합성하였다.
상기와 같이 합성된 CD5-CAR의 mRNA를 전기천공법으로 primary 자연살해 세포 에 도입하였고, 7시간이 경과한 뒤에 CD5-CAR의 Myc에 특이적으로 결합하는 항-Myc 항체(CST; 9B11)를 처리하고(4℃, 암소에서 30분), 유동세포계수법을 통하여 Myc의 발현을 확인함으로써 CD5-CAR의 발현을 확인하였다.그 결과, 도 9에 도시된 바와 같이, primary 자연살해 세포에서 CD5-CAR가 제대로 발현되고 있음을 확인하였다.
또한, CD5를 발현하는 것으로 알려진 암 세포주인 MOLT4, CCRF-CEM 및 상기 실시예 [2-2]에서 분리한 MNC를 대상으로, 상기와 같이 primary 자연살해 세포를 기반으로 제조한 2종의 CD5-CAR-NK 세포들을 각각 0.5:1, 1:1의 비율(primary 자연살해 세포 : 암 세포)로 처리하여 상기 실시예 [2-1]에서와 동일한 방법으로 primary 자연살해 세포 기반의 CD5-CAR-NK 세포의 세포독성을 확인하였다.
그 결과, 도 10에 도시된 바와 같이, CD5를 발현하는 암 세포인 MOLT4 세포 및 CCRF-CEM 세포에 대해서는 상기 2종의 primary 자연살해 세포 기반의 CD5-CAR-NK 세포가 모두 대조군(PURO NK 세포 또는 dEcto-NK 세포)에 비해 훨씬 높은 세포독성을 나타내는 낼 뿐만 아니라, 이러한 세포독성이, 처리된 CD5-CAR-NK 세포에 농도의존적인 것으로 확인되었다. 그에 반해, CD5를 발현하는 정상 T 세포가 포함된 MNC에대해서는 보다 감소된 세포독성을 나타내는 것으로 확인되었다.
[실시예 3]
본 발명의 CD5-CAR-NK 세포의 활성을 조절하는 리간드 확인
[3-1] 본 발명의 CD5-CAR-NK 세포에 대한 리간드 스크리닝
정상 T 세포와 T 세포 기반 암 세포가 모두 CD5를 발현함에도 불구하고, 상기 실시예 2에서 확인된 바와 같이 본 발명의 CD5-CAR-NK 세포가 CD5를 발현하는 암 세포에 대하여 유독 높은 세포독성을 나타내는 이유를 알아보기 위해, 정상 세포인 상기 실시예 [2-2]에서 분리한 MNC와 CD5를 발현하는 암 세포인 MOLT4, CCRF-CEM, Jurkat에서 자연살해 세포의 활성화에 관여하는 리간드의 발현을 확인하였다. 상기 각각의 세포들에 각각의 리간드에 특이적으로 결합하는 항체를 처리하고, 유동세포계수법으로 해당 리간드의 발현 정도를 분석하였다.
그 결과, 도 11a에 도시된 바와 같이, 여러 리간드들 중에서 B7-H6가 상기와 같은 3종의 암 세포 모두에서 유의적으로 높게 발현되어 있었고, 억제성(inhibitory) 리간드인 HLA class1이 정상 세포에 높게 발현되어 있는 것으로 확인되었다.
또한, 상기 실시예 [2-2]에서 분리한 MNC를 대상으로, T 세포에 대한 마커인 CD3, 조혈모세포(Hematopoietic stem cell, HSC)에 대한 마커인 CD34, 골수성 세포(myeloid cell)에 대한 마커인 CD33 및 자연살해 세포에 대한 마커인 CD56에 각각 특이적으로 결합하는 항체를 처리하고, 유동계수법으로 각 백혈구 세포 종류별로 B7-H6의 발현 정도를 측정한 결과, 도 11b에 도시된 바와 같이 대부분의 정상 백혈구에서는 B7-H6가 발현되지 않는 것으로 확인되었다.
[3-2] B7-H6 발현이 CD5-CAR-NK 세포의 활성에 미치는 영향 확인
상기 실시예 [3-1]에서 확인된 자연살해 세포 활성화 리간드인 B7-H6의 발현이 본 발명의 CD5-CAR-NK 세포의 활성에 어떠한 영향을 미치는지 확인하였다.
이를 위해, CD5를 발현하는 암 세포주인 MOLT4 세포와 Jurkat 세포에 B7-H6의 유전자에 상보적인 서열을 가진 siRNA를 도입하여 도입시켜 일시적으로 B7-H6의 발현을 녹-다운(knock-down)시켰다. 그런 다음, 상기와 같이 B7-H6의 발현이 감소된 암 세포들을 대상으로, CD5#11-CAR-NK 세포를 각각 1:1의 비율(자연살해 세포 : 암 세포)로 처리하여 상기 실시예 [2-1]에서와 동일한 방법으로 CD5#11-CAR-NK 세포의 세포독성을 확인하였다.
그 결과, 도 12에 도시된 바와 같이, B7-H6의 발현을 감소시키지 않은 암 세포들에 비하여, B7-H6의 발현을 감소시킨 암 세포들에서 CD5#11-CAR-NK 세포의 세포독성이 감소된 것으로 확인되었다.
더 나아가, CD5를 발현하는 암 세포주인 MOLT4와 상기 실시예 [2-2]에서 분리한 MNC를 대상으로, CD5#11-CARNK 세포를 각각 1:1의 비율(자연살해 세포 : 암 세포 또는 MNC)로 처리하고, 유동세포계수법으로 2시간 마다 살아있는 MOLT4 세포와 MNC에서 B7-H6와 CD5의 발현 정도를 측정하였다.
그 결과, 도 13에 도시된 바와 같이, 시간이 경과할수록 살아있는 MOLT4에서 B7-H6의 발현과 CD5의 발현이 감소하는 것으로 확인되었다. 상기와 같은 결과로부터, B7-H6 발현이 높은 세포가 상대적으로 CD5#11-CAR-NK 세포에 의해 먼저 살상되었음을 알 수 있다.
[실시예 2] 및 [실시예 3]의 고찰
본 발명의 CD5-CAR-NK 세포는, CD5를 발현하는 암 세포에 대하여, 농도의존적으로 향상된 세포독성을 나타낼 뿐만 아니라, IFN-γ의 분비와 탈과립화 도 증가되는 것으로 확인된바, 이로부터 본 발명의 CD5-CAR-NK 세포가 CD5를 발현하는 암 세포에 대해 특이적으로 반응함을 알 수 있다.
CD5는 대부분의 T 세포 악성종양에서 발현되어 있지만 정상 T 세포에도 발현되는 것이고, 종래까지 개발된 CD5-CAR들은 모두 정상 T 세포에 대해 부작용을 나타내는 것으로 보고되어 있다. 그러나, 본 발명의 CD5-CAR-NK 세포의 경우, 제대혈에서 분리한 MNC들에 대하여 보다 감소된 세포독성을 나타내는 것으로 확인되었고, 특히 CD5#11-CAR-NK 세포가 CD5#14-CAR-NK 세포에 비해 더욱 낮은 세포독성을 나타내는 것으로 확인되었다. 상기와 같은 CD5#11-CAR-NK 세포와 CD5#14-CAR-NK 세포 간의 차이는 단일 사슬 가변 단편의 구조의 차이로 인한 것으로 사료되며, 서열번호 18의 아미노산 서열을 갖는 중쇄 CDR1, 서열번호 19의 아미노산 서열을 갖는 중쇄 CDR2 및 서열번호 20의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄가변영역과, 서열번호 22의 아미노산 서열을 갖는 경쇄 CDR1, 서열번호 23의 아미노산 서열을 갖는 경쇄 CDR2 및 서열번호 24의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는 #11 ScFv가 안전성에 더 유리한 효과를 가진다고 판단된다. 나아가, CD5-CAR-NK 세포들을 단일 세포로 분리 및 증식하여 확립한 개별 세포주의 세포독성 평가에서도 비슷한 양상이 나타났으며, 특히 CD5#11-CAR-NK 세포의 경우 CD5를 발현하는 암 세포에 대한 세포독성은 대조군에 비해 약 10배 정도 높은데 반해 CD5를 발현하는 정상세포에 대한 세포독성은 대조군에 비해 약 2배 정도 밖에 상승되지 않은 것으로 확인되었다. 상기와 같은 결과로부터, 본 발명의 CD5#11-CAR-NK 세포는 기존에 보고되었던 CD5-CAR들에 비해 안전성이 훨씬 높은 것으로 판단된다. 또한, NK92 세포에 영구적으로 발현시킨 CD5-CAR뿐만 아니라 primary 자연살해 세포에 CD5-CAR의 mRNA를 도입하여 일시적으로 CD5-CAR를 발현시킨 primary 자연살해 세포 기반의 CD5-CAR-NK 세포 역시도 CD5를 발현하는 암 세포에 대한 세포독성을 가짐을 보여줌으로써 CD5를 발현하는 정상세포까지 감소되는 부작용을 낮출 수 있는 가능성을 확인하였다.
한편, 정상세포와는 달리 CD5를 발현하는 암 세포에서, 자연살해 세포의 활성화에 관여하는 여러 리간드들 중 B7-H6가 특히 높게 발현되어 있음을 확인하였고, 이로부터 B7-H6의 발현 차이로 인해 본 발명의 CD5-CAR-NK 세포가 CD5를 발현하는 암 세포와 정상세포에 다르게 반응하는 것으로 예상하였다. 나아가, CD5를 발현하는 암 세포에서 B7-H6의 발현량을 조절한 경우에, 본 발명의 CD5-CAR-NK 세포의 세포독성이 B7-H6의 발현량에 따라 변함을 확인하였고, 이로부터 B7-H6가 본 발명의 CD5-CAR-NK 세포의 활성에 주요한 요인으로 작용하며 CD5를 발현하는 암 세포에 상대적으로 높게 발현되어 있기 때문에 본 발명의 CD5-CAR-NK 세포가 정상세포보다 암 세포에 먼저 반응하는 것임을 알 수 있다.
요컨대, CD5에 대한 항체의 CDR 서열 차이에 따른 CD5-CAR의 활성 차이로 인해 CD5를 발현하는 암 세포와 정상세포에 대한 세포독성이 완전히 차별화될 수 있고, CD5-CAR의 발현 정도에 따라 각기 다른 세포독성을 가진 단일세포주를 활용하여 암 세포에 대해서는 높은 항암효과를 보이는 동시에 정상세포에 대해서는 반응성 낮은 T 세포 혈액암에 대한 새로운 치료제의 개발이 가능할 것으로 판단된다.
이상으로 본 발명 내용의 특정한 부분을 상세히 기술하였는바, 당업계의 통상의 지식을 가진 자에게 있어서, 이러한 구체적 기술은 단지 바람직한 실시 양태일 뿐이며, 이에 의해 본 발명의 범위가 제한되는 것이 아닌 점은 명백할 것이다. 따라서 본 발명의 실질적인 범위는 첨부된 청구항들과 그것들의 등가물에 의하여 정의된다고 할 것이다.

Claims (14)

  1. i) 서열번호 2, 서열번호 10, 서열번호 18 및 서열번호 26으로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR1, ii) 서열번호 3, 서열번호 11, 서열번호 19 및 서열번호 27로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR2 및 iii) 서열번호 4, 서열번호 12, 서열번호 20 및 서열번호 28로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄가변영역; 및
    iv) 서열번호 6, 서열번호 14, 서열번호 22 및 서열번호 30으로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR1, v) 서열번호 7, 서열번호 15, 서열번호 23 및 서열번호 31로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR2 및 vi) 서열번호 8, 서열번호 16, 서열번호 24 및 서열번호 32로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄가변영역;
    을 포함하는 CD5에 특이적으로 결합하는, 항체 또는 이의 항원 결합 단편.
  2. 청구항 1에 있어서,
    상기 중쇄가변영역은 서열번호 5, 서열번호 13, 서열번호 21 및 서열번호 29로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 것인, 항체 또는 이의 항원 결합 단편.
  3. 청구항 1에 있어서,
    상기 경쇄가변영역은 서열번호 9, 서열번호 17, 서열번호 25 및 서열번호 33으로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 것인, 항체 또는 이의 항원 결합 단편.
  4. CD5에 특이적으로 결합하는 항원 결합 부위를 포함하는 세포외 도메인(extracellular binding domain); 막통과 도메인(transmembrane domain); 및 세포내 신호전달 도메인(intracellular signaling domain);을 포함하는, 키메릭 항원 수용체(Chimeric antigen receptor, CAR)로서,
    상기 CD5에 특이적으로 결합하는 항원 결합 부위는, i) 서열번호 2, 서열번호 10, 서열번호 18 및 서열번호 26으로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR1, ii) 서열번호 3, 서열번호 11, 서열번호 19 및 서열번호 27로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR2 및 iii) 서열번호 4, 서열번호 12, 서열번호 20 및 서열번호 28로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄 CDR3를 포함하는 중쇄가변영역과 iv) 서열번호 6, 서열번호 14, 서열번호 22 및 서열번호 30으로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR1, v) 서열번호 7, 서열번호 15, 서열번호 23 및 서열번호 31로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR2 및 vi) 서열번호 8, 서열번호 16, 서열번호 24 및 서열번호 32로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 경쇄 CDR3를 포함하는 경쇄가변영역을 포함하는 항-CD5 항체의 단일 사슬 가변 단편(single chain variable fragment; scFv)인 것인, 키메릭 항원 수용체.
  5. 청구항 4에 있어서,
    상기 CD5에 특이적으로 결합하는 항원 결합 부위는,
    서열번호 5, 서열번호 13, 서열번호 21 및 서열번호 29로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을 갖는 중쇄가변영역을 포함하는 항-CD5 항체의 단일 사슬 가변 단편인 것인, 키메릭 항원 수용체.
  6. 청구항 4에 있어서,
    상기 CD5에 특이적으로 결합하는 항원 결합 부위는,
    서열번호 9, 서열번호 17, 서열번호 25 및 서열번호 33으로 이루어지는 군에서 선택되는 어느 하나의 아미노산 서열을을 갖는 경쇄가변영역을 포함하는 항-CD5 항체의 단일 사슬 가변 단편인 것인, 키메릭 항원 수용체.
  7. 청구항 4 내지 청구항 6 중 어느 한 항의 키메릭 항원 수용체를 암호화하는 염기서열을 포함하는, 폴리뉴클레오티드.
  8. 청구항 7의 폴리뉴클레오티드를 포함하는, 발현 벡터.
  9. 청구항 4 내지 청구항 6 중 어느 한 항의 키메릭 항원 수용체를 표면에 발현하는, 면역세포.
  10. 청구항 9에 있어서,
    상기 면역세포는 자연살해 세포(NK cell), T 세포, 자연살해 T 세포(NKT cell), 대식세포 및 수지상세포로 이루어진 군에서 선택되는 적어도 하나인 것인, 면역세포.
  11. 청구항 9의 면역세포를 유효성분으로 포함하는 암의 예방 또는 치료용 약학적 조성물.
  12. 청구항 11에 있어서,
    상기 암은 백혈병 또는 림프종을 포함하는 혈액암인 것인, 암의 예방 또는 치료용 약학적 조성물.
  13. 청구항 12에 있어서,
    상기 암은 흉선 암종(thymic carcinoma), 비-호지킨 림프종(non-Hodgkin lymphoma), 광범위큰세포림프종(diffuse large cell lymphoma), 소림프구성세포 림프종(small lymphocytic lymphoma), T-세포 종양(T-cell neoplasma), 말초 T-세포 림프종(peripheral T-cell lymphoma), 외투세포림프종(mantle cell lymphoma), T-세포 급성림프구성백혈병(T-cell acute lymphobalstic lymphoma) 및 만성림프성백혈병(chronic lymphoblastic lymphoma)로 이루어진 군에서 선택되는 적어도 하나인 것인, 암의 예방 또는 치료용 약학적 조성물.
  14. 청구항 11에 있어서,
    항암 화학요법제를 추가로 포함하는 것인, 암의 예방 또는 치료용 약학적 조성물.
PCT/KR2022/006009 2021-04-29 2022-04-27 신규한 항-cd5 키메릭 항원 수용체 및 이를 발현하는 면역세포 WO2022231298A1 (ko)

Priority Applications (2)

Application Number Priority Date Filing Date Title
EP22796130.7A EP4332118A1 (en) 2021-04-29 2022-04-27 Novel anti-cd5 chimeric antigen receptor and immune cell expressing same
JP2023566973A JP2024516263A (ja) 2021-04-29 2022-04-27 新規な抗ｃｄ５キメラ抗原受容体及びそれを発現する免疫細胞

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR20210055886 2021-04-29
KR10-2021-0055886 2021-04-29

Publications (1)

Publication Number Publication Date
WO2022231298A1 true WO2022231298A1 (ko) 2022-11-03

Family

ID=83847038

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/006009 WO2022231298A1 (ko) 2021-04-29 2022-04-27 신규한 항-cd5 키메릭 항원 수용체 및 이를 발현하는 면역세포

Country Status (4)

Country Link
EP (1) EP4332118A1 (ko)
JP (1) JP2024516263A (ko)
KR (1) KR20220148745A (ko)
WO (1) WO2022231298A1 (ko)

Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110250203A1 (en) * 2008-08-29 2011-10-13 Symphogen A/S Anti-cd5 antibodies
KR20180002604A (ko) 2015-02-27 2018-01-08 아이셀 진 테라퓨틱스 엘엘씨 혈액 악성종양을 표적으로 하는 키메라 항원 수용체(car), 조성물 및 이의 용도
WO2020023561A1 (en) * 2018-07-23 2020-01-30 Magenta Therapeutics, Inc. Use of anti-cd5 antibody drug conjugate (adc) in allogeneic cell therapy
KR102122546B1 (ko) 2017-01-05 2020-06-15 한국생명공학연구원 항-코티닌 키메릭 항원 수용체를 발현하는 자연살해 세포
US20200405811A1 (en) * 2015-04-23 2020-12-31 Baylor College Of Medicine Cd5 chimeric antigen receptor for adoptive t cell therapy

Patent Citations (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110250203A1 (en) * 2008-08-29 2011-10-13 Symphogen A/S Anti-cd5 antibodies
KR20180002604A (ko) 2015-02-27 2018-01-08 아이셀 진 테라퓨틱스 엘엘씨 혈액 악성종양을 표적으로 하는 키메라 항원 수용체(car), 조성물 및 이의 용도
US20200405811A1 (en) * 2015-04-23 2020-12-31 Baylor College Of Medicine Cd5 chimeric antigen receptor for adoptive t cell therapy
KR102122546B1 (ko) 2017-01-05 2020-06-15 한국생명공학연구원 항-코티닌 키메릭 항원 수용체를 발현하는 자연살해 세포
WO2020023561A1 (en) * 2018-07-23 2020-01-30 Magenta Therapeutics, Inc. Use of anti-cd5 antibody drug conjugate (adc) in allogeneic cell therapy

Non-Patent Citations (4)

* Cited by examiner, † Cited by third party
Title
APPL ENVIRON MICROBIOL, vol. 64, 1998, pages 3932 - 3938
MOL GEN GENET, vol. 250, 1996, pages 734 - 741
WADA MASAYUKI; ZHANG HONGYU; FANG LIU; FENG JIA; TSE CHARLOTTE OLIVIA; ZHANG WENLI; CHEN QI; SHA SHA; CAO YUANZHEN; CHEN KEVIN H.;: "Characterization of an Anti-CD5 Directed CAR T-Cell against T-Cell Malignancies", STEM CELL REVIEWS AND REPORTS, vol. 16, no. 2, 1 February 2020 (2020-02-01), New York , pages 369 - 384, XP037090843, ISSN: 2629-3269, DOI: 10.1007/s12015-019-09937-9 *
YANOFSKY, C, J BACTERIOL, vol. 158, 1984, pages 1018 - 1024

Also Published As

Publication number Publication date
EP4332118A1 (en) 2024-03-06
KR20220148745A (ko) 2022-11-07
JP2024516263A (ja) 2024-04-12

Similar Documents

Publication Publication Date Title
JP2002512502A (ja) 癌細胞の標的細胞溶解
WO2021256724A1 (ko) Bcma를 표적으로 하는 키메라 항원 수용체 및 이의 용도
US20240082306A1 (en) Novel chimeric antigen receptor and use thereof
WO2020005003A1 (ko) Lag-3에 특이적으로 결합하는 단클론항체 및 이의 용도
WO2022030730A1 (ko) 메소텔린에 특이적으로 결합하는 항-메소텔린 키메릭 항원 수용체
EP4194472A1 (en) Chimeric antigen receptor comprising novel co-stimulatory domain and use thereof
WO2022218226A1 (zh) 工程化免疫细胞及其用途
WO2024049161A1 (ko) 신규한 항-pd-l1 키메릭 항원 수용체 및 이를 발현하는 면역세포
WO2021210939A1 (ko) 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체
WO2021060914A1 (ko) 항-클라우딘-3 키메라 항원 수용체
WO2023003404A1 (ko) 신규한 키메릭 항원 수용체 및 이를 발현하는 면역세포
WO2022231298A1 (ko) 신규한 항-cd5 키메릭 항원 수용체 및 이를 발현하는 면역세포
WO2022250440A1 (ko) Erbb3 특이적인 키메라 항원 수용체 및 이를 발현하는 면역세포 치료제
WO2021235697A1 (ko) Cd22에 특이적인 항체 및 이의 용도
WO2023014182A1 (ko) 신규한 항-epha2 키메릭 항원 수용체 및 이를 발현하는 면역세포
CN115521917A (zh) 工程化免疫细胞及其用途
CN115725503A (zh) 工程化免疫细胞
WO2023027471A1 (ko) 기능이 강화된 신규 키메라 항원 수용체(car)
US20240216428A1 (en) Novel Anti-CD5 Chimeric Antigen Receptor and Immune Cell Expressing Same
WO2018128486A1 (ko) Ceacam6에 특이적으로 결합하는 항-ceacam6 키메릭 항원 수용체
WO2021060932A1 (ko) 항-c-met 항체 또는 그의 항원 결합 단편을 포함하는 키메라 항원 수용체, 및 이의 용도
WO2022250450A1 (ko) 항 메소텔린 scFv를 포함하는 키메릭 항원 수용체 및 이의 용도
WO2022215919A1 (ko) Cd47에 특이적으로 결합하는 키메릭 항원 수용체 및 이의 용도
WO2023068584A1 (ko) Cd138에 특이적으로 결합하는 키메릭 항원 수용체 및 이의 용도
WO2022186682A1 (ko) Rank 리간드(rank ligand)에 특이적으로 결합하는 키메릭 항원 수용체 및 이의 용도

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22796130

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 18288815

Country of ref document: US

WWE Wipo information: entry into national phase

Ref document number: 2023566973

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 2022796130

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2022796130

Country of ref document: EP

Effective date: 20231129