WO2021062227A2 - Compositions and methods for treatment of liquid cancers - Google Patents

Compositions and methods for treatment of liquid cancers Download PDF

Info

Publication number
WO2021062227A2
WO2021062227A2 PCT/US2020/052822 US2020052822W WO2021062227A2 WO 2021062227 A2 WO2021062227 A2 WO 2021062227A2 US 2020052822 W US2020052822 W US 2020052822W WO 2021062227 A2 WO2021062227 A2 WO 2021062227A2
Authority
WO
WIPO (PCT)
Prior art keywords
cell
targets
immune
cells
car
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2020/052822
Other languages
English (en)
French (fr)
Other versions
WO2021062227A3 (en
Inventor
Waseem QASIM
Jason Michael GEHRKE
Aaron D. EDWARDS
Ryan Murray
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Beam Therapeutics Inc
Original Assignee
Beam Therapeutics Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to JP2022519460A priority Critical patent/JP7615134B2/ja
Application filed by Beam Therapeutics Inc filed Critical Beam Therapeutics Inc
Priority to EP20868560.2A priority patent/EP4034138A4/en
Priority to CN202080082229.8A priority patent/CN115279398B/zh
Priority to CA3155667A priority patent/CA3155667A1/en
Priority to US17/762,690 priority patent/US12594301B2/en
Priority to AU2020355222A priority patent/AU2020355222A1/en
Priority to CN202510808723.2A priority patent/CN120905310A/zh
Priority to KR1020227013872A priority patent/KR20220090512A/ko
Publication of WO2021062227A2 publication Critical patent/WO2021062227A2/en
Publication of WO2021062227A3 publication Critical patent/WO2021062227A3/en
Anticipated expiration legal-status Critical
Priority to JP2024231478A priority patent/JP2025066723A/ja
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/63Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
    • C12N15/79Vectors or expression systems specially adapted for eukaryotic hosts
    • C12N15/85Vectors or expression systems specially adapted for eukaryotic hosts for animal cells
    • C12N15/86Viral vectors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/13B-cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/15Natural-killer [NK] cells; Natural-killer T [NKT] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/19Dendritic cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/20Cellular immunotherapy characterised by the effect or the function of the cells
    • A61K40/22Immunosuppressive or immunotolerising
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/418Antigens related to induction of tolerance to non-self
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4214Receptors for cytokines
    • A61K40/4215Receptors for tumor necrosis factors [TNF], e.g. lymphotoxin receptor [LTR], CD30
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4214Receptors for cytokines
    • A61K40/4217Receptors for interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/4224Molecules with a "CD" designation not provided for elsewhere
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70596Molecules with a "CD"-designation not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/12Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from bacteria
    • C07K16/1267Gram-positive bacteria
    • C07K16/1271Micrococcaceae (F); Staphylococcaceae (F), e.g. Staphylococcus (G)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/11DNA or RNA fragments; Modified forms thereof; Non-coding nucleic acids having a biological activity
    • C12N15/113Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing
    • C12N15/1138Non-coding nucleic acids modulating the expression of genes, e.g. antisense oligonucleotides; Antisense DNA or RNA; Triplex- forming oligonucleotides; Catalytic nucleic acids, e.g. ribozymes; Nucleic acids used in co-suppression or gene silencing against receptors or cell surface proteins
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K2035/122Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells for inducing tolerance or supression of immune responses
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K2035/124Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells the cells being hematopoietic, bone marrow derived or blood cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/80Vaccine for a specifically defined cancer
    • A61K2039/804Blood cells [leukemia, lymphoma]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2121/00Preparations for use in therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/50Cellular immunotherapy characterised by the use of allogeneic cells
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2310/00Structure or type of the nucleic acid
    • C12N2310/10Type of nucleic acid
    • C12N2310/20Type of nucleic acid involving clustered regularly interspaced short palindromic repeats [CRISPR]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2510/00Genetically modified cells
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/15011Lentivirus, not HIV, e.g. FIV, SIV
    • C12N2740/15041Use of virus, viral particle or viral elements as a vector
    • C12N2740/15043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2800/00Nucleic acids vectors
    • C12N2800/10Plasmid DNA
    • C12N2800/106Plasmid DNA for vertebrates
    • C12N2800/107Plasmid DNA for vertebrates for mammalian

Definitions

  • the immune cell is first collected from the subject (autologous) or a donor separate from the subject receiving treatment (allogeneic) and genetically modified to express the chimeric antigen receptor.
  • the resulting cell expresses the chimeric antigen receptor on its cell surface (e.g., CAR T-cell), and upon administration to the subject, the chimeric antigen receptor binds to the marker expressed by the neoplastic cell. This interaction with the neoplasia marker activates the CAR-T cell, which then cell kills the neoplastic cell.
  • the present invention features genetically modified immune cells having enhanced anti-neoplasia activity, resistance to immune suppression, and decreased risk of eliciting a graft versus host reaction, or host versus graft reaction where host CD8+ T cells recognize a graft as non-self (e.g., where a transplant recipient generates an immune response against the transplanted organ), or a combination thereof.
  • a subject having or having a propensity to develop graft versus host disease (GVHD) is administered a CAR-T cell that lacks or has reduced levels of functional TRAC.
  • a subject having or having a propensity to develop host versus graft disease is administered a CAR-T cell that lacks or has reduced levels of functional beta2 microglobulin (B2M).
  • B2M beta2 microglobulin
  • the invention provides a composition comprising two or more immune cells, each immune cell comprising a) a different chimeric antigen receptor that targets an antigen selected from the group consisting of CD5, CD7, CD3, CD33, and CD123, wherein the immune cells comprise mutations that reduce or eliminate expression of the targeted antigens; and b) one or more mutations that reduce or eliminate the expression of an immunogenic polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • one of the immune cells comprises a chimeric antigen receptor that targets CD5 and another immune cell comprises a chimeric antigen receptor that targets an antigen selected from the group consisting of CD7, CD3, CD33, and CD123.
  • the composition comprises at least three immune cells each comprising a chimeric antigen receptor that targets a different antigen, wherein the targeted antigens are CD3, CD5, and CD7.
  • one of the immune cells expresses a chimeric antigen receptor that targets CD7 and another immune cell expresses a chimeric antigen receptor that targets an antigen selected from the group consisting of CD3, CD33, and CD123.
  • one of the immune cells expresses a chimeric antigen receptor that targets CD3 and another immune cell expresses a chimeric antigen receptor that targets an antigen selected from the group consisting of CD33, and CD123. In some embodiments, one of the immune cells expresses a chimeric antigen receptor that targets CD33 and another immune cell expresses a chimeric antigen receptor that targets CD123. In some embodiments, one immune cell expresses two, three, four or more different chimeric antigen receptors. In some embodiments, one of the chimeric antigen receptors targets CD5 and another chimeric antigen receptor targets an antigen selected from the group consisting of CD7, CD3, CD33, and CD123.
  • one of the chimeric antigen receptors targets CD7 and another chimeric antigen receptor targets an antigen selected from the group consisting of CD3, CD33, and CD123. In some embodiments, one of the chimeric antigen receptors targets CD3 and another chimeric antigen receptor targets an antigen selected from the group consisting of CD33, and CD123. In some embodiments, one of the chimeric antigen receptors targets CD33 another chimeric antigen receptor targets CD123.
  • the invention provides a composition comprising at least three immune cells, each comprising a different chimeric antigen receptor, wherein one chimeric antigen receptor targets CD3, one targets CD5, and a third targets CD7, wherein the cells further comprise mutations that reduce or eliminate the expression of the targeted antigens; and further comprise one or more mutations that reduce or eliminate the expression of a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the invention provides a composition comprising at least two immune cells, each comprising a different chimeric antigen receptor, wherein one chimeric antigen receptor targets CD3 and another targets CD7, wherein the cells further comprise mutations that reduce or eliminate the expression of the targeted antigens; and further comprise one or more mutations that reduce or eliminate the expression of a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the invention provides a composition comprising at least two immune cells, each comprising a different chimeric antigen receptor, wherein one chimeric antigen receptor targets CD5 and another targets CD7, wherein the cells further comprise mutations that reduce or eliminate the expression of the targeted antigens; and further comprise one or more mutations that reduce or eliminate the expression of a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the invention provides a composition comprising at least two immune cells, each comprising a different chimeric antigen receptor, wherein one chimeric antigen receptor targets CD3 and another targets CD5, wherein the cells further comprise mutations that reduce or eliminate the expression of the targeted antigens; and further comprise one or more mutations that reduce or eliminate the expression of a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the invention provides a composition comprising at least two immune cells, each comprising a different chimeric antigen receptor, wherein one chimeric antigen receptor targets CD33 and another targets CD123, wherein the cells further comprise mutations that reduce or eliminate the expression of the targeted antigen; and further comprise one or more mutations that reduce or eliminate the expression of a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the mutation is a C to T or A to G mutation that silences the gene or that introduces a stop codon into the gene.
  • the mutation introduces a premature stop codon or alters a splice donor or acceptor site.
  • the mutation is generated by a base editor comprising a deaminase domain.
  • the deaminase is a cytidine or an adenosine deaminase.
  • the base editor is BE4.
  • the mutation reduces expression of an encoded polypeptide by about 50% or more relative to a corresponding control cell lacking the mutation.
  • the composition comprises a population of immune cells. In some embodiments, at least 50% of the population comprises one or more mutations that reduce or eliminate expression of the targeted antigen and/or the immunogenic polypeptide.
  • the immune cells are fratricide resistant. In some embodiments, the immune cells have increased anti-neoplasia activity. In some embodiments, the immune cells comprise no detectable translocations. In some embodiments, the immune cells comprise less than 1% indels. In some embodiments, the immune cell is a mammalian cell. In some embodiments, the mammalian cell is a human or rodent cell. In some embodiments, the immune cell is a cytotoxic T cell, a regulatory T cell, a T helper cell, a dendritic cell, a B cell, or a NK cell, or a progenitor thereof. In some embodiments, the progenitor is a hematopoietic stem cell.
  • the invention provides a pharmaceutical composition comprising an effective amount of any of the compositions provided herein and a pharmaceutically acceptable excipient.
  • the invention provides a base editor system comprising a fusion protein comprising a nucleic acid programmable DNA binding protein (napDNAbp) and a deaminase domain, and at least two guide polynucleotides each targeting a different antigen, wherein the antigens are selected from the group consisting of CD5, CD7, CD3, CD33, and CD123.
  • one guide polynucleotide targets CD5 and another targets an antigen selected from the group consisting of CD7, CD3, CD33, and CD123.
  • the system comprising three guide polynucleotides each of which targets one of antigens CD3, CD5, and CD7.
  • one guide polynucleotide targets CD7 and another targets an antigen selected from the group consisting of CD3, CD33, and CD123.
  • one guide polynucleotide targets CD3 and another targets an antigen selected from the group consisting of CD33, and CD123.
  • one guide polynucleotide targets CD33 and another targets CD123.
  • the guide polynucleotides each comprise a nucleic acid sequence selected from Table 26.
  • the guide polynucleotide comprises a nucleic acid sequence selected fromAGCGACUGCAGAAAGAAGAG orCAUACCAGCUGAGCCGUCCG.
  • the fusion protein further comprises one or more uracil glycosylase inhibitors (UGIs) and/or one or more nuclear localization sequences (NLS).
  • the napDNAbp comprises a Cas9, Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, Cas12i, or Cas12j/CasF polypeptide or a portion thereof.
  • the napDNAbp comprises a Cas12 polypeptide or a fragment thereof. In some embodiments, the napDNAbp comprises a Cas9 polypeptide or a fragment thereof. In some embodiments, the Cas9 is a dead Cas9 (dCas9) or a Cas9 nickase (nCas9). In some embodiments, the Cas9 is a modified Staphylococcus aureus Cas9 (SaCas9), Streptococcus thermophilus 1 Cas9 (St1Cas9), or a modified Streptococcus pyogenes Cas9 (SpCas9).
  • the Cas9 comprises an altered protospacer-adjacent motif (PAM) specificity.
  • the altered PAM has specificity for the nucleic acid sequence 5’-NGC-3’.
  • the deaminase domain is capable of deaminating cytidine or adenosine.
  • the deaminase domain is a cytidine or an adenosine deaminase domain.
  • the cytidine deaminase is an APOBEC deaminase.
  • the adenosine deaminase is a TadA variant.
  • the TadA variant is a TadA*8 variant.
  • the TadA*8 variant is TadA*8.1, TadA*8.2, TadA*8.3, TadA*8.4, TadA*8.5, TadA*8.6, TadA*8.7, TadA*8.8, TadA*8.9, TadA*8.10, TadA*8.11, TadA*8.12, TadA*8.13, TadA*8.14, TadA*8.15, TadA*8.16, TadA*8.17, TadA*8.18, TadA*8.19, TadA*8.20, TadA*8.21, TadA*8.22, TadA*8.23, or TadA*8.24.
  • the TadA variant is a TadA*9 variant.
  • the invention provides a pharmaceutical composition comprising any of the base editor systems as provided herein.
  • the invention provides a polynucleotide encoding any of the base editor systems and guide polynucleotides as provided herein.
  • the invention provides a vector comprising any of the polynucleotides as provided herein.
  • the vector is a viral vector.
  • the viral vector is a retroviral vector, adenoviral vector, lentiviral vector, herpesvirus vector, or adeno-associated viral vector (AAV).
  • the invention provides a pharmaceutical composition comprising any of the polynucleotides or any of the vectors as provided herein. [0019] In one aspect, the invention provides a method for producing a CAR-expressing immune cell having reduced immunogenicity.
  • the method includes expressing in a CAR-expressing immune cell a base editor system comprising a fusion protein comprising a nucleic acid programmable DNA binding protein (napDNAbp) and a deaminase domain, and two guide polynucleotides each targeting a polynucleotide encoding a different antigen, wherein the antigens are selected from the group consisting of CD5, CD7, CD3, CD33, and CD123, thereby producing a CAR-expressing immune cell having reduced immunogenicity.
  • a base editor system comprising a fusion protein comprising a nucleic acid programmable DNA binding protein (napDNAbp) and a deaminase domain
  • two guide polynucleotides each targeting a polynucleotide encoding a different antigen, wherein the antigens are selected from the group consisting of CD5, CD7, CD3, CD33, and CD123, thereby producing a CAR-expressing immune cell having reduced immunogenic
  • the immune cell expresses or is contacted with a guide polynucleotide that targets a polynucleotide encoding a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the method includes (a) expressing in a CAR-expressing immune cell a base editor system comprising a fusion protein comprising a nucleic acid programmable DNA binding protein (napDNAbp) and a deaminase domain; and (b) contacting the CAR- expressing immune cell with at least two guide polynucleotides each targeting a polynucleotide encoding a different antigen, wherein the antigens are selected from the group consisting of CD5, CD7, CD3, CD33, and CD123, thereby producing a CAR-expressing immune cell having reduced immunogenicity.
  • a base editor system comprising a fusion protein comprising a nucleic acid programmable DNA binding protein (napDNAbp) and a deaminase domain
  • contacting the CAR- expressing immune cell with at least two guide polynucleotides each targeting a polynucleotide encoding a different antigen, wherein the antigens are selected from the group
  • the method further includes contacting the CAR-expressing immune cell with a guide polynucleotide that targets a polynucleotide encoding a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the immune cell expresses a chimeric antigen receptor (CAR) that targets an antigen selected from the group consisting of CD5, CD7, CD3, CD33, and CD123.
  • CAR chimeric antigen receptor
  • the method further includes introducing a mutation that reduces or eliminates the expression of at least one polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1 into the immune cells, thereby producing a population of CAR-expressing immune cells having reduced immunogenicity.
  • the invention provides a method for producing a population of CAR- expressing immune cells having reduced immunogenicity.
  • the method includes a) introducing a mutation that reduces or eliminates the expression of at an antigen selected from the group consisting of CD5, CD7, CD3, CD33, and CD123 into one immune cell and a different mutation in one of said antigens into a second immune cell; and b) introducing a mutation that reduces or eliminates the expression of at least one polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1 into the immune cells, thereby producing a population of CAR-expressing immune cells having reduced immunogenicity.
  • the chimeric antigen receptor expressed by the immune cell targets an antigen selected from the group consisting of CD3, CD5, CD7, CD33, and CD123.
  • an immune cell produced by the method expresses a chimeric antigen receptor that targets a CD3, CD5, and/or CD7 antigen and fails to express or expresses a reduced level of a CD3, CD5, and/or CD7 antigen.
  • an immune cell produced by the method expresses a chimeric antigen receptor that targets a CD33 and a CD123 antigen and fails to express or expresses a reduced level of a CD33 and a CD123 antigen.
  • the CAR is a CD5 chimeric antigen receptor (CAR).
  • the CD5 CAR is encoded by a CD5 CAR construct presented in Table 28.
  • the invention provides a method for producing an immune cell having reduced immunogenicity.
  • the method includes a) introducing a mutation in an endogenous CD5 gene sequence or regulatory element that reduces or eliminates expression of CD5; and b) expressing in the cell a CD5 CAR construct presented in Table 28.
  • the CD5 CAR construct encodes a CD5 CAR polypeptide that comprises or consists of an amino acid sequence selected from the following: b) Q c) d) e) [0024]
  • the immune cell produced by the method exhibits fratricide resistance and/or increased anti-neoplasia activity as compared to a corresponding control cell.
  • the method is carried out in vivo or ex vivo.
  • the immune cell produced by the method comprises no detectable translocations.
  • the immune cell produced by the method comprises less than 1% indels.
  • the immune cell produced by the method comprises less than 5% of non-target edits.
  • the immune cell produced by the method comprises less than 5% of off-target edits.
  • the mutation is generated by nucleobase modification.
  • the mutation is in an exon.
  • the mutation results in a premature stop codon that reduces or eliminates protein expression.
  • the mutation is in a splice donor site or a splice acceptor site.
  • one or more mutations is generated by contacting a target polynucleotide with a base editor system comprising a fusion protein comprising a nucleic acid programmable DNA binding protein (napDNAbp), a deaminase, and one or more guide polynucleotides.
  • napDNAbp nucleic acid programmable DNA binding protein
  • the deaminase is an adenosine or cytidine deaminase.
  • the cytidine deaminase is BE4.
  • the mutation reduces expression of an encoded polypeptide by at least about 50% or more relative to a corresponding control cell lacking the mutation.
  • the guide polynucleotide comprises a sequence selected from those provided at Table 26.
  • the guide polynucleotide comprises a nucleic acid sequence selected fromAGCGACUGCAGAAAGAAGAG or CAUACCAGCUGAGCCGUCCG.
  • each of the one or more guide nucleic acid sequences targets the napDNAbp to a CD5, FAS, LAG-3, CD52, TRAC, B2M, CIITA, TRBC1, TRBC2 and/or a PDC1/PD-1 gene, or regulatory element.
  • the base editor and one or more guide nucleic acid sequences are introduced into the immune cell via electroporation, nucleofection, cationic lipid-mediated methods, viral transduction, or a combination thereof.
  • the method further includes expanding the immune cell in culture to generate a population of immune cells.
  • expression of the antigen or polypeptide is reduced in at least about 50% of the population of immune cells.
  • the method further includes depleting TCR ⁇ / ⁇ + cells from the population of modified immune cells.
  • the invention provides a CAR-expressing immune cell having reduced immunogenicity produced by any of the methods as provided herein.
  • the invention provides a pharmaceutical composition comprising any of the immune cells as provided herein.
  • the pharmaceutical composition includes a pharmaceutically acceptable excipient.
  • the invention provides a method for killing a neoplastic cell.
  • the method includes contacting a neoplastic cell expressing an antigen selected from the group consisting of CD5, CD7, CD3, CD33, and CD123, with two or more immune cells, each immune cell expressing a different chimeric antigen receptor that targets two of said antigens expressed by the cell, wherein the immune cell comprise one or more mutations that reduce or eliminate expression of the targeted antigen, and one or more mutations that reduce or eliminate expression of a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the method is carried out in vitro or in vivo.
  • the neoplastic cell is derived from a neoplasia.
  • the invention provides a method for treating a neoplasia in a subject.
  • the method includes administering to the subject two or more immune cells, each immune cell expressing a different chimeric antigen receptor that targets an antigen expressed by a neoplastic cell of the subject, selected from the group consisting of CD5, CD7, CD3, CD33, and CD123, wherein the immune cell comprise one or more mutations that reduce or eliminate expression of the antigen, and each of the immune cells further comprise one or more mutations that reduce or eliminate expression of a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the neoplasia is a hematological cancer. In some embodiments, the neoplasia is a liquid cancer. In some embodiments, the hematological cancer is leukemia, myeloma, and/or lymphoma. In some embodiments, the hematological cancer is a B cell cancer.
  • the hematological cancer is selected from at least one of the following T- cell acute lymphoblastic leukemia (T-ALL), mycosis fungoides (MF), Sézary syndrome (SS), Peripheral T/NK ⁇ cell lymphoma, Anaplastic large cell lymphoma ALK + , Primary cutaneous T ⁇ cell lymphoma, T ⁇ cell large granular lymphocytic leukemia, Angioimmunoblastic T/NK ⁇ cell lymphoma, Hepatosplenic T ⁇ cell lymphoma, Primary cutaneous CD30 + lymphoproliferative disorders, Extranodal NK/T ⁇ cell lymphoma, Adult T ⁇ cell leukemia/lymphoma, T ⁇ cell prolymphocytic leukemia, Subcutaneous panniculitis ⁇ like T-cell lymphoma, Primary cutaneous gamma ⁇ delta T-cell lymphoma, Aggressive NK ⁇ cell leukemia, and Enteropathy ⁇ associated T ⁇ cell lymphoma.
  • T-ALL
  • the hematological cancer is a T-cell acute lymphoblastic leukemia (T-ALL) cell. In some embodiments, the hematological cancer is acute myelogenous leukemia (AML). [0031] In another aspect, the invention provides a method for treating a neoplasia in a selected subject.
  • T-ALL T-cell acute lymphoblastic leukemia
  • AML acute myelogenous leukemia
  • the method includes administering to the selected subject two or more immune cells, each immune cell expressing a different chimeric antigen receptor that targets an antigen expressed by a neoplastic cell of the subject, wherein the antigen is selected from the group consisting of CD5, CD7, CD3, CD33, and CD123, wherein the immune cell comprise one or more mutations that reduce or eliminate expression of the antigen, and each of the immune cells further comprise one or more mutations that reduce or eliminate expression of a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1, wherein the subject is selected as having a neoplasia expressing an antigen selected from the group consisting of CD5, CD7, CD3, CD33, and CD123.
  • the hematological cancer is a T-cell acute lymphoblastic leukemia (T-ALL) cell. In some embodiments, the hematological cancer is acute myelogenous leukemia (AML).
  • T-ALL T-cell acute lymphoblastic leukemia
  • AML acute myelogenous leukemia
  • the two or more immune cells expressing different chimeric antigen receptors are administered sequentially. In some embodiments, the two or more immune cells expressing different chimeric antigen receptors are administered simultaneously.
  • the invention provides a method for the antigen-dependent killing of a neoplastic cell in a subject.
  • the method includes administering to a subject having a neoplasia expressing an antigen selected from the group consisting of CD5, CD7, CD3, CD33, and CD123, two or more immune cells, each immune cell expressing a different chimeric antigen receptor that targets one of said antigens, wherein the immune cell comprise one or more mutations that reduce or eliminate expression of the targeted antigen, and one or more mutations that reduce or eliminate expression of a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the invention provides a method for the antigen-dependent killing of an acute myelogenous leukemia (AML) cell in a subject.
  • the method includes administering to a subject having AML expressing CD33 and CD123 antigens, two or more immune cells, each immune cell expressing a different chimeric antigen receptor that targets one of said antigens, wherein the immune cell comprise one or more mutations that reduce or eliminate expression of the targeted antigen, and one or more mutations that reduce or eliminate expression of a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the invention provides a method for the antigen-dependent killing of a T- cell acute lymphoblastic leukemia (T-ALL) cell in a subject.
  • the method includes administering to a subject having T-ALL expressing CD3, CD5, and CD7 antigens, at least three immune cells, each immune cell expressing a different chimeric antigen receptor that targets one of said antigens, wherein the immune cell comprise one or more mutations that reduce or eliminate expression of the targeted antigen, and one or more mutations that reduce or eliminate expression of a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the invention provides a method for treating cancer in a selected subject.
  • the method includes administering to the subject at least two immune cells, each immune cell expressing a chimeric antigen receptor that targets CD33 or CD123 antigens, wherein the immune cells comprise one or more mutations that reduce or eliminate expression of the targeted antigen, and one or more mutations that reduce or eliminate expression of a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1, wherein the subject is selected by characterizing the cancer as expressing CD33 and CD123 antigens.
  • the cancer expressing CD33 and CD123 antigens is AML.
  • the invention provides a method for treating cancer in a selected subject.
  • the method includes administering to the subject three or more immune cells, each immune cell expressing a different chimeric antigen receptor that targets CD3, CD5, and CD7 antigens, wherein the immune cells comprise one or more mutations that reduce or eliminate expression of the targeted antigen, and one or more mutations that reduce or eliminate expression of a polypeptide selected from the group consisting of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1, wherein the subject is selected by characterizing the cancer as expressing CD3, CD5, and CD7 antigens.
  • the cancer expressing CD3, CD5, and CD7 antigens is T-ALL.
  • the immune cells are cytotoxic T cells, regulatory T cells, T helper cells, dendritic cells, B cells, or NK cells.
  • the subject has been previously treated with lymphodepletion.
  • the lymphodepletion involves administration of cyclophosphamide, fludarabine, and/or alemtuzumab (Cy/Flu/Campath).
  • the subject is refractory to chemotherapy or has a high tumor burden.
  • the subject is subsequently treated with allogeneic hematopoietic stem cell transplantation (allo-HSCT).
  • the immune cell is derived from a single human donor. In some embodiments, the immune cell is autologous to the subject. In some embodiments, the immune cell is allogenic to the subject. In some embodiments, the subject is a mammalian subject. In some embodiments, the subject is a human or rodent subject. In some embodiments, the subject is a pediatric human subject. [0038] In one aspect, the invention provides a kit including any of the compositions provided herein for use in the treatment of cancer. In another aspect, the invention provides a kit including any of the base editor systems as provided herein for use in generating a CAR- expressing immune cell having reduced immunogenicity. In some embodiments, any of the kits as provided herein include written instructions for the use of the kit.
  • the words “comprising” (and any form of comprising, such as “comprise” and “comprises”), “having” (and any form of having, such as “have” and “has”), “including” (and any form of including, such as “includes” and “include”) or “containing” (and any form of containing, such as “contains” and “contain”) are inclusive or open-ended and do not exclude additional, unrecited elements or method steps. It is contemplated that any embodiment discussed in this specification can be implemented with respect to any method or composition of the present disclosure, and vice versa. Furthermore, compositions of the present disclosure can be used to achieve methods of the present disclosure.
  • the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within one (1) or more than one (1) standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, such as within 5-fold or within 2- fold, of a value.
  • Ranges provided herein are understood to be shorthand for all of the values within the range.
  • a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50.
  • adenosine deaminase is meant a polypeptide or fragment thereof capable of catalyzing the hydrolytic deamination of adenine or adenosine.
  • the deaminase or deaminase domain is an adenosine deaminase catalyzing the hydrolytic deamination of adenosine to inosine or deoxyadenosine to deoxyinosine.
  • the adenosine deaminase catalyzes the hydrolytic deamination of adenine or adenosine in deoxyribonucleic acid (DNA).
  • the adenosine deaminases e.g., engineered adenosine deaminases, evolved adenosine deaminases
  • the adenosine deaminases may be from any organism, such as a bacterium.
  • the deaminase or deaminase domain is a variant of a naturally- occurring deaminase from an organism, such as a human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse.
  • the deaminase or deaminase domain does not occur in nature.
  • the deaminase or deaminase domain is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75% at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% identical to a naturally-occurring deaminase.
  • the adenosine deaminase is from a bacterium, such as, E. coli, S. aureus, B. subtilis, S. typhi, S. putrefaciens, H. influenzae, C. crescentus, or G. sulfurreducens.
  • the adenosine deaminase is a TadA deaminase.
  • the TadA deaminase is an E. coli TadA (ecTadA) deaminase or a fragment thereof.
  • the ecTadA deaminase is truncated ecTadA.
  • the truncated ecTadA may be missing one or more N-terminal amino acids relative to a full-length ecTadA.
  • the truncated ecTadA may be missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 N-terminal amino acid residues relative to the full length ecTadA.
  • the truncated ecTadA may be missing 1, 2, 3, 4, 5 ,6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 6, 17, 18, 19, or 20 C-terminal amino acid residues relative to the full length ecTadA.
  • the ecTadA deaminase does not comprise an N-terminal methionine.
  • the TadA deaminase is an N-terminal truncated TadA.
  • the TadA is any one of the TadAs described in PCT/US2017/045381, which is incorporated herein by reference in its entirety.
  • the TadA deaminase is TadA variant. In some embodiments, the TadA variant is TadA*7.10. In some embodiments, the TadA variant is TadA*8. In some embodiments, the TadA*8 is TadA*8.1, TadA*8.2, TadA*8.3, TadA*8.4, TadA*8.5, TadA*8.6, TadA*8.7, TadA*8.8, TadA*8.9, TadA*8.10, TadA*8.11, TadA*8.12, TadA*8.13, TadA*8.14, TadA*8.15, TadA*8.16, TadA*8.17, TadA*8.18, TadA*8.19, TadA*8.20, TadA*8.21, TadA*8.22, TadA*8.23, or TadA*8.24.
  • the TadA*8 is TadA*8a, TadA*8b, TadA*8c, TadA*8d, or TadA*8e. In some embodiments, the TadA*8 is TadA*8e. In some embodiments, the TadA variant is TadA*9.
  • ABE8 polypeptide or “ABE8” is meant a base editor as defined herein comprising an adenosine deaminase variant comprising an alteration at amino acid position 82 and/or 166 of the following reference sequence: [0055] In some embodiments, ABE8 comprises further alterations, as described herein, relative to the reference sequence. [0056] By “Adenosine Deaminase Base Editor 8 (ABE8) polynucleotide” is meant a polynucleotide encoding an ABE8.
  • Adenosine Deaminase Base Editor 9 polypeptide
  • ABE9 a base editor as defined herein comprising an adenosine deaminase variant comprising one or more of the following alterations: R21N, R23H, E25F, N38G, L51W, P54C, M70V, Q71M, N72K, Y73S, V82T, M94V, P124W, T133K, D139L, D139M, C146R, and A158K, in the following reference sequence: [0058] The relevant bases altered in the reference sequence are shown by underlining and bold font.
  • ABE9 comprises further alterations, as described herein, relative to the reference sequence. Details of ABE9 base editors are described in International PCT Application No. PCT/2020/049975, which is incorporated herein by reference for its entirety.
  • ABE9 base editors are described in International PCT Application No. PCT/2020/049975, which is incorporated herein by reference for its entirety.
  • composition administration e.g., injection
  • intravenous i.v.
  • sub-cutaneous s.c.
  • intradermal i.d.
  • intraperitoneal i.p.
  • intramuscular injection i.m.
  • Parenteral administration can be, for example, by bolus injection or by gradual perfusion over time.
  • parenteral administration includes infusing or injecting intravascularly, intravenously, intramuscularly, intraarterially, intrathecally, intratumorally, intradermally, intraperitoneally, transtracheally, subcutaneously, subcuticularly, intraarticularly, subcapsularly, subarachnoidly and intrasternally.
  • administration can be by the oral route.
  • agent is meant any small molecule chemical compound, antibody, nucleic acid molecule, or polypeptide, or fragments thereof.
  • alteration is meant a change (e.g.
  • an alteration includes a change in a polynucleotide or polypeptide sequence or a change in expression levels, such as a 10% change, a 25% change, a 40% change, and a 50% change, or greater.
  • Allogeneic refers to cells of the same species that differ genetically to the cell in comparison.
  • ameliorate is meant decrease, suppress, attenuate, diminish, arrest, or stabilize the development or progression of a disease.
  • analog is meant a molecule that is not identical, but has analogous functional or structural features.
  • a polynucleotide or polypeptide analog retains the biological activity of a corresponding naturally-occurring polynucleotide or polypeptide, while having certain modifications that enhance the analog's function relative to a naturally occurring polynucleotide or polypeptide. Such modifications could increase the analog's affinity for DNA, efficiency, specificity, protease or nuclease resistance, membrane permeability, and/or half-life, without altering, for example, ligand binding.
  • An analog may include an unnatural nucleotide or amino acid.
  • antibody refers to an immunoglobulin molecule that specifically binds to, or is immunologically reactive with, a particular antigen, and includes polyclonal, monoclonal, genetically engineered, and otherwise modified forms of antibodies, including but not limited to chimeric antibodies, humanized antibodies, heteroconjugate antibodies (e.g., bi- tri- and quad-specific antibodies, diabodies, triabodies, and tetrabodies), and antigen binding fragments of antibodies, including, for example, Fab', F(ab')2, Fab, Fv, rlgG, and scFv fragments.
  • mAb monoclonal antibody
  • mAb monoclonal antibody
  • Fab and F(ab')2 fragments refer to antibody fragments that lack the Fc fragment of an intact antibody. Examples of these antibody fragments are described herein.
  • B cell maturation antigen, or tumor necrosis factor receptor superfamily member 17 polypeptide, (BCMA) is meant a protein having at least about 85% amino acid sequence identify to NCBI Accession No. NP_001183 or a fragment thereof that is expressed on mature B lymphocytes.
  • BCMA polypeptide sequence is provided below.
  • >NP 001183.2 tumor necrosis factor receptor superfamily member 17 [Homo sapiens]
  • This antigen can be targeted in relapsed or refractory multiple myeloma and other hematological neoplasia therapies.
  • B cell maturation antigen, or tumor necrosis factor receptor superfamily member 17, (BCMA) polynucleotide is meant a nucleic acid molecule encoding a BCMA polypeptide.
  • the BCMA gene encodes a cell surface receptor that recognizes B cell activating factor.
  • An exemplary B2M polynucleotide sequence is provided below.
  • base editor an agent that binds a polynucleotide and has nucleobase modifying activity.
  • the agent binds the polynucleotide at a specific sequence using a nucleic acid programmable DNA binding protein.
  • the base editor is an enzyme capable of modifying a cytidine base within a nucleic acid molecule (e.g., DNA).
  • the base editor is capable of deaminating a base within a nucleic acid molecule.
  • the base editor is capable of deaminating a base within a DNA molecule. In some embodiments, the base editor is capable of deaminating a cytidine in DNA. In some embodiments, the base editor is a fusion protein comprising a cytidine deaminase or an adenosine deaminase. In some embodiments, the base editor is a Cas9 protein fused to a cytidine deaminase or an adenosine deaminase.
  • the base editor is a Cas9 nickase (nCas9) fused to a cytidine deaminase or an adenosine deaminase.
  • the base editor is fused to an inhibitor of base excision repair, for example, a UGI domain.
  • the fusion protein comprises a Cas9 nickase fused to a deaminase and an inhibitor of base excision repair, such as a UGI domain.
  • the cytidine deaminase or an or an adenosine deaminase nucleobase editor polypeptide comprising the following domains A-B: NH 2 -[A-B]-COOH, wherein A comprises a cytidine deaminase domain, an adenosine deaminase domain or an active fragment thereof, and wherein B comprises one or more domains having nucleic acid sequence specific binding activity.
  • the cytidine or adenosine deaminase Nucleobase Editor polypeptide of the previous aspect contains: NH 2 -[A n -B o ]-COOH, wherein A comprises a cytidine deaminase domain, an adenosine deaminase domain, or an active fragment thereof, wherein n is an integer: 1, 2, 3, 4, or 5; and wherein B comprises a domain having nucleic acid sequence specific binding activity; and wherein o is an integer: 1, 2, 3, 4, or 5.
  • the polypeptide contains one or more nuclear localization sequences.
  • the polypeptide contains at least one of said nuclear localization sequences is at the N-terminus or C-terminus. In one embodiment, the polypeptide contains the nuclear localization signal is a bipartite nuclear localization signal. In one embodiment, the polypeptide contains one or more domains linked by a linker.
  • the base editor is a cytidine base editor (CBE). In some embodiments, the base editor is an adenosine base editor (ABE). In some embodiments, the base editor is an adenosine base editor (ABE) and a cytidine base editor (CBE).
  • the base editor is a nuclease-inactive Cas9 (dCas9) fused to an adenosine deaminase.
  • the Cas9 is a circular permutant Cas9 (e.g., spCas9 or saCas9). Circular permutant Cas9s are known in the art and described, for example, in Oakes et al., Cell 176, 254–267, 2019.
  • the base editor is fused to an inhibitor of base excision repair, for example, a UGI domain, or a dISN domain.
  • the fusion protein comprises a Cas9 nickase fused to a deaminase and an inhibitor of base excision repair, such as a UGI or dISN domain.
  • the base editor is an abasic base editor.
  • an adenosine deaminase is evolved from TadA.
  • the polynucleotide programmable DNA binding domain is a CRISPR associated (e.g., Cas or Cpf1) enzyme.
  • the base editor is a catalytically dead Cas9 (dCas9) fused to a deaminase domain.
  • the base editor is a Cas9 nickase (nCas9) fused to a deaminase domain. In some embodiments, the base editor is fused to an inhibitor of base excision repair (BER). In some embodiments, the inhibitor of base excision repair is a uracil DNA glycosylase inhibitor (UGI). In some embodiments, the inhibitor of base excision repair is an inosine base excision repair inhibitor.
  • base editors are generated by cloning an adenosine deaminase variant (e.g., TadA*7.10) into a scaffold that includes a circular permutant Cas9 (e.g., spCAS9) and a bipartite nuclear localization sequence.
  • base editors are generated (e.g. ABE8) by cloning an adenosine deaminase variant (e.g., TadA*8) into a scaffold that includes a circular permutant Cas9 (e.g., spCAS9 or saCAS9) and a bipartite nuclear localization sequence.
  • the polynucleotide programmable DNA binding domain is a CRISPR associated (e.g., Cas or Cpf1) enzyme.
  • the base editor is a catalytically dead Cas9 (dCas9) fused to a deaminase domain.
  • the base editor is a Cas9 nickase (nCas9) fused to a deaminase domain.
  • the base editor is fused to an inhibitor of base excision repair (BER).
  • BER base excision repair
  • the inhibitor of base excision repair is a uracil DNA glycosylase inhibitor (UGI). In some embodiments, the inhibitor of base excision repair is an inosine base excision repair inhibitor. [0080] Details of base editors are described in International PCT Application Nos. PCT/2017/045381 (WO 2018/027078) and PCT/US2016/058344 (WO 2017/070632), each of which is incorporated herein by reference for its entirety.
  • the adenine base editor as used in the base editing compositions, systems and methods described herein has the nucleic acid sequence (8877 base pairs), (Addgene, Watertown, MA.; Gaudelli NM, et al., Nature. 2017 Nov 23;551(7681):464- 471. doi: 10.1038/nature24644; Koblan LW, et al., Nat Biotechnol. 2018 Oct;36(9):843-846. doi: 10.1038/nbt.4172.) as provided below.
  • the base editor is an Adenosine Deaminase Base Editor 8 (ABE8).
  • ABE8 is selected from a base editor from Table 13, 14 or 16 infra.
  • ABE8 contains an adenosine deaminase variant evolved from TadA.
  • the adenosine deaminase variant of ABE8 is a TadA*8 variant as described in Table 11, 13 or 14 infra.
  • the adenosine deaminase variant is TadA*7.10 variant (e.g., TadA*8) comprising one or more of an alteration selected from the group of Y147T, Y147R, Q154S, Y123H, V82S, T166R, and/or Q154R.
  • ABE8 comprises TadA*7.10 variant (e.g., TadA*8) with a combination of alterations selected from the group of: Y147T + Q154R; Y147T + Q154S; Y147R + Q154S; V82S + Q154S; V82S + Y147R; V82S + Q154R; V82S + Y123H; I76Y + V82S; V82S + Y123H + Y147T; V82S + Y123H + Y147R; V82S + Y123H + Q154R; Y147R + Q154R +Y123H; Y147R + Q154R + I76Y; Y147R + Q154R + T166R; Y123H + Y147R + Q154R + I76Y; V82S + Y123H + Y147R + Q154R; and I76Y + V82S + Y123H + Y147R + Q154R.
  • TadA*8 comprises TadA
  • ABE8 is a monomeric construct. In some embodiments, ABE8 is a heterodimeric construct. In some embodiments, the ABE8 base editor comprises the sequence: RVEITEGILADECAALLCTFFRMPRQVFNAQKKAQSSTD.
  • a cytidine base editor as used in the base editing compositions, systems and methods described herein has the following nucleic acid sequence (8877 base pairs), (Addgene, Watertown, MA.; Komor AC, et al., 2017, Sci Adv., 30;3(8):eaao4774. doi: 10.1126/sciadv.aao4774) as provided below. Polynucleotide sequences having at least 95% or greater identity to the BE4 nucleic acid sequence are also encompassed.
  • the cytidine base editor is BE4 having a nucleic acid sequence selected from one of the following: [0085] Original BE4 nucleic acid sequence:
  • BE4 Codon Optimization 1 nucleic acid sequence By “base editing activity” is meant acting to chemically alter a base within a polynucleotide. In one embodiment, a first base is converted to a second base. In one embodiment, the base editing activity is cytidine deaminase activity, e.g., converting target C•G to T•A. In another embodiment, the base editing activity is adenosine or adenine deaminase activity, e.g., converting A•T to G•C.
  • the base editing activity is cytidine deaminase activity, e.g., converting target C•G to T•A and adenosine or adenine deaminase activity, e.g., converting A•T to G•C.
  • base editing activity is assessed by efficiency of editing. Base editing efficiency may be measured by any suitable means, for example, by sanger sequencing or next generation sequencing. In some embodiments, base editing efficiency is measured by percentage of total sequencing reads with nucleobase conversion effected by the base editor, for example, percentage of total sequencing reads with target A•T base pair converted to a G•C base pair or target C•G base pair to a T•A base pair.
  • base editing efficiency is measured by percentage of total cells with nucleobase conversion effected by the base editor, when base editing is performed in a population of cells.
  • the term “base editor system” refers to a system for editing a nucleobase of a target nucleotide sequence.
  • the base editor system comprises (1) a polynucleotide programmable nucleotide binding domain (e.g. Cas9); (2) a deaminase domain (e.g.
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable DNA binding domain.
  • the base editor is a cytidine base editor (CBE).
  • the base editor is an adenine or adenosine base editor (ABE).
  • the base editor system is an Adenosine Deaminase Base Editor 8 (ABE8).
  • the ABE8 is a monomeric construct.
  • the ABE8 is ABE8.1-m, ABE8.2-m, ABE8.3-m, ABE8.4-m, ABE8.5-m, ABE8.6-m, ABE8.7-m, ABE8.8-m, ABE8.9-m, ABE8.10-m, ABE8.11-m, ABE8.12-m, ABE8.13-m, ABE8.14-m, ABE8.15-m, ABE8.16-m, ABE8.17-m, ABE8.18-m, ABE8.19-m, ABE8.20-m, ABE8.21-m, ABE8.22-m, ABE8.23-m, ABE8.24-m.
  • the ABE8 is a heteromeric construct.
  • the ABE8 is ABE8.1-d, ABE8.2-d, ABE8.3-d, ABE8.4-d, ABE8.5-d, ABE8.6-d, ABE8.7-d, ABE8.8-d, ABE8.9-d, ABE8.10-d, ABE8.11-d, ABE8.12-d, ABE8.13-d, ABE8.14-d, ABE8.15-d, ABE8.16-d, ABE8.17-d, ABE8.18-d, ABE8.19-d, ABE8.20-d, ABE8.21-d, ABE8.22-d, ABE8.23-d, or ABE8.24-d.
  • a base editor system may comprise more than one base editing component.
  • a base editor system may include more than one deaminase.
  • a base editor system may include one or more cytidine deaminases.
  • a base editor system may include one or more adenosine deaminases.
  • a single guide polynucleotide may be utilized to target different deaminases to a target nucleic acid sequence.
  • a single pair of guide polynucleotides may be utilized to target different deaminases to a target nucleic acid sequence.
  • nucleobase components and the polynucleotide programmable nucleotide binding component of a base editor system may be associated with each other covalently or non- covalently, or any combination of associations and interactions thereof.
  • a deaminase domain can be targeted to a target nucleotide sequence by a polynucleotide programmable nucleotide binding domain.
  • a polynucleotide programmable nucleotide binding domain can be fused or linked to a deaminase domain.
  • a polynucleotide programmable nucleotide binding domain can target a deaminase domain to a target nucleotide sequence by non-covalently interacting with or associating with the deaminase domain.
  • the nucleobase editing component e.g., a deaminase domain
  • the nucleobase editing component can comprise an additional heterologous portion or domain that is capable of interacting with, associating with, or capable of forming a complex with an additional heterologous portion or domain that is part of a polynucleotide programmable nucleotide binding domain.
  • the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polypeptide. In some embodiments, the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a guide polynucleotide. In some embodiments, the additional heterologous portion may be capable of binding to a polypeptide linker. In some embodiments, the additional heterologous portion may be capable of binding to a polynucleotide linker. The additional heterologous portion may be a protein domain.
  • the additional heterologous portion may be a K Homology (KH) domain, a MS2 coat protein domain, a PP7 coat protein domain, a SfMu Com coat protein domain, a steril alpha motif, a telomerase Ku binding motif and Ku protein, a telomerase Sm7 binding motif and Sm7 protein, or a RNA recognition motif.
  • KH K Homology
  • a base editor system may further comprise a guide polynucleotide component. It should be appreciated that components of the base editor system may be associated with each other via covalent bonds, noncovalent interactions, or any combination of associations and interactions thereof.
  • a deaminase domain can be targeted to a target nucleotide sequence by a guide polynucleotide.
  • the nucleobase editing component of the base editor system e.g., a deaminase domain
  • can comprise an additional heterologous portion or domain e.g., polynucleotide binding domain such as an RNA or DNA binding protein
  • a portion or segment e.g., a polynucleotide motif
  • the additional heterologous portion or domain (e.g., polynucleotide binding domain such as an RNA or DNA binding protein) can be fused or linked to the deaminase domain.
  • the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polypeptide.
  • the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polynucleotide.
  • the additional heterologous portion may be capable of binding to a guide polynucleotide.
  • the additional heterologous portion may be capable of binding to a polypeptide linker.
  • the additional heterologous portion may be capable of binding to a polynucleotide linker.
  • the additional heterologous portion may be a protein domain.
  • the additional heterologous portion may be a K Homology (KH) domain, a MS2 coat protein domain, a PP7 coat protein domain, a SfMu Com coat protein domain, a sterile alpha motif, a telomerase Ku binding motif and Ku protein, a telomerase Sm7 binding motif and Sm7 protein, or a RNA recognition motif.
  • KH K Homology
  • a base editor system can further comprise an inhibitor of base excision repair (BER) component.
  • BER base excision repair
  • the inhibitor of BER component may comprise a BER inhibitor.
  • the inhibitor of BER can be a uracil DNA glycosylase inhibitor (UGI).
  • the inhibitor of BER can be an inosine BER inhibitor.
  • the inhibitor of BER can be targeted to the target nucleotide sequence by the polynucleotide programmable nucleotide binding domain.
  • a polynucleotide programmable nucleotide binding domain can be fused or linked to an inhibitor of BER.
  • a polynucleotide programmable nucleotide binding domain can be fused or linked to a deaminase domain and an inhibitor of BER.
  • a polynucleotide programmable nucleotide binding domain can target an inhibitor of BER to a target nucleotide sequence by non-covalently interacting with or associating with the inhibitor of BER.
  • the inhibitor of BER component can comprise an additional heterologous portion or domain that is capable of interacting with, associating with, or capable of forming a complex with an additional heterologous portion or domain that is part of a polynucleotide programmable nucleotide binding domain.
  • the inhibitor of BER can be targeted to the target nucleotide sequence by the guide polynucleotide.
  • the inhibitor of BER can comprise an additional heterologous portion or domain (e.g., polynucleotide binding domain such as an RNA or DNA binding protein) that is capable of interacting with, associating with, or capable of forming a complex with a portion or segment (e.g., a polynucleotide motif) of a guide polynucleotide.
  • an additional heterologous portion or domain e.g., polynucleotide binding domain such as an RNA or DNA binding protein
  • the additional heterologous portion or domain of the guide polynucleotide can be fused or linked to the inhibitor of BER.
  • the additional heterologous portion may be capable of binding to, interacting with, associating with, or forming a complex with a polynucleotide.
  • the additional heterologous portion may be capable of binding to a guide polynucleotide.
  • the additional heterologous portion may be capable of binding to a polypeptide linker.
  • the additional heterologous portion may be capable of binding to a polynucleotide linker.
  • the additional heterologous portion may be a protein domain.
  • the additional heterologous portion may be a K Homology (KH) domain, a MS2 coat protein domain, a PP7 coat protein domain, a SfMu Com coat protein domain, a sterile alpha motif, a telomerase Ku binding motif and Ku protein, a telomerase Sm7 binding motif and Sm7 protein, or a RNA recognition motif.
  • KH K Homology
  • Beta-2-microglobulin (B2M) polynucleotide is meant a nucleic acid molecule encoding a B2M polypeptide.
  • the beta-2-microglobulin gene encodes a serum protein associated with the major histocompatibility complex. B2M is involved in non-self recognition by host CD8+ T cells.
  • An exemplary B2M polynucleotide sequence is provided below.
  • Cas9 or "Cas9 domain” refers to an RNA-guided nuclease comprising a Cas9 protein, or a fragment thereof (e.g., a protein comprising an active, inactive, or partially active DNA cleavage domain of Cas9, and/or the gRNA binding domain of Cas9).
  • a Cas9 nuclease is also referred to sometimes as a Casn1 nuclease or a CRISPR("clustered regularly interspaced short palindromic repeat")-associated nuclease.
  • CRISPR is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids).
  • CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids.
  • CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA).
  • crRNA CRISPR RNA
  • type II CRISPR systems correct processing of pre-crRNA requires a trans-encoded small RNA (tracrRNA), endogenous ribonuclease 3 (rnc) and a Cas9 protein.
  • tracrRNA serves as a guide for ribonuclease 3-aided processing of pre- crRNA.
  • Cas9/crRNA/tracrRNA endonucleolytically cleaves linear or circular dsDNA target complementary to the spacer.
  • the target strand not complementary to crRNA is first cut endonucleolytically, then trimmed 3 ⁇ -5 ⁇ exonucleolytically.
  • DNA-binding and cleavage typically requires protein and both RNAs.
  • single guide RNAs sgRNA, or simply "gRNA" can be engineered so as to incorporate aspects of both the crRNA and tracrRNA into a single RNA species. See, e.g., Jinek M., et al., Charpentier E.
  • Cas9 recognizes a short motif in the CRISPR repeat sequences (the PAM or protospacer adjacent motif) to help distinguish self versus non-self.
  • Cas9 nuclease sequences and structures are well known to those of skill in the art (see, e.g., "Complete genome sequence of an M1 strain of Streptococcus pyogenes.” Ferretti et al., Proc. Natl. Acad. Sci.
  • Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski, Rhun, and Charpentier, "The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems” (2013) RNA Biology 10:5, 726-737; the entire contents of which are incorporated herein by reference.
  • a nuclease-inactivated Cas9 protein may interchangeably be referred to as a "dCas9" protein (for nuclease-"dead” Cas9) or catalytically inactive Cas9.
  • Methods for generating a Cas9 protein (or a fragment thereof) having an inactive DNA cleavage domain are known (See, e.g., Jinek et al., Science.337:816-821(2012); Qi et al., "Repurposing CRISPR as an RNA-Guided Platform for Sequence-Specific Control of Gene Expression” (2013) Cell.28;152(5):1173-83, the entire contents of each of which are incorporated herein by reference).
  • the DNA cleavage domain of Cas9 is known to include two subdomains, the HNH nuclease subdomain and the RuvC1 subdomain.
  • the HNH subdomain cleaves the strand complementary to the gRNA, whereas the RuvC1 subdomain cleaves the non-complementary strand. Mutations within these subdomains can silence the nuclease activity of Cas9. For example, the mutations D10A and H840A completely inactivate the nuclease activity of S. pyogenes Cas9 (Jinek et al., Science.337:816-821(2012); Qi et al., Cell.28;152(5):1173-83 (2013)).
  • dCas9 corresponds to, or comprises in part or in whole, a Cas9 amino acid sequence having one or more mutations that inactivate the Cas9 nuclease activity.
  • a dCas9 domain comprises D10A and an H840A mutation or corresponding mutations in another Cas9.
  • a Cas9 nuclease has an inactive (e.g., an inactivated) DNA cleavage domain, that is, the Cas9 is a nickase, referred to as an “nCas9” protein (for “nickase” Cas9).
  • Cas9 proteins e.g., a nuclease dead Cas9 (dCas9), a Cas9 nickase (nCas9), or a nuclease active Cas9), including variants and homologs thereof, are within the scope of this disclosure.
  • Exemplary Cas9 proteins include, without limitation, those provided herein.
  • the Cas9 protein is a nuclease dead Cas9 (dCas9).
  • the Cas9 protein is a Cas9 nickase (nCas9).
  • the Cas9 protein is a nuclease active Cas9.
  • proteins comprising fragments of Cas9 are provided.
  • a protein comprises one of two Cas9 domains: (1) the gRNA binding domain of Cas9; or (2) the DNA cleavage domain of Cas9.
  • proteins comprising Cas9 or fragments thereof are referred to as "Cas9 variants.”
  • a Cas9 variant shares homology to Cas9, or a fragment thereof.
  • a Cas9 variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to wild type Cas9.
  • the Cas9 variant may have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more amino acid changes compared to wild type Cas9.
  • the Cas9 variant comprises a fragment of Cas9 (e.g., a gRNA binding domain or a DNA-cleavage domain), such that the fragment is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to the corresponding fragment of wild type Cas9.
  • a fragment of Cas9 e.g., a gRNA binding domain or a DNA-cleavage domain
  • the fragment is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% of the amino acid length of a corresponding wild type Cas9.
  • the fragment is at least 100 amino acids in length.
  • the fragment is at least 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, or at least 1300 amino acids in length.
  • Cas9 refers to Cas9 from: Corynebacterium ulcerans (NCBI Refs: NC_015683.1, NC_017317.1); Corynebacterium diphtheria (NCBI Refs: NC_016782.1, NC_016786.1); Spiroplasma syrphidicola (NCBI Ref: NC_021284.1); Prevotella intermedia (NCBI Ref: NC_017861.1); Spiroplasma taiwanense (NCBI Ref: NC_021846.1); Streptococcus iniae (NCBI Ref: NC_021314.1); Belliella baltica (NCBI Ref: NC_018010.1); Psychroflexus torquisI (NCBI Ref: NC_018721.1); Streptococcus thermophilus (NCBI Ref: YP_820832.1), Listeria innocua (NCBI Ref: NP_472073.1), Camp
  • the Cas9 is from Neisseria meningitidis (Nme).
  • the Cas9 is Nme1, Nme2 or Nme3.
  • the PAM-interacting domains for Nme1, Nme2 or Nme3 are N 4 GAT, N 4 CC, and N 4 CAAA, respectively (see e.g., Edraki, A., et al., ⁇ A Compact, High-Accuracy Cas9 with a Dinucleotide PAM for In Vivo Genome Editing, Molecular Cell (2018)).
  • Cas9 fusion proteins as provided herein comprise the full-length amino acid sequence of a Cas9 protein, e.g., one of the Cas9 sequences provided herein. In other embodiments, however, fusion proteins as provided herein do not comprise a full-length Cas9 sequence, but only one or more fragments thereof.
  • a Cas9 fusion protein provided herein comprises a Cas9 fragment, wherein the fragment binds crRNA and tracrRNA or sgRNA, but does not comprise a functional nuclease domain, e.g., in that it comprises only a truncated version of a nuclease domain or no nuclease domain at all.
  • Cas9 refers to a Cas9 from archaea (e.g. nanoarchaea), which constitute a domain and kingdom of single-celled prokaryotic microbes.
  • Cas9 refers to CasX or CasY, which have been described in, for example, Burstein et al., "New CRISPR-Cas systems from uncultivated microbes.” Cell Res.2017 Feb 21.
  • Cas9 refers to CasX, or a variant of CasX. In some embodiments, Cas9 refers to a CasY, or a variant of CasY.
  • RNA-guided DNA binding proteins may be used as a nucleic acid programmable DNA binding protein (napDNAbp), and are within the scope of this disclosure.
  • napDNAbps useful in the methods of the invention include circular permutants, which are known in the art and described, for example, by Oakes et al., Cell 176, 254–267, 2019.
  • Non-limiting examples of a polynucleotide programmable nucleotide binding domain which can be incorporated into a base editor include a CRISPR protein-derived domain, a restriction nuclease, a meganuclease, TAL nuclease (TALEN), and a zinc finger nuclease (ZFN).
  • the nucleic acid programmable DNA binding protein (napDNAbp) or any of the fusion proteins provided herein may be a CasX or CasY protein.
  • the napDNAbp is a CasX protein.
  • the napDNAbp is a CasY protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a naturally- occurring CasX or CasY protein.
  • the napDNAbp is a naturally-occurring CasX or CasY protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any CasX or CasY protein described herein. It should be appreciated that CasX and CasY from other bacterial species may also be used in accordance with the present disclosure.
  • Cas12b or “Cas12b domain” refers to an RNA-guided nuclease comprising a Cas12b/C2c1 protein, or a fragment thereof (e.g., a protein comprising an active, inactive, or partially active DNA cleavage domain of Cas12b, and/or the gRNA binding domain of Cas12b). contents of each of which are incorporated herein by reference).
  • Cas12b orthologs have been described in various species, including, but not limited to, Alicyclobacillus acidoterrestris, Alicyclobacillus acidophilus (Teng et al., Cell Discov.2018 Nov 27;4:63), Bacillus hisashi, and Bacillus sp. V3-13. Additional suitable Cas12b nucleases and sequences will be apparent to those of skill in the art based on this disclosure. [0112] In some embodiments, proteins comprising Cas12b or fragments thereof are referred to as "Cas12b variants.” A Cas12b variant shares homology to Cas12b, or a fragment thereof.
  • a Cas12b variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to wild type Cas12b.
  • the Cas12b variant may have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more amino acid changes compared to wild type Cas12b.
  • the Cas12b variant comprises a fragment of Cas12b (e.g., a gRNA binding domain or a DNA- cleavage domain), such that the fragment is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to the corresponding fragment of wild type Cas12b.
  • a fragment of Cas12b e.g., a gRNA binding domain or a DNA- cleavage domain
  • the fragment is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% of the amino acid length of a corresponding wild type Cas12b.
  • Exemplary Cas12b polypeptides are listed herein.
  • CBLB polypeptide is meant a protein having at least about 85% amino acid sequence identity to GenBank Accession No. ABC86700.1 or a fragment thereof that is involved in the regulation of immune responses.
  • An exemplary CBLB polypeptide sequence is provided below.
  • CBLB Cbl proto-oncogene B polynucleotide
  • the CBLB gene encodes an E3 ubiquitin ligase.
  • An exemplary CBLB nucleic acid sequence is provided below. >DQ349203.1 Homo sapiens CBL-B mRNA, complete cds
  • chimeric antigen receptor or “CAR” is meant a synthetic or engineered receptor comprising an extracellular antigen binding domain joined to one or more intracellular signaling domains (e.g., T cell signaling domain) that confers specificity for an antigen onto an immune effector cell.
  • the CAR includes a transmembrane domain.
  • chimeric antigen receptor T cell or “CAR-T cell” is meant a T cell expressing a CAR that has antigen specificity determined by the antibody-derived targeting domain of the CAR.
  • CAR-T cells includes T cells or NK cells.
  • CAR-T cells includes cells engineered to express a CAR or a T cell receptor (TCR).
  • CAR-T cells can be T helper CD4+ and/or T effector CD8+ cells, optionally in defined proportions.
  • Methods of making CARs are publicly available (see, e.g., Park et al., Trends Biotechnol., 29:550-557, 2011; Grupp et al., N Engl J Med., 368:1509-1518, 2013; Han et al., J.
  • CIITA major histocompatibility complex, transactivator
  • CIITA major histocompatibility complex, transactivator
  • cytotoxic T-lymphocyte associated protein 4 (CTLA-4) polypeptide is meant a protein having at least about 85% sequence identity to NCBI Accession No. EAW70354.1 or a fragment thereof.
  • cytotoxic T-lymphocyte-associated protein 4 [Homo sapiens]
  • CTLA-4 cytotoxic T-lymphocyte associated protein 4
  • CTLA-4 polynucleotide
  • the CTLA-4 gene encodes an immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells.
  • An exemplary CTLA-4 nucleic acid sequence is provided below.
  • CD2 polypeptide a protein having at least about 85% amino acid sequence identity to NCBI Accession No. NP_001758.2 or fragment thereof and having immunomodulatory activity.
  • An exemplary amino acid sequence is provided below.
  • >NP_001758.2 T-cell surface antigen CD2 isoform 2 precursor [Homo sapiens] The CD2 cytoplasmic domain (amino acid residues 235-351) is shown in bold font.
  • CD2 polypeptide from Homo Sapiens is shown in FIG.4.
  • CD2 polynucleotide a nucleic acid encoding a CD2 polypeptide.
  • An exemplary CD2 nucleic acid sequence is provided below. > ⁇ NM_001767.5 Homo sapiens CD2 molecule (CD2), transcript variant 2, mRNA
  • cluster of differentiation 5 (CD5) polypeptide is meant a protein having at least about 85% amino acid sequence identity to NCBI Accession No. NP_001333385.1 or fragment thereof and having immunomodulatory activity.
  • An exemplary amino acid sequence is provided below.
  • CD5 polynucleotide a nucleic acid encoding a CD5 polypeptide.
  • An exemplary CD5 nucleic acid sequence is provided below.
  • CD5 nucleic acid sequence is provided below.
  • CD5 Homo sapiens CD5 molecule (CD5), transcript variant 2, mRNA
  • CD7 polypeptide is meant a protein having at least about 85% amino acid sequence identity to NCBI Reference Sequence: NP_006128.1 or a fragment thereof and having immunomodulatory activity.
  • An exemplary amino acid sequence is provided below.
  • CD7 polynucleotide is meant a nucleic acid molecule encoding a CD7 polypeptide.
  • An exemplary CD7 nucleic acid sequence is provided below. >NM_006137.7 Homo sapiens CD7 molecule (CD7), mRNA
  • CD33 polypeptide is meant a protein having at least about 85% amino acid sequence identity to NCBI Reference Sequence: NP_001763.3 or a fragment thereof. CD33 is also known as Siglec-3.
  • An exemplary amino acid sequence is provided below.
  • CD33 polynucleotide is meant a nucleic acid molecule encoding a CD33 polypeptide.
  • An exemplary CD33 nucleic acid sequence is provided below.
  • NM_001772.4 Homo sapiens CD33 molecule (CD33), transcript variant 1, mRNA
  • Cluster of Differentiation 52 (CD52) polypeptide is meant a protein having at least about 85% amino acid sequence identity to NCBI Reference Sequence: NP_001794.2or a fragment thereof. CD52 is also known as CAMPATH-1.
  • An exemplary amino acid sequence is provided below.
  • CD52 polynucleotide a nucleic acid molecule encoding a CD52 polypeptide.
  • An exemplary CD52 nucleic acid sequence is provided below.
  • Cluster of Differentiation 123 (CD123) polypeptide is meant a protein having at least about 85% amino acid sequence identity to NCBI Reference Sequence: NP_002174.1 or a fragment thereof. CD123 is also known as the interleukin-3 receptor. An exemplary amino acid sequence is provided below. > NP_002174.1 interleukin-3 receptor subunit alpha isoform 1 precursor [Homo sapiens] [0133] By “Cluster of Differentiation 123 (CD123) polynucleotide” is meant a nucleic acid molecule encoding a CD123 polypeptide.
  • CD123 nucleic acid sequence is provided below. > NM_002183.4 Homo sapiens interleukin 3 receptor subunit alpha (IL3RA), transcript variant 1, mRNA [0134]
  • Cluster of Differentiation 137 (CD137) polypeptide is meant a protein having at least about 85% amino acid sequence identity to NCBI Reference Sequence: NP_001552.2 or a fragment thereof. CD137 is also known as 4-1BB.
  • An exemplary amino acid sequence is provided below.
  • CD137 Cluster of Differentiation 137 polynucleotide
  • TNFRSF9 Homo sapiens TNF receptor superfamily member 9
  • CD247 Cluster of Differentiation 247 polypeptide
  • CD137 is also known as CD3 ⁇ .
  • An exemplary amino acid sequence is provided below.
  • T-cell surface glycoprotein CD3 zeta chain isoform 1 precursor [Homo sapiens] 1 MKWKALFTAA ILQAQLPITE AQSFGLLDPK LCYLLDGILF IYGVILTALF LRVKFSRSAD 61 APAYQQGQNQ LYNELNLGRR EEYDVLDKRR GRDPEMGGKP QRRKNPQEGL YNELQKDKMA 121 EAYSEIGMKG ERRRGKGHDG LYQGLSTATK DTYDALHMQA LPPR [0137]
  • Cluster of Differentiation 247 (CD247) polynucleotide is meant a nucleic acid molecule encoding a CD247 polypeptide.
  • CD247 nucleic acid sequence is provided below. > NM_ NM_198053.3 Homo sapiens CD247 molecule (CD247), transcript variant 1, mRNA [0138] “Co-administration” or “co-administered” refers to administering two or more therapeutic agents or pharmaceutical compositions during a course of treatment. Such co-administration can be simultaneous administration or sequential administration. Sequential administration of a later-administered therapeutic agent or pharmaceutical composition can occur at any time during the course of treatment after administration of the first pharmaceutical composition or therapeutic agent. [0139] The term “conservative amino acid substitution” or “conservative mutation” refers to the replacement of one amino acid by another amino acid with a common property.
  • a functional way to define common properties between individual amino acids is to analyze the normalized frequencies of amino acid changes between corresponding proteins of homologous organisms (Schulz, G. E. and Schirmer, R. H., Principles of Protein Structure, Springer-Verlag, New York (1979)). According to such analyses, groups of amino acids can be defined where amino acids within a group exchange preferentially with each other, and therefore resemble each other most in their impact on the overall protein structure (Schulz, G. E. and Schirmer, R. H., supra).
  • Non- limiting examples of conservative mutations include amino acid substitutions of amino acids, for example, lysine for arginine and vice versa such that a positive charge can be maintained; glutamic acid for aspartic acid and vice versa such that a negative charge can be maintained; serine for threonine such that a free –OH can be maintained; and glutamine for asparagine such that a free –NH2 can be maintained.
  • coding sequence or “protein coding sequence” as used interchangeably herein refers to a segment of a polynucleotide that codes for a protein. The region or sequence is bounded nearer the 5’ end by a start codon and nearer the 3’ end with a stop codon.
  • Coding sequences can also be referred to as open reading frames.
  • codon optimization is meant a process of modifying a nucleic acid sequence for enhanced expression in the host cells of interest by replacing at least one codon (e.g. about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons) of the native sequence with codons that are more frequently or most frequently used in the genes of that host cell while maintaining the native amino acid sequence.
  • codons e.g. about or more than about 1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more codons
  • Various species exhibit particular bias for certain codons of a particular amino acid.
  • Codon bias (differences in codon usage between organisms) often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, among other things, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules.
  • mRNA messenger RNA
  • tRNA transfer RNA
  • the predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization. Codon usage tables are readily available, for example, at the “Codon Usage Database” available at www.kazusa.orjp/codon/ (visited Jul.9, 2002), and these tables can be adapted in a number of ways.
  • codon optimizing a particular sequence for expression in a particular host cell are also available, such as Gene Forge (Aptagen; Jacobus, Pa.), are also available.
  • one or more codons e.g.1, 2, 3, 4, 5, 10, 15, 20, 25, 50, or more, or all codons
  • one or more codons in a sequence encoding an engineered nuclease correspond to the most frequently used codon for a particular amino acid.
  • cytidine deaminase is meant a polypeptide or fragment thereof capable of catalyzing a deamination reaction that converts an amino group to a carbonyl group.
  • the cytidine deaminase converts cytosine to uracil or 5-methylcytosine to thymine.
  • PmCDA1 which is derived from Petromyzon marinus (Petromyzon marinus cytosine deaminase 1 (“PmCDA1”)), or AID (Activation-induced cytidine deaminase (“AICDA”)), which is derived from a mammal (e.g., human, swine, bovine, horse, monkey etc.), and APOBEC are exemplary cytidine deaminases.
  • AICDA1 Activation-induced cytidine deaminase
  • the base sequence and amino acid sequence of PmCDA1 and the base sequence and amino acid sequence of human AID are shown below. >tr
  • APOBEC catalytic polypeptide-like
  • APOBEC family members include APOBEC1, APOBEC2, APOBEC3A, APOBEC3B, APOBEC3C, APOBEC3D ("APOBEC3E” now refers to this), APOBEC3F, APOBEC3G, APOBEC3H, APOBEC4, and Activation-induced (cytidine) deaminase.
  • modified cytidine deaminases are commercially available, including but not limited to SaBE3, SaKKH-BE3, VQR-BE3, EQR- BE3, VRER-BE3, YE1-BE3, EE-BE3, YE2-BE3, and YEE-BE3, which are available from Addgene (plasmids 85169, 85170, 85171, 85172, 85173, 85174, 85175, 85176, 85177).
  • Addgene Plas 85169, 85170, 85171, 85172, 85173, 85174, 85175, 85176, 85177.
  • the active domain of the respective sequence can be used, e.g., the domain without a localizing signal (nuclear localization sequence, without nuclear export signal, cytoplasmic localizing signal).
  • the deaminase or deaminase domain is a cytidine deaminase, catalyzing the hydrolytic deamination of cytidine or deoxycytidine to uridine or deoxyuridine, respectively.
  • the deaminase or deaminase domain is a cytosine deaminase, catalyzing the hydrolytic deamination of cytosine to uracil.
  • the deaminase is an adenosine deaminase, which catalyzes the hydrolytic deamination of adenine to hypoxanthine.
  • the deaminase is an adenosine deaminase, which catalyzes the hydrolytic deamination of adenosine or adenine (A) to inosine (I).
  • the deaminase or deaminase domain is an adenosine deaminase catalyzing the hydrolytic deamination of adenosine or deoxyadenosine to inosine or deoxyinosine, respectively.
  • the adenosine deaminase catalyzes the hydrolytic deamination of adenosine in deoxyribonucleic acid (DNA).
  • the adenosine deaminases e.g., engineered adenosine deaminases, evolved adenosine deaminases
  • the adenosine deaminases can be from any organism, such as a bacterium.
  • the adenosine deaminase is from a bacterium, such as Escherichia coli, Staphylococcus aureus, Salmonella typhimurium, Shewanella putrefaciens, Haemophilus influenzae, or Caulobacter crescentus.
  • the deaminase or deaminase domain is a variant of a naturally occurring deaminase from an organism, such as a human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse. In some embodiments, the deaminase or deaminase domain does not occur in nature.
  • the deaminase or deaminase domain is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75% at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% identical to a naturally occurring deaminase.
  • deaminase domains are described in International PCT Application Nos. PCT/2017/045381 (WO 2018/027078) and PCT/US2016/058344 (WO 2017/070632), each of which is incorporated herein by reference for its entirety.
  • Detect refers to identifying the presence, absence or amount of the analyte to be detected.
  • detecttable label is meant a composition that when linked to a molecule of interest renders the latter detectable, via spectroscopic, photochemical, biochemical, immunochemical, or chemical means.
  • useful labels include radioactive isotopes, magnetic beads, metallic beads, colloidal particles, fluorescent dyes, electron-dense reagents, enzymes (for example, as commonly used in an enzyme-linked immunosorbent assay (ELISA)), biotin, digoxigenin, or haptens.
  • disease is meant any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ.
  • the disease is a neoplasia or cancer.
  • the disease is a hematological cancer.
  • hematological cancer is meant a malignancy of immune system cells.
  • the hematological cancer is leukemia, myeloma, and/or lymphoma.
  • Lymphomas and Leukemias are examples of “liquid cancers” or cancers present in the blood and are derived from the transformation of either a hematopoietic precursor in the bone marrow or a mature hematopoietic cell in the blood.
  • Leukemias can be lymphoid or myeloid, and acute or chronic.
  • the transformed cell is a fully differentiated plasma cell that may be present as a dispersed collection of malignant cells or as a solid mass in the bone marrow.
  • the hematological cancer is a B cell cancer.
  • the B cell cancer is a lymphoma or a leukemia.
  • the leukemia comprises a pre-leukemia.
  • the leukemia is an acute leukemia.
  • Acute leukemias include, for example, an acute myeloid leukemia (AML).
  • Acute leukemias also include, for example, an acute lymphoid leukemia or an acute lymphocytic leukemia (ALL); ALL includes B-lineage ALL; T-lineage ALL; and T-cell acute lymphocytic leukemia (T-ALL).
  • ALL includes B-lineage ALL; T-lineage ALL; and T-cell acute lymphocytic leukemia (T-ALL).
  • Nonlimiting examples of diseases include T-cell acute lymphoblastic leukemia (T-ALL), mycosis fungoides (MF), Sézary syndrome (SS), Peripheral T/NK ⁇ cell lymphoma, Anaplastic large cell lymphoma ALK + , Primary cutaneous T ⁇ cell lymphoma, T ⁇ cell large granular lymphocytic leukemia, Angioimmunoblastic T/NK ⁇ cell lymphoma, Hepatosplenic T ⁇ cell lymphoma, Primary cutaneous CD30 + lymphoproliferative disorders, Extranodal NK/T ⁇ cell lymphoma, Adult T ⁇ cell leukemia/lymphoma, T ⁇ cell prolymphocytic leukemia, Subcutaneous panniculitis ⁇ like T-cell lymphoma, Primary cutaneous gamma ⁇ delta T-cell lymphoma, Aggressive NK ⁇ cell leukemia, and Enteropathy ⁇ associated T ⁇ cell lymphoma.
  • T-ALL T-cell acute lymphoblastic le
  • the disease is a liquid tumor.
  • the disease is T-cell acute lymphoblastic leukemia (T-ALL).
  • the disease is acute myelogenous leukemia (AML).
  • the term "effective amount,” as used herein, refers to an amount of a biologically active agent that is sufficient to elicit a desired biological response.
  • an effect amount is an amount required to ameliorate the symptoms of a disease relative to an untreated patient.
  • the effective amount of an active agent(s) used to practice the present invention for therapeutic treatment of a disease varies depending upon the manner of administration, the age, body weight, and general health of the subject. Ultimately, the attending physician or veterinarian will decide the appropriate amount and dosage regimen.
  • an effective amount is the amount of a base editor of the invention (e.g., a fusion protein comprising a programable DNA binding protein, a nucleobase editor and gRNA) sufficient to introduce an alteration in a gene of interest in a cell (e.g., a cell in vitro or in vivo).
  • an effective amount is the amount of a base editor required to achieve a therapeutic effect (e.g., to reduce or control a disease or a symptom or condition thereof).
  • an effective amount of a fusion protein provided herein refers to the amount of the fusion protein that is sufficient to induce editing of a target site specifically bound and edited by the nucleobase editors described herein.
  • an effective amount of an agent e.g., a fusion protein, a nuclease, a hybrid protein, a protein dimer, a complex of a protein (or protein dimer) and a polynucleotide, or a polynucleotide
  • an agent e.g., a fusion protein, a nuclease, a hybrid protein, a protein dimer, a complex of a protein (or protein dimer) and a polynucleotide, or a polynucleotide
  • an agent e.g., a fusion protein, a nuclease, a hybrid protein, a protein dimer, a complex of a protein (or protein dimer) and a polynucleotide, or a polynucleotide
  • an effective amount refers” to the quantity of cells necessary to administer to a patient to achieve a therapeutic response.
  • Epitope means an antigenic determinant.
  • An epitope is the part of an antigen molecule that by its structure determines the specific antibody molecule that will recognize and bind it.
  • Fas Cell Surface Death Receptor (FAS) polypeptide is meant a protein having at least about 85% amino acid sequence identity to NCBI Accession No. NP_000034.1 or fragment thereof. An exemplary amino acid sequence is provided below.
  • FAS Fas Cell Surface Death Receptor
  • fragment is meant a portion of a polypeptide or nucleic acid molecule. This portion contains, at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% of the entire length of the reference nucleic acid molecule or polypeptide. A fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, 700, 800, 900, or 1000 nucleotides or amino acids.
  • farnesotides are examples of the killing of immune cells by other immune cells, including self-antigen driven killing of immune cells.
  • immune cells of the invention are genetically modified to prevent or reduce expression of antigens recognized by immune cells expressing a chimeric antigen receptor (CAR), thereby preventing or reducing fratricide.
  • fratricide may occur in vivo (e.g., in a subject) or ex vivo (e.g., in an immune cell preparation).
  • GVHD chimeric antigen receptor
  • guide RNA or “gRNA” is meant a polynucleotide which can be specific for a target sequence and can form a complex with a polynucleotide programmable nucleotide binding domain protein (e.g., Cas9 or Cpf1).
  • the guide polynucleotide is a guide RNA (gRNA).
  • gRNAs can exist as a complex of two or more RNAs, or as a single RNA molecule.
  • gRNAs that exist as a single RNA molecule may be referred to as single-guide RNAs (sgRNAs), though “gRNA” is used interchangeably to refer to guide RNAs that exist as either single molecules or as a complex of two or more molecules.
  • gRNAs that exist as single RNA species comprise two domains: (1) a domain that shares homology to a target nucleic acid (e.g., and directs binding of a Cas9 complex to the target); and (2) a domain that binds a Cas9 protein.
  • domain (2) corresponds to a sequence known as a tracrRNA, and comprises a stem-loop structure.
  • domain (2) is identical or homologous to a tracrRNA as provided in Jinek et al., Science 337:816-821(2012), the entire contents of which is incorporated herein by reference.
  • gRNAs e.g., those including domain 2
  • a gRNA comprises two or more of domains (1) and (2), and may be referred to as an “extended gRNA.”
  • An extended gRNA will bind two or more Cas9 proteins and bind a target nucleic acid at two or more distinct regions, as described herein.
  • the gRNA comprises a nucleotide sequence that complements a target site, which mediates binding of the nuclease/RNA complex to said target site, providing the sequence specificity of the nuclease:RNA complex.
  • RNA polynucleotide sequences include the nucleobase uracil (U), a pyrimidine derivative, rather than the nucleobase thymine (T), which is included in DNA polynucleotide sequences.
  • U nucleobase uracil
  • T nucleobase thymine
  • uracil base-pairs with adenine and replaces thymine during DNA transcription.
  • heterodimer is meant a fusion protein comprising two domains, such as a wild type TadA domain and a variant of TadA domain (e.g., TadA*8) or two variant TadA domains (e.g., TadA*7.10 and TadA*8 or two TadA*8 domains).
  • HVGD hyperthelial growth factor
  • Hybridization means hydrogen bonding, which may be Watson-Crick, Hoogsteen or reversed Hoogsteen hydrogen bonding, between complementary nucleobases.
  • immune cell is meant a cell of the immune system capable of generating an immune response.
  • immune effector cell is meant a lymphocyte, once activated, capable of effecting an immune response upon a target cell.
  • immune effector cells are effector T cells.
  • the effector T cell is a na ⁇ ve CD8 + T cell, a cytotoxic T cell, a natural killer T (NKT) cell, a natural killer (NK) cell, or a regulatory T (Treg) cell.
  • immune effector cells are effector NK cells.
  • the effector T cells are thymocytes, immature T lymphocytes, mature T lymphocytes, resting T lymphocytes, or activated T lymphocytes.
  • the immune effector cell is a CD4 + CD8 + T cell or a CD4- CD8- T cell.
  • the immune effector cell is a T helper cell.
  • the T helper cell is a T helper 1 (Th1), a T helper 2 (Th2) cell, or a helper T cell expressing CD4 (CD4+ T cell).
  • Immune response regulation gene or “immune response regulator” is meant a gene that encodes a polypeptide that is involved in the regulation of an immune response.
  • An immune response regulation gene may regulate immune response in multiple mechanisms or on different levels.
  • an immune response regulation gene may inhibit or facilitate the activation of an immune cell, e.g. a T cell.
  • An immune response regulation gene may increase or decrease the activation threshold of an immune cell.
  • the immune response regulation gene positively regulates an immune cell signal transduction pathway.
  • the immune response regulation gene negatively regulates an immune cell signal transduction pathway.
  • the immune response regulation gene encodes an antigen, an antibody, a cytokine, or a neuroendocrine.
  • immunogenic gene is meant a gene that encodes a polypeptide that is able to elicit an immune response.
  • an immunogenic gene may encode an immunogen that elicits an immune response.
  • an immunogenic gene encodes a cell surface protein.
  • an immunogenic gene encodes a cell surface antigen or a cell surface marker.
  • the cell surface marker is a T cell marker or a B cell marker.
  • an immunogenic gene encodes a CD2, CD3e, CD3 delta, CD3 gamma, TRAC, TRBC1, TRBC2, CD4, CD5, CD7, CD8, CD19, CD23, CD27, CD28, CD30, CD33, CD52, CD70, CD127, CD122, CD130, CD132, CD38, CD69, CD11a, CD58, CD99, CD103, CCR4, CCR5, CCR6, CCR9, CCR10, CXCR3, CXCR4, CLA, CD161, B2M, or CIITA polypeptide.
  • inhibitor of base repair refers to a protein that is capable in inhibiting the activity of a nucleic acid repair enzyme, for example a base excision repair (BER) enzyme.
  • the IBR is an inhibitor of inosine base excision repair.
  • Exemplary inhibitors of base repair include inhibitors of APE1, Endo III, Endo IV, Endo V, Endo VIII, Fpg, hOGGl, hNEILl, T7 Endol, T4PDG, UDG, hSMUGl, and hAAG.
  • the IBR is an inhibitor of Endo V or hAAG.
  • the IBR is a catalytically inactive EndoV or a catalytically inactive hAAG.
  • the base repair inhibitor is an inhibitor of Endo V or hAAG.
  • the base repair inhibitor is a catalytically inactive EndoV or a catalytically inactive hAAG.
  • the base repair inhibitor is uracil glycosylase inhibitor (UGI).
  • UGI refers to a protein that is capable of inhibiting a uracil-DNA glycosylase base-excision repair enzyme.
  • a UGI domain comprises a wild-type UGI or a fragment of a wild-type UGI.
  • the UGI proteins provided herein include fragments of UGI and proteins homologous to a UGI or a UGI fragment.
  • the base repair inhibitor is an inhibitor of inosine base excision repair.
  • the base repair inhibitor is a “catalytically inactive inosine specific nuclease” or “dead inosine specific nuclease.
  • catalytically inactive inosine glycosylases can bind inosine, but cannot create an abasic site or remove the inosine, thereby sterically blocking the newly formed inosine moiety from DNA damage/repair mechanisms.
  • the catalytically inactive inosine specific nuclease can be capable of binding an inosine in a nucleic acid but does not cleave the nucleic acid.
  • Non-limiting exemplary catalytically inactive inosine specific nucleases include catalytically inactive alkyl adenosine glycosylase (AAG nuclease), for example, from a human, and catalytically inactive endonuclease V (EndoV nuclease), for example, from E. coli.
  • AAG nuclease catalytically inactive alkyl adenosine glycosylase
  • EndoV nuclease catalytically inactive endonuclease V
  • the catalytically inactive AAG nuclease comprises an E125Q mutation or a corresponding mutation in another AAG nuclease.
  • By “increases” is meant a positive alteration of at least 10%, 25%, 50%, 75%, or 100%.
  • an “intein” is a fragment of a protein that is able to excise itself and join the remaining fragments (the exteins) with a peptide bond in a process known as protein splicing. Inteins are also referred to as “protein introns.” The process of an intein excising itself and joining the remaining portions of the protein is herein termed “protein splicing” or “intein-mediated protein splicing.” In some embodiments, an intein of a precursor protein (an intein containing protein prior to intein-mediated protein splicing) comes from two genes.
  • intein is referred to herein as a split intein (e.g., split intein-N and split intein-C).
  • a split intein e.g., split intein-N and split intein-C
  • DnaE the catalytic subunit a of DNA polymerase III
  • dnaE-n the catalytic subunit a of DNA polymerase III
  • dnaE-n the catalytic subunit a of DNA polymerase III
  • dnaE-n the catalytic subunit a of DNA polymerase III
  • the intein encoded by the dnaE-n gene may be herein referred as “intein-N.”
  • intein-C The intein encoded by the dnaE-c gene may be herein referred as “intein-C.”
  • Other intein systems may also be used.
  • a synthetic intein based on the dnaE intein, the Cfa-N (e.g., split intein-N) and Cfa-C (e.g., split intein-C) intein pair has been described (e.g., in Stevens et al., J Am Chem Soc.2016 Feb.24; 138(7):2162-5, incorporated herein by reference).
  • Non-limiting examples of intein pairs that may be used in accordance with the present disclosure include: Cfa DnaE intein, Ssp GyrB intein, Ssp DnaX intein, Ter DnaE3 intein, Ter ThyX intein, Rma DnaB intein and Cne Prp8 intein (e.g., as described in U.S. Patent No.8,394,604, incorporated herein by reference. [0175] Exemplary nucleotide and amino acid sequences of inteins are provided below.
  • DnaE Intein-N DNA DnaE Intein-N Protein: DnaE Intein-C DNA: Cfa-N DNA: Cfa-N Protein: Cfa-C DNA: [0176]
  • Intein-N and intein-C may be fused to the N-terminal portion of the split Cas9 and the C- terminal portion of the split Cas9, respectively, for the joining of the N-terminal portion of the split Cas9 and the C-terminal portion of the split Cas9.
  • an intein-N is fused to the C-terminus of the N-terminal portion of the split Cas9, i.e., to form a structure of N--[N-terminal portion of the split Cas9]-[intein-N]--C.
  • an intein-C is fused to the N-terminus of the C-terminal portion of the split Cas9, i.e., to form a structure of N-[intein-C]--[C-terminal portion of the split Cas9]-C.
  • intein- mediated protein splicing for joining the proteins the inteins are fused to (e.g., split Cas9) is known in the art, e.g., as described in Shah et al., Chem Sci.2014; 5(1):446-461, incorporated herein by reference.
  • Methods for designing and using inteins are known in the art and described, for example by WO2014004336, WO2017132580, US20150344549, and US20180127780, each of which is incorporated herein by reference in their entirety.
  • isolated isolated
  • Isolate denotes a degree of separation from original source or surroundings.
  • Purify denotes a degree of separation that is higher than isolation.
  • a “purified” or “biologically pure” protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high- performance liquid chromatography.
  • isolated polynucleotide is meant a nucleic acid (e.g., a DNA) that is free of the genes which, in the naturally-occurring genome of the organism from which the nucleic acid molecule of the invention is derived, flank the gene.
  • the term therefore includes, for example, a recombinant DNA that is incorporated into a vector; into an autonomously replicating plasmid or virus; or into the genomic DNA of a prokaryote or eukaryote; or that exists as a separate molecule (for example, a cDNA or a genomic or cDNA fragment produced by PCR or restriction endonuclease digestion) independent of other sequences.
  • the term includes an RNA molecule that is transcribed from a DNA molecule, as well as a recombinant DNA that is part of a hybrid gene encoding additional polypeptide sequence.
  • an "isolated polypeptide” is meant a polypeptide of the invention that has been separated from components that naturally accompany it.
  • the polypeptide is isolated when it is at least 60%, by weight, free from the proteins and naturally-occurring organic molecules with which it is naturally associated.
  • the preparation is at least 75%, more preferably at least 90%, and most preferably at least 99%, by weight, a polypeptide of the invention.
  • An isolated polypeptide of the invention may be obtained, for example, by extraction from a natural source, by expression of a recombinant nucleic acid encoding such a polypeptide; or by chemically synthesizing the protein.
  • leader peptide is meant a short amino acid sequence (e.g., approximately 16-30 amino acids in length) that directs newly synthesized secretory or membrane proteins to and through membranes (e.g., the endoplasmic reticulum membrane).
  • Leader peptides are typically located at the N-terminus of a polypeptide and can be removed by signal peptidases after the polypeptide has crossed the membrane.
  • Leader peptide sequences typically contain three common structural features: N-terminal polar basic region (n-region), a hydrophobic core, and a hydrophilic c- region).
  • a CAR of the present invention includes a leader peptide sequence (e.g., N-terminal to the antigen binding domain).
  • An exemplary leader peptide amino acid sequence is: METDTLLLWVLLLWVPGSTG.
  • the term "linker,” as used herein, refers to a bond (e.g., covalent bond), chemical group, or a molecule linking two molecules or moieties, e.g., two components of a protein complex or a ribonucleocomplex, or two domains of a fusion protein, such as, for example, a polynucleotide programmable DNA binding domain (e.g., dCas9) and a deaminase domain (e.g., an adenosine deaminase, a cytidine deaminase).
  • a linker can join different components of, or different portions of components of, a base editor system.
  • a linker can join a guide polynucleotide binding domain of a polynucleotide programmable nucleotide binding domain and a catalytic domain of a deaminase.
  • a linker can join a CRISPR polypeptide and a deaminase.
  • a linker can join a Cas9 and a deaminase.
  • a linker can join a dCas9 and a deaminase.
  • a linker can join a nCas9 and a deaminase. In some embodiments, a linker can join a guide polynucleotide and a deaminase. In some embodiments, a linker can join a deaminating component and a polynucleotide programmable nucleotide binding component of a base editor system. In some embodiments, a linker can join an RNA-binding portion of a deaminating component and a polynucleotide programmable nucleotide binding component of a base editor system.
  • a linker can join an RNA-binding portion of a deaminating component and an RNA-binding portion of a polynucleotide programmable nucleotide binding component of a base editor system.
  • a linker can be positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond or non-covalent interaction, thus connecting the two.
  • the linker can be an organic molecule, group, polymer, or chemical moiety.
  • the linker can be a polynucleotide.
  • the linker can be a DNA linker.
  • the linker can be an RNA linker.
  • a linker can comprise an aptamer capable of binding to a ligand.
  • the ligand may be carbohydrate, a peptide, a protein, or a nucleic acid.
  • the linker may comprise an aptamer may be derived from a riboswitch.
  • the riboswitch from which the aptamer is derived may be selected from a theophylline riboswitch, a thiamine pyrophosphate (TPP) riboswitch, an adenosine cobalamin (AdoCbl) riboswitch, an S-adenosyl methionine (SAM) riboswitch, an SAH riboswitch, a flavin mononucleotide (FMN) riboswitch, a tetrahydrofolate riboswitch, a lysine riboswitch, a glycine riboswitch, a purine riboswitch, a GlmS riboswitch, or a pre- queosine1 (PreQ1) riboswitch.
  • TPP thiamine pyrophosphate
  • AdoCbl adenosine cobalamin
  • a linker may comprise an aptamer bound to a polypeptide or a protein domain, such as a polypeptide ligand.
  • the polypeptide ligand may be a K Homology (KH) domain, a MS2 coat protein domain, a PP7 coat protein domain, a SfMu Com coat protein domain, a sterile alpha motif, a telomerase Ku binding motif and Ku protein, a telomerase Sm7 binding motif and Sm7 protein, or an RNA recognition motif.
  • the polypeptide ligand may be a portion of a base editor system component.
  • a nucleobase editing component may comprise a deaminase domain and an RNA recognition motif.
  • the linker can be an amino acid or a plurality of amino acids (e.g., a peptide or protein).
  • the linker can be about 5-100 amino acids in length, for example, about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 20-30, 30-40, 40-50, 50-60, 60-70, 70-80, 80-90, or 90-100 amino acids in length.
  • the linker can be about 100-150, 150-200, 200-250, 250-300, 300-350, 350-400, 400-450, or 450- 500 amino acids in length.
  • a linker joins a gRNA binding domain of an RNA-programmable nuclease, including a Cas9 nuclease domain, and the catalytic domain of a nucleic-acid editing protein (e.g., cytidine or adenosine deaminase).
  • a linker joins a dCas9 and a nucleic-acid editing protein.
  • the linker is positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond, thus connecting the two.
  • the linker is an amino acid or a plurality of amino acids (e.g., a peptide or protein).
  • the linker is an organic molecule, group, polymer, or chemical moiety.
  • the linker is 5-200 amino acids in length, for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 35, 45, 50, 55, 60, 60, 65, 70, 70, 75, 80, 85, 90, 90, 95, 100, 101, 102, 103, 104, 105, 110, 120, 130, 140, 150, 160, 175, 180, 190, or 200 amino acids in length. Longer or shorter linkers are also contemplated.
  • a linker comprises the amino acid sequenceSGSETPGTSESATPES, which may also be referred to as the XTEN linker.
  • a linker comprises the amino acid sequence SGGS.
  • a linker comprises (SGGS)n, (GGGS)n, (GGGGS) n, (G) n, (EAAAK) n , (GGS) n , SGSETPGTSESATPES, or (XP) n motif, or a combination of any of these, where n is independently an integer between 1 and 30, and where X is any amino acid.
  • n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15.
  • a linker comprises a plurality of proline residues and is 5-21, 5-14, 5-9, 5-7 amino acids in length, e.g., PAPAP, PAPAPA, PAPAPAP, PAPAPAPA, P(AP) 4 , P(AP) 7 , P(AP) 10 .
  • proline-rich linkers are also termed “rigid” linkers.
  • the chimeric antigen receptor comprises at least one linker. The at least one linker joins, or links, a variable heavy (VH) region to a constant heavy (CH) region of the extracellular binding domain of the chimeric antigen receptor.
  • Linkers can also link a variable light (VL) region to a variable constant (VC) region of the extracellular binding domain.
  • the domains of the base editor are fused via a linker that comprises the amino acid sequence of: [0185]
  • domains of the base editor are fused via a linker comprising the amino acid sequence SGSETPGTSESATPES, which may also be referred to as the XTEN linker.
  • a linker comprises the amino acid sequenceSGGS.
  • the linker is 24 amino acids in length.
  • the linker comprises the amino acid sequence SGGSSGGSSGSETPGTSESATPES.
  • the linker is 40 amino acids in length.
  • the linker comprises the amino acid sequence In some embodiments, the linker is 64 amino acids in length. In some embodiments, the linker comprises the amino acid sequence In some embodiments, the linker is 92 amino acids in length. In some embodiments, the linker comprises the amino acid sequence [0186]
  • liquid cancer refers to cancer cells that are present in body fluids, such as, for example, blood, lymph, and bone marrow. Liquid cancers include, but are not limited to, leukemias, myelomas, and liquid lymphomas. Liquid cancers as used herein do not include solid tumors, such as sarcomas and carcinomas, or solid lymphomas that do not contain cysts or liquid areas.
  • a “liquid cancer” can be relapsed, refractory, or metastatic.
  • a liquid cancer to be treated with the methods described herein can be, for example, a liquid lymphoma; liquid lymphomas include lymphomas that contain cysts or liquid areas.
  • LAG-3 polypeptide is meant a protein having at least about 85% amino acid sequence identity to NCBI Accession No. NP_002277.4 or fragment thereof and having immunomodulatory activity. An exemplary amino acid sequence is provided below.
  • lymphocyte activation gene 3 protein precursor
  • LAG-3 polynucleotide a nucleic acid encoding a LAG-3 polypeptide.
  • An exemplary LAG-3 nucleic acid sequence is provided below.
  • marker is meant any protein or polynucleotide having an alteration in expression level or activity that is associated with a disease or disorder.
  • mutation refers to a substitution of a residue within a sequence, e.g., a nucleic acid or amino acid sequence, with another residue, or a deletion or insertion of one or more residues within a sequence. Mutations are typically described herein by identifying the original residue followed by the position of the residue within the sequence and by the identity of the newly substituted residue. Various methods for making the amino acid substitutions (mutations) provided herein are well known in the art, and are provided by, for example, Green and Sambrook, Molecular Cloning: A Laboratory Manual (4 th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)).
  • an intended mutation such as a point mutation
  • a nucleic acid e.g., a nucleic acid within a genome of a subject
  • an intended mutation is a mutation that is generated by a specific base editor (e.g., cytidine base editor or adenosine base editor) bound to a guide polynucleotide (e.g., gRNA), specifically designed to generate the intended mutation.
  • a specific base editor e.g., cytidine base editor or adenosine base editor
  • a guide polynucleotide e.g., gRNA
  • mutations made or identified in a sequence are numbered in relation to a reference (or wild-type) sequence, i.e., a sequence that does not contain the mutations.
  • a reference sequence i.e., a sequence that does not contain the mutations.
  • the skilled practitioner in the art would readily understand how to determine the position of mutations in amino acid and nucleic acid sequences relative to a reference sequence.
  • "Neoplasia" refers to cells or tissues exhibiting abnormal growth or proliferation.
  • the term neoplasia encompasses cancer, liquid and solid tumors. In some embodiments, the neoplasia is a solid tumor. In other embodiments, the neoplasia is a liquid tumor.
  • the neoplasia is a hematological cancer.
  • the hematological cancer is leukemia, myeloma, and/or lymphoma.
  • the hematological cancer is a B cell cancer.
  • the B cell cancer is a lymphoma or a leukemia.
  • the leukemia comprises a pre-leukemia.
  • the leukemia is an acute leukemia.
  • Acute leukemias include, for example, an acute myeloid leukemia (AML).
  • Acute leukemias also include, for example, an acute lymphoid leukemia or an acute lymphocytic leukemia (ALL); ALL includes B-lineage ALL; T-lineage ALL; and T-cell acute lymphocytic leukemia (T-ALL).
  • ALL includes B-lineage ALL; T-lineage ALL; and T-cell acute lymphocytic leukemia (T-ALL).
  • Nonlimiting examples of neoplasia include T-cell acute lymphoblastic leukemia (T- ALL), mycosis fungoides (MF), Sézary syndrome (SS), Peripheral T/NK ⁇ cell lymphoma, Anaplastic large cell lymphoma ALK + , Primary cutaneous T ⁇ cell lymphoma, T ⁇ cell large granular lymphocytic leukemia, Angioimmunoblastic T/NK ⁇ cell lymphoma, Hepatosplenic T ⁇ cell lymphoma, Primary cutaneous CD30 + lymphoproliferative disorders, Extranodal NK/T ⁇ cell lymphoma, Adult T ⁇ cell leukemia/lymphoma, T ⁇ cell prolymphocytic leukemia, Subcutaneous panniculitis ⁇ like T-cell lymphoma, Primary cutaneous gamma ⁇ delta T-cell lymphoma, Aggressive NK ⁇ cell leukemia, and Enteropathy ⁇ associated T ⁇ cell lymphoma.
  • T- ALL T-cell
  • the neoplasia is T-cell acute lymphoblastic leukemia (T-ALL). In some embodiments, the neoplasia is acute myelogenous leukemia (AML).
  • T-ALL T-cell acute lymphoblastic leukemia
  • AML acute myelogenous leukemia
  • NFATc1 polypeptide a protein having at least about 85% amino acid sequence identity to NCBI Accession No. NM_172390.2 or a fragment thereof and is a component of the activated T cell DNA-binding transcription complex. An exemplary amino acid sequence is provided below. >NP_765978.1 nuclear factor of activated T-cells, cytoplasmic 1 isoform A [Homo sapiens]
  • nuclear factor of activated T cells 1 polynucleotide
  • NFATc1 polynucleotide a nucleic acid molecule encoding a NFATc1 polypeptide.
  • the NFATc1 gene encodes a protein that is involved in in the inducible expression of cytokine genes, especially IL-2 and IL-4, in T-cells.
  • An exemplary nucleic acid sequenced is provided below. >NM_172390.2 Homo sapiens nuclear factor of activated T cells 1 (NFATC1), transcript variant 1, mRNA
  • non-conservative mutations involve amino acid substitutions between different groups, for example, lysine for tryptophan, or phenylalanine for serine, etc. In this case, it is preferable for the non-conservative amino acid substitution to not interfere with, or inhibit the biological activity of, the functional variant.
  • the non-conservative amino acid substitution can enhance the biological activity of the functional variant, such that the biological activity of the functional variant is increased as compared to the wild-type protein.
  • nuclear localization sequence “nuclear localization signal,” or “NLS” refers to an amino acid sequence that promotes import of a protein into the cell nucleus.
  • Nuclear localization sequences are known in the art and described, for example, in Plank et al., International PCT application, PCT/EP2000/011690, filed November 23, 2000, published as WO/2001/038547 on May 31, 2001, the contents of which are incorporated herein by reference for their disclosure of exemplary nuclear localization sequences.
  • the NLS is an optimized NLS described, for example, by Koblan et al., Nature Biotech.2018 doi:10.1038/nbt.4172.
  • an NLS comprises the amino acid sequence [0198]
  • nucleic acid and nucleic acid molecule refer to a compound comprising a nucleobase and an acidic moiety, e.g., a nucleoside, a nucleotide, or a polymer of nucleotides.
  • polymeric nucleic acids e.g., nucleic acid molecules comprising three or more nucleotides are linear molecules, in which adjacent nucleotides are linked to each other via a phosphodiester linkage.
  • nucleic acid refers to individual nucleic acid residues (e.g.
  • nucleic acid refers to an oligonucleotide chain comprising three or more individual nucleotide residues.
  • oligonucleotide and polynucleotide can be used interchangeably to refer to a polymer of nucleotides (e.g., a string of at least three nucleotides).
  • nucleic acid encompasses RNA as well as single and/or double- stranded DNA.
  • Nucleic acids may be naturally occurring, for example, in the context of a genome, a transcript, an mRNA, tRNA, rRNA, siRNA, snRNA, a plasmid, cosmid, chromosome, chromatid, or other naturally occurring nucleic acid molecule.
  • a nucleic acid molecule may be a non-naturally occurring molecule, e.g., a recombinant DNA or RNA, an artificial chromosome, an engineered genome, or fragment thereof, or a synthetic DNA, RNA, DNA/RNA hybrid, or including non-naturally occurring nucleotides or nucleosides.
  • nucleic acid examples include nucleic acid analogs, e.g., analogs having other than a phosphodiester backbone.
  • Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g., in the case of chemically synthesized molecules, nucleic acids can comprise nucleoside analogs such as analogs having chemically modified bases or sugars, and backbone modifications. A nucleic acid sequence is presented in the 5 ⁇ to 3 ⁇ direction unless otherwise indicated.
  • a nucleic acid is or comprises natural nucleosides (e.g.
  • nucleoside analogs e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5- methylcytidine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5- propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7- deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, O(6)-methylguanine, and 2-thiocyt
  • nucleic acid programmable DNA binding protein or “napDNAbp” may be used interchangeably with “polynucleotide programmable nucleotide binding domain” to refer to a protein that associates with a nucleic acid (e.g., DNA or RNA), such as a guide nucleic acid or guide polynucleotide (e.g., gRNA), that guides the napDNAbp to a specific nucleic acid sequence.
  • a nucleic acid e.g., DNA or RNA
  • gRNA guide nucleic acid or guide polynucleotide
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable DNA binding domain.
  • the polynucleotide programmable nucleotide binding domain is a polynucleotide programmable RNA binding domain.
  • the polynucleotide programmable nucleotide binding domain is a Cas9 protein.
  • a Cas9 protein can associate with a guide RNA that guides the Cas9 protein to a specific DNA sequence that is complementary to the guide RNA.
  • the napDNAbp is a Cas9 domain, for example a nuclease active Cas9, a Cas9 nickase (nCas9), or a nuclease inactive Cas9 (dCas9).
  • Non-limiting examples of nucleic acid programmable DNA binding proteins include, Cas9 (e.g., dCas9 and nCas9), Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, Cas12i, and Cas12j/CasF.
  • Cas enzymes include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas5d, Cas5t, Cas5h, Cas5a, Cas6, Cas7, Cas8, Cas8a, Cas8b, Cas8c, Cas9 (also known as Csn1 or Csx12), Cas10, Cas10d, Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, Cas12i, Cas12j/CasF, Csy1, Csy2, Csy3, Csy4, Cse1, Cse2, Cse3, Cse4, Cse5e, Csc1, Csc2, Csa5, Csn1, Csn2, Csm1, Csm2, Csm3, Csm4, Csm5, Csm6,
  • nucleic acid programmable DNA binding proteins are also within the scope of this disclosure, although they may not be specifically listed in this disclosure. See, e.g., Makarova et al. “Classification and Nomenclature of CRISPR-Cas Systems: Where from Here?” CRISPR J. 2018 Oct;1:325-336. doi: 10.1089/crispr.2018.0033; Yan et al., “Functionally diverse type V CRISPR-Cas systems” Science.2019 Jan 4;363(6422):88-91. doi: 10.1126/science.aav7271, the entire contents of each are hereby incorporated by reference.
  • nucleobase refers to a nitrogen-containing biological compound that forms a nucleoside, which in turn is a component of a nucleotide.
  • RNA ribonucleic acid
  • DNA deoxyribonucleic acid
  • Adenine and guanine are derived from purine, and cytosine, uracil, and thymine are derived from pyrimidine.
  • DNA and RNA can also contain other (non-primary) bases that are modified.
  • Non-limiting exemplary modified nucleobases can include hypoxanthine, xanthine, 7-methylguanine, 5,6-dihydrouracil, 5- methylcytosine (m5C), and 5-hydromethylcytosine.
  • Hypoxanthine and xanthine can be created through mutagen presence, both of them through deamination (replacement of the amine group with a carbonyl group). Hypoxanthine can be modified from adenine.
  • Xanthine can be modified from guanine. Uracil can result from deamination of cytosine.
  • a “nucleoside” consists of a nucleobase and a five carbon sugar (either ribose or deoxyribose). Examples of a nucleoside include adenosine, guanosine, uridine, cytidine, 5-methyluridine (m5U), deoxyadenosine, deoxyguanosine, thymidine, deoxyuridine, and deoxycytidine.
  • nucleoside with a modified nucleobase examples include inosine (I), xanthosine (X), 7-methylguanosine (m7G), dihydrouridine (D), 5-methylcytidine (m5C), and pseudouridine ( ⁇ ).
  • a “nucleotide” consists of a nucleobase, a five carbon sugar (either ribose or deoxyribose), and at least one phosphate group.
  • nucleobase editing domain refers to a protein or enzyme that can catalyze a nucleobase modification in RNA or DNA, such as cytosine (or cytidine) to uracil (or uridine) or thymine (or thymidine), and adenine (or adenosine) to hypoxanthine (or inosine) deaminations, as well as non-templated nucleotide additions and insertions.
  • cytosine or cytidine
  • uracil or uridine
  • thymine or thymidine
  • adenine or adenosine
  • hypoxanthine or inosine
  • the nucleobase editing domain is a deaminase domain (e.g., an adenine deaminase or an adenosine deaminase; or a cytidine deaminase or a cytosine deaminase). In some embodiments, the nucleobase editing domain is more than one deaminase domain (e.g., an adenine deaminase or an adenosine deaminase and a cytidine or a cytosine deaminase). In some embodiments, the nucleobase editing domain can be a naturally occurring nucleobase editing domain.
  • the nucleobase editing domain can be an engineered or evolved nucleobase editing domain from the naturally occurring nucleobase editing domain.
  • the nucleobase editing domain can be from any organism, such as a bacterium, human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse.
  • "obtaining” as in “obtaining an agent” includes synthesizing, purchasing, or otherwise acquiring the agent.
  • a “patient” or “subject” as used herein refers to a mammalian subject or individual diagnosed with, at risk of having or developing, or suspected of having or developing a disease or a disorder.
  • the term “patient” refers to a mammalian subject with a higher than average likelihood of developing a disease or a disorder.
  • exemplary patients can be humans, non-human primates, cats, dogs, pigs, cattle, cats, horses, camels, llamas, goats, sheep, rodents (e.g., mice, rabbits, rats, or guinea pigs) and other mammalians that can benefit from the therapies disclosed herein.
  • Exemplary human patients can be male and/or female.
  • pathogenic mutation refers to a genetic alteration or mutation that increases an individual’s susceptibility or predisposition to a certain disease or disorder.
  • the pathogenic mutation comprises at least one wild- type amino acid substituted by at least one pathogenic amino acid in a protein encoded by a gene.
  • pharmaceutically-acceptable carrier means a pharmaceutically-acceptable material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, manufacturing aid (e.g., lubricant, talc magnesium, calcium or zinc stearate, or steric acid), or solvent encapsulating material, involved in carrying or transporting the compound from one site (e.g., the delivery site) of the body, to another site (e.g., organ, tissue or portion of the body).
  • a pharmaceutically acceptable carrier is “acceptable” in the sense of being compatible with the other ingredients of the formulation and not injurious to the tissue of the subject (e.g., physiologically compatible, sterile, physiologic pH, etc.).
  • composition means a composition formulated for pharmaceutical use.
  • pharmaceutical composition further comprises a pharmaceutically acceptable carrier.
  • pharmaceutical composition comprises additional agents (e.g., for specific delivery, increasing half-life, or other therapeutic compounds).
  • PDCD1 or PD-1) polypeptide is meant a protein having at least about 85% amino acid sequence identity to NCBI Accession No. AJS10360.1 or a fragment thereof. The PD-1 protein is thought to be involved in T cell function regulation during immune reactions and in tolerance conditions.
  • An exemplary B2M polypeptide sequence is provided below.
  • PDCD1 or PD-1) polynucleotide is meant a nucleic acid molecule encoding a PD-1 polypeptide.
  • the PDCD1 gene encodes an inhibitory cell surface receptor that inhibits T-cell effector functions in an antigen-specific manner.
  • An exemplary PDCD1 nucleic acid sequence is provided below.
  • PDCD1 programmed cell death 1
  • protein protein
  • peptide polypeptide
  • amide peptide bonds
  • the terms refer to a protein, peptide, or polypeptide of any size, structure, or function. Typically, a protein, peptide, or polypeptide will be at least three amino acids long.
  • a protein, peptide, or polypeptide can refer to an individual protein or a collection of proteins.
  • One or more of the amino acids in a protein, peptide, or polypeptide can be modified, for example, by the addition of a chemical entity such as a carbohydrate group, a hydroxyl group, a phosphate group, a farnesyl group, an isofarnesyl group, a fatty acid group, a linker for conjugation, functionalization, or other modifications, etc.
  • a protein, peptide, or polypeptide can also be a single molecule or can be a multi-molecular complex.
  • a protein, peptide, or polypeptide can be just a fragment of a naturally occurring protein or peptide.
  • a protein, peptide, or polypeptide can be naturally occurring, recombinant, or synthetic, or any combination thereof.
  • fusion protein refers to a hybrid polypeptide which comprises protein domains from at least two different proteins.
  • One protein can be located at the amino- terminal (N-terminal) portion of the fusion protein or at the carboxy-terminal (C-terminal) protein thus forming an amino-terminal fusion protein or a carboxy-terminal fusion protein, respectively.
  • a protein can comprise different domains, for example, a nucleic acid binding domain (e.g., the gRNA binding domain of Cas9 that directs the binding of the protein to a target site) and a nucleic acid cleavage domain, or a catalytic domain of a nucleic acid editing protein.
  • a protein comprises a proteinaceous part, e.g., an amino acid sequence constituting a nucleic acid binding domain, and an organic compound, e.g., a compound that can act as a nucleic acid cleavage agent.
  • a protein is in a complex with, or is in association with, a nucleic acid, e.g., RNA or DNA.
  • Any of the proteins provided herein can be produced by any method known in the art.
  • the proteins provided herein can be produced via recombinant protein expression and purification, which is especially suited for fusion proteins comprising a peptide linker.
  • Polypeptides and proteins disclosed herein can comprise synthetic amino acids in place of one or more naturally-occurring amino acids.
  • Such synthetic amino acids include, for example, aminocyclohexane carboxylic acid, norleucine, ⁇ -amino n-decanoic acid, homoserine, S- acetylaminomethyl-cysteine, trans-3- and trans-4-hydroxyproline, 4-aminophenylalanine, 4- nitrophenylalanine, 4-chlorophenylalanine, 4-carboxyphenylalanine, ⁇ -phenylserine ⁇ - hydroxyphenylalanine, phenylglycine, ⁇ -naphthylalanine, cyclohexylalanine, cyclohexylglycine, indoline-2-carboxylic acid, 1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid, aminomalonic acid, aminomalonic acid monoamide, N’-benzyl-N’-methyl-lysine, N’,N’-dibenzyl-
  • the polypeptides and proteins can be associated with post-translational modifications of one or more amino acids of the polypeptide constructs.
  • post-translational modifications include phosphorylation, acylation including acetylation and formylation, glycosylation (including N-linked and O-linked), amidation, hydroxylation, alkylation including methylation and ethylation, ubiquitylation, addition of pyrrolidone carboxylic acid, formation of disulfide bridges, sulfation, myristoylation, palmitoylation, isoprenylation, farnesylation, geranylation, glypiation, lipoylation and iodination.
  • promoter is meant an array of nucleic acid control sequences, which direct transcription of a nucleic acid.
  • a promoter includes necessary nucleic acid sequences near the start site of transcription.
  • a promoter also optionally includes distal enhancer or repressor sequence elements.
  • a “constitutive promoter” is a promoter that is continuously active and is not subject to regulation by external signals or molecules. In contrast, the activity of an “inducible promoter” is regulated by an external signal or molecule (for example, a transcription factor).
  • a promoter may be a CMV promoter.
  • recombinant protein or nucleic acid molecule comprises an amino acid or nucleotide sequence that comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations as compared to any naturally occurring sequence.
  • reduceds is meant a negative alteration of at least 10%, 25%, 50%, 75%, or 100%.
  • reference is meant a standard or control condition. In one embodiment, the reference is a wild-type or healthy cell.
  • a reference is an untreated cell that is not subjected to a test condition, or is subjected to placebo or normal saline, medium, buffer, and/or a control vector that does not harbor a polynucleotide of interest.
  • a "reference sequence” is a defined sequence used as a basis for sequence comparison.
  • a reference sequence may be a subset of or the entirety of a specified sequence; for example, a segment of a full-length cDNA or gene sequence, or the complete cDNA or gene sequence.
  • the length of the reference polypeptide sequence will generally be at least about 16 amino acids, at least about 20 amino acids, at least about 25 amino acids, about 35 amino acids, about 50 amino acids, or about 100 amino acids.
  • the length of the reference nucleic acid sequence will generally be at least about 50 nucleotides, at least about 60 nucleotides, at least about 75 nucleotides, and about 100 nucleotides or about 300 nucleotides or any integer thereabout or therebetween.
  • a reference sequence is a wild- type sequence of a protein of interest.
  • a reference sequence is a polynucleotide sequence encoding a wild-type protein.
  • RNA-programmable nuclease and "RNA-guided nuclease” are used with (e.g., binds or associates with) one or more RNA(s) that is not a target for cleavage.
  • an RNA-programmable nuclease when in a complex with an RNA, may be referred to as a nuclease:RNA complex.
  • the bound RNA(s) is referred to as a guide RNA (gRNA).
  • gRNAs can exist as a complex of two or more RNAs, or as a single RNA molecule.
  • gRNAs that exist as a single RNA molecule may be referred to as single-guide RNAs (sgRNAs), though "gRNA” is used interchangeably to refer to guide RNAs that exist as either single molecules or as a complex of two or more molecules.
  • gRNAs that exist as single RNA species comprise two domains: (1) a domain that shares homology to a target nucleic acid (e.g., and directs binding of a Cas9 complex to the target); and (2) a domain that binds a Cas9 protein.
  • domain (2) corresponds to a sequence known as a tracrRNA, and comprises a stem-loop structure.
  • domain (2) is identical or homologous to a tracrRNA as provided in Jinek et al., Science 337:816-821(2012), the entire contents of which is incorporated herein by reference.
  • gRNAs e.g., those including domain 2
  • U.S. Provisional Patent Application No.61/874,682 filed September 6, 2013, entitled “Switchable Cas9 Nucleases and Uses Thereof”
  • U.S. Provisional Patent Application, No. 61/874,746, filed September 6, 2013, entitled “Delivery System For Functional Nucleases” the entire contents of each are hereby incorporated by reference in their entirety.
  • a gRNA comprises two or more of domains (1) and (2), and may be referred to as an "extended gRNA.”
  • an extended gRNA will, e.g., bind two or more Cas9 proteins and bind a target nucleic acid at two or more distinct regions, as described herein.
  • the gRNA comprises a nucleotide sequence that complements a target site, which mediates binding of the nuclease/RNA complex to said target site, providing the sequence specificity of the nuclease:RNA complex.
  • the RNA-programmable nuclease is the (CRISPR-associated system) Cas9 endonuclease, for example, Cas9 (Csnl) from Streptococcus pyogenes (see, e.g., "Complete genome sequence of an Ml strain of Streptococcus pyogenes.” Ferretti J.J., et al., Proc. Natl. Acad. Sci.
  • RNA-programmable nucleases e.g., Cas9
  • Cas9 RNA:DNA hybridization to target DNA cleavage sites
  • Methods of using RNA-programmable nucleases, such as Cas9, for site-specific cleavage (e.g., to modify a genome) are known in the art (see e.g., Cong, L.
  • signal domain an intracellular portion of a protein expressed in a T cell that transduces a T cell effector function signal (e.g., an activation signal) and directs the T cell to perform a specialized function.
  • T cell activation can be induced by a number of factors, including binding of cognate antigen to the T cell receptor on the surface of T cells and binding of cognate ligand to costimulatory molecules on the surface of the T cell.
  • a T cell co- stimulatory molecule is a cognate binding partner on a T cell that specifically binds with a co- stimulatory ligand, thereby mediating a co-stimulatory response by the T cell, such as, but not limited to, proliferation.
  • Co-stimulatory molecules include, but are not limited to an MHC class I molecule.
  • the co-stimulatory domain is a CD2 cytoplasmic domain. Activation of a T cell leads to immune response, Such as T cell proliferation and differentiation (see, e.g., Smith-Garvin et al., Annu. Rev. Immunol., 27:591-619, 2009).
  • Exemplary T cell signaling domains are known in the art.
  • Non-limiting examples include the CD2, CD3 ⁇ , CD8, CD28, CD27, CD154, GITR (TNFRSF18), CD134 (OX40), and CD137 (4-1BB) signaling domains.
  • single-chain antibody or “scFv” is meant a genetically engineered molecule containing the VH and VL domains of one or more antibodies linked by a suitable polypeptide linker as a genetically fused single chain molecule (see, e.g., Bird et al., Science, 242:423-426, 1988; Huston et al., Proc. Natl. Acad. Sci., 85:5879-5883, 1988: Ahmad et al., Clin. Dev.
  • the intramolecular orientation of the VH-domain and the VL-domain in an scFv is VH-domain-linker domain-VL-domain. In some embodiments, the intramolecular orientation of the VH-domain and the VL-domain in an scFv is VL-domain-linker domain-VH-domain.
  • SNP single nucleotide polymorphism
  • SNPs can fall within coding regions of genes, non-coding regions of genes, or in the intergenic regions (regions between genes). In some embodiments, SNPs within a coding sequence do not necessarily change the amino acid sequence of the protein that is produced, due to degeneracy of the genetic code.
  • SNPs in the coding region are of two types: synonymous and nonsynonymous SNPs. Synonymous SNPs do not affect the protein sequence, while nonsynonymous SNPs change the amino acid sequence of protein. The nonsynonymous SNPs are of two types: missense and nonsense. SNPs that are not in protein-coding regions can still affect gene splicing, transcription factor binding, messenger RNA degradation, or the sequence of noncoding RNA.
  • eSNP expression SNP
  • SNV single nucleotide variant
  • a somatic single nucleotide variation e.g., associated with cancer
  • a nucleic acid molecule, polypeptide, or complex thereof e.g., a nucleic acid programmable DNA binding protein, a guide nucleic acid, and a chimeric antigen receptor
  • compound, or molecule that recognizes and binds a polypeptide and/or nucleic acid molecule of the invention but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample.
  • a chimeric antigen receptor specifically binds to a particular marker expressed on the surface of a cell, but does not bind to other polypeptides, carbohydrates, lipids, or any other compound on the surface of the cell.
  • Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having "substantial identity" to an endogenous sequence are typically capable of hybridizing with at least one strand of a double- stranded nucleic acid molecule. Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity.
  • Polynucleotides having "substantial identity" to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule.
  • hybridize is meant pair to form a double- stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency.
  • complementary polynucleotide sequences e.g., a gene described herein
  • stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate.
  • Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide.
  • Stringent temperature conditions will ordinarily include temperatures of at least about 30° C, more preferably of at least about 37° C, and most preferably of at least about 42° C.
  • Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art.
  • concentration of detergent e.g., sodium dodecyl sulfate (SDS)
  • SDS sodium dodecyl sulfate
  • Various levels of stringency are accomplished by combining these various conditions as needed.
  • hybridization will occur at 30° C in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS.
  • hybridization will occur at 37° C in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 mg/ml denatured salmon sperm DNA (ssDNA).
  • hybridization will occur at 42° C in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 ⁇ g/ml ssDNA. Useful variations on these conditions will be apparent to those skilled in the art.
  • washing steps that follow hybridization will also vary in stringency. Wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature. For example, stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate.
  • Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25° C, more preferably of at least about 42° C, and even more preferably of at least about 68° C.
  • wash steps will occur at 25° C in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS.
  • wash steps will occur at 42 C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS.
  • wash steps will occur at 68° C in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. Additional variations on these conditions will be apparent to those skilled in the art.
  • Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196:180, 1977); Grunstein and Hogness (Proc. Natl. Acad. Sci., USA 72:3961, 1975); Ausubel et al. (Current Protocols in Molecular Biology, Wiley Interscience, New York, 2001); Berger and Kimmel (Guide to Molecular Cloning Techniques, 1987, Academic Press, New York); and Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York. [0224] By “split” is meant divided into two or more fragments.
  • a “split Cas9 protein” or “split Cas9” refers to a Cas9 protein that is provided as an N- terminal fragment and a C-terminal fragment encoded by two separate nucleotide sequences.
  • the polypeptides corresponding to the N-terminal portion and the C-terminal portion of the Cas9 protein may be spliced to form a “reconstituted” Cas9 protein.
  • the Cas9 protein is divided into two fragments within a disordered region of the protein, e.g., as described in Nishimasu et al., Cell, Volume 156, Issue 5, pp.935-949, 2014, or as described in Jiang et al.
  • the protein is divided into two fragments at any C, T, A, or S within a region of SpCas9 between about amino acids A292-G364, F445-K483, or E565-T637, or at corresponding positions in any other Cas9, Cas9 variant (e.g., nCas9, dCas9), or other napDNAbp.
  • protein is divided into two fragments at SpCas9 T310, T313, A456, S469, or C574.
  • the process of dividing the protein into two fragments is referred to as “splitting” the protein.
  • the N-terminal portion of the Cas9 protein comprises amino acids 1-573 or 1-637 S. pyogenes Cas9 wild-type (SpCas9) (NCBI Reference Sequence: NC_002737.2, Uniprot Reference Sequence: Q99ZW2) and the C-terminal portion of the Cas9 protein comprises a portion of amino acids 574-1368 or 638-1368 of SpCas9 wild-type, or a corresponding position thereof.
  • the C-terminal portion of the split Cas9 can be joined with the N-terminal portion of the split Cas9 to form a complete Cas9 protein.
  • the C-terminal portion of the Cas9 protein starts from where the N-terminal portion of the Cas9 protein ends.
  • the C-terminal portion of the split Cas9 comprises a portion of amino acids (551- 651)-1368 of spCas9. “(551-651)-1368” means starting at an amino acid between amino acids 551-651 (inclusive) and ending at amino acid 1368.
  • the C-terminal portion of the split Cas9 may comprise a portion of any one of amino acid 551-1368, 552-1368, 553-1368, 554-1368, 555-1368, 556-1368, 557-1368, 558-1368, 559-1368, 560-1368, 561-1368, 562-1368, 563-1368, 564-1368, 565-1368, 566-1368, 567-1368, 568-1368, 569-1368, 570-1368, 571-1368, 572-1368, 573-1368, 574-1368, 575-1368, 576-1368, 577-1368, 578-1368, 579-1368, 580-1368, 581-1368, 582-1368, 583-1368, 584-1368, 585-1368, 586-1368, 587-1368, 588-1368, 589-1368, 590-1368, 591-1368, 592-1368, 593-1368, 594-1368, 595-1368, 596-1368
  • the C-terminal portion of the split Cas9 protein comprises a portion of amino acids 574-1368 or 638-1368 of SpCas9.
  • subject is meant a mammal, including, but not limited to, a human or non-human mammal, such as a bovine, equine, canine, ovine, or feline.
  • Subjects include livestock, domesticated animals raised to produce labor and to provide commodities, such as food, including without limitation, cattle, goats, chickens, horses, pigs, rabbits, and sheep.
  • substantially identical is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein). In one embodiment, such a sequence is at least 60%, 80% or 85%, 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison.
  • Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis.53705, BLAST, BESTFIT, COBALT, EMBOSS Needle, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications.
  • sequence analysis software for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis.53705, BLAST, BESTFIT, COBALT, EMBOSS Needle, GAP, or PILEUP/PRETTYBOX programs.
  • Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid, asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine.
  • a BLAST program may be used, with a probability score between e -3 and e -100 indicating a closely related sequence.
  • COBALT is used, for example, with the following parameters: a) alignment parameters: Gap penalties-11,-1 and End-Gap penalties-5,-1, b) CDD Parameters: Use RPS BLAST on; Blast E-value 0.003; Find conserveed columns and Recompute on, and c) Query Clustering Parameters: Use query clusters on; Word Size 4; Max cluster distance 0.8; Alphabet Regular.
  • EMBOSS Needle is used, for example, with the following parameters: a) Matrix: BLOSUM62; b) GAP OPEN: 10; c) GAP EXTEND: 0.5; d) OUTPUT FORMAT: pair; e) END GAP PENALTY: false; f) END GAP OPEN: 10; and g) END GAP EXTEND: 0.5.
  • the term “target site” refers to a sequence within a nucleic acid molecule that is modified by a nucleobase editor.
  • the target site is deaminated by a deaminase or a fusion protein comprising a deaminase (e.g., cytidine or adenine deaminase).
  • a deaminase e.g., cytidine or adenine deaminase.
  • T Cell Receptor Alpha Constant (TRAC) polypeptide is meant a protein having at least about 85% amino acid sequence identity to NCBI Accession No. P01848.2 or fragment thereof and having immunomodulatory activity. An exemplary amino acid sequence is provided below.
  • T Cell Receptor Alpha Constant (TRAC) polynucleotide is meant a nucleic acid encoding a TRAC polypeptide.
  • TRAC nucleic acid sequences are provided below.
  • T cell receptor beta constant 1 polypeptide TRBC1
  • TRBC1 T cell receptor beta constant 1 polypeptide
  • T cell receptor beta constant 1 polynucleotide (TRBC1)” is meant a nucleic acid encoding a TRBC1 polypeptide.
  • An exemplary TRBC1 nucleic acid sequence is provided below.
  • T cell receptor beta constant 2 polypeptide (TRBC2) is meant a protein having at least about 85% amino acid sequence identity to NCBI Accession No. A0A5B9 or fragment thereof and having immunomodulatory activity. An exemplary amino acid sequence is provided below.
  • T cell receptor beta constant 2 polynucleotide (TRBC2) is meant a nucleic acid encoding a TRAC polypeptide.
  • TRBC2 nucleic acid sequence is provided below.
  • TET2 T cell receptor beta locus
  • TET2 tet methylcytosine dioxygenase 2
  • TET2 gene Homo sapiens
  • transforming growth factor receptor 2 (TGFBRII) polypeptide is meant a protein having at least about 85% sequence identity to NCBI Accession No. ABG65632.1 or a fragment thereof and having immunosuppressive activity.
  • An exemplary amino acid sequence is provided below.
  • transforming growth factor receptor 2 (TGFBRII) polynucleotide is meant a nucleic acid that encodes a TGFBRII polypeptide.
  • the TGFBRII gene encodes a transmembrane protein having serine/threonine kinase activity.
  • An exemplary TGFBRII nucleic acid is provided below. >M85079.1 Human TGF-beta type II receptor mRNA, complete cds
  • T Cell Immunoreceptor with Ig and ITIM Domains (TIGIT) polypeptide is meant a protein having at least about 85% sequence identity to NCBI Accession No. ACD74757.1 or a fragment thereof and having immunomodulatory activity.
  • An exemplary TIGIT amino acid sequence is provided below. >ACD74757.1 T cell immunoreceptor with Ig and ITIM domains [Homo sapiens]
  • TIGIT T Cell Immunoreceptor With Ig And ITIM Domains (TIGIT) polynucleotide
  • TIGIT gene encodes an inhibitory immune receptor that is associated with neoplasia and T cell exhaustion.
  • transduction means to transfer a gene or genetic material to a cell via a viral vector.
  • Transformation refers to the process of introducing a genetic change in a cell produced by the introduction of exogenous nucleic acid.
  • Transfection refers to the transfer of a gene or genetical material to a cell via a chemical or physical means.
  • translocation is meant the rearrangement of nucleic acid segments between non- homologous chromosomes.
  • transmembrane domain is meant an amino acid sequence that inserts into a lipid bilayer, such as the lipid bilayer of a cell or virus or virus-like particle.
  • a transmembrane domain can be used to anchor a protein of interest (e.g., a CAR) to a membrane.
  • the transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.
  • Transmembrane domains for use in the disclosed CARs can include at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.
  • the transmembrane domain is derived from CD4, CD8 ⁇ , CD28 and CD3 ⁇ .
  • the transmembrane domain is a CD8 ⁇ hinge and transmembrane domain.
  • the terms "treat,” treating,” “treatment,” and the like refer to reducing or ameliorating a disorder and/or a symptom associated therewith or obtaining a desired pharmacologic and/or physiologic effect. It will be appreciated that, although not precluded, treating a disorder or condition does not require that the disorder, condition or symptoms associated therewith be completely eliminated. In some embodiments, the effect is therapeutic, i.e., without limitation, the effect partially or completely reduces, diminishes, abrogates, abates, alleviates, decreases the intensity of, or cures a disease and/or adverse symptom attributable to the disease.
  • the effect is preventative, i.e., the effect protects or prevents an occurrence or reoccurrence of a disease or condition.
  • the presently disclosed methods comprise administering a therapeutically effective amount of a compositions as described herein.
  • uracil glycosylase inhibitor or "UGI” is meant an agent that inhibits the uracil-excision repair system.
  • the agent is a protein or fragment thereof that binds a host uracil-DNA glycosylase and prevents removal of uracil residues from DNA.
  • a UGI is a protein, a fragment thereof, or a domain that is capable of inhibiting a uracil-DNA glycosylase base-excision repair enzyme.
  • a UGI domain comprises a wild-type UGI or a modified version thereof.
  • a UGI domain comprises a fragment of the exemplary amino acid sequence set forth below.
  • a UGI fragment comprises an amino acid sequence that comprises at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% of the exemplary UGI sequence provided below.
  • a UGI comprises an amino acid sequence that is homologous to the exemplary UGI amino acid sequence or fragment thereof, as set forth below.
  • the UGI is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5%, at least 99.9%, or 100% identical to a wild-type UGI or a UGI sequence, or portion thereof, as set forth below.
  • An exemplary UGI comprises an amino acid sequence as follows: >splP14739IUNGI_BPPB2 Uracil-DNA glycosylase inhibitor [0253] SD APEYKPWALVIQDSNGENKIKML.
  • vector refers to a means of introducing a nucleic acid sequence into a cell, resulting in a transformed cell.
  • Vectors include plasmids, transposons, phages, viruses, liposomes, and episome.
  • “Expression vectors” are nucleic acid sequences comprising the nucleotide sequence to be expressed in the recipient cell.
  • Expression vectors may include additional nucleic acid sequences to promote and/or facilitate the expression of the of the introduced sequence such as start, stop, enhancer, promoter, and secretion sequences.
  • ZAP70 T cell receptor associated protein kinase 70
  • ZAP70 polypeptide a protein having at least about 85% amino acid sequence identity to NCBI Accession No. AAH53878.1 and having kinase activity.
  • An exemplary amino acid sequence is provided below. >AAH53878.1 Zeta-chain (TCR) associated protein kinase 70kDa [Homo sapiens]
  • zeta chain of T cell receptor associated protein kinase 70 (ZAP70) polynucleotide is meant a nucleic acid encoding a ZAP70 polypeptide.
  • the ZAP70 gene encodes a tyrosine kinase that is involved in T cell development and lymphocyte activation. Absence of functional ZAP10 can lead to a severe combined immunodeficiency characterized by the lack of CD8+ T cells.
  • An exemplary ZAP70 nucleic acid sequence is provided below. >BC053878.1 Homo sapiens zeta-chain (TCR) associated protein kinase 70kDa, mRNA (cDNA clone MGC:61743 IMAGE:5757161), complete cds
  • HDR homology directed repair
  • FIGs.1A-1B are illustrations of three proteins that impact T cell function.
  • FIG.1A is an illustration of the TRAC protein, which is a key component in graft versus host disease.
  • FIG.1B is an illustration of the B2M protein, a component of the MHC class 1 antigen presenting complex present on nucleated cells that can be recognized by a host's CD8+ T cells.
  • FIG.1C is an illustration of T cell signaling that leads to expression of the PDCD1 gene, and the resulting PD-1 protein acts to inhibit the T cell signaling.
  • FIG.2 is a graph of the percentage of cells with knocked down expression of target genes after base editing. "EP” denotes electroporation.
  • FIG.3 is a graph of the percentages of the observed types of genetic modification in untransduced cells or in cells transduced with a BE4 base editing system or a Cas9 nuclease.
  • FIG.4 is a graph depicting target nucleotide modification percentage as measured by percentage of cells that are negative for target protein expression as determined by flow cytometry (FC) in cells transduced with BE4 and sgRNAs directing BE4 to splice site acceptors (SA) or donors (SD) or that generate a STOP codon.
  • FC flow cytometry
  • FIG.5 is a diagram of the BE4 system disrupting splice site acceptors (SA), splice donors (SD), or generate STOP codons.
  • FIG.6 is a chart summarizing off-target binding sites of sgRNAs employed to disrupt target genes.
  • FIG.7 is a graph summarizing flow cytometry (FC) data of the percentage of cells edited with BE4 or Cas9 that exhibit reduced protein expression. Cells were either gated to B2M or CD3, the latter being a proxy for TRAC expression.
  • FIG.8A is a scatter plot of FACS data of unedited control cells.
  • FIG.8B is a scatter plot of FACS data of cells that have been edited at the B2M, TRAC, and PD1 loci.
  • FIG.9 is a graph illustration the effectiveness of the base editing techniques described herein to modify specific genes that can negatively impact CAR-T immunotherapy.
  • FIG.10 is a diagram depicting a droplet digital PCR (ddPCR) protocol to detect and quantify gene modifications and translocations.
  • FIG.11 presents two graphs showing the data generated from next generation sequencing (NGS) analysis or ddPCR of cells edited using either the BE4 system or the Cas9 system.
  • FIG.12 is a schematic diagram that illustrates the role Cbl-b plays in suppressing T cell activation.
  • FIG.13 is a graph depicting the efficiency of Cbl-b knockdown by disruption of splice sites.
  • SA Splice Acceptor
  • SD Splice Donor
  • 2° Only secondary antibody only
  • C373 refers to a loss of function variant (C373R)
  • RL1-A::APC-A laser
  • ICS intracellular staining.
  • FIG.14 is a graph illustrating the rate of Cas12b-mediated indels in the GRIN2B and DNMT1 genes in T cells. EP denotes electroporation.
  • FIG.15 is a graph summarizing fluorescence assisted cell sorting (FACS) data of cells transduced via electroporation (EP) with bvCas12b and guide RNAs specific for TRAC, GRIN2B, and DNMT1 and gated for CD3.
  • FIG.16 is a scatter plot of fluorescence assisted cell sorting data of cells transduced CAR-P2A-mCherry lentivirus demonstrating CAR expression.
  • FIG.17 is a scatter plot of fluorescence assisted cell sorting data demonstrating CAR expression in cells transduced with a poly(1,8-octanediol citrate) (POC) lentiviral vector.
  • FACS fluorescence assisted cell sorting
  • FIG.18 is graph showing that BE4 produced efficient, durable gene knockout with high product purity.
  • FIG.19A is a representative FACS analysis showing loss of surface expression of a protein due to gene knockout by BE4 or spCas9.
  • FIG.19B is a graph show that gene knockout by BE4 or spCas9 produces loss of B2M surface expression.
  • FIG.20 is a schematic depicting the locations of B2M, TRAC, and PD-1 target sites. Translocations can be detected when B2M, TRAC, and PD-1 sequences recombine.
  • FIG.21 is a graph showing that multiplexed base editing does not significantly impair cell expansion.
  • FIG.22 is a graph showing that BE4 generated triple-edited T cells with similar on-target editing efficiency and cellular phenotype as spCas9.
  • FIG.23 depicts flow cytometry analysis showing the generation of triple-edited CD3-, B2M-, PD1- T cells.
  • FIG.24 depicts flow cytometry analysis showing the CAR expression in BE4 and Cas9 edited cells.
  • FIG.25 is a graph showing CAR-T cell killing or antigen positive cells.
  • FIG.26 are graphs showing that Cas12b and BE4 can be paired for efficient multiplex editing in T cells.
  • FIG.27 is a graph showing that Cas12b can direct insertion of a chimeric antigen receptor (CAR) into a locus by introducing into a cell a double-stranded DNA template encoding the CAR in the presence of a Cas12 nuclease and a sgRNA targeting the locus.
  • FIGS.28A-B are depictions showing base editing approaches to silence genes for engineering CAR-T cells.
  • FIG.28A illustrates targets for CAR-T editing.
  • FIG.28B shows two strategies for silencing with base editors: creating a stop codon with CBE and splice disruption with CBE.
  • FIG.29 is an illustrative cartoon representation that, in some cases, Multiple CAR-Ts required to address clonality of disease in AML.
  • FIG.30 is an illustrative cartoon representation that, in some cases, multiple edits may be required to eliminate fratricide for a T-ALL CAR-T combination.
  • FIGS.31A-B illustrate the results of experiments testing four simultaneous base edits for T-ALL; CAR-T does not impact yield compared to nuclease.
  • FIG.31A illustrates the theoretical yield in contest of quad T-ALL edits for no electroporation (no EP; dark circles), EP only (dark squares), CBE Variant 1 (light, upright triangles), CBE Variant 2 (light, upside down triangles), and Cas9 (light diamonds).
  • FIG.31B illustrates viability of cells post electroporation. For each set of results at 24 hours (hr), 48 hr, 72 hr, 96 hr, and 168 hr, results are shown from right to left as no EP, EP only, CBE variant 1, CBE variant 2, and Cas9. [0292]
  • FIG.32 illustrates that greater than 90% quad knockout by BE4.
  • FIG.33 illustrates that base editing causes no difference in cell yields. Data is: no EP (circles), EP only (squares), rBE4 (triangles), ppBE4 (upside down triangles), and Cas9 (diamonds). [0294] FIG.34 illustrates that edited CAR-Ts target CD3 and CD7 on model tumor cells.
  • FIG.35 is a schematic drawing of an exemplary CD7 CAR-T cell for targeting T-ALL Tumor cells.
  • FIG.36 is a flow chart depicting a clinical protocol for treating patients with CD7 CAR- T cells.
  • FIGS.37A-37C depict CD7 CAR-T cell production.
  • FIG.37A is a flow chart depicting a protocol for producing TALL017 heterogenous thawed CD7 CAR-T cells.
  • FIG 37B is a flow chart depicting a protocol for producing TALL083 CD7 CAR-T cells.
  • FIG.37C is a scatter plot of fluorescence assisted cell sorting data demonstrating that TALL017 CAR-T cells are highly activated post-thaw.
  • FIG.38 is a graph depicting total editing in TALL017 and TALL038 CD7 CAR-T cells by next generation sequencing (NGS).
  • NGS next generation sequencing
  • FIGS.39A-39B depict 24hr post thaw protein expression of TCR ⁇ / ⁇ , CD7, and CD52 in TALL017 and TALL038 CD7 CAR-T cells.
  • FIG.39A is a scatter plot of fluorescence assisted cell sorting data for TALL017 and TALL038 CD7 CAR-T cells.
  • FIG.39B is a graph depicting residual protein expression via FACS.
  • FIG.40 depicts a gating scheme for an identity panel.
  • FIG.41 is a graph depicting the identity of final cell product as a mix of CD2+/- and CD56+/- cells.
  • FIG.42 is a graph depicting 24h and 48h post-thaw CD7 CAR-T cell expression.
  • FIG.43 includes graphs depicting that CD25 expression post thaw is lower in TALL038 CD7 CAR-T cells compared to TALL017 CD7 CAR-T cells.
  • FIG.44 is a flow chart depicting a CD7 CAR-T bead based potency protocol for in vitro characterization.
  • FIGS.45A-45B depict that TALL038 CD7 CAR-T cells release IFN ⁇ , TNF ⁇ , and IL-2 compared in response to CD7 antigen.
  • FIG.45A is a graph depicting the release of IFN ⁇ by TALL038 CD7 CAR-T cells.
  • FIG. 45B is a graph depicting the release of TNF ⁇ , IL-10 and IL-2 by TALL038 CD7 CAR-T cells.
  • FIG.46 is a schematic depicting a co-culture protocol for measurement of CAR directed T-cell killing of tumor cells.
  • FIGS.47A-47B depict that TALL038 CD7 CAR-T cells exhibit increased CCRF when re-challenged compared to TALL017 CAR T cells.
  • FIG.47A is a graph depicting a primary challenge.
  • FIG.47B is a graph depicting a secondary challenge.
  • FIG.48 is a graph depicting Bioluminescent Radiance Data at Day 10 Post CCRF Implant / Day -1 to CD7 CAR-T Treatment (mean, SEM). Total flux is measured on a linear scale.
  • FIGS.49A-49B depict Bioluminescent Radiance Data at Day 19 Post CCRF Implant / Day 8 Post CD7 CAR-T Treatment (mean, SEM).
  • FIG.49A is a graph depicting mean tumor burden. Total flux is measured on a linear scale.
  • FIG.49B is a graph depicting mean mouse weights.
  • FIGS.50A-50B depict Bioluminescent Radiance Data at Day 38 Post CCRF Implant / Day 27 Post CD7 CAR-T Treatment (mean, SEM).
  • FIG.50A is a graph depicting mean tumor burden. Total flux is measured on a linear scale.
  • FIG.50B is a graph depicting mean tumor burden. Total flux is measured on a logarithmic scale.
  • FIGS.51A-51B depict Bioluminescent Radiance Data at Day 38 Post CCRF Implant / Day 27 Post CD7 CAR-T Treatment (individual mice).
  • FIG.51A is a graph depicting mean tumor burden. Total flux is measured on a linear scale.
  • FIG.51B is a graph depicting mean tumor burden. Total flux is measured on a logarithmic scale.
  • FIGS.52A-52B depict Bioluminescent Radiance Data at Day 38 Post CCRF Implant / Day 27 Post CD7 CAR-T Treatment (individual mice).
  • FIG.52A includes graphs depicting mean tumor burden. Total flux is measured on a linear scale (Top) and on a logarithmic scale (bottom).
  • FIG.52B includes graphs depicting mean tumor burden. Total flux is measured on a linear scale (Top) and on a logarithmic scale (bottom).
  • FIG.53 is a graph depicting editing efficiency of CD5 gRNA candidates.
  • FIG.54 is a graph depicting editing efficiency via NGS of CD5 gRNA candidates g103 and g104 in combination with BE4.
  • FIG.55 is a schematic depicting production of an exemplary CD5 CAR construct.
  • FIG.56 is a graph depicting CAR expression from a lentiviral vector (LVV) screen using CD5 gRNA candidates g103 and g104.
  • FIG.57 is a graph depicting CAR LVV expression based on hinge sequence.
  • FIGS.58A-58D are graphs depicting edited and unedited constructs are fully cytotoxic against CD5+ CCRF in live imaging cell killing assay.
  • FIGS.59A-59B depict cytokine (IFN ⁇ ) production by CD5 CAR LVV constructs using sgRNA 103 or sgRNA 104 in the presence of CD5+ CCRF-CEM leukemia cell lines.
  • FIG.59A (left) is a graph depicting IFN ⁇ production with CD5 CAR LVV (LV63-69) transduced T cells alone or with CCRF cells edited using sgRNA 103.
  • FIG.59A (right) is a graph depicting IFN ⁇ production with CD5 CAR LVV (LV63-69) transduced T cells alone or with CCRF cells edited using sgRNA 104.
  • FIG.59A (bottom) is a graph depicting IFN ⁇ production using unedited CD5 CAR LVV (LV63-69) transduced T cells or CCRF cells.
  • FIG.59B (top) is a graph depicting IFN ⁇ production with CD5 CAR LVV (LV63-69) transduced T cells alone either unedited or edited using sgRNA 103 or 104.
  • FIG.59B (bottom) is a graph depicting IFN ⁇ production with CD5 CAR LVV (LV63-69) transduced CCRF cells either unedited or edited using sgRNA 103 or 104.
  • DETAILED DESCRIPTION OF THE INVENTION [0320] The present invention features genetically modified immune cells having enhanced anti- neoplasia activity, resistance to immune suppression, and decreased risk of eliciting a graft versus host reaction or a host versus graft reaction, or a combination thereof.
  • the present invention also features methods for producing and using these modified immune cells (e.g., immune effector cells, such as T cells).
  • a subject having or having a propensity to develop graft versus host disease is administered a CAR-T cell that lacks or has reduced levels of functional TRAC.
  • a subject having or having a propensity to develop host versus graft disease is administered a CAR-T cell that lacks or has reduced levels of functional beta2 microglobulin (B2M).
  • Allogeneic CAR-T therapies were developed as a potential solution to these challenges, having similar clinical efficacy profiles to autologous products while treating many patients with cells derived from a single healthy donor, thereby substantially reducing cost of goods and lot-to-lot variability.
  • Most first-generation allogeneic CAR-Ts use nucleases to introduce two or more targeted genomic DNA double strand breaks (DSBs) in a target T cell population, relying on error-prone DNA repair to generate mutations that knock out target genes in a semi-stochastic manner.
  • DSBs genomic DNA double strand breaks
  • Such nuclease-based gene knockout strategies aim to reduce the risk of graft-versus-host-disease and host rejection of CAR-Ts.
  • BEs Base editors
  • an alternative means of producing allogeneic CAR-T cells is proposed by using base editing technology to reduce or eliminate detectable genomic rearrangements while also improving cell expansion.
  • base editing technology to reduce or eliminate detectable genomic rearrangements while also improving cell expansion.
  • concurrent modification of one or more, for example, one, two, three, four, five, six, seven, eight, night, ten, or more, genetic loci by base editing produces highly efficient gene knockouts with no detectable translocation events.
  • at least one or more genes or regulatory elements thereof are modified in an immune cell with the base editing compositions and methods provided herein.
  • the at least one or more genes or regulatory elements thereof are selected from ACAT1, ACLY, ADORA2A, AXL, B2M , BATF, BCL2L11, BTLA, CAMK2D, cAMP, CASP8, CBLB, CCR5, CD2, CD3D, CD3E, CD3G, CD4, CD5, CD7, CD8A, CD33, CD38, CD52, CD70, CD82, CD86, CD96, CD123, CD160, CD244, CD276, CDK8, CDKN1B, Chi3l1, CIITA, CISH, CSF2CSK, CTLA-4, CUL3, Cyp11a1, DCK, DGKA, DGKZ, DHX37, ELOB(TCEB2), ENTPD1 (CD39), FADD, FAS, GATA3, IL6, IL6R, IL10, IL10RA, IRF4, IRF8, JUNB, Lag3, , LAIR-1 (CD305), LDHA, L
  • the at least one or more genes or regulatory elements thereof are selected from CD3, CD5, CD7, CD33, CD123, TRAC, LAG-3, FAS, CD52, TRBC1, TRBC2, B2M, and CIITA and PD-1.
  • the modified immune cell comprises a modification in CD5 and at least one or more genes or regulatory elements thereof selected from TRAC, LAG-3, FAS, CD52, TRBC1, TRBC2, B2M, and CIITA and PD-1.
  • the modified immune cell comprises a modification in CD7 and at least one or more genes or regulatory elements thereof selected from TRAC, LAG-3, FAS, CD52, TRBC1, TRBC2, B2M, and CIITA and PD-1.
  • the modified immune cell comprises a modification in CD33 and at least one or more genes or regulatory elements thereof selected from TRAC, LAG-3, FAS, CD52, TRBC1, TRBC2, B2M, and CIITA and PD-1. In some embodiments, the modified immune cell comprises a modification in CD3 and at least one or more genes or regulatory elements thereof selected from TRAC, LAG-3, FAS, CD52, TRBC1, TRBC2, B2M, and CIITA and PD-1. In some embodiments, the modified immune cell comprises a modification in CD123 and at least one or more genes or regulatory elements thereof selected from TRAC, LAG-3, FAS, CD52, TRBC1, TRBC2, B2M, and CIITA and PD-1.
  • a universal CAR-T cell In one aspect, provided herein is a universal CAR-T cell.
  • the CAR-T cell described herein is an allogeneic cell.
  • the universal CAR-T cell is an allogeneic T cell that can be used to express a desired CAR, and can be universally applicable, irrespective of the donor and the recipient’s immunogenic compatibility.
  • An allogenic immune cell may be derived from one or more donors. In certain embodiments, the allogenic immune cell is derived from a single human donor.
  • the allogenic T cell may be derived from PBMCs of a single healthy human donor.
  • the allogenic immune cell is derived from multiple human donors.
  • an universal CAR-T cell may be generated, as described herein by using gene modification to introduce concurrent edits at multiple gene loci, for example, three, four, five, six, seven, eight, nine, ten or more genetic loci.
  • a modification, or concurrent modifications as described herein may be a genetic editing, such as a base editing, generated by a base editor.
  • the base editor may be a C base editor or A base editor.
  • base editing may be used to achieve a gene disruption, such that the gene is not expressed.
  • a modification by base editing may be used to achieve a reduction in gene expression.
  • base editor may be used to introduce a genetic modification such that the edited gene does not generate a structurally or functionally viable protein product.
  • a modification such as the concurrent modifications described herein may comprise a genetic editing, such as base editing, such that the expression or functionality of the gene product is altered in any way.
  • the expression of the gene product may be enhanced or upregulated as compared to baseline expression levels.
  • the activity or functionality of the gene product may be upregulated as a result of the base editing, or multiple base editing events acting in concert.
  • generation of universal CAR-T cell may be advantageous over autologous T cell (CAR-T), which may be difficult to generate for an urgent use.
  • Allogeneic approaches are preferred over autologous cell preparation for a number of situations related to uncertainty of engineering autologous T cells to express a CAR and finally achieving the desired cellular products for a transplant at the time of medical emergency.
  • allogeneic T cells or “off-the-shelf” T cells, it is important to carefully negotiate the host’s reactivity to the CAR-T cells (HVGD) as well as the allogeneic T cell’s potential hostility towards a host cell (GVHD).
  • base editing can be successfully used to generate multiple simultaneous gene editing events, such that (a) it is possible to reduce or down regulate expression of antigens to generate a fratricide resistant immune cell; (b) it is possible to generate a platform cell type that is devoid of or expresses low amounts of an endogenous T cell receptor, for example, a TCR alpha chain (such a via base editing of TRAC), or a TCR beta chain (such a through base editing of TRBC1/TRBC2); and/or (c) it is possible to reduce or down regulate expression of antigens that may be incompatible to a host tissue system and vice versa.
  • the methods described herein can be used to generate an autologous T cell expressing a CAR-T.
  • multiple base editing events can be accomplished in a single electroporation event, thereby reducing electroporation event associated toxicity.
  • Any known methods for incorporation of exogenous genetic material into a cell may be used to replace electroporation, and such methods known in the art are hereby contemplated for use in any of the methods described herein.
  • a subject having or having a propensity to develop a neoplasia is administered an effective amount of a modified immune effector cell (e.g., CAR-T cell) that lacks or has reduced levels of CD2 and expresses a CD2 chimeric antigen receptor containing a CD2 co-stimulatory domain.
  • a modified immune effector cell e.g., CAR-T cell
  • the CD2 modified immune cell administered to a subject is further modified in one or more genes or regulatory elements (e.g., CD52, TRAC, PD-1) with the base editing compositions and methods provided herein.
  • base editing in combination with a CAR insertion is a useful strategy for generating fratricide resistant allogeneic T cells with minimal genomic rearrangements. Multiplex editing of genes may also be useful in the creation of CAR-T cell therapies with improved therapeutic properties. This method addresses known limitations of CAR-T therapy and is a promising development towards the next generation of precision cell based therapies.
  • the base editor BE4 demonstrated high efficiency multiplex base editing of three cell surface targets in T cells (TRAC, B2M, and PD-1), knocking out gene expression by 95%, 95% and 88%, respectively, in a single electroporation to generate cell populations with high percentages of cells with reduced protein expression of B2M and CD3.
  • each of these genes may be useful in the creation of CAR-T cell therapies with improved therapeutic properties.
  • Each of the genes was silenced by a single targeted base change (C to T) without the creation of double strand breaks.
  • the BE4-treated cells also did not show any measurable translocations (large-scale genomic rearrangements), whereas cells receiving the same three edits with a nuclease did show detectable genomic rearrangements.
  • coupling nuclease-based knockout of the TRAC gene with simultaneous BE- mediated knockout of two additional genes yields a homogeneous allogeneic T cell population with minimal genomic rearrangements, enabling the targeted insertion of a CAR transgene at the TRAC locus.
  • Modification of immune cells to express a chimeric antigen receptor can enhance an immune cell’s immunoreactive activity, wherein the chimeric antigen receptor has an affinity for an epitope on an antigen, wherein the antigen is associated with an altered fitness of an organism.
  • the chimeric antigen receptor can have an affinity for an epitope on a protein expressed in a neoplastic cell.
  • the CAR- T cells can act independently of major histocompatibility complex (MHC), activated CAR-T cells can kill the neoplastic cell expressing the antigen.
  • MHC major histocompatibility complex
  • the invention provides immune effector cells that express chimeric antigen receptors that target B cells involved in an autoimmune response (e.g., B cells of a subject that express antibodies generated against the subject's own tissues).
  • Some embodiments comprise autologous immune cell immunotherapy, wherein immune cells are obtained from a subject having a disease or altered fitness characterized by cancerous or otherwise altered cells expressing a surface marker. The obtained immune cells are genetically modified to express a chimeric antigen receptor and are effectively redirected against specific antigens.
  • immune cells are obtained from a subject in need of CAR-T immunotherapy.
  • these autologous immune cells are cultured and modified shortly after they are obtained from the subject.
  • the autologous cells are obtained and then stored for future use. This practice may be advisable for individuals who may be undergoing parallel treatment that will diminish immune cell counts in the future.
  • immune cells can be obtained from a donor other than the subject who will be receiving treatment.
  • immune cells are obtained from a healthy subject or donor and are genetically modified to express a chimeric antigen receptor and are effectively redirected against specific antigens. The immune cells, after modification to express a chimeric antigen receptor, are administered to a subject for treating a neoplasia (e.g., leukemia).
  • a neoplasia e.g., leukemia
  • immune cells to be modified to express a chimeric antigen receptor can be obtained from pre-existing stock cultures of immune cells.
  • Immune cells and/or immune effector cells can be isolated or purified from a sample collected from a subject or a donor using standard techniques known in the art. For example, immune effector cells can be isolated or purified from a whole blood sample by lysing red blood cells and removing peripheral mononuclear blood cells by centrifugation. The immune effector cells can be further isolated or purified using a selective purification method that isolates the immune effector cells based on cell-specific markers such as CD25, CD3, CD4, CD8, CD28, CD45RA, or CD45RO.
  • CD25+ is used as a marker to select regulatory T cells.
  • CD4 + is used as a marker to select T cells.
  • CD8 + is used as a marker to select T cells.
  • CD4 + and CD8 + are used as a marker to select T cells.
  • CD4 + and CD25 + are used as a marker to select T cells.
  • the invention provides T cells that have targeted gene knockouts at the TCR constant region (TRAC), which is responsible for TCR ⁇ surface expression.
  • TCR ⁇ -deficient CAR T cells are compatible with allogeneic immunotherapy (Qasim et al., Sci. Transl.
  • the invention provides donor T cells selected ex vivo to recognize minor histocompatibility antigens expressed on recipient hematopoietic cells, thereby minimizing the risk of graft-versus-host disease (GVHD), which is the main cause of morbidity and mortality after transplantation (Warren et al., Blood 2010;115(19):3869-3878).
  • Another technique for isolating or purifying immune effector cells is flow cytometry.
  • a fluorescently labelled antibody with affinity for an immune effector cell marker is used to label immune effector cells in a sample.
  • a gating strategy appropriate for the cells expressing the marker is used to segregate the cells.
  • T lymphocytes can be separated from other cells in a sample by using, for example, a fluorescently labeled antibody specific for an immune effector cell marker (e.g., CD4, CD8, CD28, CD45) and corresponding gating strategy.
  • a CD45 gating strategy is employed.
  • a gating strategy for other markers specific to an immune effector cell is employed instead of, or in combination with, the CD45 gating strategy.
  • a CD4 gating strategy is employed.
  • a CD8 gating strategy is employed. In one embodiment, a CD25 gating strategy is employed. In one embodiment, a CD4 and CD8 gating strategy is employed. In one embodiment, a CD4 and CD25 gating strategy is employed. In some embodiments, a gating strategy for other markers specific to an immune effector cell is employed instead of, or in combination with, the CD4, CD25 and/or CD8 gating strategy. In some embodiments, the gating strategy as provided in FIG.40 is employed. [0339] The immune effector cells contemplated in the invention are effector T cells.
  • the effector T cell is a na ⁇ ve CD8 + T cell, a cytotoxic T cell, a natural killer T (NKT) cell, a natural killer (NK) cell, or a regulatory T (Treg) cell.
  • the effector T cells are thymocytes, immature T lymphocytes, mature T lymphocytes, resting T lymphocytes, or activated T lymphocytes.
  • the immune effector cell is a CD4 + CD8 + T cell or a CD4- CD8- T cell.
  • the immune effector cell is a T helper cell.
  • the T helper cell is a T helper 1 (Th1), a T helper 2 (Th2) cell, or a helper T cell expressing CD4 (CD4+ T cell).
  • immune effector cells are effector NK cells.
  • the immune effector cell is any other subset of T cells.
  • the modified immune effector cell may express, in addition to the chimeric antigen receptor, an exogenous cytokine, a different chimeric receptor, or any other agent that would enhance immune effector cell signaling or function. For example, co-expression of the chimeric antigen receptor and a cytokine may enhance the CAR-T cell’s ability to lyse a target cell.
  • Chimeric antigen receptors as contemplated in the present invention comprise an extracellular binding domain, a transmembrane domain, and an intracellular domain. Binding of an antigen to the extracellular binding domain can activate the CAR-T cell and generate an effector response, which includes CAR-T cell proliferation, cytokine production, and other processes that lead to the death of the antigen expressing cell.
  • the chimeric antigen receptor further comprises a linker.
  • the linker is a (GGGGS) n linker.
  • the linker is a (GGGGS) 3 linker.
  • a CAR of the present invention includes a leader peptide sequence (e.g., N-terminal to the antigen binding domain).
  • An exemplary leader peptide amino acid sequence is: [0341]
  • the extracellular binding domain of a chimeric antigen receptor contemplated herein comprises an amino acid sequence of an antibody, or an antigen binding fragment thereof, that has an affinity for a specific antigen.
  • the CAR specifically binds 5T4.
  • Exemplary anti-5T4 CARs include, without limitation, CART-5T4 (Oxford BioMedica plc) and UCART-5T4 (Cellectis SA).
  • the CAR specifically binds Alpha-fetoprotein.
  • Exemplary anti- Alpha-fetoprotein CARs include, without limitation, ET-1402 (Eureka Therapeutics Inc). [0343] In various embodiments, the CAR specifically binds Axl. Exemplary anti-Axl CARs include, without limitation, CCT-301-38 (F1 Oncology Inc). [0344] In various embodiments, the CAR specifically binds B7H6. Exemplary anti-B7H6 CARs include, without limitation, CYAD-04 (Celyad SA). [0345] In various embodiments, the CAR specifically binds BCMA.
  • Exemplary anti-BCMA CARs include, without limitation, ACTR-087 + SEA-BCMA (Seattle Genetics Inc), ALLO-715 (Cellectis SA), ARI-0002 (Institut d'Investigacions Biomediques August Pi I Sunyer), bb-2121 (bluebird bio Inc), bb-21217 (bluebird bio Inc), CART-BCMA (University of Pennsylvania), CT-053 (Carsgen Therapeutics Ltd), Descartes-08 (Cartesian Therapeutics), FCARH-143 (Juno Therapeutics Inc), ICTCAR-032 (Innovative Cellular Therapeutics Co Ltd), IM21 CART (Beijing Immunochina Medical Science & Technology Co Ltd), JCARH-125 (Memorial Sloan- Kettering Cancer Center), KITE-585 (Kite Pharma Inc), LCAR-B38M (Nanjing Legend Biotech Co Ltd), LCAR-B4822M (Nanjing Legend Biotech Co Ltd), MC
  • the CAR specifically binds CCK2R.
  • Exemplary anti-CCK2R CARs include, without limitation, anti-CCK2R CAR-T adaptor molecule (CAM) + anti-FITC CAR T-cell therapy (cancer), Endocyte/Purdue (Purdue University), [0347]
  • the CAR specifically binds a CD antigen.
  • Exemplary anti-CD antigen CARs include, without limitation, VM-802 (ViroMed Co Ltd).
  • the CAR specifically binds CD123.
  • Exemplary anti-CD123 CARs include, without limitation, MB-102 (Fortress Biotech Inc), RNA CART123 (University of Pennsylvania), SFG–iMC-CD123.zeta (Bellicum Pharmaceuticals Inc), and UCART-123 (Cellectis SA). [0349] In various embodiments, the CAR specifically binds CD133. Exemplary anti-CD133 CARs include, without limitation, KD-030 (Nanjing Kaedi Biotech Inc). [0350] In various embodiments, the CAR specifically binds CD138. Exemplary anti-CD138 CARs include, without limitation, ATLCAR.CD138 (UNC Lineberger Comprehensive Cancer Center) and CART-138 (Chinese PLA General Hospital).
  • the CAR specifically binds CD171.
  • exemplary anti-CD171 CARs include, without limitation, JCAR-023 (Juno Therapeutics Inc).
  • the CAR specifically binds CD19.
  • Exemplary anti-CD19 CARs include, without limitation, 1928z-41BBL (Memorial Sloan-Kettering Cancer Center), 1928z- E27 (Memorial Sloan-Kettering Cancer Center), 19-28z-T2 (Guangzhou Institutes of Biomedicine and Health), 4G7-CARD (University College London), 4SCAR19 (Shenzhen Geno-Immune Medical Institute), ALLO-501 (Pfizer Inc), ATA-190 (QIMR Berghofer Medical Research Institute), AUTO-1 (University College London), AVA-008 (Avacta Ltd), axicabtagene ciloleucel (Kite Pharma Inc), BG-T19 (Guangzhou Bio-gene Technology Co Ltd), BinD-19 (Shenzhen BinDeBio Ltd.), BPX-401 (Bellicum Pharmaceuticals Inc), CAR19h28TM41BBz (Westmead Institute for Medical Research), C-CAR-011 (Chinese PLA General Hospital), CD19CART (Innovative Cellular Therapeutic
  • the CAR specifically binds CD2.
  • Exemplary anti-CD2 CARs include, without limitation, UCART-2 (Wugen Inc).
  • the CAR specifically binds CD20.
  • Exemplary anti-CD20 CARs include, without limitation, ACTR-087 (National University of Singapore), ACTR-707 (Unum Therapeutics Inc), CBM-C20.1 (Chinese PLA General Hospital), MB-106 (Fred Hutchinson Cancer Research Center), and MB-CART20.1 (Miltenyi Biotec GmbH).
  • the CAR specifically binds CD22.
  • Exemplary anti-CD22 CARs include, without limitation, anti-CD22 CAR T-cell therapy (B-cell acute lymphoblastic leukemia), University of Pennsylvania (University of Pennsylvania), CD22-CART (Shanghai Unicar-Therapy Bio-medicine Technology Co Ltd), JCAR-018 (Opus Bio Inc), MendCART (Shanghai Hrain Biotechnology), and UCART-22 (Cellectis SA).
  • the CAR specifically binds CD30.
  • Exemplary anti-CD30 CARs include, without limitation, ATLCAR.CD30 (UNC Lineberger Comprehensive Cancer Center), CBM-C30.1 (Chinese PLA General Hospital), and Hu30-CD28zeta (National Cancer Institute).
  • the CAR specifically binds CD33.
  • Exemplary anti-CD33 CARs include, without limitation, anti-CD33 CAR gamma delta T-cell therapy (acute myeloid leukemia), TC BioPharm/University College London (University College London), CAR33VH (Opus Bio Inc), CART-33 (Chinese PLA General Hospital), CIK-CAR.CD33 (Formula Pharmaceuticals Inc), UCART-33 (Cellectis SA), and VOR-33 (Columbia University).
  • the CAR specifically binds CD38.
  • Exemplary anti-CD38 CARs include, without limitation, UCART-38 (Cellectis SA).
  • the CAR specifically binds CD38 A2.
  • Exemplary anti-CD38 A2 CARs include, without limitation, T-007 (TNK Therapeutics Inc).
  • the CAR specifically binds CD4.
  • Exemplary anti-CD4 CARs include, without limitation, CD4CAR (iCell Gene Therapeutics).
  • the CAR specifically binds CD44.
  • Exemplary anti-CD44 CARs include, without limitation, CAR-CD44v6 (Istituto Scientifico H San Raffaele).
  • the CAR specifically binds CD5.
  • Exemplary anti-CD5 CARs include, without limitation, CD5CAR (iCell Gene Therapeutics).
  • CD5 CAR amino acid sequences are provided below: >5CAR-CH3-CD28TM-CD28-CD3Z >5CAR-CD8aH-CD28TM-CD28-CD3Z >5CAR-CD28H-CD28TM-CD28-CD3Z >5CAR-CH3-CD8aTM-41BB-CD3Z >5CAR-CD8aH-CD8aTM-41BB-CD3Z 481 TYDALHMQALPPRX 494 [0363] In various embodiments, the CAR specifically binds CD7.
  • Exemplary anti-CD7 CARs include, without limitation, CAR-pNK (PersonGen Biomedicine (Suzhou) Co Ltd), and CD7.CAR/28zeta CAR T cells (Baylor College of Medicine), UCART7 (Washington University in St Louis).
  • An exemplary CD7 CAR amino acid sequence is as follows: >7CAR8 [0364]
  • the CAR specifically binds CDH17.
  • Exemplary anti-CDH17 CARs include, without limitation, ARB-001.T (Arbele Ltd).
  • the CAR specifically binds CEA.
  • Exemplary anti-CEA CARs include, without limitation, HORC-020 (HumOrigin Inc).
  • the CAR specifically binds Chimeric TGF-beta receptor (CTBR).
  • CTBR Chimeric TGF-beta receptor
  • Exemplary anti-Chimeric TGF-beta receptor (CTBR) CARs include, without limitation, CAR-CTBR T cells (bluebird bio Inc).
  • CAR-CTBR T cells bluebird bio Inc.
  • the CAR specifically binds Claudin18.2.
  • Exemplary anti- Claudin18.2 CARs include, without limitation, CAR-CLD18 T-cells (Carsgen Therapeutics Ltd) and KD-022 (Nanjing Kaedi Biotech Inc).
  • the CAR specifically binds CLL1.
  • Exemplary anti-CLL1 CARs include, without limitation, KITE-796 (Kite Pharma Inc).
  • the CAR specifically binds DLL3.
  • Exemplary anti-DLL3 CARs include, without limitation, AMG-119 (Amgen Inc).
  • the CAR specifically binds Dual BCMA/TACI (APRIL).
  • Exemplary anti-Dual BCMA/TACI (APRIL) CARs include, without limitation, AUTO-2 (Autolus Therapeutics Limited).
  • the CAR specifically binds Dual CD19/CD22.
  • Exemplary anti- Dual CD19/CD22 CARs include, without limitation, AUTO-3 (Autolus Therapeutics Limited) and LCAR-L10D (Nanjing Legend Biotech Co Ltd).
  • the CAR specifically binds CD19.
  • the CAR specifically binds Dual CLL1/CD33.
  • Exemplary anti- Dual CLL1/CD33 CARs include, without limitation, ICG-136 (iCell Gene Therapeutics).
  • the CAR specifically binds Dual EpCAM/CD3.
  • Exemplary anti-Dual EpCAM/CD3 CARs include, without limitation, IKT-701 (Icell Kealex Therapeutics).
  • the CAR specifically binds Dual ErbB / 4ab.
  • Exemplary anti- Dual ErbB/4ab CARs include, without limitation, LEU-001 (King's College London).
  • the CAR specifically binds Dual FAP/CD3.
  • Exemplary anti- Dual FAP/CD3 CARs include, without limitation, IKT-702 (Icell Kealex Therapeutics). [0377] In various embodiments, the CAR specifically binds EBV. Exemplary anti-EBV CARs include, without limitation, TT-18 (Tessa Therapeutics Pte Ltd). [0378] In various embodiments, the CAR specifically binds EGFR.
  • anti-EGFR CARs include, without limitation, anti-EGFR CAR T-cell therapy (CBLB MegaTAL, cancer), bluebird bio (bluebird bio Inc), anti-EGFR CAR T-cell therapy expressing CTLA-4 checkpoint inhibitor + PD-1 checkpoint inhibitor mAbs (EGFR-positive advanced solid tumors), Shanghai Cell Therapy Research Institute (Shanghai Cell Therapy Research Institute), CSG-EGFR (Carsgen Therapeutics Ltd), and EGFR-IL12-CART (Pregene (Shenzhen) Biotechnology Co Ltd). [0379] In various embodiments, the CAR specifically binds EGFRvIII.
  • Exemplary anti- EGFRvIII CARs include, without limitation, KD-035 (Nanjing Kaedi Biotech Inc) and UCART- EgfrVIII (Cellectis SA). [0380] In various embodiments, the CAR specifically binds Flt3. Exemplary anti-Flt3 CARs include, without limitation, ALLO-819 (Pfizer Inc) and AMG-553 (Amgen Inc). [0381] In various embodiments, the CAR specifically binds Folate receptor. Exemplary anti- Folate receptor CARs include, without limitation, EC17/CAR T (Endocyte Inc). [0382] In various embodiments, the CAR specifically binds G250.
  • Exemplary anti-G250 CARs include, without limitation, autologous T-lymphocyte cell therapy (G250-scFV-transduced, renal cell carcinoma), Erasmus Medical Center (Daniel den Hoed Cancer Center). [0383] In various embodiments, the CAR specifically binds GD2.
  • Exemplary anti-GD2 CARs include, without limitation, 1RG-CART (University College London), 4SCAR-GD2 (Shenzhen Geno-Immune Medical Institute), C7R-GD2.CART cells (Baylor College of Medicine), CMD- 501 (Baylor College of Medicine), CSG-GD2 (Carsgen Therapeutics Ltd), GD2-CART01 (Bambino Gesu Hospital and Research Institute), GINAKIT cells (Baylor College of Medicine), iC9-GD2-CAR-IL-15 T-cells (UNC Lineberger Comprehensive Cancer Center), and IKT-703 (Icell Kealex Therapeutics). [0384] In various embodiments, the CAR specifically binds GD2 and MUC1.
  • Exemplary anti- GD2/MUC1 CARs include, without limitation, PSMA CAR-T (University of Pennsylvania). [0385] In various embodiments, the CAR specifically binds GPC3. Exemplary anti-GPC3 CARs include, without limitation, ARB-002.T (Arbele Ltd), CSG-GPC3 (Carsgen Therapeutics Ltd), GLYCAR (Baylor College of Medicine), and TT-14 (Tessa Therapeutics Pte Ltd). [0386] In various embodiments, the CAR specifically binds Her2.
  • Exemplary anti-Her2 CARs include, without limitation, ACTR-087 + trastuzumab (Unum Therapeutics Inc), ACTR-707 + trastuzumab (Unum Therapeutics Inc), CIDeCAR (Bellicum Pharmaceuticals Inc), MB-103 (Mustang Bio Inc), RB-H21 (Refuge Biotechnologies Inc), and TT-16 (Baylor College of Medicine).
  • the CAR specifically binds IL13R.
  • Exemplary anti-IL13R CARs include, without limitation, MB-101 (City of Hope) and YYB-103 (YooYoung Pharmaceuticals Co Ltd).
  • the CAR specifically binds integrin beta-7.
  • Exemplary anti- integrin beta-7 CARs include, without limitation, MMG49 CAR T-cell therapy (Osaka University). [0389] In various embodiments, the CAR specifically binds LC antigen. Exemplary anti-LC antigen CARs include, without limitation, VM-803 (ViroMed Co Ltd) and VM-804 (ViroMed Co Ltd). [0390] In various embodiments, the CAR specifically binds mesothelin.
  • Exemplary anti- mesothelin CARs include, without limitation, CARMA-hMeso (Johns Hopkins University), CSG-MESO (Carsgen Therapeutics Ltd), iCasp9M28z (Memorial Sloan-Kettering Cancer Center), KD-021 (Nanjing Kaedi Biotech Inc), m-28z-T2 (Guangzhou Institutes of Biomedicine and Health), MesoCART (University of Pennsylvania), meso-CAR-T + PD-78 (MirImmune LLC), RB-M1 (Refuge Biotechnologies Inc), and TC-210 (TCR2 Therapeutics Inc). [0391] In various embodiments, the CAR specifically binds MUC1.
  • anti-MUC1 CARs include, without limitation, anti-MUC1 CAR T-cell therapy + PD-1 knockout T cell therapy (esophageal cancer/NSCLC), Guangzhou Anjie Biomedical Technology/University of Technology Sydney (Guangzhou Anjie Biomedical Technology Co LTD), ICTCAR-043 (Innovative Cellular Therapeutics Co Ltd), ICTCAR-046 (Innovative Cellular Therapeutics Co Ltd), P-MUC1C-101 (Poseida Therapeutics Inc), and TAB-28z (OncoTab Inc). [0392] In various embodiments, the CAR specifically binds MUC16.
  • Exemplary anti-MUC16 CARs include, without limitation, 4H1128Z-E27 (Eureka Therapeutics Inc) and JCAR-020 (Memorial Sloan-Kettering Cancer Center). [0393] In various embodiments, the CAR specifically binds nfP2X7. Exemplary anti-nfP2X7 CARs include, without limitation, BIL-022c (Biosceptre International Ltd). [0394] In various embodiments, the CAR specifically binds PSCA. Exemplary anti-PSCA CARs include, without limitation, BPX-601 (Bellicum Pharmaceuticals Inc). [0395] In various embodiments, the CAR specifically binds PSMA.
  • the CAR specifically binds ROR1.
  • Exemplary anti-ROR1 CARs include, without limitation, JCAR-024 (Fred Hutchinson Cancer Research Center).
  • Exemplary anti-ROR2 CARs include, without limitation, CCT-301-59 (F1 Oncology Inc).
  • the CAR specifically binds SLAMF7.
  • Exemplary anti- SLAMF7 CARs include, without limitation, UCART-CS1 (Cellectis SA).
  • the CAR specifically binds TRBC1.
  • Exemplary anti-TRBC1 CARs include, without limitation, AUTO-4 (Autolus Therapeutics Limited).
  • the CAR specifically binds TRBC2.
  • Exemplary anti-TRBC2 CARs include, without limitation, AUTO-5 (Autolus Therapeutics Limited).
  • the CAR specifically binds TSHR.
  • Exemplary anti-TSHR CARs include, without limitation, ICTCAT-023 (Innovative Cellular Therapeutics Co Ltd).
  • the CAR specifically binds VEGFR-1.
  • Exemplary anti- VEGFR-1 CARs include, without limitation, SKLB-083017 (Sichuan University).
  • the CAR is AT-101 (AbClon Inc); AU-101, AU-105, and AU- 180 (Aurora Biopharma Inc); CARMA-0508 (Carisma Therapeutics); CAR-T (Fate Therapeutics Inc); CAR-T (Cell Design Labs Inc); CM-CX1 (Celdara Medical LLC); CMD-502, CMD-503, and CMD-504 (Baylor College of Medicine); CSG-002 and CSG-005 (Carsgen Therapeutics Ltd); ET-1501, ET-1502 , and ET-1504 (Eureka Therapeutics Inc); FT-61314 (Fate Therapeutics Inc); GB-7001 (Shanghai GeneChem Co Ltd); IMA-201 (Immatics Biotechnologies GmbH); IMM-005 and IMM-039 (Immunome Inc); ImmuniCAR (TC BioPharm Ltd); NT-0004 and NT- 0009 (BioNTech Cell and Gene Therapies GmbH), OGD-203 (
  • nucleic acids that encode the chimeric antigen receptors described herein.
  • the nucleic acid is isolated or purified. Delivery of the nucleic acids ex vivo can be accomplished using methods known in the art. For example, immune cells obtained from a subject may be transformed with a nucleic acid vector encoding the chimeric antigen receptor. The vector may then be used to transform recipient immune cells so that these cells will then express the chimeric antigen receptor. Efficient means of transforming immune cells include transfection and transduction. Such methods are well known in the art.
  • nucleic acid molecule encoding the chimeric antigen receptor (and the nucleic acid(s) encoding the base editor) can be found in International Application No. PCT/US2009/040040 and US Patent Nos.8,450,112; 9,132,153; and 9,669,058, each of which is incorporated herein in its entirety. Additionally, those methods and vectors described herein for delivering the nucleic acid encoding the base editor are applicable to delivering the nucleic acid encoding the chimeric antigen receptor.
  • Extracellular Binding Domain [0406]
  • the chimeric antigen receptors of the invention include an extracellular binding domain.
  • the extracellular binding domain of a chimeric antigen receptor contemplated herein comprises an amino acid sequence of an antibody, or an antigen binding fragment thereof, that has an affinity for a specific antigen.
  • the antigen is CD3.
  • the antigen is CD5.
  • the antigen is CD7.
  • the antigen is CD33.
  • the antigen is CD123.
  • the chimeric antigen receptor comprises an amino acid sequence of an antibody.
  • the chimeric antigen receptor comprises the amino acid sequence of an antigen binding fragment of an antibody. The antibody (or fragment thereof) portion of the extracellular binding domain recognizes and binds to an epitope of an antigen.
  • the antibody fragment portion of a chimeric antigen receptor is a single chain variable fragment (scFv).
  • scFv comprises the light and variable fragments of a monoclonal antibody.
  • the antibody fragment portion of a chimeric antigen receptor is a multichain variable fragment, which can comprise more than one extracellular binding domains and therefore bind to more than one antigen simultaneously.
  • a hinge region may separate the different variable fragments, providing necessary spatial arrangement and flexibility.
  • the antibody portion of a chimeric antigen receptor comprises at least one heavy chain and at least one light chain.
  • the antibody portion of a chimeric antigen receptor comprises two heavy chains, joined by disulfide bridges and two light chains, wherein the light chains are each joined to one of the heavy chains by disulfide bridges.
  • the light chain comprises a constant region and a variable region.
  • Complementarity determining regions residing in the variable region of an antibody are responsible for the antibody’s affinity for a particular antigen.
  • antibodies that recognize different antigens comprise different complementarity determining regions.
  • Complementarity determining regions reside in the variable domains of the extracellular binding domain, and variable domains (i.e., the variable heavy and variable light) can be linked with a linker or, in some embodiments, with disulfide bridges.
  • variable heavy chain and variable light chain are linked by a (GGGGS) n linker, wherein the n is an integer from 1 to 10.
  • the linker is a (GGGGS)3 linker.
  • the antigen recognized and bound by the extracellular domain is a protein or peptide, a nucleic acid, a lipid, or a polysaccharide.
  • Antigens can be heterologous, such as those expressed in a pathogenic bacteria or virus. Antigens can also be synthetic; for example, some individuals have extreme allergies to synthetic latex and exposure to this antigen can result in an extreme immune reaction.
  • the antigen is autologous, and is expressed on a diseased or otherwise altered cell.
  • the antigen is expressed in a neoplastic cell.
  • the neoplastic cell is a solid tumor cell.
  • the neoplastic cell is a liquid tumor cell.
  • the neoplastic cell is a hematological cancer, such as a B cell cancer.
  • the B cell cancer is a lymphoma or a leukemia.
  • a liquid cancer to be treated with the methods described herein can be, for example, a leukemia.
  • the leukemia comprises a pre-leukemia.
  • the leukemia is an acute leukemia.
  • Acute leukemias include, for example, an acute myeloid leukemia (AML).
  • Acute leukemias also include, for example, an acute lymphoid leukemia or an acute lymphocytic leukemia (ALL); ALL includes B-lineage ALL; T-lineage ALL; and T-cell acute lymphocytic leukemia (T-ALL).
  • ALL acute lymphoid leukemia or an acute lymphocytic leukemia
  • ALL includes B-lineage ALL; T-lineage ALL; and T-cell acute lymphocytic leukemia (T-ALL).
  • Nonlimiting examples of neoplasias include T-cell acute lymphoblastic leukemia (T- ALL), mycosis fungoides (MF), Sézary syndrome (SS), Peripheral T/NK ⁇ cell lymphoma, Anaplastic large cell lymphoma ALK + , Primary cutaneous T ⁇ cell lymphoma, T ⁇ cell large granular lymphocytic leukemia, Angioimmunoblastic T/NK ⁇ cell lymphoma, Hepatosplenic T ⁇ cell lymphoma, Primary cutaneous CD30 + lymphoproliferative disorders, Extranodal NK/T ⁇ cell lymphoma, Adult T ⁇ cell leukemia/lymphoma, T ⁇ cell prolymphocytic leukemia, Subcutaneous panniculitis ⁇ like T-cell lymphoma, Primary cutaneous gamma ⁇ delta T-cell lymphoma, Aggressive NK ⁇ cell leukemia, and Enteropathy ⁇ associated T ⁇ cell lymphoma.
  • T- ALL T-
  • the neoplasia is T-cell acute lymphoblastic leukemia (T-ALL). In some embodiments, the neoplasia is acute myelogenous leukemia (AML).
  • T-ALL T-cell acute lymphoblastic leukemia
  • AML acute myelogenous leukemia
  • Antibody-antigen interactions are noncovalent interactions resulting from hydrogen bonding, electrostatic or hydrophobic interactions, or from van der Waals forces.
  • the antibody-antigen interaction can also be characterized based on the dissociation of the antigen from the antibody.
  • the chimeric antigen receptors of the invention include a transmembrane domain.
  • the transmembrane domain of the chimeric antigen receptors described herein spans the CAR-T cells lipid bilayer cellular membrane and separates the extracellular binding domain and the intracellular signaling domain. In some embodiments, this domain is derived from other receptors having a transmembrane domain, while in other embodiments, this domain is synthetic. In some embodiments, the transmembrane domain may be derived from a non-human transmembrane domain and, in some embodiments, humanized.
  • the transmembrane domain is derived from another transmembrane protein expressed in a human immune effector cell.
  • examples of such proteins include, but are not limited to, subunits of the T cell receptor (TCR) complex, PD1, or any of the Cluster of Differentiation proteins, or other proteins, that are expressed in the immune effector cell and that have a transmembrane domain.
  • TCR T cell receptor
  • PD1 T cell receptor
  • the transmembrane domain will be synthetic, and such sequences will comprise many hydrophobic residues.
  • Transmembrane domains for use in the disclosed CARs can include at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.
  • the transmembrane domain is derived from CD4, CD8 ⁇ , CD28 or CD3 ⁇ .
  • the transmembrane domain is a CD28 transmembrane domain.
  • the transmembrane domain is a CD8 ⁇ transmembrane domain.
  • the transmembrane domain is a CD8 ⁇ hinge and transmembrane domain.
  • the CD8 ⁇ hinge and transmembrane domain is at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to an exemplary amino acid sequence as provided below:
  • the chimeric antigen receptor is designed, in some embodiments, to comprise a spacer between the transmembrane domain and the extracellular domain, the intracellular domain, or both. Such spacers can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids in length.
  • the spacer can be 20, 30, 40, 50, 60, 70, 80, 90, or 100 amino acids in length. In still other embodiments the spacer can be between 100 and 500 amino acids in length.
  • the spacer can be any polypeptide that links one domain to another and are used to position such linked domains to enhance or optimize chimeric antigen receptor function.
  • the hinge/spacer is selected from CH3, CD8 ⁇ , or CD28.
  • Intracellular Signaling Domain [0417]
  • the chimeric antigen receptors of the invention include an intracellular signaling domain.
  • the intracellular signaling domain is the intracellular portion of a protein expressed in a T cell that transduces a T cell effector function signal (e.g., an activation signal) and directs the T cell to perform a specialized function.
  • T cell activation can be induced by a number of factors, including binding of cognate antigen to the T cell receptor on the surface of T cells and binding of cognate ligand to costimulatory molecules on the surface of the T cell.
  • a T cell co- stimulatory molecule is a cognate binding partner on a T cell that specifically binds with a co- stimulatory ligand, thereby mediating a co-stimulatory response by the T cell, such as, but not limited to, proliferation.
  • Co-stimulatory molecules include, but are not limited to an MHC class I molecule.
  • Activation of a T cell leads to immune response, Such as T cell proliferation and differentiation (see, e.g., Smith-Garvin et al., Annu. Rev. Immunol., 27:591-619, 2009).
  • Exemplary T cell signaling domains are known in the art. Non-limiting examples include the CD3 ⁇ , CD8, CD28, CD27, CD154, GITR (TNFRSF18), CD134 (OX40), and CD137 (4-1BB) signaling domains.
  • the intracellular signaling domain of the chimeric antigen receptor contemplated herein comprises a primary signaling domain.
  • the chimeric antigen receptor comprises the primary signaling domain and a secondary, or co-stimulatory, signaling domain.
  • the primary signaling domain comprises one or more immunoreceptor tyrosine-based activation motifs, or ITAMs.
  • the primary signaling domain comprises more than one ITAM.
  • ITAMs incorporated into the chimeric antigen receptor may be derived from ITAMs from other cellular receptors.
  • the primary signaling domain comprising an ITAM may be derived from subunits of the TCR complex, such as CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , or CD3 ⁇ (see FIG.1A).
  • the primary signaling domain comprising an ITAM may be derived from FcR ⁇ , FcR ⁇ , CD5, CD22, CD79a, CD79b, or CD66d.
  • the primary signaling domain is selected from the group consisting of CD8, CD28, CD134 (OX40), CD137 (4-1BB), and CD3 ⁇ .
  • the primary signaling domain is a CD3 ⁇ signaling domain.
  • the CD3 ⁇ signaling domain is at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to an exemplary amino acid sequence as provided below: [0421]
  • the primary signaling domain is a CD134 (OX40) signaling domain.
  • the CD134 (OX40) signaling domain is at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to an exemplary amino acid sequence as provided below: [0422]
  • the secondary, or co-stimulatory, signaling domain is derived from 4-1BB, CD2, CD4, CD28, CDS, CD8 ⁇ , CD83, CD134, CD137, ICOS, or CD154.
  • the secondary signaling domain is a CD28 signaling domain.
  • the CD28 signaling domain is at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to an exemplary amino acid sequence as provided below: [0423]
  • the secondary signaling domain is a CD137 (4-1BB) signaling domain.
  • the CD137 (4-1BB) signaling domain is at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to an exemplary amino acid sequence as provided below:
  • the CD137 (4-1BB) signaling domain is at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to an exemplary amino acid sequence as provided below: .
  • the CAR comprises one or more signaling domains. In some embodiments, the CAR comprises a 4-1BB signaling domain and a CD3 ⁇ signaling domain. In some embodiments, the CAR comprises a CD28 signaling domain and a CD3 ⁇ signaling domain. Editing of Target Genes in Immune Cells [0426]
  • the present invention provides for immune cells comprising a chimeric antigen (CAR) and one or more edited genes, one or more regulatory elements thereof, or combinations thereof, wherein expression of the edited gene is either knocked out or knocked down.
  • the immune cell comprises a CAR and an altered endogenous gene that provides resistance to fratricide, enhances immune cell function, resistance to immunosuppression or inhibition, or a combination thereof.
  • the immune cell is a T cell.
  • the immune cell is a CAR-T cell.
  • the immune cell is a NK cell.
  • each edited gene may comprise a single base edit.
  • each edited gene may comprise multiple base edits at different regions of the gene.
  • a single modification event (such as electroporation), may introduce one or more gene edits.
  • At least one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty or more edits may be introduced in one or more genes simultaneously.
  • an immune cell including but not limited to any immune cell comprising an edited gene selected from any of the aforementioned gene edits, can be edited to generate mutations in other genes that enhance the CAR-T’s function or reduce immunosuppression or inhibition of the cell.
  • the CAR-T cells have increased fratricide resistance as compared to a similar CAR-T cell but without further having the one or more edited genes as described herein.
  • the CAR-T cells have reduced immunogenicity as compared to a similar CAR-T cell but without further having the one or more edited genes as described herein. In some embodiments, the CAR-T cells have lower activation threshold as compared to a similar CAR-T but without further having the one or more edited genes as described herein. In some embodiments, the CAR-T cells have increased anti-neoplasia activity as compared to a similar CAR-T cell but without further having the one or more edited genes as described herein. [0429] In some embodiments, provided herein is an immune cell with at least one modification in an endogenous gene or regulatory elements thereof.
  • the immune cell may comprise a further modification in at least one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty or more endogenous genes or regulatory elements thereof.
  • the one or more genes, or one or more regulatory elements thereof, or combinations thereof may be selected from a group consisting of: CD3 antigen (CD3); CD5 antigen (CD5); CD7 antigen (CD7); CD33 antigen (CD33); CD52 antigen (CD52); CD123 antigen (CD123); T cell receptor alpha constant (TRAC); Programmed cell death 1 (PDCD1 or PD-1); Fas cell surface death receptor (FAS); Lymphocyte-activation gene 3 (LAG-3); Class II Major Histocompatibility Complex Transactivator (CIITA); T Cell Receptor Beta Constant 1 (TRBC1); T Cell Receptor Beta Constant 2 (TRBC2); and beta-2 microglobulin (B2M).
  • CD3 antigen CD3 antigen
  • CD5 antigen CD5 antigen
  • CD7 antigen CD7 antigen
  • CD33 antigen CD33
  • CD52 antigen CD52
  • CD123 antigen CD123
  • T cell receptor alpha constant TRAC
  • PDCD1 or PD-1
  • CD3, CD5, CD7, CD33 or CD123 is edited.
  • the immune cell comprises an edited CD3 gene, and additionally, at least one edited gene.
  • the immune cell comprises an edited CD5 gene, and additionally, at least one edited gene.
  • the immune cell comprises an edited CD7 gene, and additionally, at least one edited gene.
  • the immune cell comprises an edited CD33 gene, and additionally, at least one edited gene.
  • the immune cell comprises an edited CD123 gene, and additionally, at least one edited gene. The at least one edited gene may be selected from the list of genes mentioned in the preceding paragraphs.
  • CD3, CD5, CD7, CD33 or CD123 is edited in combination with one or more of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the modified immune cell comprises mutations in one or more of CD5, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1, or a combination thereof.
  • the modified immune cell comprises mutations in two, three, four, five, six, seven, eight, nine or ten of CD5, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the modified immune cell comprises a mutation in CD5 and mutations in one or more of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1, or a combination thereof.
  • the modified immune cell comprises mutations in CD5, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the modified immune cell comprises mutations in one or more of CD7, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1, or a combination thereof.
  • the modified immune cell comprises mutations in two, three, four, five, six, seven, eight, nine or ten of CD7, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the modified immune cell comprises a mutation in CD7 and mutations in one or more of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1, or a combination thereof.
  • the modified immune cell comprises mutations in CD7, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the modified immune cell comprises mutations in one or more of CD3, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1, or a combination thereof. In various embodiments, the modified immune cell comprises mutations in two, three, four, five, six, seven, eight, nine or ten of CD3, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1. In various embodiments, the modified immune cell comprises a mutation in CD3 and mutations in one or more of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1, or a combination thereof.
  • the modified immune cell comprises mutations in CD3, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the modified immune cell comprises mutations in one or more of CD33, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1, or a combination thereof.
  • the modified immune cell comprises mutations in two, three, four, five, six, seven, eight, nine or ten of CD33, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the modified immune cell comprises a mutation in CD33 and mutations in one or more of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1, or a combination thereof.
  • the modified immune cell comprises mutations in CD33, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the modified immune cell comprises mutations in one or more of CD123, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1, or a combination thereof.
  • the modified immune cell comprises mutations in two, three, four, five, six, seven, eight, nine or ten of CD123, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the modified immune cell comprises a mutation in CD123 and mutations in one or more of TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1, or a combination thereof.
  • the modified immune cell comprises mutations in CD123, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and PD1.
  • the at least one modification is a single nucleobase modification.
  • the altered endogenous gene may be created by base editing.
  • the base editing may reduce or attenuate the gene expression.
  • the base editing may reduce or attenuate the gene activation.
  • the base editing may reduce or attenuate the functionality of the gene product.
  • the base editing may activate or enhance the gene expression.
  • the base editing may increase the functionality of the gene product.
  • the alpha component of the immune cell receptor complex is encoded by the TRAC gene, and in some embodiments, this gene is edited such that the alpha subunit of the TCR complex is nonfunctional or absent. Because this subunit is necessary for endogenous immune cell signaling, editing this gene can reduce the risk of graft versus host disease caused by allogeneic immune cells. [0438] In some embodiments, editing of genes to provide fratricide resistance, enhance the function of the immune cell or to reduce immunosuppression or inhibition can occur in the immune cell before the cell is transformed to express a chimeric antigen receptor.
  • editing of genes to enhance the function of the immune cell or to reduce immunosuppression or inhibition can occur in a CAR-T cell, i.e., after the immune cell has been transformed to express a chimeric antigen receptor.
  • the CD5 gene is edited in the CAR-T cell to knockout or knockdown expression.
  • the CAR-T is then transformed to express a chimeric antigen receptor with a CD5 scFv.
  • the modified CAR-T cells are less likely to commit fratricide.
  • the CD7 gene is edited in the CAR-T cell to knockout or knockdown expression.
  • the CAR-T is then transformed to express a chimeric antigen receptor with a CD7 scFv. By knocking out or knocking down expression of the CD7 gene, the modified CAR-T cells are less likely to commit fratricide.
  • the CD33 gene is edited in the CAR-T cell to knockout or knockdown expression.
  • the CAR-T is then transformed to express a chimeric antigen receptor with a CD33 scFv. By knocking out or knocking down expression of the CD33 gene, the modified CAR-T cells are less likely to commit fratricide.
  • the CD3 gene is edited in the CAR-T cell to knockout or knockdown expression.
  • the CAR-T is then transformed to express a chimeric antigen receptor with a CD3 scFv. By knocking out or knocking down expression of the CD3 gene, the modified CAR-T cells are less likely to commit fratricide.
  • the CD123 gene is edited in the CAR-T cell to knockout or knockdown expression.
  • the CAR-T is then transformed to express a chimeric antigen receptor with a CD123 scFv. By knocking out or knocking down expression of the CD123 gene, the modified CAR-T cells are less likely to commit fratricide.
  • Host immune cells can potentially recognize allogeneic CAR-T cells as non-self and elicit an immune response to remove the non-self cells.
  • B2M is expressed in nearly all nucleated cells and is associated with MHC class I complex (FIG.1B). Circulating host CD8 + T cells can recognize this B2M protein as non-self and kill the allogeneic cells.
  • the B2M gene is edited to either knockout or knockdown expression.
  • provided herein is an immune cell with an edited B2M gene, such that the immune cell does not express an endogenous functional B2M.
  • an immune cell comprises a chimeric antigen receptor and one or more edited genes, a regulatory element thereof, or combinations thereof.
  • An edited gene may be an immune response regulation gene, an immunogenic gene, a checkpoint inhibitor gene, a gene involved in immune responses, a cell surface marker, e.g. a T cell surface marker, or any combination thereof.
  • an immune cell comprises a chimeric antigen receptor and an edited gene that is associated with activated T cell proliferation, alpha-beta T cell activation, gamma-delta T cell activation, positive regulation of T cell proliferation, negative regulation of T-helper cell proliferation or differentiation, or their regulatory elements thereof, or combinations thereof.
  • the edited gene may be a checkpoint inhibitor gene, for example, such as a PD1 gene, a PDC1 gene, or a member related to or regulating the pathway of their formation or activation.
  • the edited gene is a TRAC gene.
  • the edited gene is a CD5 gene.
  • the edited gene is a CD7 gene.
  • the edited gene is a CD33 gene. In some embodiments, the edited gene is a CD3 gene. In some embodiments, the edited gene is a CD123 gene. In some embodiments, the edited gene is a B2M gene. In some embodiments, the edited gene is a CIITA gene. In some embodiments, the edited gene is a TRBC1/2 gene. In some embodiments, the edited gene is a CD5 gene. In some embodiments, the edited gene is a CD7 gene. In some embodiments, the edited gene is a CD52 gene. In some embodiments, at least one gene is edited selected from PD-1, CD2, CD3, CD5, CD7, CD52, B2M, TRBC1/2, CIITA, and TRAC, or combinations thereof.
  • the PD-1, CD2, CD52, and TRAC genes are edited.
  • the PD-1, CD2, CD52, B2M, TRBC1/2, CIITA and TRAC genes are edited.
  • the PD-1, CD5, CD52, and TRAC genes are edited.
  • the PD-1, CD3, CD7, and CD52 genes are edited. [0446]
  • the editing of the endogenous gene reduces expression of the gene. In some embodiments, the editing of the endogenous gene reduces expression of the gene by at least 50% as compared to a control cell without the modification.
  • the editing of the endogenous gene reduces expression of the gene by at least 60% as compared to a control cell without the modification. In some embodiments, the editing of the endogenous gene reduces expression of the gene by at least 70% as compared to a control cell without the modification. In some embodiments, the editing of the endogenous gene reduces expression of the gene by at least 80% as compared to a control cell without the modification. In some embodiments, the editing of the endogenous gene reduces expression of the gene by at least 90% as compared to a control cell without the modification. In some embodiments, the editing of the endogenous gene reduces expression of the gene by at least 100% as compared to a control cell without the modification.
  • the editing of the endogenous gene eliminates gene expression.
  • the PDCD1 gene is edited in the CAR-T cell to knockout or knockdown expression.
  • the PDCD1 gene encodes the cell surface receptor PD-1, an immune system checkpoint expressed in immune cells, and it is involved in reducing autoimmunity by promoting apoptosis of antigen specific immune cells.
  • knocking out or knocking down expression of the PDCD1 gene the modified CAR-T cells are less likely to apoptose, are more likely to proliferate, and can escape the programmed cell death immune checkpoint.
  • the CBLB gene encodes an E3 ubiquitin ligase that plays a significant role in inhibiting immune effector cell activation.
  • the CBLB protein favors the signaling pathway resulting in immune effector cell tolerance and actively inhibits signaling that leads to immune effector cell activation. Because immune effector cell activation is necessary for the CAR-T cells to proliferate in vivo post-transplant, in some embodiments of the present invention the CBLB gene is edited to knockout or knockdown expression.
  • an immune cell with an edited TRAC gene (wherein, the TRAC gene may comprise one, two, three, four, five, six, seven eight, nine, ten or more base edits), such that the immune cell does not express an endogenous functional T cell receptor alpha chain.
  • the immune cell is a T cell expressing a chimeric antigen receptor (a CAR-T cell).
  • a CAR-T cell with base edits in TRAC gene, such that the CAR-T cell have reduced or negligible or no expression of endogenous T cell receptor alpha protein.
  • an immune cell with an edited CIITA gene such that the immune cell does not express an endogenous functional class II, major histocompatibility complex, transactivator.
  • a CAR-T cell with an edited CIITA gene such that the CAR-T cell exhibits reduced or negligible expression or no expression of endogenous class II, major histocompatibility complex, transactivator.
  • an immune cell with an edited TRBC1 or TRBC2 gene such that the immune cell does not express an endogenous functional T cell receptor beta chain.
  • an immune cell comprises a chimeric antigen receptor and an edited TRAC, B2M, PDCD1, CBLB gene, or a combination thereof, wherein expression of the edited gene is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and an edited TRAC gene, wherein expression of the edited gene is knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and edited TRAC and B2M genes, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited TRAC and PDCD1 genes, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited TRAC and CBLB genes, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited TRAC, B2M, and PDCD1 genes, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and edited TRAC, B2M, and CBLB genes, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell or immune effector cell comprises a chimeric antigen receptor and edited TRAC, PDCD1, and CBLB genes, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen and edited TRAC, B2M, PDCD1, and CBLB genes, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and an edited B2M gene, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited B2M and PDCD1 genes, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited B2M and CBLB genes, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited B2M, PDCD1, and CBLB genes, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and an edited PDCD gene, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and edited PDCD and CBLB genes, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and an edited CBLB, expression of the edited gene is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and edited CD5 gene, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and edited CD7 gene, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited CD33 gene, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited CD3 gene, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited CD123 gene, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and edited FAS gene, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited LAG-3 gene, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited CIITA gene, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited TRBC1 gene, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and edited TRBC2 gene, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited CD52 gene, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and one or more edited CD3, CD5, CD7, CD33, CD123, TRAC, LAG-3, FAS, CIITA, TRBC1, TRBC2, CD52, B2M, and/or PD1 genes, wherein expression of the edited genes is either knocked out or knocked down.
  • the base editing may be positioned at any suitable position of the gene, or in a regulatory element of the gene.
  • a single base editing at a start codon can completely abolish the expression of the gene.
  • the altered endogenous gene may be modified or edited in an exon, an intron, an exon-intron injunction, or a regulatory element thereof.
  • the modification may be edit to a single nucleobase in a gene or a regulatory element thereof.
  • the modification may be in a exon, more than one exons, an intron, or more than one introns, or a combination thereof.
  • the modification may be in an open reading frame of a gene.
  • the modification may be in an untranslated region of the gene, for example, a 3’-UTR or a 5’-UTR.
  • the modification is in a regulatory element of an endogenous gene.
  • the modification is in a promoter, an enhancer, an operator, a silencer, an insulator, a terminator, a transcription initiation sequence, a translation initiation sequence (e.g. a Kozak sequence), or any combination thereof.
  • base editing may introduce a premature STOP codon into an exon, resulting in either lack of a translated product or in a truncated that may be misfolded and thereby eliminated by degradation, or may produce an unstable mRNA that is readily degraded.
  • base editing may be performed, for example on exon 1, exon 2, or exon 3, or exon 4, or exon 5 of human PDC1/PD-1 gene.
  • base editing in the human PDC1/PD-1 gene is performed at a site within exon 1.
  • base editing in the human PDC1/PD-1 gene is performed at a site within exon 2.
  • base editing in the human PDC1/PD-1 gene is performed at a site within exon 3.
  • base editing in the human PDC1/PD-1 gene is performed at a site within exon 4.
  • base editing in the human PDC1/PD-1 gene is performed at a site within exon 5.
  • one or more base editing actions can be performed on the human PDC1/PD-1 gene, at exon 1, exon 2, exon 3, exon 4, exon 5, or any combination thereof.
  • base editing in the human PDC1/PD-1A gene is performed by editing position 4, 6, 7, 8 or 9 of a guide RNA spacer sequence targeting exon 1.
  • base editing in the human PDC1/PD-1A gene is performed by editing position 4, 6, 7, 8 or 9 of a guide RNA spacer sequence targeting exon 1.
  • base editing in the human PDC1/PD-1A gene is performed by editing position 7, 8 or 9 of a guide RNA spacer sequence targeting exon 2.
  • base editing in the human PDC1/PD-1A gene is performed by editing position 5, 7, or 8 of a guide RNA spacer sequence targeting exon 3. In some embodiments, base editing in the human PDC1/PD-1A gene is performed by editing position 5 or 8 of a guide RNA spacer sequence targeting exon 5. [0457] In some embodiments, base editing may be performed, for example on exon 1, exon 2, or exon 3 of human CD7 gene. In some embodiments, base editing in the human CD7 gene is performed at a site within exon 1. In some embodiments, base editing in the human CD7 gene is performed at a site within exon 2. In some embodiments, base editing in the human CD7 gene is performed at a site within exon 3.
  • one or more base editing actions can be performed on the human CD7 gene, at exon 1, exon 2, exon 3, or any combination thereof.
  • base editing in the human CD7 gene is performed at position 4, 8, 9 within exon 1.
  • base editing in the human CD7 gene is performed by editing position 5, 6, 7, 8, or 9 of a guide RNA spacer sequence targeting exon 2.
  • base editing in the human CD7 gene is performed by editing position 4 or 9 of a guide RNA spacer sequence targeting exon 3.
  • base editing may be performed, for example on exon 1, exon 2, exon 3, exon 4, exon 5, exon 6, exon 7, or exon 8 of human LAG-3 gene.
  • base editing in the human LAG-3 gene is performed at a site within exon 1. In some embodiments, base editing in the human LAG-3 gene is performed at a site within exon 2. In some embodiments, base editing in the human LAG-3 gene is performed at a site within exon 3. In some embodiments, base editing in the human LAG-3 gene is performed at a site within exon 4. In some embodiments, base editing in the human LAG-3 gene is performed at a site within exon 5. In some embodiments, base editing in the human LAG-3 gene is performed at a site within exon 6. In some embodiments, base editing in the human LAG-3 gene is performed at a site within exon 7. In some embodiments, base editing in the human LAG-3 gene is performed at a site within exon 8.
  • one or more base editing actions can be performed on the human LAG-3 gene, at exon 1, exon 2, exon 3, exon 4, exon 5, exon 6, exon 7, exon 8, or any combination thereof.
  • base editing in the human LAG-3 gene is performed by editing position 4 or 8 of a guide RNA spacer sequence targeting exon 1.
  • base editing in the human LAG-3 gene is performed by editing position 4, 6, or 8 of a guide RNA spacer sequence targeting exon 2.
  • base editing in the human LAG-3 gene is performed by editing position 4, 5, 6 or 7 of a guide RNA spacer sequence targeting exon 3.
  • base editing in the human LAG-3 gene is performed by editing position 4, 8 or 9 of a guide RNA spacer sequence targeting exon 4. In some embodiments, base editing in the human LAG-3 gene is performed by editing position 8 or 9 of a guide RNA spacer sequence targeting exon 5. In some embodiments, base editing in the human LAG-3 gene is performed by editing position 4, 6, 7 or 8 of a guide RNA spacer sequence targeting exon 6. In some embodiments, base editing in the human LAG-3 gene is performed by editing position 4, 6 or 7 of a guide RNA spacer sequence targeting exon 7. In some embodiments, base editing in the human LAG-3 gene is performed by editing position 8 of a guide RNA spacer sequence targeting exon 8.
  • base editing may be performed, for example on exon 1, exon 2, exon 3, exon 4, exon 5, or exon 6 of human CD33 gene.
  • base editing in the human CD33 gene is performed at a site within exon 1.
  • base editing in the human CD33 gene is performed at a site within exon 2.
  • base editing in the human CD33 gene is performed at a site within exon 3.
  • base editing in the human CD33 gene is performed at a site within exon 4.
  • base editing in the human CD33 gene is performed at a site within exon 5.
  • base editing in the human CD33 gene is performed at a site within exon 6.
  • one or more base editing actions can be performed on the human CD33 gene, at exon 1, exon 2, exon 3, exon 4, exon 5, exon 6, or any combination thereof.
  • base editing in the human CD33 gene is performed by editing position 7, 8 or 9 of a guide RNA spacer sequence targeting exon 1.
  • base editing in the human CD33 gene is performed by editing position 4, 5, 6, or 8 of a guide RNA spacer sequence targeting exon 2.
  • base editing in the human CD33 gene is performed by editing position 4, 5, 6 or 7 of a guide RNA spacer sequence targeting exon 3.
  • base editing in the human CD33 gene is performed by editing position 6 or 7 of a guide RNA spacer sequence targeting exon 4.
  • base editing in the human CD33 gene is performed by editing position 7 or 8 of a guide RNA spacer sequence targeting exon 5. In some embodiments, base editing in the human CD33 gene is performed by editing position 4, 5, or 6 of a guide RNA spacer sequence targeting exon 6. [0460] In some embodiments, base editing may be performed, for example on exon 1, exon 2, exon 3, exon 4, exon 5, exon 7, exon 8, exon 10, or exon 11 of human CD123 gene. In some embodiments, base editing in the human CD123 gene is performed at a site within exon 1. In some embodiments, base editing in the human CD123 gene is performed at a site within exon 2. In some embodiments, base editing in the human CD123 gene is performed at a site within exon 3.
  • base editing in the human CD123 gene is performed at a site within exon 4. In some embodiments, base editing in the human CD123 gene is performed at a site within exon 5. In some embodiments, base editing in the human CD123 gene is performed at a site within exon 7. In some embodiments, base editing in the human CD123 gene is performed at a site within exon 8. In some embodiments, base editing in the human CD123 gene is performed at a site within exon 10. In some embodiments, base editing in the human CD123 gene is performed at a site within exon 11. In some embodiments one or more base editing actions can be performed on the human CD123 gene, at exon 1, exon 2, exon 3, exon 4, exon 5, exon 7, exon 8, exon 10, exon 11, or any combination thereof.
  • base editing in the human CD123 gene is performed by editing position 6 of a guide RNA spacer sequence targeting exon 1. In some embodiments, base editing in the human CD123 gene is performed by editing position 4, 6, or 8 of a guide RNA spacer sequence targeting exon 2. In some embodiments, base editing in the human CD123 gene is performed by editing position 5, 6 or 8 of a guide RNA spacer sequence targeting exon 3. In some embodiments, base editing in the human CD123 gene is performed by editing position 5 or 6 of a guide RNA spacer sequence targeting exon 4. In some embodiments, base editing in the human CD123 gene is performed by editing position 4 or 5 of a guide RNA spacer sequence targeting exon 5.
  • base editing in the human CD123 gene is performed by editing position 5 of a guide RNA spacer sequence targeting exon 7. In some embodiments, base editing in the human CD123 gene is performed by editing position 5, 6, 7 or 8 of a guide RNA spacer sequence targeting exon 8. In some embodiments, base editing in the human CD123 gene is performed by editing position 4, 7 or 8 of a guide RNA spacer sequence targeting exon 10. In some embodiments, base editing in the human CD123 gene is performed by editing position 5 or 8 of a guide RNA spacer sequence targeting exon 11. [0461] In some embodiments, base editing may be performed, for example on exon 1, or exon 3, or exon 4, or exon 5, or exon 6, or exon 7, or exon 8, or exon 9 of human FAS gene.
  • base editing in the human FAS gene is performed at a site within exon 1. In some embodiments, base editing in the human FAS gene is performed at a site within exon 3. In some embodiments, base editing in the human FAS gene is performed at a site within exon 4. In some embodiments, base editing in the human FAS gene is performed at a site within exon 5. In some embodiments, base editing in the human FAS is performed at a site within exon 6. In some embodiments, base editing in the human FAS is performed at a site within exon 7. In some embodiments, base editing in the human FAS is performed at a site within exon 8. In some embodiments, base editing in the human FAS is performed at a site within exon 9.
  • one or more base editing actions can be performed on the human FAS gene, at exon 1, exon 3, exon 4, exon 5, exon 6, exon 7, exon 8, exon 9, or any combination thereof.
  • base editing in the human FAS gene is performed by editing position 9 of a guide RNA spacer sequence targeting exon 1.
  • base editing in the human FAS gene is performed by editing position 6 of a guide RNA spacer sequence targeting exon 3.
  • base editing in the human FAS gene is performed by editing position 7 of a guide RNA spacer sequence targeting exon 4.
  • base editing in the human FAS gene is performed by editing position 5 of a guide RNA spacer sequence targeting exon 5.
  • base editing in the human FAS gene is performed by editing position 4 or 7 of a guide RNA spacer sequence targeting exon 6. In some embodiments, base editing in the human FAS gene is performed by editing position 8 of a guide RNA spacer sequence targeting exon 7. In some embodiments, base editing in the human FAS gene is performed by editing position 8 of a guide RNA spacer sequence targeting exon 8. In some embodiments, base editing in the human FAS gene is performed by editing position 5 or 6 of a guide RNA spacer sequence targeting exon 9. [0463] In some embodiments, base editing may be performed, for example on exon 1, exon 2, or exon 3 of human CD52 gene. In some embodiments, base editing in the human CD52 gene is performed at a site within exon 1.
  • base editing in the human CD52 gene is performed at a site within exon 2.
  • base editing in the human CD7 gene is performed at a site within exon 3.
  • one or more base editing actions can be performed on the human CD52 gene, at exon 1, exon 2, exon 3, or any combination thereof.
  • base editing in the human CD52 gene is performed by editing position 4 or 7 of a guide RNA spacer sequence targeting exon 1.
  • base editing in the human CD52 gene is performed by editing position 5, 6, or 7 of a guide RNA spacer sequence targeting exon 2.
  • base editing may be performed, for example on exon 1, exon 2, or exon 3, or exon 4, or exon 5, or exon 6, or exon 7, or exon 8, or exon 9, or exon 10 of human CD5 gene.
  • base editing in the human CD5 gene is performed at a site within exon 1.
  • base editing in the human CD5 gene is performed at a site within exon 2.
  • base editing in the human CD5 gene is performed at a site within exon 3.
  • base editing in the human CD5 gene is performed at a site within exon 4.
  • base editing in the human CD5 gene is performed at a site within exon 5.
  • base editing in the human CD5 gene is performed at a site within exon 6. In some embodiments, base editing in the human CD5 gene is performed at a site within exon 7. In some embodiments, base editing in the human CD5 gene is performed at a site within exon 8. In some embodiments, base editing in the human CD5 gene is performed at a site within exon 9. In some embodiments, base editing in the human CD5 gene is performed at a site within exon 10. In some embodiments one or more base editing actions can be performed on the human CD5 gene, at exon 1, exon 2, exon 3, exon 4, exon 5, exon 6, exon 7, exon 8, exon 9, exon 10, or any combination thereof.
  • base editing in the human CD5 gene is performed by editing position 6 of a guide RNA spacer sequence targeting exon 1. In some embodiments, base editing in the human CD5 gene is performed by editing position 6 of a guide RNA spacer sequence targeting exon 1. In some embodiments, base editing in the human CD5 gene is performed by editing position 5 and/or 6 of a guide RNA spacer sequence targeting exon 2. In some embodiments, base editing in the human CD5 gene is performed by editing position 5 and/or 6 of a guide RNA spacer sequence targeting exon 2. In some embodiments, base editing in the human CD5 gene is performed by editing position 5, 6, 8 and/or 9 of a guide RNA spacer sequence targeting exon 3.
  • base editing in the human CD5 gene is performed by editing position 4 or 5 of a guide RNA spacer sequence targeting exon 4. In some embodiments, base editing in the human CD5 gene is performed by editing position 4, 5, 7, 8 or 9 of a guide RNA spacer sequence targeting exon 5. In some embodiments, base editing in the human CD5 gene is performed by editing position 4, 5, 6, 7, 8 and/or 9 of a guide RNA spacer sequence targeting exon 6. In some embodiments, base editing in the human CD5 gene is performed by editing position 4 of a guide RNA spacer sequence targeting exon 7. In some embodiments, base editing in the human CD5 gene is performed by editing position 4, 5, or 7 of a guide RNA spacer sequence targeting exon 8.
  • base editing in the human CD5 gene is performed by editing position 6 or 8 of a guide RNA spacer sequence targeting exon 9. In some embodiments, base editing in the human CD5 gene is performed by editing position 9 of a guide RNA spacer sequence targeting exon 10. [0466] In some embodiments, base editing may be performed, for example on exon 1, or exon 2, or exon 3 or exon 4 of human TRAC gene (UCSC genomic database ENSG00000277734.8). In some embodiments, base editing in human TRAC gene is performed at a site within exon 1. In some embodiments, base editing in human TRAC gene is performed at a site within exon 2. In some embodiments, base editing in human TRAC gene is performed at a site within exon 3.
  • base editing in human TRAC gene is performed at a site within exon 4. In some embodiments one or more base editing actions can be performed on human TRAC gene, at exon 1, exon 2, exon 3, exon 4 or any combination thereof. In some embodiments, base editing in the human TRAC gene is performed by editing at position 5, 6, or 9 of a guide RNA spacer sequence targeting within exon 1. [0467] In some embodiments, base editing may be performed, for example, on exon 1, exon 2, exon 3, or exon 4 of human B2M gene (Chromosome 15, NC_000015.10, 44711492 – 44718877; exemplary mRNA sequence NM_004048).
  • base editing in human B2M gene is performed at a site within exon 1. In some embodiments, base editing in human B2M gene is performed at a site within exon 2. In some embodiments, base editing in human B2M gene is performed at a site within exon 3. In some embodiments, base editing in human B2M gene is performed at a site within exon 4. In some embodiments one or more base editing actions can be performed on human B2M gene, at exon 1, exon 2, exon 3, exon 4 or any combination thereof. In some embodiments, base editing in the human B2M gene is performed by editing position 5 of a guide RNA spacer sequence targeting exon 1.
  • base editing in the human B2M gene is performed by editing position 4, 6 or 9 of a guide RNA spacer sequence targeting exon 2.
  • base editing may be performed, for example on exon 1, exon 2, exon 3, exon 4, exon 5, exon 6, exon 7, exon 8, exon 9, exon 10, exon 11, exon 12, exon 13, exon 14, exon 15, exon 16, exon 17, exon 18, or exon 19 of human CIITA gene.
  • base editing in the human CD52 gene is performed at a site within exon 1.
  • base editing in the human CIITA gene is performed at a site within exon 2.
  • base editing in the human CIITA gene is performed at a site within exon 3.
  • base editing in the human CIITA gene is performed at a site within exon 4. In some embodiments, base editing in the human CIITA gene is performed at a site within exon 5. In some embodiments, base editing in the human CIITA gene is performed at a site within exon 6. In some embodiments, base editing in the human CIITA gene is performed at a site within exon 7. In some embodiments, base editing in the human CIITA gene is performed at a site within exon 8. In some embodiments, base editing in the human CIITA gene is performed at a site within exon 9. In some embodiments, base editing in the human CIITA gene is performed at a site within exon 10. In some embodiments, base editing in the human CIITA gene is performed at a site within exon 11.
  • base editing in the human CIITA gene is performed at a site within exon 12. In some embodiments, base editing in the human CIITA gene is performed at a site within exon 13. In some embodiments, base editing in the human CIITA gene is performed at a site within exon 14. In some embodiments, base editing in the human CIITA gene is performed at a site within exon 15. In some embodiments, base editing in the human CIITA gene is performed at a site within exon 16. In some embodiments, base editing in the human CIITA gene is performed at a site within exon 17. In some embodiments, base editing in the human CIITA gene is performed at a site within exon 18. In some embodiments, base editing in the human CIITA gene is performed at a site within exon 19.
  • one or more base editing actions can be performed on the human CIITA gene, at exon 1, exon 2, exon 3, exon 4, exon 5, exon 6, exon 7, exon 8, exon 9, exon 10, exon 11, exon 12, exon 13, exon 14, exon 15, exon 16, exon 17, exon 18, exon 19, or any combination thereof.
  • base editing in the human CIITA gene is performed by editing position 6 or 7 of a guide RNA spacer sequence targeting exon 1.
  • base editing in the human CIITA gene is performed by editing position 7 or 8 of a guide RNA spacer sequence targeting exon 2.
  • base editing in the human CIITA gene is performed by editing position 8 of a guide RNA spacer sequence targeting exon 4.
  • base editing in the human CIITA gene is performed by editing position 4, 7 or 8 of a guide RNA spacer sequence targeting exon 7. In some embodiments, base editing in the human CIITA gene is performed by editing position 8 of a guide RNA spacer sequence targeting exon 8. In some embodiments, base editing in the human CIITA gene is performed by editing position 4, 6, or 7 of a guide RNA spacer sequence targeting exon 9. In some embodiments, base editing in the human CIITA gene is performed by editing position 4, 5, or 7 of a guide RNA spacer sequence targeting exon 10. In some embodiments, base editing in the human CIITA gene is performed by editing position 4, 5, 6, 7 or 8 of a guide RNA spacer sequence targeting exon 11.
  • base editing in the human CIITA gene is performed by editing position 6 of a guide RNA spacer sequence targeting exon 12. In some embodiments, base editing in the human CIITA gene is performed by editing position 4 or 5 of a guide RNA spacer sequence targeting exon 14. In some embodiments, base editing in the human CIITA gene is performed by editing position 4, 7 or 8 of a guide RNA spacer sequence targeting exon 15. In some embodiments, base editing in the human CIITA gene is performed by editing position 5, 7 or 8 of a guide RNA spacer sequence targeting exon 16. In some embodiments, base editing in the human CIITA gene is performed by editing position 7 or 8 of a guide RNA spacer sequence targeting exon 17.
  • base editing in the human CIITA gene is performed by editing position 5 of a guide RNA spacer sequence targeting exon 18. In some embodiments, base editing in the human CIITA gene is performed by editing position 5, 6, 7 or 8 of a guide RNA spacer sequence targeting exon 19. [0470] In some embodiments, base editing may be performed, for example, on exon 1, exon 2, or exon 3 of human TRBC1 gene. In some embodiments, base editing in human TRBC1 gene is performed at a site within exon 1. In some embodiments, base editing in human TRBC1 gene is performed at a site within exon 2. In some embodiments, base editing in human TRBC1 gene is performed at a site within exon 3.
  • one or more base editing actions can be performed on human TRBC1 gene, at exon 1, exon 2, exon 3, or any combination thereof.
  • base editing in the human TRBC1 gene is performed by editing position 5, 6, 7 or 8 of a guide RNA spacer sequence targeting exon 1.
  • base editing in the human TRBC1 gene is performed by editing position 8 of a guide RNA spacer sequence targeting exon 2.
  • base editing in the human TRBC1 gene is performed by editing position 4 or 5 of a guide RNA spacer sequence targeting exon 3.
  • base editing may be performed, for example, on exon 1, exon 2, or exon 3 of human TRBC2 gene.
  • base editing in human TRBC2 gene is performed at a site within exon 1. In some embodiments, base editing in human TRBC2 gene is performed at a site within exon 2. In some embodiments, base editing in human TRBC2 gene is performed at a site within exon 3. In some embodiments one or more base editing actions can be performed on human TRBC2 gene, at exon 1, exon 2, exon 3, or any combination thereof. In some embodiments, base editing in the human TRBC2 gene is performed by editing position 5, 6, 7 or 8 of a guide RNA spacer sequence targeting exon 1. In some embodiments, base editing in the human TRBC2 gene is performed by editing position 7 or 8 of a guide RNA spacer sequence targeting exon 2.
  • base editing in the human TRBC2 gene is performed by editing position 4 of a guide RNA spacer sequence targeting exon 3.
  • base editing may be performed on an intron.
  • base editing may be performed on an intron.
  • the base editing may be performed at a site within an intron.
  • the base editing may be performed at a site one or more introns.
  • the base editing may be performed at any exon of the multiple introns in a gene.
  • one or more base editing may be performed on an exon, an intron or any combination of exons and introns.
  • the modification or base edit may be within a promoter site.
  • the base edit may be introduced within an alternative promoter site.
  • the base edit may be in a 5’ regulatory element, such as an enhancer.
  • base editing may be introduced to disrupt the binding site of a nucleic acid binding protein.
  • Exemplary nucleic acid binding proteins may be a polymerase, nuclease, gyrase, topoisomerase, methylase or methyl transferase, transcription factors, enhancer, PABP, zinc finger proteins, among many others.
  • base editing may be used for splice disruption to silence target protein expression.
  • base editing may generate a splice acceptor-splice donor (SA-SD) site.
  • SA-SD splice acceptor-splice donor
  • Targeted base editing generating a SA-SD, or at a SA-SD site can result in reduced expression of a gene.
  • base editors e.g., ABE, CBE
  • ABE adenosine base editor
  • CBE a cytidine base editor
  • base editors are used to edit exons by creating STOP codons.
  • the premature stop codon may be generated in an exon, an intron, or an untranslated region.
  • base editing may be used to introduce more than one STOP codon, in one or more alternative reading frames.
  • a premature STOP codon can be introduced at position 8 within exon 2, at position 4 within exon 3, at position 6 within exon 3, at position 9 within exon 3, at position 4 within exon 4, at position 5 within exon 4, or at position 4 within exon 5.
  • the stop codon is generated by a adenosine base editor (ABE).
  • the stop codon is generated by a cytidine base editor (CBE).
  • CBE cytidine base editor
  • the CBE generates any one of the following edits (shown in underlined font) to generate a STOP codon: CAG ⁇ TAG; CAA ⁇ TAA; CGA ⁇ TGA; TGG ⁇ TGA; TGG ⁇ TAG; or TGG ⁇ TAA.
  • modification/base edits may be introduced at a 3’-UTR, for example, in a poly adenylation (poly-A) site.
  • base editing may be performed on a 5’-UTR region.
  • an immune cell including by not limited to any immune cell comprising any of the aforementioned gene edits, can be edited to generate mutations in other genes that enhance the CAR-T's function or reduce immunosuppression or inhibition of the cell.
  • an immune cell comprises a chimeric antigen receptor and an edited TGFBR2, ZAP70, NFATc1, TET2 gene, or a combination thereof, wherein expression of the edited gene is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and an edited TGFBR2 gene, wherein expression of the edited gene is knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and edited TGFBR2 and ZAP70 genes, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited TGFBR2 and ZAP70 genes, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited TGFBR2 and NFATC1 genes, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and edited TGFBR2 and TET2 genes, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and edited TGFBR2, ZAP70, and NFATC1 genes, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and edited TGFBR2, ZAP70, and TET2 genes, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and edited TGFBR2, NFATC1, and TET2 genes, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen and edited TGFBR2, ZAP70, NFATC1, and TET2 genes, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and an edited ZAP70 gene, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and edited ZAP70 and NFATC1 genes, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited ZAP70 and TET2 genes, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and edited ZAP70, PDCD1, and TET2 genes, wherein expression of the edited genes is either knocked out or knocked down. In some embodiments, an immune cell comprises a chimeric antigen receptor and an edited PDCD1 gene, wherein expression of the edited genes is either knocked out or knocked down.
  • an immune cell comprises a chimeric antigen receptor and edited PDCD1 and TET2 genes, wherein expression of the edited genes is either knocked out or knocked down. And in some embodiments, an immune cell comprises a chimeric antigen receptor and an edited TET2, expression of the edited gene is either knocked out or knocked down. [0476] In some embodiments, a chimeric antigen receptor is inserted into the TRAC gene. This has advantages. First, because TRAC is highly expressed in immune cell, the chimeric antigen receptor will be similarly expressed when its construct is designed to insert the chimeric antigen receptor into the TRAC gene such that expression of the receptor is driven by the TRAC promoter.
  • the gene editing system described herein can be used to insert the chimeric antigen receptor into the TRAC locus.
  • gRNAs specific for the TRAC locus can guide the gene editing system to the locus and initiate double-stranded DNA cleavage.
  • the gRNA is used in conjunction with Cas12b.
  • the gene editing system is used in conjunction with a nucleic acid having a sequence encoding a CAR receptor.
  • Exemplary guide RNAs are provided in the following Table 1A.
  • Table 1A Guide RNAs [0477] A DNA construct encoding the chimeric antigen receptor and nucleic acid containing extended stretches of TRAC DNA that flank the gRNA targeting sequences. Without being bound by theory, the construct binds to the complementary TRAC sequences, and the chimeric antigen receptor DNA, residing in proximity to the TRAC sequences on the construct is then inserted at the site of the lesion, effectively knocking out the TRAC gene and knocking in the chimeric antigen receptor nucleic acid.
  • Table 1B provides guide RNAs for the TRAC gene that can guide the base editing machinery to the TRAC locus, which enables insertion of the chimeric antigen receptor nucleic acid.
  • the first 11 gRNAs are for BhCas12b nuclease.
  • the second set of 11 are for the BvCas12b nuclease. These are all for inserting the CAR at TRAC by creating a double stranded break, and not for base editing.
  • a nucleic acid encoding a chimeric antigen receptor of the present invention can be targeted to the TRAC locus using the BE4 base editor.
  • the chimeric antigen receptor is targeted to the TRAC locus using a CRISPR/Cas9 base editing system.
  • immune cells are collected from a subject and contacted with two or more guide RNAs and a nucleobase editor polypeptide comprising a nucleic acid programmable DNA binding protein (napDNAbp) and a cytidine deaminase or adenosine deaminase.
  • the collected immune cells are contacted with at least one nucleic acid, wherein the at least one nucleic acid encodes two or more guide RNAs and a nucleobase editor polypeptide comprising a nucleic acid programmable DNA binding protein (napDNAbp) and a cytidine deaminase.
  • the gRNA comprises nucleotide analogs. These nucleotide analogs can inhibit degradation of the gRNA from cellular processes. Table 2 provides target sequences to be used for gRNAs.
  • cytidine and adenosine deaminase nucleobase editors used in this invention can act on DNA, including single stranded DNA. Methods of using them to generate modifications in target nucleobase sequences in immune cells are presented.
  • the fusion proteins provided herein comprise one or more features that improve the base editing activity of the fusion proteins.
  • any of the fusion proteins provided herein may comprise a Cas9 domain that has reduced nuclease activity.
  • any of the fusion proteins provided herein may have a Cas9 domain that does not have nuclease activity (dCas9), or a Cas9 domain that cuts one strand of a duplexed DNA molecule, referred to as a Cas9 nickase (nCas9).
  • the presence of the catalytic residue e.g., H840
  • the non-edited e.g., non-methylated
  • Mutation of the catalytic residue e.g., D10 to A10 prevents cleavage of the edited strand containing the targeted A residue.
  • Such Cas9 variants can generate a single-strand DNA break (nick) at a specific location based on the gRNA-defined target sequence, leading to repair of the non-edited strand, ultimately resulting in a nucleobase change on the non-edited strand.
  • NUCLEOBASE EDITORS [0483] Disclosed herein is a base editor or a nucleobase editor for editing, modifying or altering a target nucleotide sequence of a polynucleotide.
  • nucleobase editor or a base editor comprising a polynucleotide programmable nucleotide binding domain and a nucleobase editing domain (e.g., adenosine deaminase or cytidine deaminase).
  • a nucleobase editing domain e.g., adenosine deaminase or cytidine deaminase
  • a polynucleotide programmable nucleotide binding domain when in conjunction with a bound guide polynucleotide (e.g., gRNA), can specifically bind to a target polynucleotide sequence (i.e., via complementary base pairing between bases of the bound guide nucleic acid and bases of the target polynucleotide sequence) and thereby localize the base editor to the target nucleic acid sequence desired to be edited.
  • the target polynucleotide sequence comprises single-stranded DNA or double-stranded DNA.
  • the target polynucleotide sequence comprises RNA.
  • the target polynucleotide sequence comprises a DNA-RNA hybrid.
  • polynucleotide programmable nucleotide binding domains can also include nucleic acid programmable proteins that bind RNA.
  • the polynucleotide programmable nucleotide binding domain can be associated with a nucleic acid that guides the polynucleotide programmable nucleotide binding domain to an RNA.
  • Other nucleic acid programmable DNA binding proteins are also within the scope of this disclosure, though they are not specifically listed in this disclosure.
  • a polynucleotide programmable nucleotide binding domain of a base editor can itself comprise one or more domains.
  • a polynucleotide programmable nucleotide binding domain can comprise one or more nuclease domains.
  • the nuclease domain of a polynucleotide programmable nucleotide binding domain can comprise an endonuclease or an exonuclease.
  • an endonuclease refers to a protein or polypeptide capable of digesting a nucleic acid (e.g., RNA or DNA) from free ends
  • the term “endonuclease” refers to a protein or polypeptide capable of catalyzing (e.g., cleaving) internal regions in a nucleic acid (e.g., DNA or RNA).
  • an endonuclease can cleave a single strand of a double-stranded nucleic acid.
  • an endonuclease can cleave both strands of a double-stranded nucleic acid molecule.
  • a polynucleotide programmable nucleotide binding domain can be a deoxyribonuclease. In some embodiments a polynucleotide programmable nucleotide binding domain can be a ribonuclease. [0486] In some embodiments, a nuclease domain of a polynucleotide programmable nucleotide binding domain can cut zero, one, or two strands of a target polynucleotide. In some embodiments, the polynucleotide programmable nucleotide binding domain can comprise a nickase domain.
  • nickase refers to a polynucleotide programmable nucleotide binding domain comprising a nuclease domain that is capable of cleaving only one strand of the two strands in a duplexed nucleic acid molecule (e.g., DNA).
  • a nickase can be derived from a fully catalytically active (e.g., natural) form of a polynucleotide programmable nucleotide binding domain by introducing one or more mutations into the active polynucleotide programmable nucleotide binding domain.
  • a polynucleotide programmable nucleotide binding domain comprises a nickase domain derived from Cas9
  • the Cas9-derived nickase domain can include a D10A mutation and a histidine at position 840.
  • the residue H840 retains catalytic activity and can thereby cleave a single strand of the nucleic acid duplex.
  • a Cas9-derived nickase domain can comprise an H840A mutation, while the amino acid residue at position 10 remains a D.
  • a nickase can be derived from a fully catalytically active (e.g., natural) form of a polynucleotide programmable nucleotide binding domain by removing all or a portion of a nuclease domain that is not required for the nickase activity.
  • a polynucleotide programmable nucleotide binding domain comprises a nickase domain derived from Cas9
  • the Cas9-derived nickase domain can comprise a deletion of all or a portion of the RuvC domain or the HNH domain.
  • amino acid sequence of an exemplary catalytically active Cas9 is as follows: [0488] A base editor comprising a polynucleotide programmable nucleotide binding domain comprising a nickase domain is thus able to generate a single-strand DNA break (nick) at a specific polynucleotide target sequence (e.g., determined by the complementary sequence of a bound guide nucleic acid).
  • the strand of a nucleic acid duplex target polynucleotide sequence that is cleaved by a base editor comprising a nickase domain is the strand that is not edited by the base editor (i.e., the strand that is cleaved by the base editor is opposite to a strand comprising a base to be edited).
  • a base editor comprising a nickase domain can cleave the strand of a DNA molecule which is being targeted for editing.
  • the non-targeted strand is not cleaved.
  • base editors comprising a polynucleotide programmable nucleotide binding domain which is catalytically dead (i.e., incapable of cleaving a target polynucleotide sequence).
  • catalytically dead and nuclease dead are used interchangeably to refer to a polynucleotide programmable nucleotide binding domain which has one or more mutations and/or deletions resulting in its inability to cleave a strand of a nucleic acid.
  • a catalytically dead polynucleotide programmable nucleotide binding domain base editor can lack nuclease activity as a result of specific point mutations in one or more nuclease domains.
  • the Cas9 can comprise both a D10A mutation and an H840A mutation. Such mutations inactivate both nuclease domains, thereby resulting in the loss of nuclease activity.
  • a catalytically dead polynucleotide programmable nucleotide binding domain can comprise one or more deletions of all or a portion of a catalytic domain (e.g., RuvC1 and/or HNH domains).
  • a catalytically dead polynucleotide programmable nucleotide binding domain comprises a point mutation (e.g., D10A or H840A) as well as a deletion of all or a portion of a nuclease domain.
  • mutations capable of generating a catalytically dead polynucleotide programmable nucleotide binding domain from a previously functional version of the polynucleotide programmable nucleotide binding domain.
  • dCas9 catalytically dead Cas9
  • variants having mutations other than D10A and H840A are provided, which result in nuclease inactivated Cas9.
  • Such mutations include other amino acid substitutions at D10 and H840, or other substitutions within the nuclease domains of Cas9 (e.g., substitutions in the HNH nuclease subdomain and/or the RuvC1 subdomain).
  • nuclease-inactive dCas9 domains can be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure.
  • Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D10A/H840A, D10A/D839A/H840A, and D10A/D839A/H840A/N863A mutant domains (See, e.g., Prashant et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology.2013; 31(9): 833-838, the entire contents of which are incorporated herein by reference).
  • Non-limiting examples of a polynucleotide programmable nucleotide binding domain which can be incorporated into a base editor include a CRISPR protein-derived domain, a restriction nuclease, a meganuclease, TAL nuclease (TALEN), and a zinc finger nuclease (ZFN).
  • a base editor comprises a polynucleotide programmable nucleotide binding domain comprising a natural or modified protein or portion thereof which via a bound guide nucleic acid is capable of binding to a nucleic acid sequence during CRISPR (i.e., Clustered Regularly Interspaced Short Palindromic Repeats)-mediated modification of a nucleic acid.
  • CRISPR Clustered Regularly Interspaced Short Palindromic Repeats
  • CRISPR protein Such a protein is referred to herein as a “CRISPR protein.”
  • a base editor comprising a polynucleotide programmable nucleotide binding domain comprising all or a portion of a CRISPR protein (i.e. a base editor comprising as a domain all or a portion of a CRISPR protein, also referred to as a “CRISPR protein-derived domain” of the base editor).
  • a CRISPR protein-derived domain incorporated into a base editor can be modified compared to a wild-type or natural version of the CRISPR protein.
  • CRISPR protein-derived domain can comprise one or more mutations, insertions, deletions, rearrangements and/or recombinations relative to a wild-type or natural version of the CRISPR protein.
  • CRISPR is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids).
  • CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids.
  • CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA).
  • tracrRNA trans-encoded small RNA
  • rnc endogenous ribonuclease 3
  • Cas9 protein The tracrRNA serves as a guide for ribonuclease 3-aided processing of pre-crRNA.
  • Cas9/crRNA/tracrRNA endonucleolytically cleaves linear or circular dsDNA target complementary to the spacer.
  • the target strand not complementary to crRNA is first cut endonucleolytically, and then trimmed 3 ⁇ - 5 ⁇ exonucleolytically.
  • DNA-binding and cleavage typically requires protein and both RNAs.
  • single guide RNAs (“sgRNA,” or simply “gRNA”) can be engineered so as to incorporate aspects of both the crRNA and tracrRNA into a single RNA species. See, e.g., Jinek M., et al. Science 337:816-821(2012), the entire contents of which is hereby incorporated by reference.
  • Cas9 recognizes a short motif in the CRISPR repeat sequences (the PAM or protospacer adjacent motif) to help distinguish self versus non-self.
  • the methods described herein can utilize an engineered Cas protein.
  • a guide RNA is a short synthetic RNA composed of a scaffold sequence necessary for Cas-binding and a user-defined ⁇ 20 nucleotide spacer that defines the genomic target to be modified.
  • a skilled artisan can change the genomic target of the Cas protein specificity is partially determined by how specific the gRNA targeting sequence is for the genomic target compared to the rest of the genome.
  • the gRNA scaffold sequence is as follows: [0495]
  • the RNA scaffold comprises a stem loop.
  • the RNA scaffold comprises the nucleic acid sequence: [0496]
  • the RNA scaffold comprises a canonical stem loop.
  • an S. pyogenes sgRNA scaffold polynucleotide sequence is as follows: [0499] In an embodiment, an S.
  • aureus sgRNA scaffold polynucleotide sequence is as follows: [0500]
  • a BhCas12b sgRNA scaffold has the following polynucleotide sequence: UGCUGGACGAUGUCUCUUACGAGGCAUUAGCAC.
  • a BvCas12b sgRNA scaffold has the following polynucleotide sequence: [0502]
  • the RNA scaffold comprises a non-canonical sequence.
  • a CRISPR protein-derived domain incorporated into a base editor is an endonuclease (e.g., deoxyribonuclease or ribonuclease) capable of binding a target polynucleotide when in conjunction with a bound guide nucleic acid.
  • a CRISPR protein-derived domain incorporated into a base editor is a nickase capable of binding a target polynucleotide when in conjunction with a bound guide nucleic acid.
  • a CRISPR protein-derived domain incorporated into a base editor is a catalytically dead domain capable of binding a target polynucleotide when in conjunction with a bound guide nucleic acid.
  • a target polynucleotide bound by a CRISPR protein derived domain of a base editor is DNA.
  • a target polynucleotide bound by a CRISPR protein-derived domain of a base editor is RNA.
  • Cas proteins that can be used herein include class 1 and class 2.
  • Non-limiting examples of Cas proteins include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas5d, Cas5t, Cas5h, Cas5a, Cas6, Cas7, Cas8, Cas9 (also known as Csn1 or Csx12), Cas10, Csy1 , Csy2, Csy3, Csy4, Cse1, Cse2, Cse3, Cse4, Cse5e, Csc1, Csc2, Csa5, Csn1, Csn2, Csm1, Csm2, Csm3, Csm4, Csm5, Csm6, Cmr1, Cmr3, Cmr4, Cmr5, Cmr6, Csb1, Csb2, Csb3, Csx17, Csx14, Csx10, Csx16, CsaX, Csx3, Csx1, Csx1S, Cs
  • An unmodified CRISPR enzyme can have DNA cleavage activity, such as Cas9, which has two functional endonuclease domains: RuvC and HNH.
  • a CRISPR enzyme can direct cleavage of one or both strands at a target sequence, such as within a target sequence and/or within a complement of a target sequence.
  • a CRISPR enzyme can direct cleavage of one or both strands within about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 50, 100, 200, 500, or more base pairs from the first or last nucleotide of a target sequence.
  • a vector that encodes a CRISPR enzyme that is mutated to with respect, to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence can be used.
  • Cas9 can refer to a polypeptide with at least or at least about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity and/or sequence homology to a wild-type exemplary Cas9 polypeptide (e.g., Cas9 from S. pyogenes).
  • Cas9 can refer to a polypeptide with at most or at most about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity and/or sequence homology to a wild-type exemplary Cas9 polypeptide (e.g., from S. pyogenes).
  • Cas9 can refer to the wild- type or a modified form of the Cas9 protein that can comprise an amino acid change such as a deletion, insertion, substitution, variant, mutation, fusion, chimera, or any combination thereof.
  • a CRISPR protein-derived domain of a base editor can include all or a portion of Cas9 from Corynebacterium ulcerans (NCBI Refs: NC_015683.1, NC_017317.1); Corynebacterium diphtheria (NCBI Refs: NC_016782.1, NC_016786.1); Spiroplasma syrphidicola (NCBI Ref: NC_021284.1); Prevotella intermedia (NCBI Ref: NC_017861.1); Spiroplasma taiwanense (NCBI Ref: NC_021846.1); Streptococcus iniae (NCBI Ref: NC_021314.1); Belliella baltica (NCBI Ref: NC_018010.1); Psychroflexus torquis (NCBI Ref: NC_018721.1); Streptococcus thermophilus (NCBI Ref: YP_820832.1); Listeria innocua
  • Cas9 domains of Nucleobase Editors [0507] Cas9 nuclease sequences and structures are well known to those of skill in the art (See, e.g., “Complete genome sequence of an Ml strain of Streptococcus pyogenes.” Ferretti et al., Proc. Natl. Acad. Sci.
  • a nucleic acid programmable DNA binding protein (napDNAbp) is a Cas9 domain.
  • Non-limiting, exemplary Cas9 domains are provided herein.
  • the Cas9 domain may be a nuclease active Cas9 domain, a nuclease inactive Cas9 domain (dCas9), or a Cas9 nickase (nCas9).
  • the Cas9 domain is a nuclease active domain.
  • the Cas9 domain may be a Cas9 domain that cuts both strands of a duplexed nucleic acid (e.g., both strands of a duplexed DNA molecule).
  • the Cas9 domain comprises any one of the amino acid sequences as set forth herein.
  • the Cas9 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences set forth herein.
  • the Cas9 domain comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more mutations compared to any one of the amino acid sequences set forth herein.
  • the Cas9 domain comprises an amino acid sequence that has at least 10, at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, or at least 1200 identical contiguous amino acid residues as compared to any one of the amino acid sequences set forth herein. [0509] In some embodiments, proteins comprising fragments of Cas9 are provided.
  • a protein comprises one of two Cas9 domains: (1) the gRNA binding domain of Cas9; or (2) the DNA cleavage domain of Cas9.
  • proteins comprising Cas9 or fragments thereof are referred to as “Cas9 variants.”
  • a Cas9 variant shares homology to Cas9, or a fragment thereof.
  • a Cas9 variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to wild-type Cas9.
  • the Cas9 variant may have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more amino acid changes compared to wild- type Cas9.
  • the Cas9 variant comprises a fragment of Cas9 (e.g., a gRNA binding domain or a DNA-cleavage domain), such that the fragment is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to the corresponding fragment of wild-type Cas9.
  • a fragment of Cas9 e.g., a gRNA binding domain or a DNA-cleavage domain
  • the fragment is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% of the amino acid length of a corresponding wild-type Cas9.
  • the fragment is at least 100 amino acids in length.
  • the fragment is at least 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, or at least 1300 amino acids in length.
  • Cas9 fusion proteins as provided herein comprise the full-length amino acid sequence of a Cas9 protein, e.g., one of the Cas9 sequences provided herein. In other embodiments, however, fusion proteins as provided herein do not comprise a full-length Cas9 sequence, but only one or more fragments thereof.
  • a Cas9 protein can associate with a guide RNA that guides the Cas9 protein to a specific DNA sequence that has complementary to the guide RNA.
  • the polynucleotide programmable nucleotide binding domain is a Cas9 domain, for example a nuclease active Cas9, a Cas9 nickase (nCas9), or a nuclease inactive Cas9 (dCas9).
  • nucleic acid programmable DNA binding proteins include, without limitation, Cas9 (e.g., dCas9 and nCas9), Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, Cas12i, and Cas12j/CasF.
  • Cas enzymes include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas5d, Cas5t, Cas5h, Cas5a, Cas6, Cas7, Cas8, Cas8a, Cas8b, Cas8c, Cas9 (also known as Csn1 or Csx12), Cas10, Cas10d, Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, Cas12i, Cas12j/CasF, Csy1 , Csy2, Csy3, Csy4, Cse1, Cse2, Cse3, Cse4, Cse5e, Csc1, Csc2, Csa5, Csn1, Csn2, Csm1, Csm2, Csm3, Csm4, Csm5, Cs
  • wild-type Cas9 corresponds to Cas9 from Streptococcus pyogenes (NCBI Reference Sequence: NC_017053.1).
  • An exemplary Streptococcus pyogenes Cas9 (spCas9) nucleic acid sequence is provided below:
  • Streptococcus pyogenes Cas9 (spCas9) amino acid sequence is provided below:
  • wild-type Cas9 corresponds to, or comprises the following nucleotide sequences:
  • wild-type Cas9 corresponds to, or comprises the following amino acid sequence: (single underline: HNH domain; double underline: RuvC domain) [0518]
  • Cas9 refers to Cas9 from: Corynebacterium ulcerans (NCBI Refs: NC_015683.1, NC_017317.1); Corynebacterium diphtheria (NCBI Refs: NC_016782.1, NC_016786.1); Spiroplasma syrphidicola (NCBI Ref: NC_021284.1); Prevotella intermedia (NCBI Ref: NC_017861.1); Spiroplasma taiwanense (NCBI Ref: NC_021846.1); Streptococcus iniae (NCBI Ref: NC_021314.1); Belliella baltica (NCBI Ref: NC_018010.1); Psychroflexus torquisI (NCBI Ref: NC_0187
  • Cas9 proteins e.g., a nuclease dead Cas9 (dCas9), a Cas9 nickase (nCas9), or a nuclease active Cas9), including variants and homologs thereof, are within the scope of this disclosure.
  • Exemplary Cas9 proteins include, without limitation, those provided below.
  • the Cas9 protein is a nuclease dead Cas9 (dCas9).
  • the Cas9 protein is a Cas9 nickase (nCas9).
  • the Cas9 protein is a nuclease active Cas9.
  • the Cas9 domain is a nuclease-inactive Cas9 domain (dCas9).
  • the dCas9 domain may bind to a duplexed nucleic acid molecule (e.g., via a gRNA molecule) without cleaving either strand of the duplexed nucleic acid molecule.
  • the nuclease-inactive dCas9 domain comprises a D10X mutation and a H840X mutation of the amino acid sequence set forth herein, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid change.
  • the nuclease-inactive dCas9 domain comprises a D10A mutation and a H840A mutation of the amino acid sequence set forth herein, or a corresponding mutation in any of the amino acid sequences provided herein.
  • a nuclease-inactive Cas9 domain comprises the amino acid sequence set forth in Cloning vector pPlatTET-gRNA2 (Accession No. BAV54124).
  • the amino acid sequence of an exemplary catalytically inactive Cas9 (dCas9) is as follows: guided platform for sequence-specific control of gene expression.” Cell.2013; 152(5):1173-83, the entire contents of which are incorporated herein by reference).
  • nuclease-inactive dCas9 domains will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure.
  • Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D10A/H840A, D10A/D839A/H840A, and D10A/D839A/H840A/N863A mutant domains (See, e.g., Prashant et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology.2013; 31(9): 833-838, the entire contents of which are incorporated herein by reference).
  • a Cas9 nuclease has an inactive (e.g., an inactivated) DNA cleavage domain, that is, the Cas9 is a nickase, referred to as an “nCas9” protein (for “nickase” Cas9).
  • nCas9 nickase
  • a nuclease-inactivated Cas9 protein may interchangeably be referred to as a “dCas9” protein (for nuclease-”dead” Cas9) or catalytically inactive Cas9.
  • Methods for generating a Cas9 protein (or a fragment thereof) having an inactive DNA cleavage domain are known (See, e.g., Jinek et al., Science.337:816-821(2012); Qi et al., “Repurposing CRISPR as an RNA-Guided Platform for Sequence-Specific Control of Gene Expression” (2013) Cell.28;152(5):1173-83, the entire contents of each of which are incorporated herein by reference).
  • the DNA cleavage domain of Cas9 is known to include two subdomains, the HNH nuclease subdomain and the RuvC1 subdomain.
  • the HNH subdomain cleaves the strand complementary to the gRNA, whereas the RuvC1 subdomain cleaves the non-complementary strand. Mutations within these subdomains can silence the nuclease activity of Cas9. For example, the mutations D10A and H840A completely inactivate the nuclease activity of S. pyogenes Cas9 (Jinek et al., Science.337:816-821(2012); Qi et al., Cell.28;152(5):1173-83 (2013)).
  • the dCas9 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the dCas9 domains provided herein.
  • the Cas9 domain comprises an amino acid sequences that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more or more mutations compared to any one of the amino acid sequences set forth herein.
  • the Cas9 domain comprises an amino acid sequence that has at least 10, at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, or at least 1200 identical contiguous amino acid residues as compared to any one of the amino acid sequences set forth herein.
  • dCas9 corresponds to, or comprises in part or in whole, a Cas9 amino acid sequence having one or more mutations that inactivate the Cas9 nuclease activity.
  • the nuclease-inactive dCas9 domain comprises a D10X mutation and a H840X mutation of the amino acid sequence set forth herein, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid change.
  • the nuclease-inactive dCas9 domain comprises a D10A mutation and a H840A mutation of the amino acid sequence set forth herein, or a corresponding mutation in any of the amino acid sequences provided herein.
  • a nuclease-inactive Cas9 domain comprises the amino acid sequence set forth in Cloning vector pPlatTET-gRNA2 (Accession No. BAV54124).
  • the dCas9 comprises the amino acid sequence of dCas9 (D10A and H840A):
  • the amino acid sequence of an exemplary catalytically inactive Cas9 is as follows:
  • the amino acid sequence of an exemplary catalytically inactive Cas9 is as follows: [0529]
  • the Cas9 domain comprises a D10A mutation, while the residue at position 840 remains a histidine in the amino acid sequence provided above, or at corresponding positions in any of the amino acid sequences provided herein.
  • dCas9 variants having mutations other than D10A and H840A are provided, which, e.g., result in nuclease inactivated Cas9 (dCas9).
  • Such mutations include other amino acid substitutions at D10 and H840, or other substitutions within the nuclease domains of Cas9 (e.g., substitutions in the HNH nuclease subdomain and/or the RuvC1 subdomain).
  • variants or homologues of dCas9 are provided which are at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical.
  • variants of dCas9 are provided having amino acid sequences which are shorter, or longer, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids or more.
  • nuclease-inactive dCas9 domains will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure.
  • Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D10A/H840A, D10A/D839A/H840A, and D10A/D839A/H840A/N863A mutant domains (See, e.g., Prashant et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology.2013; 31(9): 833-838, the entire contents of which are incorporated herein by reference).
  • a Cas9 nuclease has an inactive (e.g., an inactivated) DNA cleavage domain, that is, the Cas9 is a nickase, referred to as an “nCas9” protein (for “nickase” Cas9).
  • the Cas9 nickase may be a Cas9 protein that is capable of cleaving only one strand of a duplexed nucleic acid molecule (e.g., a duplexed DNA molecule).
  • the Cas9 nickase cleaves the target strand of a duplexed nucleic acid molecule, meaning that the Cas9 nickase cleaves the strand that is base paired to (complementary to) a gRNA (e.g., an sgRNA) that is bound to the Cas9.
  • a Cas9 nickase comprises a D10A mutation and has a histidine at position 840.
  • the Cas9 nickase cleaves the non-target, non-base-edited strand of a duplexed nucleic acid molecule, meaning that the Cas9 nickase cleaves the strand that is not base paired to a gRNA (e.g., an sgRNA) that is bound to the Cas9.
  • a Cas9 nickase comprises an H840A mutation and has an aspartic acid residue at position 10, or a corresponding mutation.
  • the Cas9 nickase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the Cas9 nickases provided herein. Additional suitable Cas9 nickases will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure.
  • Cas9 refers to a Cas9 from archaea (e.g., nanoarchaea), which constitute a domain and kingdom of single-celled prokaryotic microbes.
  • the nucleic acid programmable DNA binding protein may be a CasX or CasY protein, which have been described in, for example, Burstein et al., “New CRISPR-Cas systems from uncultivated microbes.” Cell Res.2017 Feb 21. doi: 10.1038/cr.2017.21, the entire contents of which is hereby incorporated by reference.
  • Cas9 is replaced by CasX, or a variant of CasX.
  • Cas9 is replaced by CasY, or a variant of CasY.
  • RNA-guided DNA binding proteins may be used as a nucleic acid programmable DNA binding protein (napDNAbp), and are within the scope of this disclosure.
  • the nucleic acid programmable DNA binding protein (napDNAbp) of any of the fusion proteins provided herein may be a CasX or CasY protein.
  • the napDNAbp is a CasX protein.
  • the napDNAbp is a CasY protein.
  • the programmable nucleotide binding protein comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any CasX or CasY protein described herein.
  • the programmable nucleotide binding protein is a naturally-occurring CasX or CasY protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a naturally-occurring CasX or CasY protein. It should be appreciated that CasX and CasY from other bacterial species may also be used in accordance with the present disclosure.
  • An exemplary CasX ((uniprot.org/uniprot/F0NN87; uniprot.org/uniprot/F0NH53) tr
  • Cas9 undergoes a conformational change upon target binding that positions the nuclease domains to cleave opposite strands of the target DNA.
  • the end result of Cas9-mediated DNA cleavage is a double-strand break (DSB) within the target DNA ( ⁇ 3-4 nucleotides upstream of the PAM sequence).
  • the resulting DSB is then repaired by one of two general repair pathways: (1) the efficient but error-prone non-homologous end joining (NHEJ) pathway; or (2) the less efficient but high-fidelity homology directed repair (HDR) pathway.
  • NHEJ efficient but error-prone non-homologous end joining
  • HDR homology directed repair
  • efficiency can be expressed in terms of percentage of successful HDR.
  • a surveyor nuclease assay can be used to generate cleavage products and the ratio of products to substrate can be used to calculate the percentage.
  • a surveyor nuclease enzyme can be used that directly cleaves DNA containing a newly integrated restriction sequence as the result of successful HDR. More cleaved substrate indicates a greater percent HDR (a greater efficiency of HDR).
  • a fraction (percentage) of HDR can be calculated using the following equation [(cleavage products)/(substrate plus cleavage products)] (e.g., (b+c)/(a+b+c), where “a” is the band intensity of DNA substrate and “b” and “c” are the cleavage products).
  • efficiency can be expressed in terms of percentage of successful NHEJ.
  • a T7 endonuclease I assay can be used to generate cleavage products and the ratio of products to substrate can be used to calculate the percentage NHEJ.
  • T7 endonuclease I cleaves mismatched heteroduplex DNA which arises from hybridization of wild-type and mutant DNA strands (NHEJ generates small random insertions or deletions (indels) at the site of the original break). More cleavage indicates a greater percent NHEJ (a greater efficiency of NHEJ).
  • a fraction (percentage) of NHEJ can be calculated using the following equation: (1-(1-(b+c)/(a+b+c)) 1/2 ) ⁇ 100, where “a” is the band intensity of DNA substrate and “b” and “c” are the cleavage products (Ran et.
  • NHEJ repair pathway is the most active repair mechanism, and it frequently causes small nucleotide insertions or deletions (indels) at the DSB site.
  • the randomness of NHEJ- mediated DSB repair has important practical implications, because a population of cells expressing Cas9 and a gRNA or a guide polynucleotide can result in a diverse array of mutations.
  • NHEJ gives rise to small indels in the target DNA that result in amino acid deletions, insertions, or frameshift mutations leading to premature stop codons within the open reading frame (ORF) of the targeted gene.
  • ORF open reading frame
  • the ideal end result is a loss-of- function mutation within the targeted gene.
  • HDR homology directed repair
  • a DNA repair template containing the desired sequence can be delivered into the cell type of interest with the gRNA(s) and Cas9 or Cas9 nickase.
  • the repair template can contain the desired edit as well as additional homologous sequence immediately upstream and downstream of the target (termed left & right homology arms). The length of each homology arm can be dependent on the size of the change being introduced, with larger insertions requiring longer homology arms.
  • the repair template can be a single-stranded oligonucleotide, double-stranded oligonucleotide, or a double-stranded DNA plasmid.
  • the efficiency of HDR is generally low ( ⁇ 10% of modified alleles) even in cells that express Cas9, gRNA and an exogenous repair template.
  • the efficiency of HDR can be enhanced by synchronizing the cells, since HDR takes place during the S and G2 phases of the cell cycle. Chemically or genetically inhibiting genes involved in NHEJ can also increase HDR frequency.
  • Cas9 is a modified Cas9.
  • a given gRNA targeting sequence can have additional sites throughout the genome where partial homology exists. These sites are called off-targets and need to be considered when designing a gRNA.
  • CRISPR specificity can also be increased through modifications to Cas9.
  • Cas9 generates double-strand breaks (DSBs) through the combined activity of two nuclease domains, RuvC and HNH.
  • Cas9 nickase a D10A mutant of SpCas9, retains one nuclease domain and generates a DNA nick rather than a DSB.
  • the nickase system can also be combined with HDR- mediated gene editing for specific gene edits.
  • Cas9 is a variant Cas9 protein.
  • a variant Cas9 polypeptide has an amino acid sequence that is different by one amino acid (e.g., has a deletion, insertion, substitution, fusion) when compared to the amino acid sequence of a wild-type Cas9 protein.
  • the variant Cas9 polypeptide has an amino acid change (e.g., deletion, insertion, or substitution) that reduces the nuclease activity of the Cas9 polypeptide.
  • the variant Cas9 polypeptide has less than 50%, less than 40%, less than 30%, less than 20%, less than 10%, less than 5%, or less than 1% of the nuclease activity of the corresponding wild-type Cas9 protein.
  • the variant Cas9 protein has no substantial nuclease activity.
  • a variant Cas9 protein When a subject Cas9 protein is a variant Cas9 protein that has no substantial nuclease activity, it can be referred to as “dCas9.” [0548] In some embodiments, a variant Cas9 protein has reduced nuclease activity. For example, a variant Cas9 protein exhibits less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 1%, or less than about 0.1%, of the endonuclease activity of a wild-type Cas9 protein, e.g., a wild-type Cas9 protein.
  • a variant Cas9 protein can cleave the complementary strand of a guide target sequence but has reduced ability to cleave the non-complementary strand of a double stranded guide target sequence.
  • the variant Cas9 protein can have a mutation (amino acid substitution) that reduces the function of the RuvC domain.
  • a variant Cas9 protein has a D10A (aspartate to alanine at amino acid position 10) and can therefore cleave the complementary strand of a double stranded guide target sequence but has reduced ability to cleave the non-complementary strand of a double stranded guide target sequence (thus resulting in a single strand break (SSB) instead of a double strand break (DSB) when the variant Cas9 protein cleaves a double stranded target nucleic acid) (see, for example, Jinek et al., Science.2012 Aug.17; 337(6096):816-21).
  • SSB single strand break
  • DSB double strand break
  • a variant Cas9 protein can cleave the non-complementary strand of a double stranded guide target sequence but has reduced ability to cleave the complementary strand of the guide target sequence.
  • the variant Cas9 protein can have a mutation (amino acid substitution) that reduces the function of the HNH domain (RuvC/HNH/RuvC domain motifs).
  • the variant Cas9 protein has an H840A (histidine to alanine at amino acid position 840) mutation and can therefore cleave the non-complementary strand of the guide target sequence but has reduced ability to cleave the complementary strand of the guide target sequence (thus resulting in a SSB instead of a DSB when the variant Cas9 protein cleaves a double stranded guide target sequence).
  • H840A histidine to alanine at amino acid position 840
  • Such a Cas9 protein has a reduced ability to cleave a guide target sequence (e.g., a single stranded guide target sequence) but retains the ability to bind a guide target sequence (e.g., a single stranded guide target sequence).
  • a variant Cas9 protein has a reduced ability to cleave both the complementary and the non-complementary strands of a double stranded target DNA.
  • the variant Cas9 protein harbors both the D10A and the H840A mutations such that the polypeptide has a reduced ability to cleave both the complementary and the non-complementary strands of a double stranded target DNA.
  • Such a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors W476A and W1126A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors P475A, W476A, N477A, D1125A, W1126A, and D1127A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors H840A, W476A, and W1126A, mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors H840A, D10A, W476A, and W1126A, mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • Such a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 has restored catalytic His residue at position 840 in the Cas9 HNH domain (A840H).
  • the variant Cas9 protein harbors, H840A, P475A, W476A, N477A, D1125A, W1126A, and D1127A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • Such a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors D10A, H840A, P475A, W476A, N477A, D1125A, W1126A, and D1127A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • Such a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • a target DNA e.g., a single stranded target DNA
  • the variant Cas9 protein does not bind efficiently to a PAM sequence.
  • the method does not require a PAM sequence.
  • the method when such a variant Cas9 protein is used in a method of binding, can include a guide RNA, but the method can be performed in the absence of a PAM sequence (and the specificity of binding is therefore provided by the targeting segment of the guide RNA).
  • Other residues can be mutated to achieve the above effects (i.e., inactivate one or the other nuclease portions).
  • residues D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or A987 can be altered (i.e., substituted).
  • mutations other than alanine substitutions are suitable.
  • a variant Cas9 protein that has reduced catalytic activity e.g., when a Cas9 protein has a D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or a A987 mutation, e.g., D10A, G12A, G17A, E762A, H840A, N854A, N863A, H982A, H983A, A984A, and/or D986A), the variant Cas9 protein can still bind to target DNA in a site- specific manner (because it is still guided to a target DNA sequence by a guide RNA) as long as it retains the ability to interact with the guide RNA.
  • the variant Cas9 protein can still bind to target DNA in a site- specific manner (because it is still guided to a target DNA sequence by a guide RNA) as long as it retains the ability to interact with the guide RNA.
  • the variant Cas protein can be spCas9, spCas9-VRQR, spCas9- VRER, xCas9 (sp), saCas9, saCas9-KKH, spCas9-MQKSER, spCas9-LRKIQK, or spCas9- LRVSQL.
  • a modified SpCas9 including amino acid substitutions D1135M, S1136Q, G1218K, E1219F, A1322R, D1332A, R1335E, and T1337R (SpCas9-MQKFRAER) and having specificity for the altered PAM 5’-NGC-3’ was used.
  • Alternatives to S. pyogenes Cas9 can include RNA-guided endonucleases from the Cpf1 family that display cleavage activity in mammalian cells.
  • CRISPR from Prevotella and Francisella 1 (CRISPR/Cpf1) is a DNA-editing technology analogous to the CRISPR/Cas9 system.
  • Cpf1 is an RNA-guided endonuclease of a class II CRISPR/Cas system. This acquired immune mechanism is found in Prevotella and Francisella bacteria. Cpf1 genes are associated with the CRISPR locus, coding for an endonuclease that use a guide RNA to find and cleave viral DNA. Cpf1 is a smaller and simpler endonuclease than Cas9, overcoming some of the CRISPR/Cas9 system limitations. Unlike Cas9 nucleases, the result of Cpf1-mediated DNA cleavage is a double-strand break with a short 3 ⁇ overhang.
  • Cpf1 staggered cleavage pattern can open up the possibility of directional gene transfer, analogous to traditional restriction enzyme cloning, which can increase the efficiency of gene editing.
  • Cpf1 can also expand the number of sites that can be targeted by CRISPR to AT-rich regions or AT-rich genomes that lack the NGG PAM sites favored by SpCas9.
  • the Cpf1 locus contains a mixed alpha/beta domain, a RuvC-I followed by a helical region, a RuvC-II and a zinc finger-like domain.
  • the Cpf1 protein has a RuvC-like endonuclease domain that is similar to the RuvC domain of Cas9.
  • Cpf1 unlike Cas9, does not have a HNH endonuclease domain, and the N- terminal of Cpf1 does not have the alpha-helical recognition lobe of Cas9.
  • Cpf1 CRISPR-Cas domain architecture shows that Cpf1 is functionally unique, being classified as Class 2, type V CRISPR system.
  • the Cpf1 loci encode Cas1, Cas2 and Cas4 proteins that are more similar to types I and III than type II systems.
  • Functional Cpf1 does not require the trans-activating CRISPR RNA (tracrRNA), therefore, only CRISPR (crRNA) is required.
  • Cpf1 is not only smaller than Cas9, but also it has a smaller sgRNA molecule (approximately half as many nucleotides as Cas9).
  • the Cpf1-crRNA complex cleaves target DNA or RNA by identification of a protospacer adjacent motif 5’-YTN-3’ or 5’-TTN-3’ in contrast to the G-rich PAM targeted by Cas9.
  • Cpf1 introduces a sticky-end-like DNA double- stranded break having an overhang of 4 or 5 nucleotides.
  • the Cas9 is a Cas9 variant having specificity for an altered PAM sequence.
  • the Additional Cas9 variants and PAM sequences are described in Miller, S.M., et al. Continuous evolution of SpCas9 variants compatible with non-G PAMs, Nat. Biotechnol. (2020), the entirety of which is incorporated herein by reference.
  • a Cas9 variate have no specific PAM requirements.
  • a Cas9 variant, e.g. a SpCas9 variant has specificity for a NRNH PAM, wherein R is A or G and H is A, C, or T.
  • the SpCas9 variant has specificity for a PAM sequence AAA, TAA, CAA, GAA, TAT, GAT, or CAC.
  • the SpCas9 variant comprises an amino acid substitution at position 1114, 1134, 1135, 1137, 1139, 1151, 1180, 1188, 1211, 1218, 1219, 1221, 1249, 1256, 1264, 1290, 1318, 1317, 1320, 1321, 1323, 1332, 1333, 1335, 1337, or 1339 or a corresponding position thereof.
  • the SpCas9 variant comprises an amino acid substitution at position 1114, 1135, 1218, 1219, 1221, 1249, 1320, 1321, 1323, 1332, 1333, 1335, or 1337 or a corresponding position thereof.
  • the SpCas9 variant comprises an amino acid substitution at position 1114, 1134, 1135, 1137, 1139, 1151, 1180, 1188, 1211, 1219, 1221, 1256, 1264, 1290, 1318, 1317, 1320, 1323, 1333 or a corresponding position thereof.
  • the SpCas9 variant comprises an amino acid substitution at position 1114, 1131, 1135, 1150, 1156, 1180, 1191, 1218, 1219, 1221, 1227, 1249, 1253, 1286, 1293, 1320, 1321, 1332, 1335, 1339 or a corresponding position thereof.
  • the SpCas9 variant comprises an amino acid substitution at position 1114, 1127, 1135, 1180, 1207, 1219, 1234, 1286, 1301, 1332, 1335, 1337, 1338, 1349 or a corresponding position thereof.
  • Exemplary amino acid substitutions and PAM specificity of SpCas9 variants are shown in Tables 3A-3D. Table 3A SpCas9 Variants
  • the Cas9 is a Neisseria meningitidis Cas9 (NmeCas9) or a variant thereof.
  • the NmeCas9 has specificity for a NNNNGAYW PAM, wherein Y is C or T and W is A or T.
  • the NmeCas9 has specificity for a NNNNGYTT PAM, wherein Y is C or T.
  • the NmeCas9 has specificity for a NNNNGTCT PAM.
  • the NmeCas9 is a Nme1 Cas9.
  • the NmeCas9 has specificity for a NNNNGATT PAM, a NNNNCCTA PAM, a NNNNCCTC PAM, a NNNNCCTT PAM, a NNNNCCTG PAM, a NNNNCCGT PAM, a NNNNCCGGPAM, a NNNNCCCA PAM, a NNNNCCCT PAM, a NNNNCCCC PAM, a NNNNCCAT PAM, a NNNNCCAG PAM, a NNNNCCAT PAM, or a NNNGATT PAM.
  • the Nme1Cas9 has specificity for a NNNNGATT PAM, a NNNNCCTA PAM, a NNNNCCTC PAM, a NNNNCCTT PAM, or a NNNNCCTG PAM. In some embodiments, the NmeCas9 has specificity for a CAA PAM, a CAAA PAM, or a CCA PAM. In some embodiments, the NmeCas9 is a Nme2 Cas9. In some embodiments, the NmeCas9 has specificity for a NNNNCC (N4CC) PAM, wherein N is any one of A, G, C, or T.
  • N4CC NNNNCC
  • the NmeCas9 has specificity for a NNNNCCGT PAM, a NNNNCCGGPAM, a NNNNCCCA PAM, a NNNNCCCT PAM, a NNNNCCCC PAM, a NNNNCCAT PAM, a NNNNCCAG PAM, a NNNNCCAT PAM, or a NNNGATT PAM.
  • the NmeCas9 is a Nme3Cas9.
  • the NmeCas9 has specificity for a NNNNCAAA PAM, a NNNNCC PAM, or a NNNNCNNN PAM.
  • NmeCas9 features and PAM sequences as described in Edraki et al. Mol. Cell. (2019) 73(4): 714-726 is incorporated herein by reference in its entirety.
  • An exemplary Neisseria meningitidis Cas9 protein, Nme1Cas9, (NCBI Reference: WP_002235162.1; type II CRISPR RNA-guided endonuclease Cas9) has the following amino acid sequence:
  • An exemplary Neisseria meningitidis Cas9 protein, Nme2Cas9, (NCBI Reference: WP_002230835; type II CRISPR RNA-guided endonuclease Cas9) has the following amino acid sequence: Cas12 domains of Nucleobase Editors [0565] Typically, microbial CRISPR-Cas systems are divided into Class 1 and Class 2 systems.
  • Class 1 systems have multisubunit effector complexes, while Class 2 systems have a single protein effector.
  • Cas9 and Cpf1 are Class 2 effectors, albeit different types (Type II and Type V, respectively).
  • Type V CRISPR-Cas systems also comprise Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, Cas12i and Cas12j/CasF). See, e.g., Shmakov et al., “Discovery and Functional Characterization of Diverse Class 2 CRISPR Cas Systems,” Mol.
  • Type V Cas proteins contain a RuvC (or RuvC-like) endonuclease domain. While production of mature CRISPR RNA (crRNA) is generally tracrRNA- independent, Cas12b/C2c1, for example, requires tracrRNA for production of crRNA.
  • Cas12b/C2c1 depends on both crRNA and tracrRNA for DNA cleavage.
  • Nucleic acid programmable DNA binding proteins contemplated in the present invention include Cas proteins that are classified as Class 2, Type V (Cas12 proteins).
  • Cas Class 2, Type V proteins include Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, Cas12i, and Cas12j/CasF homologues thereof, or modified versions thereof.
  • a Cas12 protein can also be referred to as a Cas12 nuclease, a Cas12 domain, or a Cas12 protein domain.
  • the Cas12 proteins of the present invention comprise an amino acid sequence interrupted by an internally fused protein domain such as a deaminase domain.
  • the Cas12 domain is a nuclease inactive Cas12 domain or a Cas12 nickase.
  • the Cas12 domain is a nuclease active domain.
  • the Cas12 domain may be a Cas12 domain that nicks one strand of a duplexed nucleic acid (e.g., duplexed DNA molecule).
  • the Cas12 domain comprises any one of the amino acid sequences as set forth herein.
  • the Cas12 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences set forth herein.
  • the Cas12 domain comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more mutations compared to any one of the amino acid sequences set forth herein.
  • the Cas12 domain comprises an amino acid sequence that has at least 10, at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, or at least 1200 identical contiguous amino acid residues as compared to any one of the amino acid sequences set forth herein.
  • proteins comprising fragments of Cas12 are provided.
  • a protein comprises one of two Cas12 domains: (1) the gRNA binding domain of Cas12; or (2) the DNA cleavage domain of Cas12.
  • proteins comprising Cas12 or fragments thereof are referred to as “Cas12 variants.”
  • a Cas12 variant shares homology to Cas12, or a fragment thereof.
  • a Cas12 variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to wild type Cas12.
  • the Cas12 variant may have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more amino acid changes compared to wild type Cas12.
  • the Cas12 variant comprises a fragment of Cas12 (e.g., a gRNA binding domain or a DNA cleavage domain), such that the fragment is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to the corresponding fragment of wild type Cas12.
  • a fragment of Cas12 e.g., a gRNA binding domain or a DNA cleavage domain
  • the fragment is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% of the amino acid length of a corresponding wild type Cas12.
  • the fragment is at least 100 amino acids in length.
  • the fragment is at least 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, or at least 1300 amino acids in length.
  • Cas12 corresponds to, or comprises in part or in whole, a Cas12 amino acid sequence having one or more mutations that alter the Cas12 nuclease activity. Such mutations, by way of example, include amino acid substitutions within the RuvC nuclease domain of Cas12.
  • variants or homologues of Cas12 are provided which are at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to a wild type Cas12.
  • variants of Cas12 are provided having amino acid sequences which are shorter, or longer, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids or more.
  • Cas12 fusion proteins as provided herein comprise the full-length amino acid sequence of a Cas12 protein, e.g., one of the Cas12 sequences provided herein. In other embodiments, however, fusion proteins as provided herein do not comprise a full-length Cas12 sequence, but only one or more fragments thereof. Exemplary amino acid sequences of suitable Cas12 domains are provided herein, and additional suitable sequences of Cas12 domains and fragments will be apparent to those of skill in the art.
  • Type V Cas proteins have a single functional RuvC endonuclease domain (See, e.g., Chen et al., “CRISPR-Cas12a target binding unleashes indiscriminate single- stranded DNase activity,” Science 360:436-439 (2016)).
  • the Cas12 protein is a variant Cas12b protein. (See Strecker et al., Nature Communications, 2019, 10(1): Art. No.: 212).
  • a variant Cas12 polypeptide has an amino acid sequence that is different by 1, 2, 3, 4, 5 or more amino acids (e.g., has a deletion, insertion, substitution, fusion) when compared to the amino acid sequence of a wild type Cas12 protein.
  • the variant Cas12 polypeptide has an amino acid change (e.g., deletion, insertion, or substitution) that reduces the activity of the Cas12 polypeptide.
  • the variant Cas12 is a Cas12b polypeptide that has less than 50%, less than 40%, less than 30%, less than 20%, less than 10%, less than 5%, or less than 1% of the nickase activity of the corresponding wild-type Cas12b protein.
  • the variant Cas12b protein has no substantial nickase activity.
  • a variant Cas12b protein has reduced nickase activity.
  • a variant Cas12b protein exhibits less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 1%, or less than about 0.1%, of the nickase activity of a wild- type Cas12b protein.
  • the Cas12 protein includes RNA-guided endonucleases from the Cas12a/Cpf1 family that displays activity in mammalian cells.
  • CRISPR from Prevotella and Francisella 1 is a DNA editing technology analogous to the CRISPR/Cas9 system.
  • Cpf1 is an RNA-guided endonuclease of a class II CRISPR/Cas system. This acquired immune mechanism is found in Prevotella and Francisella bacteria.
  • Cpf1 genes are associated with the CRISPR locus, coding for an endonuclease that use a guide RNA to find and cleave viral DNA.
  • Cpf1 is a smaller and simpler endonuclease than Cas9, overcoming some of the CRISPR/Cas9 system limitations.
  • Cpf1-mediated DNA cleavage is a double-strand break with a short 3 ⁇ overhang.
  • Cpf1’s staggered cleavage pattern can open up the possibility of directional gene transfer, analogous to traditional restriction enzyme cloning, which can increase the efficiency of gene editing.
  • Cpf1 can also expand the number of sites that can be targeted by CRISPR to AT-rich regions or AT-rich genomes that lack the NGG PAM sites favored by SpCas9.
  • the Cpf1 locus contains a mixed alpha/beta domain, a RuvC-I followed by a helical region, a RuvC-II and a zinc finger-like domain.
  • the Cpf1 protein has a RuvC-like endonuclease domain that is similar to the RuvC domain of Cas9.
  • Cpf1 unlike Cas9, does not have a HNH endonuclease domain, and the N-terminal of Cpf1 does not have the alpha-helical recognition lobe of Cas9.
  • Cpf1 CRISPR-Cas domain architecture shows that Cpf1 is functionally unique, being classified as Class 2, type V CRISPR system.
  • the Cpf1-crRNA complex cleaves target DNA or RNA by identification of a protospacer adjacent motif 5’-YTN-3’ or 5’-TTTN-3’ in contrast to the G-rich PAM targeted by Cas9.
  • a vector encodes a CRISPR enzyme that is mutated to with respect to a corresponding wild-type enzyme such that the mutated CRISPR enzyme lacks the ability to cleave one or both strands of a target polynucleotide containing a target sequence can be used.
  • Cas12 can refer to a polypeptide with at least or at least about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity and/or sequence homology to a wild type exemplary Cas12 polypeptide (e.g., Cas12 from Bacillus hisashii).
  • a wild type exemplary Cas12 polypeptide e.g., Cas12 from Bacillus hisashii.
  • Cas12 can refer to a polypeptide with at most or at most about 50%, 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity and/or sequence homology to a wild type exemplary Cas12 polypeptide (e.g., from Bacillus hisashii (BhCas12b), Bacillus sp. V3-13 (BvCas12b), and Alicyclobacillus acidiphilus (AaCas12b)).
  • a wild type exemplary Cas12 polypeptide e.g., from Bacillus hisashii (BhCas12b), Bacillus sp. V3-13 (BvCas12b), and Alicyclobacillus acidiphilus (AaCas12b)).
  • Cas12 can refer to the wild type or a modified form of the Cas12 protein that can comprise an amino acid change such as a deletion, insertion, substitution, variant, mutation, fusion, chimera, or any combination thereof.
  • BhCas12b guide polynucleotide has the following sequence: BhCas12b sgRNA scaffold (underlined) + 20nt to 23nt guide sequence (denoted by Nn)
  • BvCas12b and AaCas12b guide polynucleotides have the following sequences: BvCas12b sgRNA scaffold (underlined) + 20nt to 23nt guide sequence (denoted by N n ) AaCas12b sgRNA scaffold (underlined) + 20nt to 23nt guide sequence (denoted by N n ) Nucleic acid programmable DNA binding proteins [0577]
  • a fusion protein comprises a nucleic acid programmable DNA binding protein domain and a deaminase domain.
  • nucleic acid programmable DNA binding proteins include, Cas9 (e.g., dCas9 and nCas9), Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, Cas12i and Cas12j/CasF.
  • Non- limiting examples of Cas enzymes include Cas1, Cas1B, Cas2, Cas3, Cas4, Cas5, Cas5d, Cas5t, Cas5h, Cas5a, Cas6, Cas7, Cas8, Cas8a, Cas8b, Cas8c, Cas9 (also known as Csn1 or Csx12), Cas10, Cas10d, Cas12a/Cpfl, Cas12b/C2cl, Cas12c/C2c3, Cas12d/CasY, Cas12e/CasX, Cas12g, Cas12h, Cas12i, Cas12j/CasF, Csy1 , Csy2, Csy3, Csy4, Cse1, Cse2, Cse3, Cse4, Cse5e, Csc1, Csc2, Csa5, Csn1, Csn2, Csm1, Csm2, Csm3, Csm4, Csm5,
  • nucleic acid programmable DNA binding proteins are also within the scope of this disclosure, although they may not be specifically listed in this disclosure. See, e.g., Makarova et al. “Classification and Nomenclature of CRISPR-Cas Systems: Where from Here?” CRISPR J.2018 Oct;1:325-336. doi: 10.1089/crispr.2018.0033; Yan et al., “Functionally diverse type V CRISPR-Cas systems” Science.2019 Jan 4;363(6422):88-91. doi: 10.1126/science.aav7271, the entire contents of each are hereby incorporated by reference.
  • Cpf1 Clustered Regularly Interspaced Short Palindromic Repeats from Prevotella and Francisella 1 (Cpf1). Similar to Cas9, Cpf1 is also a class 2 CRISPR effector. It has been shown that Cpf1 mediates robust DNA interference with features distinct from Cas9. Cpf1 is a single RNA-guided endonuclease lacking tracrRNA, and it utilizes a T-rich protospacer-adjacent motif (TTN, TTTN, or YTN). Moreover, Cpf1 cleaves DNA via a staggered DNA double-stranded break.
  • TTN T-rich protospacer-adjacent motif
  • Cpf1-family proteins Two enzymes from Acidaminococcus and Lachnospiraceae are shown to have efficient genome-editing activity in human cells.
  • Cpf1 proteins are known in the art and have been described previously, for example Yamano et al., “Crystal structure of Cpf1 in complex with guide RNA and target DNA.” Cell (165) 2016, p.949-962; the entire contents of which is hereby incorporated by reference.
  • Useful in the present compositions and methods are nuclease-inactive Cpf1 (dCpf1) variants that may be used as a guide nucleotide sequence-programmable DNA-binding protein domain.
  • the Cpf1 protein has a RuvC-like endonuclease domain that is similar to the RuvC domain of Cas9 but does not have a HNH endonuclease domain, and the N-terminal of Cpf1 does not have the alfa-helical recognition lobe of Cas9. It was shown in Zetsche et al., Cell, 163, 759-771, 2015 (which is incorporated herein by reference) that, the RuvC-like domain of Cpf1 is responsible for cleaving both DNA strands and inactivation of the RuvC-like domain inactivates Cpf1 nuclease activity.
  • the dCpf1 of the present disclosure comprises mutations corresponding to D917A, E1006A, D1255A, D917A/E1006A, D917A/D1255A, E1006A/D1255A, or D917A/E1006A/D1255A. It is to be understood that any mutations, e.g., substitution mutations, deletions, or insertions that inactivate the RuvC domain of Cpf1, may be used in accordance with the present disclosure.
  • the nucleic acid programmable DNA binding protein (napDNAbp) of any of the fusion proteins provided herein may be a Cpf1 protein.
  • the Cpf1 protein is a Cpf1 nickase (nCpf1).
  • the Cpf1 protein is a nuclease inactive Cpf1 (dCpf1).
  • the Cpf1, the nCpf1, or the dCpf1 comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a Cpf1 sequence disclosed herein.
  • the dCpf1 comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a Cpf1 sequence disclosed herein, and comprises mutations corresponding to D917A, E1006A, D1255A, D917A/E1006A, D917A/D1255A, E1006A/D1255A, or D917A/E1006A/D1255A. It should be appreciated that Cpf1 from other bacterial species may also be used in accordance with the present disclosure.
  • Francisella novicida Cpf1 E1006A (D917, A1006, and D1255 are bolded and underlined)
  • Francisella novicida Cpf1 D1255A (D917, E1006, and A1255 are bolded and underlined)
  • Francisella novicida Cpf1 D917A/E1006A (A917, A1006, and D1255 are bolded and underlined)
  • Francisella novicida Cpf1 D917A/D1255A (A917, E1006, and A1255 are bolded and underlined)
  • Francisella novicida Cpf1 E1006A/D1255A (D917, A1006, and A1255 are bolded and underlined)
  • Francisella novicida Cpf1 D917A/E1006A/D1255A (A917, A1006, and A1255 are bolded and underlined)
  • one of the Cas9 domains present in the fusion protein may be replaced with a guide nucleotide sequence-programmable DNA-binding protein domain that has no requirements for a PAM sequence.
  • the Cas9 domain is a Cas9 domain from Staphylococcus aureus (SaCas9).
  • the SaCas9 domain is a nuclease active SaCas9, a nuclease inactive SaCas9 (SaCas9d), or a SaCas9 nickase (SaCas9n).
  • the SaCas9 comprises a N579A mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SaCas9 domain, the SaCas9d domain, or the SaCas9n domain can bind to a nucleic acid sequence having a non-canonical PAM.
  • the SaCas9 domain, the SaCas9d domain, or the SaCas9n domain can bind to a nucleic acid sequence having a NNGRRT or a NNGRRT PAM sequence.
  • the SaCas9 domain comprises one or more of a E781X, a N967X, and a R1014X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SaCas9 domain comprises one or more of a E781K, a N967K, and a R1014H mutation, or one or more corresponding mutation in any of the amino acid sequences provided herein.
  • the SaCas9 domain comprises a E781K, a N967K, or a R1014H mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • Exemplary SaCas9 sequence Residue N579 above may be mutated (e.g., to a A579) to yield a SaCas9 nickase.
  • Exemplary SaCas9n sequence Residue A579 above which can be mutated from N579 to yield a SaCas9 nickase, is underlined and in bold.
  • Exemplary SaKKH Cas9 Residue A579 above which can be mutated from N579 to yield a SaCas9 nickase, is underlined and in bold.
  • Residues K781, K967, and H1014 above, which can be mutated from E781, N967, and R1014 to yield a SaKKH Cas9 are underlined and in italics.
  • the napDNAbp is a circular permutant.
  • the plain text denotes an adenosine deaminase sequence
  • bold sequence indicates sequence derived from Cas9
  • the italicized sequence denotes a linker sequence
  • the underlined sequence denotes a bipartite nuclear localization sequence
  • double underlined sequence indicates mutations.
  • the asterisk (*) denotes a STOP codon.
  • the nucleic acid programmable DNA binding protein is a single effector of a microbial CRISPR-Cas system.
  • Single effectors of microbial CRISPR-Cas systems include, without limitation, Cas9, Cpf1, Cas12b/C2c1, and Cas12c/C2c3.
  • microbial CRISPR-Cas systems are divided into Class 1 and Class 2 systems.
  • Class 1 systems have multisubunit effector complexes, while Class 2 systems have a single protein effector.
  • Cas9 and Cpf1 are Class 2 effectors.
  • three distinct Class 2 CRISPR-Cas systems (Cas12b/C2c1, and Cas12c/C2c3) have been described by Shmakov et al., “Discovery and Functional Characterization of Diverse Class 2 CRISPR Cas Systems”, Mol. Cell, 2015 Nov.5; 60(3): 385-397, the entire contents of which is hereby incorporated by reference.
  • a third system contains an effector with two predicated HEPN RNase domains.
  • Production of mature CRISPR RNA is tracrRNA-independent, unlike production of CRISPR RNA by Cas12b/C2c1.
  • Cas12b/C2c1 depends on both CRISPR RNA and tracrRNA for DNA cleavage.
  • AcC2c1 The crystal structure of Alicyclobaccillus acidoterrastris Cas12b/C2c1 (AacC2c1) has been reported in complex with a chimeric single-molecule guide RNA (sgRNA). See e.g., Liu et al., “C2c1-sgRNA Complex Structure Reveals RNA-Guided DNA Cleavage Mechanism”, Mol. Cell, 2017 Jan.19; 65(2):310-322, the entire contents of which are hereby incorporated by reference. The crystal structure has also been reported in Alicyclobacillus acidoterrestris C2c1 bound to target DNAs as ternary complexes.
  • sgRNA chimeric single-molecule guide RNA
  • the nucleic acid programmable DNA binding protein (napDNAbp) of any of the fusion proteins provided herein may be a Cas12b/C2c1, or a Cas12c/C2c3 protein.
  • the napDNAbp is a Cas12b/C2c1 protein.
  • the napDNAbp is a Cas12c/C2c3 protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a naturally-occurring Cas12b/C2c1 or Cas12c/C2c3 protein.
  • the napDNAbp is a naturally-occurring Cas12b/C2c1 or Cas12c/C2c3 protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any one of the napDNAbp sequences provided herein. It should be appreciated that Cas12b/C2c1 or Cas12c/C2c3 from other bacterial species may also be used in accordance with the present disclosure.
  • a Cas12b/C2c1 ((uniprot.org/uniprot/T0D7A2#2) sp
  • BhCas12b (V4) is expressed as follows: 5’ mRNA Cap---5’UTR---bhCas12b---STOP sequence - -- 3’UTR --- 120polyA tail. 5’UTR: 3’ UTR (TriLink standard UTR) Nucleic acid sequence of bhCas12b (V4)
  • the Cas12b is BvCas12B.
  • the Cas12b comprises amino acid substitutions S893R, K846R, and E837G as numbered in the BvCas12b exemplary sequence provided below.
  • BvCas12b (Bacillus sp. V3-13) NCBI Reference Sequence: WP_101661451.1
  • the Cas12b is BTCas12b.BTCas12b (Bacillus thermoamylovorans) NCBI Reference Sequence: WP_041902512
  • a napDNAbp refers to Cas12c.
  • the Cas12c protein is a Cas12c1 or a variant of Cas12c1.
  • the Cas12 protein is a Cas12c2 or a variant of Cas12c2.
  • the Cas12 protein is a Cas12c protein from Oleiphilus sp.
  • HI0009 i.e., OspCas12c
  • OspCas12c a variant of OspCas12c.
  • These Cas12c molecules have been described in Yan et al., “Functionally Diverse Type V CRISPR-Cas Systems,” Science, 2019 Jan.4; 363: 88-91; the entire contents of which is hereby incorporated by reference.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally- occurring Cas12c1, Cas12c2, or OspCas12c protein.
  • the napDNAbp is a naturally-occurring Cas12c1, Cas12c2, or OspCas12c protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any Cas12c1, Cas12c2, or OspCas12c protein described herein. It should be appreciated that Cas12c1, Cas12c2, or OspCas12c from other bacterial species may also be used in accordance with the present disclosure.
  • a napDNAbp refers to Cas12g, Cas12h, or Cas12i, which have been described in, for example, Yan et al., “Functionally Diverse Type V CRISPR-Cas Systems,” Science, 2019 Jan.4; 363: 88-91; the entire contents of each is hereby incorporated by reference.
  • aggregating more than 10 terabytes of sequence data new classifications of Type V Cas proteins were identified that showed weak similarity to previously characterized Class V protein, including Cas12g, Cas12h, and Cas12i.
  • the Cas12 protein is a Cas12g or a variant of Cas12g. In some embodiments, the Cas12 protein is a Cas12h or a variant of Cas12h. In some embodiments, the Cas12 protein is a Cas12i or a variant of Cas12i. It should be appreciated that other RNA-guided DNA binding proteins may be used as a napDNAbp, and are within the scope of this disclosure.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring Cas12g, Cas12h, or Cas12i protein.
  • the napDNAbp is a naturally-occurring Cas12g, Cas12h, or Cas12i protein.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any Cas12g, Cas12h, or Cas12i protein described herein. It should be appreciated that Cas12g, Cas12h, or Cas12i from other bacterial species may also be used in accordance with the present disclosure. In some embodiments, the Cas12i is a Cas12i1 or a Cas12i2. [0611] Cas12g1
  • Cas12i2 [0615] Representative nucleic acid and protein sequences of the base editors follow: BhCas12b GGSGGS-ABE8-Xten20 at P153
  • BhCas12b GGSGGS-ABE8-Xten20 at K1019 [0616]
  • the Kozak sequence is bolded and underlined; marks the N- terminal nuclear localization signal (NLS); lower case characters denote the GGGSGGS linker; marks the sequence encoding ABE8, unmodified sequence encodes BhCas12b; double underling denotes the Xten20 linker; single underlining denotes the C-terminal NLS; GGATCC denotes the GS linker; and italicized characters represent the coding sequence of the 3x hemagglutinin (HA) tag.
  • NLS nuclear localization signal
  • GGATCC denotes the GS linker
  • italicized characters represent the coding sequence of the 3x hemagglutinin (HA) tag.
  • the nucleic acid programmable DNA binding protein (napDNAbp) of any of the fusion proteins provided herein may be a Cas12j/CasF protein.
  • Cas12j/CasF is described in Pausch et al., “CRISPR-CasF from huge phages is a hypercompact genome editor,” Science, 17 July 2020, Vol.369, Issue 6501, pp.333-337, which is incorporated herein by reference in its entirety.
  • the napDNAbp comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a naturally-occurring Cas12j/CasF protein.
  • the napDNAbp is a naturally-occurring Cas12j/CasF protein.
  • the napDNAbp is a nuclease inactive (“dead”) Cas12j/CasF protein. It should be appreciated that Cas12j/CasF from other species may also be used in accordance with the present disclosure. [0618] Exemplary Cas12j/CasF amino acid sequences follow: >CasF-1 Q >CasF-2 >CasF-3 >CasF-4 >CasF-5
  • the guide polynucleotide is a guide RNA.
  • guide RNA gRNA
  • gRNA guide RNA
  • RNA/Cas complex can assist in “guiding” Cas protein to a target DNA.
  • Cas9/crRNA/tracrRNA endonucleolytically cleaves linear or circular dsDNA target complementary to the spacer.
  • the target strand not complementary to crRNA is first cut endonucleolytically, then trimmed 3’-5’ exonucleolytically.
  • DNA-binding and cleavage typically requires protein and both RNAs.
  • single guide RNAs (“sgRNA,” or simply “gRNA”) can be engineered so as to incorporate aspects of both the crRNA and tracrRNA into a single RNA species. See, e.g., Jinek M.
  • Cas9 recognizes a short motif in the CRISPR repeat sequences (the PAM or protospacer adjacent motif) to help distinguish self versus non-self.
  • Cas9 nuclease sequences and structures are well known to those of skill in the art (see e.g., “Complete genome sequence of an M1 strain of Streptococcus pyogenes.” Ferretti, J.J. et al., Natl. Acad. Sci. U.S.A.98:4658-4663(2001); “CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III.” Deltcheva E.
  • Cas9 nucleases and sequences can be apparent to those of skill in the art based on this disclosure, and such Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski, Rhun, and Charpentier, “The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems” (2013) RNA Biology 10:5, 726-737; the entire contents of which are incorporated herein by reference.
  • a Cas9 nuclease has an inactive (e.g., an inactivated) DNA cleavage domain, that is, the Cas9 is a nickase.
  • the guide polynucleotide is at least one single guide RNA (“sgRNA” or “gRNA”). In some embodiments, the guide polynucleotide is at least one tracrRNA. In some embodiments, the guide polynucleotide does not require PAM sequence to guide the polynucleotide-programmable DNA-binding domain (e.g., Cas9 or Cpf1) to the target nucleotide sequence.
  • the polynucleotide programmable nucleotide binding domain (e.g., a CRISPR-derived domain) of the base editors disclosed herein can recognize a target polynucleotide sequence by associating with a guide polynucleotide.
  • a guide polynucleotide e.g., gRNA
  • a guide polynucleotide is typically single-stranded and can be programmed to site-specifically bind (i.e., via complementary base pairing) to a target sequence of a polynucleotide, thereby directing a base editor that is in conjunction with the guide nucleic acid to the target sequence.
  • a guide polynucleotide can be DNA.
  • a guide polynucleotide can be RNA.
  • the guide polynucleotide comprises natural nucleotides (e.g., adenosine).
  • the guide polynucleotide comprises non-natural (or unnatural) nucleotides (e.g., peptide nucleic acid or nucleotide analogs).
  • the targeting region of a guide nucleic acid sequence can be at least 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length.
  • a targeting region of a guide nucleic acid can be between 10-30 nucleotides in length, or between 15-25 nucleotides in length, or between 15-20 nucleotides in length.
  • a guide polynucleotide may be truncated by 1, 2, 3, 4, etc. nucleotides, particularly at the 5 ⁇ end.
  • a guide polynucleotide of 20 nucleotides in length may be truncated by 1, 2, 3, 4, etc. nucleotides, particularly at the 5 ⁇ end.
  • a guide polynucleotide comprises two or more individual polynucleotides, which can interact with one another via for example complementary base pairing (e.g., a dual guide polynucleotide).
  • a guide polynucleotide can comprise a CRISPR RNA (crRNA) and a trans-activating CRISPR RNA (tracrRNA).
  • a guide polynucleotide can comprise one or more trans-activating CRISPR RNA (tracrRNA).
  • RNA molecules comprising a sequence that recognizes the target sequence
  • trRNA second RNA molecule
  • the base editor utilizes a single guide polynucleotide (e.g., sgRNA).
  • the base editor provided herein utilizes a dual guide polynucleotide (e.g., dual gRNAs). In some embodiments, the base editor provided herein utilizes one or more guide polynucleotide (e.g., multiple gRNA). In some embodiments, a single guide polynucleotide is utilized for different base editors described herein. For example, a single guide polynucleotide can be utilized for a cytidine base editor and an adenosine base editor.
  • a guide polynucleotide can comprise both the polynucleotide targeting portion of the nucleic acid and the scaffold portion of the nucleic acid in a single molecule (i.e., a single-molecule guide nucleic acid).
  • a single-molecule guide polynucleotide can be a single guide RNA (sgRNA or gRNA).
  • sgRNA or gRNA single guide RNA
  • guide polynucleotide sequence contemplates any single, dual or multi-molecule nucleic acid capable of interacting with and directing a base editor to a target polynucleotide sequence.
  • a guide polynucleotide (e.g., crRNA/trRNA complex or a gRNA) comprises a “polynucleotide-targeting segment” that includes a sequence capable of recognizing and binding to a target polynucleotide sequence, and a “protein-binding segment” that stabilizes the guide polynucleotide within a polynucleotide programmable nucleotide binding domain component of a base editor.
  • the polynucleotide targeting segment of the guide polynucleotide recognizes and binds to a DNA polynucleotide, thereby facilitating the editing of a base in DNA.
  • the polynucleotide targeting segment of the guide polynucleotide recognizes and binds to an RNA polynucleotide, thereby facilitating the editing of a base in RNA.
  • a “segment” refers to a section or region of a molecule, e.g., a contiguous stretch of nucleotides in the guide polynucleotide.
  • a segment can also refer to a region/section of a complex such that a segment can comprise regions of more than one molecule.
  • a protein-binding segment of a DNA-targeting RNA that comprises two separate molecules can comprise (i) base pairs 40-75 of a first RNA molecule that is 100 base pairs in length; and (ii) base pairs 10-25 of a second RNA molecule that is 50 base pairs in length.
  • a guide RNA or a guide polynucleotide can comprise two or more RNAs, e.g., CRISPR RNA (crRNA) and transactivating crRNA (tracrRNA).
  • crRNA CRISPR RNA
  • tracrRNA transactivating crRNA
  • a guide RNA or a guide polynucleotide can sometimes comprise a single-chain RNA, or single guide RNA (sgRNA) formed by fusion of a portion (e.g., a functional portion) of crRNA and tracrRNA.
  • a guide RNA or a guide polynucleotide can also be a dual RNA comprising a crRNA and a tracrRNA.
  • a crRNA can hybridize with a target DNA.
  • a guide RNA or a guide polynucleotide can be an expression product.
  • a DNA that encodes a guide RNA can be a vector comprising a sequence coding for the guide RNA.
  • a guide RNA or a guide polynucleotide can be transferred into a cell by transfecting the cell with an isolated guide RNA or plasmid DNA comprising a sequence coding for the guide RNA and a promoter.
  • a guide RNA or a guide polynucleotide can also be transferred into a cell in other way, such as using virus-mediated gene delivery.
  • a guide RNA or a guide polynucleotide can be isolated.
  • a guide RNA can be transfected in the form of an isolated RNA into a cell or organism.
  • a guide RNA can be prepared by in vitro transcription using any in vitro transcription system known in the art.
  • a guide RNA can be transferred to a cell in the form of isolated RNA rather than in the form of plasmid comprising encoding sequence for a guide RNA.
  • a guide RNA or a guide polynucleotide can comprise three regions: a first region at the 5’ end that can be complementary to a target site in a chromosomal sequence, a second internal region that can form a stem loop structure, and a third 3’ region that can be single-stranded.
  • a first region of each guide RNA can also be different such that each guide RNA guides a fusion protein to a specific target site. Further, second and third regions of each guide RNA can be identical in all guide RNAs.
  • a first region of a guide RNA or a guide polynucleotide can be complementary to sequence at a target site in a chromosomal sequence such that the first region of the guide RNA can base pair with the target site.
  • a first region of a guide RNA can comprise from or from about 10 nucleotides to 25 nucleotides (i.e., from 10 nucleotides to nucleotides; or from about 10 nucleotides to about 25 nucleotides; or from 10 nucleotides to about 25 nucleotides; or from about 10 nucleotides to 25 nucleotides) or more.
  • a region of base pairing between a first region of a guide RNA and a target site in a chromosomal sequence can be or can be about 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 22, 23, 24, 25, or more nucleotides in length.
  • a first region of a guide RNA can be or can be about 19, 20, or 21 nucleotides in length.
  • a guide RNA or a guide polynucleotide can also comprise a second region that forms a secondary structure.
  • a secondary structure formed by a guide RNA can comprise a stem (or hairpin) and a loop. A length of a loop and a stem can vary.
  • a loop can range from or from about 3 to 10 nucleotides in length, and a stem can range from or from about 6 to 20 base pairs in length.
  • a stem can comprise one or more bulges of 1 to 10 or about 10 nucleotides.
  • the overall length of a second region can range from or from about 16 to 60 nucleotides in length.
  • a loop can be or can be about 4 nucleotides in length and a stem can be or can be about 12 base pairs.
  • a guide RNA or a guide polynucleotide can also comprise a third region at the 3' end that can be essentially single-stranded.
  • a third region is sometimes not complementarity to any chromosomal sequence in a cell of interest and is sometimes not complementarity to the rest of a guide RNA.
  • the length of a third region can vary.
  • a third region can be more than or more than about 4 nucleotides in length.
  • the length of a third region can range from or from about 5 to 60 nucleotides in length.
  • a guide RNA or a guide polynucleotide can target any exon or intron of a gene target.
  • a guide can target exon 1 or 2 of a gene; in other embodiments, a guide can target exon 3 or 4 of a gene.
  • a composition can comprise multiple guide RNAs that all target the same exon or in some embodiments, multiple guide RNAs that can target different exons. An exon and an intron of a gene can be targeted.
  • a guide RNA or a guide polynucleotide can target a nucleic acid sequence of or of about 20 nucleotides.
  • a target nucleic acid can be less than or less than about 20 nucleotides.
  • a target nucleic acid can be at least or at least about 5, 10, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, or anywhere between 1-100 nucleotides in length.
  • a target nucleic acid can be at most or at most about 5, 10, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 40, 50, or anywhere between 1-100 nucleotides in length.
  • a target nucleic acid sequence can be or can be about 20 bases immediately 5’ of the first nucleotide of the PAM.
  • a guide RNA can target a nucleic acid sequence.
  • a target nucleic acid can be at least or at least about 1-10, 1-20, 1-30, 1-40, 1-50, 1- 60, 1-70, 1-80, 1-90, or 1-100 nucleotides.
  • a guide polynucleotide for example, a guide RNA, can refer to a nucleic acid that can hybridize to another nucleic acid, for example, the target nucleic acid or protospacer in a genome of a cell.
  • a guide polynucleotide can be RNA.
  • a guide polynucleotide can be DNA.
  • the guide polynucleotide can be programmed or designed to bind to a sequence of nucleic acid site- specifically.
  • a guide polynucleotide can comprise a polynucleotide chain and can be called a single guide polynucleotide.
  • a guide polynucleotide can comprise two polynucleotide chains and can be called a double guide polynucleotide.
  • a guide RNA can be introduced into a cell or embryo as an RNA molecule.
  • an RNA molecule can be transcribed in vitro and/or can be chemically synthesized.
  • An RNA can be transcribed from a synthetic DNA molecule, e.g., a gBlocks® gene fragment.
  • a guide RNA can then be introduced into a cell or embryo as an RNA molecule.
  • a guide RNA can also be introduced into a cell or embryo in the form of a non-RNA nucleic acid molecule, e.g., a DNA molecule.
  • a DNA encoding a guide RNA can be operably linked to promoter control sequence for expression of the guide RNA in a cell or embryo of interest.
  • An RNA coding sequence can be operably linked to a promoter sequence that is recognized by RNA polymerase III (Pol III).
  • Plasmid vectors that can be used to express guide RNA include, but are not limited to, px330 vectors and px333 vectors.
  • a plasmid vector (e.g., px333 vector) can comprise at least two guide RNA- encoding DNA sequences.
  • all off-target sequences may be identified across the genome that contain up to certain number (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10) of mismatched base-pairs.
  • First regions of gRNAs complementary to a target site can be identified, and all first regions (e.g., crRNAs) can be ranked according to its total predicted off-target score; the top-ranked targeting domains represent those that are likely to have the greatest on-target and the least off-target activity.
  • Candidate targeting gRNAs can be functionally evaluated by using methods known in the art and/or as set forth herein.
  • target DNA hybridizing sequences in crRNAs of a guide RNA for use with Cas9s may be identified using a DNA sequence searching algorithm.
  • gRNA design may be carried out using custom gRNA design software based on the public tool cas- offinder as described in Bae S., Park J., & Kim J.-S. Cas-OFFinder: A fast and versatile algorithm that searches for potential off-target sites of Cas9 RNA-guided endonucleases. Bioinformatics 30, 1473-1475 (2014). This software scores guides after calculating their genome-wide off-target propensity. Typically matches ranging from perfect matches to 7 mismatches are considered for guides ranging in length from 17 to 24.
  • an aggregate score is calculated for each guide and summarized in a tabular output using a web-interface.
  • the software also identifies all PAM adjacent sequences that differ by 1, 2, 3 or more than 3 nucleotides from the selected target sites.
  • Genomic DNA sequences for a target nucleic acid sequence e.g., a target gene may be obtained and repeat elements may be screened using publicly available tools, for example, the RepeatMasker program. RepeatMasker searches input DNA sequences for repeated elements and regions of low complexity. The output is a detailed annotation of the repeats present in a given query sequence.
  • first regions of guide RNAs may be ranked into tiers based on their distance to the target site, their orthogonality and presence of 5’ nucleotides for close matches with relevant PAM sequences (for example, a 5 ⁇ G based on identification of close matches in the human genome containing a relevant PAM e.g., NGG PAM for S. pyogenes, NNGRRT or NNGRRV PAM for S. aureus).
  • relevant PAM for example, a 5 ⁇ G based on identification of close matches in the human genome containing a relevant PAM e.g., NGG PAM for S. pyogenes, NNGRRT or NNGRRV PAM for S. aureus.
  • orthogonality refers to the number of sequences in the human genome that contain a minimum number of mismatches to the target sequence.
  • a “high level of orthogonality” or “good orthogonality” may, for example, refer to 20-mer targeting domains that have no identical sequences in the human genome besides the intended target, nor any sequences that contain one or two mismatches in the target sequence. Targeting domains with good orthogonality may be selected to minimize off-target DNA cleavage.
  • a reporter system may be used for detecting base-editing activity and testing candidate guide polynucleotides.
  • a reporter system may comprise a reporter gene based assay where base editing activity leads to expression of the reporter gene.
  • a reporter system may include a reporter gene comprising a deactivated start codon, e.g., a mutation on the template strand from 3'-TAC-5' to 3'-CAC-5'.
  • a deactivated start codon e.g., a mutation on the template strand from 3'-TAC-5' to 3'-CAC-5'.
  • the corresponding mRNA Upon successful deamination of the target C, the corresponding mRNA will be transcribed as 5'- AUG-3' instead of 5'-GUG-3', enabling the translation of the reporter gene.
  • Suitable reporter genes will be apparent to those of skill in the art.
  • Non-limiting examples of reporter genes include gene encoding green fluorescence protein (GFP), red fluorescence protein (RFP), luciferase, secreted alkaline phosphatase (SEAP), or any other gene whose expression are detectable and apparent to those skilled in the art.
  • the reporter system can be used to test many different gRNAs, e.g., in order to determine which nucleotide residue(s) with respect to the target DNA sequence the respective deaminase will target.
  • gRNAs that target non-template strand nucleotide residues can also be tested in order to assess off-target effects of a specific base editing protein, e.g., a Cas9 deaminase fusion protein.
  • gRNAs can be designed such that the mutated start codon will not be base-paired with the gRNA.
  • the guide polynucleotides can comprise standard nucleotides, modified nucleotides (e.g., pseudouridine), nucleotide isomers, and/or nucleotide analogs.
  • the guide polynucleotide can comprise at least one detectable label.
  • the detectable label can be a fluorophore (e.g., FAM, TMR, Cy3, Cy5, Texas Red, Oregon Green, Alexa Fluors, Halo tags, or any other suitable fluorescent dye), a detection tag (e.g., biotin, digoxigenin, and the like), quantum dots, or gold particles.
  • the guide polynucleotides can be synthesized chemically and/or enzymatically.
  • the guide RNA can be synthesized using standard phosphoramidite-based solid-phase synthesis methods.
  • the guide RNA can be synthesized in vitro by operably linking DNA encoding the guide RNA to a promoter control sequence that is recognized by a phage RNA polymerase.
  • suitable phage promoter sequences include T7, T3, SP6 promoter sequences, or variations thereof.
  • the guide RNA comprises two separate molecules (e.g.., crRNA and tracrRNA)
  • the crRNA can be chemically synthesized and the tracrRNA can be enzymatically synthesized.
  • a base editor system may comprise multiple guide polynucleotides, e.g., gRNAs.
  • the gRNAs may target the base editor to one or more target loci (e.g., at least one (1) gRNA, at least 2 gRNA, at least 5 gRNA, at least 10 gRNA, at least 20 gRNA, at least 30 g RNA, or at least 50 gRNA).
  • target loci e.g., at least one (1) gRNA, at least 2 gRNA, at least 5 gRNA, at least 10 gRNA, at least 20 gRNA, at least 30 g RNA, or at least 50 gRNA.
  • multiple gRNA sequences can be tandemly arranged and are preferably separated by a direct repeat.
  • a DNA sequence encoding a guide RNA or a guide polynucleotide can also be part of a vector.
  • a vector comprises additional expression control sequences (e.g., enhancer sequences, Kozak sequences, polyadenylation sequences, transcriptional termination sequences, etc.), selectable marker sequences (e.g., GFP or antibiotic resistance genes such as puromycin), origins of replication, and the like.
  • a DNA molecule encoding a guide RNA or a guide polynucleotide can be circular or linear.
  • one or more components of a base editor system may be encoded by DNA sequences. Such DNA sequences may be introduced into an expression system, e.g., a cell, together or separately.
  • DNA sequences encoding a polynucleotide programmable nucleotide binding domain and a guide RNA may be introduced into a cell, each DNA sequence can be part of a separate molecule (e.g., one vector containing the polynucleotide programmable nucleotide binding domain coding sequence and a second vector containing the guide RNA coding sequence) or both can be part of a same molecule (e.g., one vector containing coding (and regulatory) sequence for both the polynucleotide programmable nucleotide binding domain and the guide RNA).
  • a guide polynucleotide can comprise one or more modifications to provide a nucleic acid with a new or enhanced feature.
  • a guide polynucleotide can comprise a nucleic acid affinity tag.
  • a guide polynucleotide can comprise synthetic nucleotide, synthetic nucleotide analog, nucleotide derivatives, and/or modified nucleotides.
  • a gRNA or a guide polynucleotide can comprise modifications.
  • a modification can be made at any location of a gRNA or a guide polynucleotide. More than one modification can be made to a single gRNA or a guide polynucleotide.
  • a gRNA or a guide polynucleotide can undergo quality control after a modification. In some embodiments, quality control can include PAGE, HPLC, MS, or any combination thereof.
  • a modification of a gRNA or a guide polynucleotide can be a substitution, insertion, deletion, chemical modification, physical modification, stabilization, purification, or any combination thereof.
  • a gRNA or a guide polynucleotide can also be modified by 5’adenylate, 5’ guanosine- triphosphate cap, 5’N7-Methylguanosine-triphosphate cap, 5’triphosphate cap, 3’phosphate, 3’thiophosphate, 5’phosphate, 5’thiophosphate, Cis-Syn thymidine dimer, trimers, C12 spacer, C3 spacer, C6 spacer, dSpacer, PC spacer, rSpacer, Spacer 18, Spacer 9,3’-3’ modifications, 5’- 5’ modifications, abasic, acridine, azobenzene, biotin, biotin BB, biotin TEG, cholesteryl TEG, desthiobiot
  • a modification is permanent. In other embodiments, a modification is transient. In some embodiments, multiple modifications are made to a gRNA or a guide polynucleotide.
  • a gRNA or a guide polynucleotide modification can alter physiochemical properties of a nucleotide, such as their conformation, polarity, hydrophobicity, chemical reactivity, base-pairing interactions, or any combination thereof.
  • a modification can also be a phosphorothioate substitute.
  • a natural phosphodiester bond can be susceptible to rapid degradation by cellular nucleases and; a modification of internucleotide linkage using phosphorothioate (PS) bond substitutes can be more stable towards hydrolysis by cellular degradation.
  • a modification can increase stability in a gRNA or a guide polynucleotide.
  • a modification can also enhance biological activity.
  • a phosphorothioate enhanced RNA gRNA can inhibit RNase A, RNase T1, calf serum nucleases, or any combinations thereof.
  • phosphorothioate (PS) bonds can be introduced between the last 3-5 nucleotides at the 5’- or ‘'-end of a gRNA which can inhibit exonuclease degradation.
  • phosphorothioate bonds can be added throughout an entire gRNA to reduce attack by endonucleases.
  • the guide RNA is designed to disrupt a splice site (i.e., a splice acceptor (SA) or a splice donor (SD).
  • SA splice acceptor
  • SD splice donor
  • the guide RNA is designed such that the base editing results in a premature STOP codon.
  • Tables 4A-4B provide a non- exhaustive list of gRNA target sequences designed to disrupt a splice site or to result in a premature STOP codon.
  • PAM Protospacer adjacent motif
  • PAM-like motif refers to a 2-6 base pair DNA sequence immediately following the DNA sequence targeted by the Cas9 nuclease in the CRISPR bacterial adaptive immune system.
  • the PAM can be a 5’ PAM (i.e., located upstream of the 5’ end of the protospacer).
  • the PAM can be a 3’ PAM (i.e., located downstream of the 5’ end of the protospacer).
  • the PAM sequence is essential for target binding, but the exact sequence depends on a type of Cas protein.
  • the PAM sequence can be any PAM sequence known in the art.
  • Suitable PAM sequences include, but are not limited to, NGG, NGA, NGC, NGN, NGT, NGTT, NGCG, NGAG, NGAN, NGNG, NGCN, NGCG, NGTN, NNGRRT, NNNRRT, NNGRR(N), TTTV, TYCV, TYCV, TATV, NNNNGATT, NNAGAAW, or NAAAAC.
  • Y is a pyrimidine; N is any nucleotide base; W is A or T.
  • a base editor provided herein can comprise a CRISPR protein-derived domain that is capable of binding a nucleotide sequence that contains a canonical or non-canonical protospacer adjacent motif (PAM) sequence.
  • PAM canonical or non-canonical protospacer adjacent motif
  • a PAM site is a nucleotide sequence in proximity to a target polynucleotide sequence.
  • Some aspects of the disclosure provide for base editors comprising all or a portion of CRISPR proteins that have different PAM specificities.
  • typically Cas9 proteins such as Cas9 from S. pyogenes (spCas9), require a canonical NGG PAM sequence to bind a particular nucleic acid region, where the “N” in “NGG” is adenine (A), thymine (T), guanine (G), or cytosine (C), and the G is guanine.
  • a PAM can be CRISPR protein-specific and can be different between different base editors comprising different CRISPR protein-derived domains.
  • a PAM can be 5’ or 3’ of a target sequence.
  • a PAM can be upstream or downstream of a target sequence.
  • a PAM can be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more nucleotides in length. Often, a PAM is between 2-6 nucleotides in length.
  • the PAM is an “NRN” PAM where the “N” in “NRN” is adenine (A), thymine (T), guanine (G), or cytosine (C), and the R is adenine (A) or guanine (G); or the PAM is an “NYN” PAM, wherein the “N” in NYN is adenine (A), thymine (T), guanine (G), or cytosine (C), and the Y is cytidine (C) or thymine (T), for example, as described in R.T.
  • the PAM is NGC. In some embodiments, the NGC PAM is recognized by a Cas9 variant. In some embodiments, the NGC PAM variant includes one or more amino acid substitutions selected from D1135M, S1136Q, G1218K, E1219F, A1322R, D1332A, R1335E, and T1337R (collectively termed “MQKFRAER”). [0660] In some embodiments, the PAM is NGT. In some embodiments, the NGT PAM is recognized by a Cas9 variant. In some embodiments, the NGT PAM variant is generated through targeted mutations at one or more residues 1335, 1337, 1135, 1136, 1218, and/or 1219.
  • the NGT PAM variant is created through targeted mutations at one or more residues 1219, 1335, 1337, 1218. In some embodiments, the NGT PAM variant is created through targeted mutations at one or more residues 1135, 1136, 1218, 1219, and 1335. In some embodiments, the NGT PAM variant is selected from the set of targeted mutations provided in Tables 6A and 6B below. Table 6A: NGT PAM Variant Mutations at residues 1219, 1335, 1337, 1218
  • the NGT PAM variant is selected from variant 5, 7, 28, 31, or 36 in Table 6A and Table 6B. In some embodiments, the variants have improved NGT PAM recognition. [0662] In some embodiments, the NGT PAM variants have mutations at residues 1219, 1335, 1337, and/or 1218. In some embodiments, the NGT PAM variant is selected with mutations for improved recognition from the variants provided in Table 7 below. Table 7: NGT PAM Variant Mutations at residues 1219, 1335, 1337, and 1218 [0663] In some embodiments, the NGT PAM is selected from the variants provided in Table 8 below. Table 8. NGT PAM variants [0664] In some embodiments the NGTN variant is variant 1.
  • the NGTN variant is variant 2. In some embodiments, the NGTN variant is variant 3. In some embodiments, the NGTN variant is variant 4. In some embodiments, the NGTN variant is variant 5. In some embodiments, the NGTN variant is variant 6. [0665] In some embodiments, the Cas9 domain is a Cas9 domain from Streptococcus pyogenes (SpCas9). In some embodiments, the SpCas9 domain is a nuclease active SpCas9, a nuclease inactive SpCas9 (SpCas9d), or a SpCas9 nickase (SpCas9n).
  • the SpCas9 comprises a D9X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid except for D.
  • the SpCas9 comprises a D9A mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain, the SpCas9d domain, or the SpCas9n domain can bind to a nucleic acid sequence having a non-canonical PAM.
  • the SpCas9 domain, the SpCas9d domain, or the SpCas9n domain can bind to a nucleic acid sequence having an NGG, a NGA, or a NGCG PAM sequence.
  • the SpCas9 domain comprises one or more of a D1135X, a R1335X, and a T1337X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SpCas9 domain comprises one or more of a D1135E, R1335Q, and T1337R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises a D1135E, a R1335Q, and a T1337R mutation, or corresponding mutations in any of the amino acid sequences provided herein. In some embodiments, the SpCas9 domain comprises one or more of a D1135X, a R1335X, and a T1337X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid. In some embodiments, the SpCas9 domain comprises one or more of a D1135V, a R1335Q, and a T1337R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises a D1135V, a R1335Q, and a T1337R mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises one or more of a D1135X, a G1218X, a R1335X, and a T1337X mutation, or a corresponding mutation in any of the amino acid sequences provided herein, wherein X is any amino acid.
  • the SpCas9 domain comprises one or more of a D1135V, a G1218R, a R1335Q, and a T1337R mutation, or a corresponding mutation in any of the amino acid sequences provided herein.
  • the SpCas9 domain comprises a D1135V, a G1218R, a R1335Q, and a T1337R mutation, or corresponding mutations in any of the amino acid sequences provided herein.
  • the Cas9 domains of any of the fusion proteins provided herein comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a Cas9 polypeptide described herein.
  • the Cas9 domains of any of the fusion proteins provided herein comprises the amino acid sequence of any Cas9 polypeptide described herein. In some embodiments, the Cas9 domains of any of the fusion proteins provided herein consists of the amino acid sequence of any Cas9 polypeptide described herein.
  • a PAM recognized by a CRISPR protein-derived domain of a base editor disclosed herein can be provided to a cell on a separate oligonucleotide to an insert (e.g., an AAV insert) encoding the base editor.
  • S. pyogenes Cas9 can be used as a CRISPR endonuclease for genome engineering. However, others can be used. In some embodiments, a different endonuclease can be used to target certain genomic targets. In some embodiments, synthetic SpCas9-derived variants with non-NGG PAM sequences can be used.
  • Non-SpCas9s can bind a variety of PAM sequences that can also be useful for the present disclosure.
  • the relatively large size of SpCas9 (approximately 4kb coding sequence) can lead to plasmids carrying the SpCas9 cDNA that cannot be efficiently expressed in a cell.
  • the coding sequence for Staphylococcus aureus Cas9 (SaCas9) is approximately 1 kilobase shorter than SpCas9, possibly allowing it to be efficiently expressed in a cell.
  • the SaCas9 endonuclease is capable of modifying target genes in mammalian cells in vitro and in mice in vivo.
  • a Cas protein can target a different PAM sequence.
  • a target gene can be adjacent to a Cas9 PAM, 5’-NGG, for example.
  • other Cas9 orthologs can have different PAM requirements.
  • PAMs such as those of S. thermophilus (5’-NNAGAA for CRISPR1 and 5’-NGGNG for CRISPR3) and Neisseria meningitidis (5’-NNNNGATT) can also be found adjacent to a target gene.
  • a target gene sequence can precede (i.e., be 5’ to) a 5’-NGG PAM, and a 20-nt guide RNA sequence can base pair with an opposite strand to mediate a Cas9 cleavage adjacent to a PAM.
  • an adjacent cut can be or can be about 3 base pairs upstream of a PAM. In some embodiments, an adjacent cut can be or can be about 10 base pairs upstream of a PAM. In some embodiments, an adjacent cut can be or can be about 0-20 base pairs upstream of a PAM.
  • an adjacent cut can be next to, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 base pairs upstream of a PAM.
  • An adjacent cut can also be downstream of a PAM by 1 to 30 base pairs.
  • the sequences of exemplary SpCas9 proteins capable of binding a PAM sequence follow: [0671]
  • the amino acid sequence of an exemplary PAM-binding SpCas9 is as follows: QS G SQ GG [0672]
  • the amino acid sequence of an exemplary PAM-binding SpCas9n is as follows:
  • residues E1135, Q1335, and R1337, which can be mutated from D1135, R1335, and T1337 to yield a SpEQR Cas9 are underlined and in bold.
  • amino acid sequence of an exemplary PAM-binding SpVQR Cas9 is as follows: [0676] In the above sequence, residues V1135, Q1335, and R1337, which can be mutated from D1135, R1335, and T1337 to yield a SpVQR Cas9, are underlined and in bold. [0677]
  • the amino acid sequence of an exemplary PAM-binding SpVRER Cas9 is as follows:
  • engineered SpCas9 variants are capable of recognizing protospacer adjacent motif (PAM) sequences flanked by a 3 ⁇ H (non-G PAM) (see Tables 3A- 3D).
  • PAM protospacer adjacent motif
  • the SpCas9 variants recognize NRNH PAMs (where R is A or G and H is A, C or T).
  • the non-G PAM is NRRH, NRTH, or NRCH (see e.g., Miller, S.M., et al. Continuous evolution of SpCas9 variants compatible with non-G PAMs, Nat. Biotechnol. (2020), the contents of which is incorporated herein by reference in its entirety).
  • the Cas9 domain is a recombinant Cas9 domain.
  • the recombinant Cas9 domain is a SpyMacCas9 domain.
  • the SpyMacCas9 domain is a nuclease active SpyMacCas9, a nuclease inactive SpyMacCas9 (SpyMacCas9d), or a SpyMacCas9 nickase (SpyMacCas9n).
  • the SaCas9 domain, the SaCas9d domain, or the SaCas9n domain can bind to a nucleic acid sequence having a non-canonical PAM.
  • the SpyMacCas9 domain, the SpCas9d domain, or the SpCas9n domain can bind to a nucleic acid sequence having a NAA PAM sequence.
  • a variant Cas9 protein harbors, H840A, P475A, W476A, N477A, D1125A, W1126A, and D1218A mutations such that the polypeptide has a reduced ability to cleave a target DNA or RNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein harbors D10A, H840A, P475A, W476A, N477A, D1125A, W1126A, and D1218A mutations such that the polypeptide has a reduced ability to cleave a target DNA.
  • a Cas9 protein has a reduced ability to cleave a target DNA (e.g., a single stranded target DNA) but retains the ability to bind a target DNA (e.g., a single stranded target DNA).
  • the variant Cas9 protein when a variant Cas9 protein harbors W476A and W1126A mutations or when the variant Cas9 protein harbors P475A, W476A, N477A, D1125A, W1126A, and D1218A mutations, the variant Cas9 protein does not bind efficiently to a PAM sequence. Thus, in some such cases, when such a variant Cas9 protein is used in a method of binding, the method does not require a PAM sequence.
  • the method when such a variant Cas9 protein is used in a method of binding, can include a guide RNA, but the method can be performed in the absence of a PAM sequence (and the specificity of binding is therefore provided by the targeting segment of the guide RNA).
  • Other residues can be mutated to achieve the above effects (i.e., inactivate one or the other nuclease portions).
  • residues D10, G12, G17, E762, H840, N854, N863, H982, H983, A984, D986, and/or A987 can be altered (i.e., substituted).
  • mutations other than alanine substitutions are suitable.
  • a CRISPR protein-derived domain of a base editor can comprise all or a portion of a Cas9 protein with a canonical PAM sequence (NGG).
  • a Cas9-derived domain of a base editor can employ a non-canonical PAM sequence.
  • NGS canonical PAM sequence
  • a Cas9-derived domain of a base editor can employ a non-canonical PAM sequence.
  • Such sequences have been described in the art and would be apparent to the skilled artisan.
  • Cas9 domains that bind non-canonical PAM sequences have been described in Kleinstiver, B. P., et al., “Engineered CRISPR-Cas9 nucleases with altered PAM specificities” Nature 523, 481-485 (2015); and Kleinstiver, B.
  • Cas9 Domains with Reduced Exclusivity Typically, Cas9 proteins, such as Cas9 from S. pyogenes (spCas9), require a canonical NGG PAM sequence to bind a particular nucleic acid region, where the “N” in “NGG” is adenosine (A), thymidine (T), or cytosine (C), and the G is guanosine. This may limit the ability to edit desired bases within a genome.
  • the base editing fusion proteins provided herein may need to be placed at a precise location, for example a region comprising a target base that is upstream of the PAM. See e.g., Komor, A.C., et al., “Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage” Nature 533, 420-424 (2016), the entire contents of which are hereby incorporated by reference. Accordingly, in some embodiments, any of the fusion proteins provided herein may contain a Cas9 domain that is capable of binding a nucleotide sequence that does not contain a canonical (e.g., NGG) PAM sequence.
  • a canonical e.g., NGG
  • Cas9 domains that bind to non-canonical PAM sequences have been described in the art and would be apparent to the skilled artisan.
  • Cas9 domains that bind non- canonical PAM sequences have been described in Kleinstiver, B. P., et al., “Engineered CRISPR-Cas9 nucleases with altered PAM specificities” Nature 523, 481-485 (2015); and Kleinstiver, B. P., et al., “Broadening the targeting range of Staphylococcus aureus CRISPR- Cas9 by modifying PAM recognition” Nature Biotechnology 33, 1293-1298 (2015); the entire contents of each are hereby incorporated by reference.
  • fusion proteins comprising a heterologous polypeptide fused to a nucleic acid programmable nucleic acid binding protein, for example, a napDNAbp.
  • a heterologous polypeptide can be a polypeptide that is not found in the native or wild-type napDNAbp polypeptide sequence.
  • the heterologous polypeptide can be fused to the napDNAbp at a C-terminal end of the napDNAbp, an N-terminal end of the napDNAbp, or inserted at an internal location of the napDNAbp.
  • the heterologous polypeptide is inserted at an internal location of the napDNAbp.
  • the heterologous polypeptide is a deaminase or a functional fragment thereof.
  • a fusion protein can comprise a deaminase flanked by an N- terminal fragment and a C-terminal fragment of a Cas9 or Cas12 (e.g., Cas12b/C2c1), polypeptide.
  • the deaminase in a fusion protein can be a cytidine deaminase.
  • the cytidine deaminase is an APOBEC deaminase (e.g., APOBEC1).
  • the deaminase in a fusion protein can be an adenosine deaminase.
  • the adenosine deaminase is a TadA (e.g., TadA*7.10 or TadA*8).
  • the TadA is a TadA*8 or a TadA*9.
  • TadA sequences e.g., TadA7.10 or TadA*8 as described herein are suitable deaminases for the above-described fusion proteins.
  • the fusion protein comprises the structure: NH2-[N-terminal fragment of a napDNAbp]-[deaminase]-[C-terminal fragment of a napDNAbp]-COOH; NH2-[N-terminal fragment of a Cas9]-[adenosine deaminase]-[C-terminal fragment of a Cas9]- COOH; NH2-[N-terminal fragment of a Cas12]-[adenosine deaminase]-[C-terminal fragment of a Cas12]-COOH; NH2-[N-terminal fragment of a Cas9]-[cytidine deaminase]-[C-terminal fragment of a Cas9]- COOH; NH2-[N-terminal fragment of a Cas12]-[cytidine deaminase]-[C-terminal fragment of a Cas9]- COOH; NH2-[N-terminal fragment of
  • the deaminase can be a circular permutant deaminase.
  • the deaminase can be a circular permutant adenosine deaminase.
  • the deaminase is a circular permutant TadA, circularly permutated at amino acid residue 116 as numbered in the TadA reference sequence.
  • the deaminase is a circular permutant TadA, circularly permutated at amino acid residue 136 as numbered in the TadA reference sequence.
  • the deaminase is a circular permutant TadA, circularly permutated at amino acid residue 65 as numbered in the TadA reference sequence.
  • the fusion protein can comprise more than one deaminase.
  • the fusion protein can comprise, for example, 1, 2, 3, 4, 5 or more deaminases.
  • the fusion protein comprises one deaminase.
  • the fusion protein comprises two deaminases.
  • the two or more deaminases in a fusion protein can be an adenosine deaminase. cytidine deaminase, or a combination thereof.
  • the two or more deaminases can be homodimers.
  • the two or more deaminases can be heterodimers.
  • the two or more deaminases can be inserted in tandem in the napDNAbp.
  • the two or more deaminases may not be in tandem in the napDNAbp.
  • the napDNAbp in the fusion protein is a Cas9 polypeptide or a fragment thereof.
  • the Cas9 polypeptide can be a variant Cas9 polypeptide.
  • the Cas9 polypeptide is a Cas9 nickase (nCas9) polypeptide or a fragment thereof.
  • the Cas9 polypeptide is a nuclease dead Cas9 (dCas9) polypeptide or a fragment thereof.
  • the Cas9 polypeptide in a fusion protein can be a full-length Cas9 polypeptide.
  • the Cas9 polypeptide in a fusion protein may not be a full length Cas9 polypeptide.
  • the Cas9 polypeptide can be truncated, for example, at a N-terminal or C- terminal end relative to a naturally-occurring Cas9 protein.
  • the Cas9 polypeptide can be a circularly permuted Cas9 protein.
  • the Cas9 polypeptide can be a fragment, a portion, or a domain of a Cas9 polypeptide, that is still capable of binding the target polynucleotide and a guide nucleic acid sequence.
  • the Cas9 polypeptide is a Streptococcus pyogenes Cas9 (SpCas9), Staphylococcus aureus Cas9 (SaCas9), Streptococcus thermophilus 1 Cas9 (St1Cas9), or fragments or variants thereof.
  • the Cas9 polypeptide of a fusion protein can comprise an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally- occurring Cas9 polypeptide.
  • the Cas9 polypeptide of a fusion protein can comprise an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to the Cas9 amino acid sequence set forth below (called the “Cas9 reference sequence” below): ATLIHQSITGLYETRIDLSQLGGD (single underline: HNH domain; double underline: RuvC domain).
  • Fusion proteins comprising a heterologous catalytic domain flanked by N- and C- terminal fragments of a Cas9 polypeptide are also useful for base editing in the methods as described herein. Fusion proteins comprising Cas9 and one or more deaminase domains, e.g., adenosine deaminase, or comprising an adenosine deaminase domain flanked by Cas9 sequences are also useful for highly specific and efficient base editing of target sequences.
  • deaminase domains e.g., adenosine deaminase, or comprising an adenosine deaminase domain flanked by Cas9 sequences are also useful for highly specific and efficient base editing of target sequences.
  • a chimeric Cas9 fusion protein contains a heterologous catalytic domain (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) inserted within a Cas9 polypeptide.
  • the fusion protein comprises an adenosine deaminase domain and a cytidine deaminase domain inserted within a Cas9.
  • an adenosine deaminase is fused within a Cas9 and a cytidine deaminase is fused to the C-terminus.
  • an adenosine deaminase is fused within Cas9 and a cytidine deaminase fused to the N-terminus.
  • a cytidine deaminase is fused within Cas9 and an adenosine deaminase is fused to the C-terminus.
  • a cytidine deaminase is fused within Cas9 and an adenosine deaminase fused to the N-terminus.
  • Exemplary structures of a fusion protein with an adenosine deaminase and a cytidine deaminase and a Cas9 are provided as follows: NH 2 -[Cas9(adenosine deaminase)]-[cytidine deaminase]-COOH; NH2-[cytidine deaminase]-[Cas9(adenosine deaminase)]-COOH; NH 2 -[Cas9(cytidine deaminase)]-[adenosine deaminase]-COOH; or NH2-[adenosine deaminase]-[Cas9(cytidine deaminase)]-COOH.
  • the “-” used in the general architecture above indicates the presence of an optional linker.
  • the catalytic domain has DNA modifying activity (e.g., deaminase activity), such as adenosine deaminase activity.
  • the adenosine deaminase is a TadA (e.g., TadA*7.10).
  • the TadA is a TadA*8.
  • a TadA*8 is fused within Cas9 and a cytidine deaminase is fused to the C- terminus.
  • a TadA*8 is fused within Cas9 and a cytidine deaminase fused to the N-terminus. In some embodiments, a cytidine deaminase is fused within Cas9 and a TadA*8 is fused to the C-terminus. In some embodiments, a cytidine deaminase is fused within Cas9 and a TadA*8 fused to the N-terminus.
  • Exemplary structures of a fusion protein with a TadA*8 and a cytidine deaminase and a Cas9 are provided as follows: NH 2 -[Cas9(TadA*8)]-[cytidine deaminase]-COOH; NH2-[cytidine deaminase]-[Cas9(TadA*8)]-COOH; NH 2 -[Cas9(cytidine deaminase)]-[TadA*8]-COOH; or NH2-[TadA*8]-[Cas9(cytidine deaminase)]-COOH.
  • the “-” used in the general architecture above indicates the presence of an optional linker.
  • the heterologous polypeptide e.g., deaminase
  • a deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • a deaminase can be inserted into a napDNAbp without compromising function of the deaminase (e.g., base editing activity) or the napDNAbp (e.g., ability to bind to target nucleic acid and guide nucleic acid).
  • a deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • a deaminase can be inserted in the napDNAbp at, for example, a disordered region or a region comprising a high temperature factor or B-factor as shown by crystallographic studies. Regions of a protein that are less ordered, disordered, or unstructured, for example solvent exposed regions and loops, can be used for insertion without compromising structure or function.
  • a deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase)can be inserted in the napDNAbp in a flexible loop region or a solvent- exposed region.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the insertion location of a deaminase is determined by B-factor analysis of the crystal structure of Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted in regions of the Cas9 polypeptide comprising higher than average B-factors (e.g., higher B factors compared to the total protein or the protein domain comprising the disordered region).
  • B-factor or temperature factor can indicate the fluctuation of atoms from their average position (for example, as a result of temperature-dependent atomic vibrations or static disorder in a crystal lattice).
  • a high B-factor (e.g., higher than average B-factor) for backbone atoms can be indicative of a region with relatively high local mobility. Such a region can be used for inserting a deaminase without compromising structure or function.
  • a deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • a deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • a deaminase can be inserted at a location with a residue having a C ⁇ atom with a B-factor that is 50%, 60%, 70%, 80%, 90%, 100%, 110%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200% or greater than 200% more than the average B-factor for a Cas9 protein domain comprising the residue.
  • Cas9 polypeptide positions comprising a higher than average B-factor can include, for example, residues 768, 792, 1052, 1015, 1022, 1026, 1029, 1067, 1040, 1054, 1068, 1246, 1247, and 1248 as numbered in the above Cas9 reference sequence.
  • Cas9 polypeptide regions comprising a higher than average B-factor can include, for example, residues 792-872, 792-906, and 2-791 as numbered in the above Cas9 reference sequence.
  • a heterologous polypeptide e.g., deaminase
  • the heterologous polypeptide is inserted between amino acid positions 768-769, 791-792, 792-793, 1015-1016, 1022-1023, 1026-1027, 1029-1030, 1040- 1041, 1052-1053, 1054-1055, 1067-1068, 1068-1069, 1247-1248, or 1248-1249 as numbered in the above Cas9 reference sequence or corresponding amino acid positions thereof.
  • the heterologous polypeptide is inserted between amino acid positions 769-770, 792-793, 793-794, 1016-1017, 1023-1024, 1027-1028, 1030-1031, 1041-1042, 1053-1054, 1055-1056, 1068-1069, 1069-1070, 1248-1249, or 1249-1250 as numbered in the above Cas9 reference sequence or corresponding amino acid positions thereof.
  • the heterologous polypeptide replaces an amino acid residue selected from the group consisting of: 768, 791, 792, 1015, 1016, 1022, 1023, 1026, 1029, 1040, 1052, 1054, 1067, 1068, 1069, 1246, 1247, and 1248 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide. It should be understood that the reference to the above Cas9 reference sequence with respect to insertion positions is for illustrative purposes.
  • the insertions as discussed herein are not limited to the Cas9 polypeptide sequence of the above Cas9 reference sequence, but include insertion at corresponding locations in variant Cas9 polypeptides, for example a Cas9 nickase (nCas9), nuclease dead Cas9 (dCas9), a Cas9 variant lacking a nuclease domain, a truncated Cas9, or a Cas9 domain lacking partial or complete HNH domain.
  • nCas9 Cas9 nickase
  • dCas9 nuclease dead Cas9
  • Cas9 variant lacking a nuclease domain for example a Cas9 nickase (nCas9), nuclease dead Cas9 (dCas9), a Cas9 variant lacking a nuclease domain, a truncated Cas9, or a Cas9 domain lacking partial or complete HNH domain.
  • a heterologous polypeptide (e.g., deaminase) can be inserted in the napDNAbp at an amino acid residue selected from the group consisting of: 768, 792, 1022, 1026, 1040, 1068, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the heterologous polypeptide is inserted between amino acid positions 768-769, 792-793, 1022-1023, 1026-1027, 1029-1030, 1040-1041, 1068-1069, or 1247-1248 as numbered in the above Cas9 reference sequence or corresponding amino acid positions thereof.
  • the heterologous polypeptide is inserted between amino acid positions 769-770, 793-794, 1023-1024, 1027-1028, 1030-1031, 1041-1042, 1069-1070, or 1248-1249 as numbered in the above Cas9 reference sequence or corresponding amino acid positions thereof.
  • the heterologous polypeptide replaces an amino acid residue selected from the group consisting of: 768, 792, 1022, 1026, 1040, 1068, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • a heterologous polypeptide (e.g., deaminase) can be inserted in the napDNAbp at an amino acid residue as described herein, or a corresponding amino acid residue in another Cas9 polypeptide.
  • a heterologous polypeptide e.g., deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) can be inserted at the N-terminus or the C- terminus of the residue or replace the residue.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • an adenosine deaminase e.g., TadA
  • an amino acid residue selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • an adenosine deaminase (e.g., TadA) is inserted in place of residues 792-872, 792-906, or 2-791 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the adenosine deaminase is inserted at the N- terminus of an amino acid selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the adenosine deaminase is inserted at the C-terminus of an amino acid selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the adenosine deaminase is inserted to replace an amino acid selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • a cytidine deaminase (e.g., APOBEC1) is inserted at an amino acid residue selected from the group consisting of: 1016, 1023, 1029, 1040, 1069, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the cytidine deaminase is inserted at the N- terminus of an amino acid selected from the group consisting of: 1016, 1023, 1029, 1040, 1069, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the cytidine deaminase is inserted at the C-terminus of an amino acid selected from the group consisting of: 1016, 1023, 1029, 1040, 1069, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide. In some embodiments, the cytidine deaminase is inserted to replace an amino acid selected from the group consisting of: 1016, 1023, 1029, 1040, 1069, and 1247 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 768 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N-terminus of amino acid residue 768 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 768 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 768 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 791 or is inserted at amino acid residue 792, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N-terminus of amino acid residue 791 or is inserted at the N- terminus of amino acid 792, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid 791 or is inserted at the N-terminus of amino acid 792, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid 791, or is inserted to replace amino acid 792, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1016 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N- terminus of amino acid residue 1016 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1016 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1016 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1022, or is inserted at amino acid residue 1023, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N-terminus of amino acid residue 1022 or is inserted at the N- terminus of amino acid residue 1023, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1022 or is inserted at the C- terminus of amino acid residue 1023, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1022, or is inserted to replace amino acid residue 1023, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1026, or is inserted at amino acid residue 1029, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N-terminus of amino acid residue 1026 or is inserted at the N- terminus of amino acid residue 1029, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1026 or is inserted at the C- terminus of amino acid residue 1029, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1026, or is inserted to replace amino acid residue 1029, as numbered in the above Cas9 reference sequence, or corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1040 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N- terminus of amino acid residue 1040 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1040 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1040 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1052, or is inserted at amino acid residue 1054, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the N-terminus of amino acid residue 1052 or is inserted at the N- terminus of amino acid residue 1054, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at the C-terminus of amino acid residue 1052 or is inserted at the C- terminus of amino acid residue 1054, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted to replace amino acid residue 1052, or is inserted to replace amino acid residue 1054, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase is inserted at amino acid residue 1067, or is inserted at amino acid residue 1068, or is inserted at amino acid residue 1069, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at the N-terminus of amino acid residue 1067 or is inserted at the N-terminus of amino acid residue 1068 or is inserted at the N-terminus of amino acid residue 1069, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at the C-terminus of amino acid residue 1067 or is inserted at the C-terminus of amino acid residue 1068 or is inserted at the C-terminus of amino acid residue 1069, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted to replace amino acid residue 1067, or is inserted to replace amino acid residue 1068, or is inserted to replace amino acid residue 1069, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at amino acid residue 1246, or is inserted at amino acid residue 1247, or is inserted at amino acid residue 1248, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at the N-terminus of amino acid residue 1246 or is inserted at the N-terminus of amino acid residue 1247 or is inserted at the N-terminus of amino acid residue 1248, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted at the C-terminus of amino acid residue 1246 or is inserted at the C-terminus of amino acid residue 1247 or is inserted at the C-terminus of amino acid residue 1248, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • adenosine deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) is inserted to replace amino acid residue 1246, or is inserted to replace amino acid residue 1247, or is inserted to replace amino acid residue 1248, as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • a heterologous polypeptide (e.g., deaminase) is inserted in a flexible loop of a Cas9 polypeptide.
  • the flexible loop portions can be selected from the group consisting of 530-537, 569-570, 686-691, 943-947, 1002-1025, 1052-1077, 1232-1247, or 1298- 1300 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the flexible loop portions can be selected from the group consisting of: 1-529, 538-568, 580-685, 692-942, 948-1001, 1026-1051, 1078-1231, or 1248- 1297 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • a heterologous polypeptide e.g., adenine deaminase
  • a heterologous polypeptide can be inserted into a Cas9 polypeptide region corresponding to amino acid residues: 1017-1069, 1242-1247, 1052-1056, 1060-1077, 1002 – 1003, 943-947, 530-537, 568-579, 686-691, 1242-1247, 1298 – 1300, 1066- 1077, 1052-1056, or 1060-1077 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • a heterologous polypeptide (e.g., adenine deaminase) can be inserted in place of a deleted region of a Cas9 polypeptide.
  • the deleted region can correspond to an N-terminal or C- terminal portion of the Cas9 polypeptide.
  • the deleted region corresponds to residues 792-872 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deleted region corresponds to residues 792-906 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the deleted region corresponds to residues 2-791 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide. In some embodiments, the deleted region corresponds to residues 1017-1069 as numbered in the above Cas9 reference sequence, or corresponding amino acid residues thereof.
  • Exemplary internal fusions base editors are provided in Table 9 below: Table 9: Insertion loci in Cas9 proteins [0719] A heterologous polypeptide (e.g., deaminase) can be inserted within a structural or functional domain of a Cas9 polypeptide.
  • a heterologous polypeptide (e.g., deaminase) can be inserted between two structural or functional domains of a Cas9 polypeptide.
  • a heterologous polypeptide (e.g., deaminase) can be inserted in place of a structural or functional domain of a Cas9 polypeptide, for example, after deleting the domain from the Cas9 polypeptide.
  • the structural or functional domains of a Cas9 polypeptide can include, for example, RuvC I, RuvC II, RuvC III, Rec1, Rec2, PI, or HNH.
  • the Cas9 polypeptide lacks one or more domains selected from the group consisting of: RuvC I, RuvC II, RuvC III, Rec1, Rec2, PI, or HNH domain. In some embodiments, the Cas9 polypeptide lacks a nuclease domain. In some embodiments, the Cas9 polypeptide lacks an HNH domain. In some embodiments, the Cas9 polypeptide lacks a portion of the HNH domain such that the Cas9 polypeptide has reduced or abolished HNH activity. In some embodiments, the Cas9 polypeptide comprises a deletion of the nuclease domain, and the deaminase is inserted to replace the nuclease domain.
  • a fusion protein comprising a heterologous polypeptide can be flanked by a N-terminal and a C-terminal fragment of a napDNAbp.
  • the fusion protein comprises a deaminase flanked by a N- terminal fragment and a C-terminal fragment of a Cas9 polypeptide. The N terminal fragment or the C terminal fragment can bind the target polynucleotide sequence.
  • the C-terminus of the N terminal fragment or the N-terminus of the C terminal fragment can comprise a part of a flexible loop of a Cas9 polypeptide.
  • the C-terminus of the N terminal fragment or the N-terminus of the C terminal fragment can comprise a part of an alpha-helix structure of the Cas9 polypeptide.
  • the N- terminal fragment or the C-terminal fragment can comprise a DNA binding domain.
  • the N-terminal fragment or the C-terminal fragment can comprise a RuvC domain.
  • the N-terminal fragment or the C-terminal fragment can comprise an HNH domain. In some embodiments, neither of the N-terminal fragment and the C-terminal fragment comprises an HNH domain.
  • the C-terminus of the N terminal Cas9 fragment comprises an amino acid that is in proximity to a target nucleobase when the fusion protein deaminates the target nucleobase.
  • the N-terminus of the C terminal Cas9 fragment comprises an amino acid that is in proximity to a target nucleobase when the fusion protein deaminates the target nucleobase.
  • the insertion location of different deaminases can be different in order to have proximity between the target nucleobase and an amino acid in the C-terminus of the N terminal Cas9 fragment or the N-terminus of the C terminal Cas9 fragment.
  • the insertion position of an deaminase can be at an amino acid residue selected from the group consisting of: 1015, 1022, 1029, 1040, 1068, 1247, 1054, 1026, 768, 1067, 1248, 1052, and 1246 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the N-terminal Cas9 fragment of a fusion protein i.e. the N-terminal Cas9 fragment flanking the deaminase in a fusion protein
  • the N-terminal Cas9 fragment of a fusion protein can comprise a length of at least about: 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids.
  • the N-terminal Cas9 fragment of a fusion protein can comprise a sequence corresponding to amino acid residues: 1-56, 1-95, 1-200, 1-300, 1-400, 1-500, 1-600, 1-700, 1-718, 1-765, 1-780, 1-906, 1- 918, or 1-1100 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the N-terminal Cas9 fragment can comprise a sequence comprising at least: 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity to amino acid residues: 1-56, 1-95, 1-200, 1-300, 1-400, 1-500, 1-600, 1-700, 1-718, 1-765, 1-780, 1-906, 1-918, or 1-1100 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the C-terminal Cas9 fragment of a fusion protein i.e.
  • the C-terminal Cas9 fragment flanking the deaminase in a fusion protein can comprise the C-terminus of a Cas9 polypeptide.
  • the C-terminal Cas9 fragment of a fusion protein can comprise a length of at least about: 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, or 1300 amino acids.
  • the C-terminal Cas9 fragment of a fusion protein can comprise a sequence corresponding to amino acid residues: 1099-1368, 918-1368, 906-1368, 780-1368, 765-1368, 718-1368, 94-1368, or 56-1368 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the N-terminal Cas9 fragment can comprise a sequence comprising at least: 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% sequence identity to amino acid residues: 1099-1368, 918-1368, 906-1368, 780-1368, 765-1368, 718-1368, 94-1368, or 56- 1368 as numbered in the above Cas9 reference sequence, or a corresponding amino acid residue in another Cas9 polypeptide.
  • the N-terminal Cas9 fragment and C-terminal Cas9 fragment of a fusion protein taken together may not correspond to a full-length naturally occurring Cas9 polypeptide sequence, for example, as set forth in the above Cas9 reference sequence.
  • the fusion protein described herein can effect targeted deamination with reduced deamination at non-target sites (e.g., off-target sites), such as reduced genome wide spurious deamination.
  • the fusion protein described herein can effect targeted deamination with reduced bystander deamination at non-target sites.
  • the undesired deamination or off-target deamination can be reduced by at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% compared with, for example, an end terminus fusion protein comprising the deaminase fused to a N terminus or a C terminus of a Cas9 polypeptide.
  • the undesired deamination or off-target deamination can be reduced by at least one-fold, at least two-fold, at least three-fold, at least four-fold, at least five-fold, at least tenfold, at least fifteen fold, at least twenty fold, at least thirty fold, at least forty fold, at least fifty fold, at least 60 fold, at least 70 fold, at least 80 fold, at least 90 fold, or at least hundred fold, compared with, for example, an end terminus fusion protein comprising the deaminase fused to a N terminus or a C terminus of a Cas9 polypeptide.
  • the deaminase e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase
  • the deaminase of the fusion protein deaminates no more than two nucleobases within the range of an R-loop. In some embodiments, the deaminase of the fusion protein deaminates no more than three nucleobases within the range of the R-loop. In some embodiments, the deaminase of the fusion protein deaminates no more than 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleobases within the range of the R-loop.
  • An R-loop is a three-stranded nucleic acid structure including a DNA:RNA hybrid, a DNA:DNA or an RNA: RNA complementary structure and the associated with single-stranded DNA.
  • an R-loop may be formed when a target polynucleotide is contacted with a CRISPR complex or a base editing complex, wherein a portion of a guide polynucleotide, e.g. a guide RNA, hybridizes with and displaces with a portion of a target polynucleotide, e.g. a target DNA.
  • an R-loop comprises a hybridized region of a spacer sequence and a target DNA complementary sequence.
  • An R-loop region may be of about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 nucleobase pairs in length. In some embodiments, the R-loop region is about 20 nucleobase pairs in length. It should be understood that, as used herein, an R-loop region is not limited to the target DNA strand that hybridizes with the guide polynucleotide.
  • editing of a target nucleobase within an R-loop region may be to a DNA strand that comprises the complementary strand to a guide RNA, or may be to a DNA strand that is the opposing strand of the strand complementary to the guide RNA.
  • editing in the region of the R-loop comprises editing a nucleobase on non-complementary strand (protospacer strand) to a guide RNA in a target DNA sequence.
  • the fusion protein described herein can effect target deamination in an editing window different from canonical base editing.
  • a target nucleobase is from about 1 to about 20 bases upstream of a PAM sequence in the target polynucleotide sequence.
  • a target nucleobase is from about 2 to about 12 bases upstream of a PAM sequence in the target polynucleotide sequence. In some embodiments, a target nucleobase is from about 1 to 9 base pairs, about 2 to 10 base pairs, about 3 to 11 base pairs, about 4 to 12 base pairs, about 5 to 13 base pairs, about 6 to 14 base pairs, about 7 to 15 base pairs, about 8 to 16 base pairs, about 9 to 17 base pairs, about 10 to 18 base pairs, about 11 to 19 base pairs, about 12 to 20 base pairs, about 1 to 7 base pairs, about 2 to 8 base pairs, about 3 to 9 base pairs, about 4 to 10 base pairs, about 5 to 11 base pairs, about 6 to 12 base pairs, about 7 to 13 base pairs, about 8 to 14 base pairs, about 9 to 15 base pairs, about 10 to 16 base pairs, about 11 to 17 base pairs, about 12 to 18 base pairs, about 13 to 19 base pairs, about 14 to 20 base pairs, about 1 to 5 base pairs, about 2 to 6 base pairs, about 3 to 7 base pairs, about 4
  • a target nucleobase is about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more base pairs away from or upstream of the PAM sequence. In some embodiments, a target nucleobase is about 1, 2, 3, 4, 5, 6, 7, 8, or 9 base pairs upstream of the PAM sequence. In some embodiments, a target nucleobase is about 2, 3, 4, or 6 base pairs upstream of the PAM sequence.
  • the fusion protein can comprise more than one heterologous polypeptide.
  • the fusion protein can additionally comprise one or more UGI domains and/or one or more nuclear localization signals. The two or more heterologous domains can be inserted in tandem.
  • a fusion protein can comprise a linker between the deaminase and the napDNAbp polypeptide.
  • the linker can be a peptide or a non-peptide linker.
  • the linker can be
  • the fusion protein comprises a linker between the N-terminal Cas9 fragment and the deaminase.
  • the fusion protein comprises a linker between the C- terminal Cas9 fragment and the deaminase.
  • the N-terminal and C- terminal fragments of napDNAbp are connected to the deaminase with a linker.
  • the N-terminal and C-terminal fragments are joined to the deaminase domain without a linker.
  • the fusion protein comprises a linker between the N- terminal Cas9 fragment and the deaminase, but does not comprise a linker between the C- terminal Cas9 fragment and the deaminase.
  • the fusion protein comprises a linker between the C-terminal Cas9 fragment and the deaminase, but does not comprise a linker between the N-terminal Cas9 fragment and the deaminase.
  • the napDNAbp in the fusion protein is a Cas12 polypeptide, e.g., Cas12b/C2c1, or a fragment thereof.
  • the Cas12 polypeptide can be a variant Cas12 polypeptide.
  • the N- or C-terminal fragments of the Cas12 polypeptide comprise a nucleic acid programmable DNA binding domain or a RuvC domain.
  • the fusion protein contains a linker between the Cas12 polypeptide and the catalytic domain.
  • the amino acid sequence of the linker is GGSGGS or GSSGSETPGTSESATPESSG.
  • the linker is a rigid linker.
  • the linker is encoded by or [0732] Fusion proteins comprising a heterologous catalytic domain flanked by N- and C- terminal fragments of a Cas12 polypeptide are also useful for base editing in the methods as described herein. Fusion proteins comprising Cas12 and one or more deaminase domains, e.g., adenosine deaminase, or comprising an adenosine deaminase domain flanked by Cas12 sequences are also useful for highly specific and efficient base editing of target sequences.
  • a chimeric Cas12 fusion protein contains a heterologous catalytic domain (e.g., adenosine deaminase, cytidine deaminase, or adenosine deaminase and cytidine deaminase) inserted within a Cas12 polypeptide.
  • the fusion protein comprises an adenosine deaminase domain and a cytidine deaminase domain inserted within a Cas12.
  • an adenosine deaminase is fused within Cas12 and a cytidine deaminase is fused to the C-terminus.
  • an adenosine deaminase is fused within Cas12 and a cytidine deaminase fused to the N-terminus.
  • a cytidine deaminase is fused within Cas12 and an adenosine deaminase is fused to the C-terminus.
  • a cytidine deaminase is fused within Cas12 and an adenosine deaminase fused to the N-terminus.
  • Exemplary structures of a fusion protein with an adenosine deaminase and a cytidine deaminase and a Cas12 are provided as follows: NH2-[Cas12(adenosine deaminase)]-[cytidine deaminase]-COOH; NH 2 -[cytidine deaminase]-[Cas12(adenosine deaminase)]-COOH; NH2-[Cas12(cytidine deaminase)]-[adenosine deaminase]-COOH; or NH 2 -[adenosine deaminase]-[Cas12(cytidine deaminase)]-COOH; [0733]
  • the “-” used in the general architecture above indicates the presence of an optional linker.
  • the catalytic domain has DNA modifying activity (e.g., deaminase activity), such as adenosine deaminase activity.
  • the adenosine deaminase is a TadA (e.g., TadA*7.10).
  • the TadA is a TadA*8.
  • a TadA*8 is fused within Cas12 and a cytidine deaminase is fused to the C- terminus.
  • a TadA*8 is fused within Cas12 and a cytidine deaminase fused to the N-terminus.
  • a cytidine deaminase is fused within Cas12 and a TadA*8 is fused to the C-terminus. In some embodiments, a cytidine deaminase is fused within Cas12 and a TadA*8 fused to the N-terminus.
  • Exemplary structures of a fusion protein with a TadA*8 and a cytidine deaminase and a Cas12 are provided as follows: N-[Cas12(TadA*8)]-[cytidine deaminase]-C; N-[cytidine deaminase]-[Cas12(TadA*8)]-C; N-[Cas12(cytidine deaminase)]-[TadA*8]-C; or N-[TadA*8]-[Cas12(cytidine deaminase)]-C.
  • the “-” used in the general architecture above indicates the presence of an optional linker.
  • the fusion protein contains one or more catalytic domains. In other embodiments, at least one of the one or more catalytic domains is inserted within the Cas12 polypeptide or is fused at the Cas12 N- terminus or C-terminus. In other embodiments, at least one of the one or more catalytic domains is inserted within a loop, an alpha helix region, an unstructured portion, or a solvent accessible portion of the Cas12 polypeptide.
  • the Cas12 polypeptide is Cas12a, Cas12b, Cas12c, Cas12d, Cas12e, Cas12g, Cas12h, Cas12i, or Cas12j/CasF.
  • the Cas12 polypeptide has at least about 85% amino acid sequence identity to Bacillus hisashii Cas12b, Bacillus thermoamylovorans Cas12b, Bacillus sp. V3-13 Cas12b, or Alicyclobacillus acidiphilus Cas12b.
  • the Cas12 polypeptide has at least about 90% amino acid sequence identity to Bacillus hisashii Cas12b, Bacillus thermoamylovorans Cas12b, Bacillus sp. V3-13 Cas12b, or Alicyclobacillus acidiphilus Cas12b. In other embodiments, the Cas12 polypeptide has at least about 95% amino acid sequence identity to Bacillus hisashii Cas12b, Bacillus thermoamylovorans Cas12b, Bacillus sp. V3-13 Cas12b, or Alicyclobacillus acidiphilus Cas12b.
  • the Cas12 polypeptide contains or consists essentially of a fragment of Bacillus hisashii Cas12b, Bacillus thermoamylovorans Cas12b, Bacillus sp. V3-13 Cas12b, or Alicyclobacillus acidiphilus Cas12b.
  • the catalytic domain is inserted between amino acid positions 153- 154, 255-256, 306-307, 980-981, 1019-1020, 534-535, 604-605, or 344-345 of BhCas12b or a corresponding amino acid residue of Cas12a, Cas12c, Cas12d, Cas12e, Cas12g, Cas12h, Cas12i, or Cas12j/CasF.
  • the catalytic domain is inserted between amino acids P153 and S154 of BhCas12b.
  • the catalytic domain is inserted between amino acids K255 and E256 of BhCas12b.
  • the catalytic domain is inserted between amino acids D980 and G981 of BhCas12b. In other embodiments, the catalytic domain is inserted between amino acids K1019 and L1020 of BhCas12b. In other embodiments, the catalytic domain is inserted between amino acids F534 and P535 of BhCas12b. In other embodiments, the catalytic domain is inserted between amino acids K604 and G605 of BhCas12b. In other embodiments, the catalytic domain is inserted between amino acids H344 and F345 of BhCas12b.
  • catalytic domain is inserted between amino acid positions 147 and 148, 248 and 249, 299 and 300, 991 and 992, or 1031 and 1032 of BvCas12b or a corresponding amino acid residue of Cas12a, Cas12c, Cas12d, Cas12e, Cas12g, Cas12h, Cas12i, or Cas12j/CasF.
  • the catalytic domain is inserted between amino acids P147 and D148 of BvCas12b.
  • the catalytic domain is inserted between amino acids G248 and G249 of BvCas12b.
  • the catalytic domain is inserted between amino acids P299 and E300 of BvCas12b. In other embodiments, the catalytic domain is inserted between amino acids G991 and E992 of BvCas12b. In other embodiments, the catalytic domain is inserted between amino acids K1031 and M1032 of BvCas12b.
  • the catalytic domain is inserted between amino acid positions 157 and 158, 258 and 259, 310 and 311, 1008 and 1009, or 1044 and 1045 of AaCas12b or a corresponding amino acid residue of Cas12a, Cas12c, Cas12d, Cas12e, Cas12g, Cas12h, Cas12i, or Cas12j/CasF.
  • the catalytic domain is inserted between amino acids P157 and G158 of AaCas12b.
  • the catalytic domain is inserted between amino acids V258 and G259 of AaCas12b.
  • the catalytic domain is inserted between amino acids D310 and P311 of AaCas12b. In other embodiments, the catalytic domain is inserted between amino acids G1008 and E1009 of AaCas12b. In other embodiments, the catalytic domain is inserted between amino acids G1044 and K1045 at of AaCas12b.
  • the fusion protein contains a nuclear localization signal (e.g., a bipartite nuclear localization signal). In other embodiments, the amino acid sequence of the nuclear localization signal is MAPKKKRKVGIHGVPAA.
  • the nuclear localization signal is encoded by the following sequence: [0739] ATGGCCCCAAAGAAGAAGCGGAAGGTCGGTATCCACGGAGTCCCAGCAGCC.
  • the Cas12b polypeptide contains a mutation that silences the catalytic activity of a RuvC domain.
  • the Cas12b polypeptide contains D574A, D829A and/or D952A mutations.
  • the fusion protein further contains a tag (e.g., an influenza hemagglutinin tag).
  • the fusion protein comprises a napDNAbp domain (e.g., Cas12- derived domain) with an internally fused nucleobase editing domain (e.g., all or a portion of a deaminase domain, e.g., an adenosine deaminase domain).
  • the napDNAbp is a Cas12b.
  • the base editor comprises a BhCas12b domain with an internally fused TadA*8 domain inserted at the loci provided in Table 10 below.
  • an adenosine deaminase e.g., TadA*8.13
  • a fusion protein e.g., TadA*8.13-BhCas12b
  • the base editing system described herein is an ABE with TadA inserted into a Cas9. Sequences of relevant ABEs with TadA inserted into a Cas9 are provided. 101 Cas9 TadAins 1015
  • Cas9 TadAins 1254 108 Cas9 TadAins 1026 109 Cas9 TadAins 768 110.1 Cas9 TadAins 1250 110.2 Cas9 TadAins 1250 110.3 Cas9 TadAins 1250 110.4 Cas9 TadAins 1250 MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGA 110.5 Cas9 TadAins 1249
  • Cas9 TadAins1006 115.3 Cas9 TadAins1006 115.4 Cas9 TadAins1007 116.1 Cas9 TadAins C-term truncate2792 116.2 Cas9 TadAins C-term truncate2791 116.3 Cas9 TadAins C-term truncate2790 117 Cas9 delta 1017-1069
  • adenosine deaminase base editors were generated to insert TadA or variants thereof into the Cas9 polypeptide at the identified positions.
  • Exemplary, yet nonlimiting, fusion proteins are described in International PCT Application Nos. PCT/US2020/016285 and U.S. Provisional Application Nos.62/852,228 and 62/852,224, the contents of which are incorporated by reference herein in their entireties.
  • a to G Editing [0745]
  • a base editor described herein comprises a fusion protein comprising an adenosine deaminase domain.
  • Such an adenosine deaminase domain of a base editor can facilitate the editing of an adenine (A) nucleobase to a guanine (G) nucleobase by deaminating the A to form inosine (I), which exhibits base pairing properties of G.
  • Adenosine deaminase is capable of deaminating (i.e., removing an amine group) adenine of a deoxyadenosine residue in deoxyribonucleic acid (DNA).
  • the nucleobase editors provided herein can be made by fusing together one or more protein domains, thereby generating a fusion protein.
  • the fusion proteins provided herein comprise one or more features that improve the base editing activity (e.g., efficiency, selectivity, and specificity) of the fusion proteins.
  • the fusion proteins provided herein can comprise a Cas9 domain that has reduced nuclease activity.
  • the fusion proteins provided herein can have a Cas9 domain that does not have nuclease activity (dCas9), or a Cas9 domain that cuts one strand of a duplexed DNA molecule, referred to as a Cas9 nickase (nCas9).
  • the presence of the catalytic residue maintains the activity of the Cas9 to cleave the non-edited (e.g., non-deaminated) strand containing a T opposite the targeted A.
  • Mutation of the catalytic residue (e.g., D10 to A10) of Cas9 prevents cleavage of the edited strand containing the targeted A residue.
  • Such Cas9 variants are able to generate a single- strand DNA break (nick) at a specific location based on the gRNA-defined target sequence, leading to repair of the non-edited strand, ultimately resulting in a T to C change on the non- edited strand.
  • an A-to-G base editor further comprises an inhibitor of inosine base excision repair, for example, a uracil glycosylase inhibitor (UGI) domain or a catalytically inactive inosine specific nuclease.
  • a uracil glycosylase inhibitor (UGI) domain or a catalytically inactive inosine specific nuclease.
  • the UGI domain or catalytically inactive inosine specific nuclease can inhibit or prevent base excision repair of a deaminated adenosine residue (e.g., inosine), which can improve the activity or efficiency of the base editor.
  • a base editor comprising an adenosine deaminase can act on any polynucleotide, including DNA, RNA and DNA-RNA hybrids.
  • a base editor comprising an adenosine deaminase can deaminate a target A of a polynucleotide comprising RNA.
  • the base editor can comprise an adenosine deaminase domain capable of deaminating a target A of an RNA polynucleotide and/or a DNA-RNA hybrid polynucleotide.
  • an adenosine deaminase incorporated into a base editor comprises all or a portion of adenosine deaminase acting on RNA (ADAR, e.g., ADAR1 or ADAR2).
  • ADAR e.g., ADAR1 or ADAR2
  • an adenosine deaminase incorporated into a base editor comprises all or a portion of adenosine deaminase acting on tRNA (ADAT).
  • a base editor comprising an adenosine deaminase domain can also be capable of deaminating an A nucleobase of a DNA polynucleotide.
  • an adenosine deaminase domain of a base editor comprises all or a portion of an ADAT comprising one or more mutations which permit the ADAT to deaminate a target A in DNA.
  • the base editor can comprise all or a portion of an ADAT from Escherichia coli (EcTadA) comprising one or more of the following mutations: D108N, A106V, D147Y, E155V, L84F, H123Y, I156F, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase can be derived from any suitable organism (e.g., E. coli).
  • the adenosine deaminase is from a prokaryote.
  • the adenosine deaminase is from a bacterium.
  • the adenosine deaminase is from Escherichia coli, Staphylococcus aureus, Salmonella typhi, Shewanella putrefaciens, Haemophilus influenzae, Caulobacter crescentus, or Bacillus subtilis. In some embodiments, the adenosine deaminase is from E. coli. In some embodiments, the adenine deaminase is a naturally-occurring adenosine deaminase that includes one or more mutations corresponding to any of the mutations provided herein (e.g., mutations in ecTadA).
  • any homologous protein can be identified by e.g., sequence alignment and determination of homologous residues.
  • the mutations in any naturally-occurring adenosine deaminase e.g., having homology to ecTadA
  • any of the mutations described herein e.g., any of the mutations identified in ecTadA
  • Adenosine deaminases [0749]
  • the fusion proteins of the invention comprise one or more adenosine deaminase domains.
  • the adenosine deaminases provided herein are capable of deaminating adenine.
  • the adenosine deaminases provided herein are capable of deaminating adenine in a deoxyadenosine residue of DNA.
  • the adenosine deaminase may be derived from any suitable organism (e.g., E. coli).
  • the adenine deaminase is a naturally-occurring adenosine deaminase that includes one or more mutations corresponding to any of the mutations provided herein (e.g., mutations in ecTadA).
  • mutations in ecTadA mutations in ecTadA
  • adenosine deaminase e.g., having homology to ecTadA
  • the adenosine deaminase is from a prokaryote.
  • the adenosine deaminase is from a bacterium.
  • the adenosine deaminase is from Escherichia coli, Staphylococcus aureus, Salmonella typhi, Shewanella putrefaciens, Haemophilus influenzae, Caulobacter crescentus, or Bacillus subtilis. In some embodiments, the adenosine deaminase is from E. coli. [0750] The invention provides adenosine deaminase variants that have increased efficiency (>50-60%) and specificity.
  • the adenosine deaminase variants described herein are more likely to edit a desired base within a polynucleotide, and are less likely to edit bases that are not intended to be altered (i.e., “bystanders”).
  • the adenosine deaminase is a TadA deaminase.
  • the TadA is any one of the TadA described in PCT/US2017/045381 (WO 2018/027078), which is incorporated herein by reference in its entirety.
  • a wild type TadA(wt) adenosine deaminase has the following sequence (also termed TadA reference sequence): [0753]
  • the adenosine deaminase is a full-length E. coli TadA deaminase.
  • the adenosine deaminase comprises the amino acid sequence: [0754]
  • the adenosine deaminase is from a prokaryote.
  • the adenosine deaminase is from a bacterium.
  • the adenosine deaminase is from Escherichia coli (E. coli), Staphylococcus aureus (S. aureus), Salmonella typhimurium (S. typhimurium), Shewanella putrefaciens (S. putrefaciens), Haemophilus influenzae (H. influenzae), Caulobacter crescentus (C. crescentus), Geobacter sulfurreducens (G. sulfurreducens), or Bacillus subtilis.
  • E. coli Escherichia coli
  • Staphylococcus aureus S. aureus
  • Salmonella typhimurium S. typhimurium
  • Shewanella putrefaciens S. putrefaciens
  • Haemophilus influenzae H. influenzae
  • Caulobacter crescentus Caulobacter crescentus
  • Geobacter sulfurreducens G. sulfurreducens
  • Bacillus subtilis Bacillus subtilis.
  • the adenosine deaminase may be a homolog of adenosine deaminase acting on tRNA (ADAT).
  • ADAT tRNA
  • the amino acid sequences of exemplary AD AT homologs include the following: Staphylococcus aureus (S. aureus) TadA: Bacillus subtilis (B. subtilis) TadA: Salmonella typhimurium (S. typhimurium) TadA: Shewanella putrefaciens (S.
  • TadA Haemophilus influenzae F3031 (H. influenzae)
  • TadA Caulobacter crescentus (C. crescentus)
  • TadA Geobacter sulfurreducens (G. sulfurreducens)
  • TadA An embodiment of E.
  • Coli TadA includes the following: [0756]
  • the adenosine deaminase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the amino acid sequences set forth in any of the adenosine deaminases provided herein.
  • adenosine deaminases provided herein may include one or more mutations (e.g., any of the mutations provided herein).
  • the disclosure provides any deaminase domains with a certain percent identify plus any of the mutations or combinations thereof described herein.
  • the adenosine deaminase comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more mutations compared to a reference sequence, or any of the adenosine deaminases provided herein.
  • the adenosine deaminase comprises an amino acid sequence that has at least 5, at least 10, at least 15, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 110, at least 120, at least 130, at least 140, at least 150, at least 160, or at least 170 identical contiguous amino acid residues as compared to any one of the amino acid sequences known in the art or described herein.
  • any of the mutations provided herein e.g., based on the TadA reference sequence
  • coli TadA ecTadA
  • S. aureus TadA saTadA
  • other adenosine deaminases e.g., bacterial adenosine deaminases
  • additional deaminases may similarly be aligned to identify homologous amino acid residues that can be mutated as provided herein.
  • any of the mutations identified in the TadA reference sequence can be made in other adenosine deaminases (e.g., ecTada) that have homologous amino acid residues.
  • the adenosine deaminase comprises a D108X mutation in the TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a D108G, D108N, D108V, D108A, or D108Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase. It should be appreciated, however, that additional deaminases may similarly be aligned to identify homologous amino acid residues that can be mutated as provided herein.
  • the adenosine deaminase comprises an A106X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an A106V mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises a E155X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a E155D, E155G, or E155V mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises a D147X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises a D147Y, mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an A106X, E155X, or D147X, mutation in the TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA), where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an E155D, E155G, or E155V mutation.
  • the adenosine deaminase comprises a D147Y.
  • any of the mutations provided herein may be introduced into other adenosine deaminases, such as S. aureus TadA (saTadA), or other adenosine deaminases (e.g., bacterial adenosine deaminases). It would be apparent to the skilled artisan how to are homologous to the mutated residues in ecTadA. Thus, any of the mutations identified in ecTadA may be made in other adenosine deaminases that have homologous amino acid residues.
  • an adenosine deaminase may contain a D108N, a A106V, a E155V, and/or a D147Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • an adenosine deaminase comprises the following group of mutations (groups of mutations are separated by a ";") in TadA reference sequence, or corresponding mutations in another adenosine deaminase: D108N and A106V; D108N and E155V; D108N and D147Y; A106V and E155V; A106V and D147Y; E155V and D147Y; D108N, A106V, and E155V; D108N, A106V, and D147Y; D108N, E155V, and D147Y; A106V, E155V, and D147Y; and D108N, A106V, E155V, and D147Y.
  • the adenosine deaminase comprises one or more of a H8X, T17X, L18X, W23X, L34X, W45X, R51X, A56X, E59X, E85X, M94X, I95X, V102X, F104X, A106X, R107X, D108X, K110X, M118X, N127X, A138X, F149X, M151X, R153X, Q154X, I156X, and/or K157X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of H8Y, T17S, L18E, W23L, L34S, W45L, R51H, A56E, or A56S, E59G, E85K, or E85G, M94L, I95L, V102A, F104L, A106V, R107C, or R107H, or R107P, D108G, or D108N, or D108V, or D108A, or D108Y, K110I, M118K, N127S, A138V, F149Y, M151V, R153C, Q154L, I156D, and/or K157R mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises one or more of a H8X, D108X, and/or N127X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where X indicates the presence of any amino acid.
  • the adenosine deaminase comprises one or more of a H8Y, D108N, and/or N127S mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises one or more of H8X, R26X, M61X, L68X, M70X, A106X, D108X, A109X, N127X, D147X, R152X, Q154X, E155X, K161X, Q163X, and/or T166X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of H8Y, R26W, M61I, L68Q, M70V, A106T, D108N, A109T, N127S, D147Y, R152C, Q154H or Q154R, E155G or E155V or E155D, K161Q, Q163H, and/or T166P mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8X, D108X, N127X, D147X, R152X, and Q154X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8X, M61X, M70X, D108X, N127X, Q154X, E155X, and Q163X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8X, D108X, N127X, E155X, and T166X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA), where X indicates the presence of any amino acid other than the corresponding amino acid in the wild- type adenosine deaminase.
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8X, A106X, and D108X, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8X, R26X, L68X, D108X, N127X, D147X, and E155X, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, six, or seven mutations selected from the group consisting of H8X, R126X, L68X, D108X, N127X, D147X, and E155X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, or five mutations selected from the group consisting of H8X, D108X, A109X, N127X, and E155X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8Y, D108N, N127S, D147Y, R152C, and Q154H in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8Y, M61I, M70V, D108N, N127S, Q154R, E155G and Q163H in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8Y, D108N, N127S, E155V, and T166P in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of H8Y, A106T, D108N, N127S, E155D, and K161Q in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, five, six, seven, or eight mutations selected from the group consisting of H8Y, R26W, L68Q, D108N, N127S, D147Y, and E155V in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one, two, three, four, or five, mutations selected from the group consisting of H8Y, D108N, A109T, N127S, and E155G in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one or more of the or one or more corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises a D108N, D108G, or D108V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase. In some embodiments, the adenosine deaminase comprises a A106V and D108N mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase. In some embodiments, the adenosine deaminase comprises R107C and D108N mutations in TadA reference sequence, or corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises a H8Y, D108N, N127S, D147Y, and Q154H mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase. In some embodiments, the adenosine deaminase comprises a H8Y, D108N, N127S, D147Y, and E155V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises a D108N, D147Y, and E155V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase. In some embodiments, the adenosine deaminase comprises a H8Y, D108N, and N127S mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises a A106V, D108N, D147Y, and E155V mutation in TadA reference sequence, or corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one or more of S2X, H8X, I49X, L84X, H123X, N127X, I156X, and/or K160X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of S2A, H8Y, I49F, L84F, H123Y, N127S, I156F, and/or K160S mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an L84X mutation adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an L84F mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an H123X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an H123Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an I156X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an I156F mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, six, or seven mutations selected from the group consisting of L84X, A106X, D108X, H123X, D147X, E155X, and I156X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of S2X, I49X, A106X, D108X, D147X, and E155X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, or five mutations selected from the group consisting of H8X, A106X, D108X, N127X, and K160X in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase, where X indicates the presence of any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, six, or seven mutations selected from the group consisting of L84F, A106V, D108N, H123Y, D147Y, E155V, and I156F in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase.
  • the adenosine deaminase comprises one, two, three, four, five, or six mutations selected from the group consisting of S2A, I49F, A106V, D108N, D147Y, and E155V in TadA reference sequence.
  • the adenosine deaminase comprises one, two, three, four, or five mutations selected from the group consisting of H8Y, A106T, D108N, N127S, and K160S in TadA reference sequence, or a corresponding mutation or mutations in another adenosine deaminase.
  • the adenosine deaminase comprises one or more of a E25X, R26X, R107X, A142X, and/or A143X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of E25M, E25D, E25A, E25R, E25V, E25S, E25Y, R26G, R26N, R26Q, R26C, R26L, R26K, R107P, R107K, R107A, R107N, R107W, R107H, R107S, A142N, A142D, A142G, A143D, A143G, A143E, A143L, A143W, A143M, A143S, A143Q, and/or A143R mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises one or more of the mutations described herein corresponding to TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase.
  • the adenosine deaminase comprises an E25X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an E25M, E25D, E25A, E25R, E25V, E25S, or E25Y mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an R26X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises R26G, R26N, R26Q, R26C, R26L, or R26K mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an R107X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an R107P, R107K, R107A, R107N, R107W, R107H, or R107S mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an A142X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an A142N, A142D, A142G, mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises an A143X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an A143D, A143G, A143E, A143L, A143W, A143M, A143S, A143Q, and/or A143R mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase (e.g., ecTadA).
  • the adenosine deaminase comprises one or more of a H36X, N37X, P48X, I49X, R51X, M70X, N72X, D77X, E134X, S146X, Q154X, K157X, and/or K161X mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase, where the presence of X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises one or more of H36L, N37T, N37S, P48T, P48L, I49V, R51H, R51L, M70L, N72S, D77G, E134G, S146R, S146C, Q154H, K157N, and/or K161T mutation in TadA reference sequence, or one or more corresponding mutations in another adenosine deaminase (e.g., ecTadA).
  • ecTadA another adenosine deaminase
  • the adenosine deaminase comprises an H36X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an H36L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an N37X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an N37T or N37S mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.
  • the adenosine deaminase comprises an P48X mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase, where X indicates any amino acid other than the corresponding amino acid in the wild-type adenosine deaminase.
  • the adenosine deaminase comprises an P48T or P48L mutation in TadA reference sequence, or a corresponding mutation in another adenosine deaminase.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Biomedical Technology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Epidemiology (AREA)
  • Biophysics (AREA)
  • Biotechnology (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Wood Science & Technology (AREA)
  • Cell Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • General Engineering & Computer Science (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Microbiology (AREA)
  • Hematology (AREA)
  • Physics & Mathematics (AREA)
  • Plant Pathology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Virology (AREA)
  • Oncology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Developmental Biology & Embryology (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
PCT/US2020/052822 2019-09-27 2020-09-25 Compositions and methods for treatment of liquid cancers Ceased WO2021062227A2 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
KR1020227013872A KR20220090512A (ko) 2019-09-27 2020-09-25 액체암의 치료를 위한 조성물 및 방법
EP20868560.2A EP4034138A4 (en) 2019-09-27 2020-09-25 COMPOSITIONS AND METHODS FOR THE TREATMENT OF LIQUID CANCERS
CN202080082229.8A CN115279398B (zh) 2019-09-27 2020-09-25 治疗液态癌症的组合物和方法
CA3155667A CA3155667A1 (en) 2019-09-27 2020-09-25 Compositions and methods for treatment of liquid cancers
US17/762,690 US12594301B2 (en) 2019-09-27 2020-09-25 Compositions and methods for treatment of liquid cancers
JP2022519460A JP7615134B2 (ja) 2019-09-27 2020-09-25 液体がんの治療のための組成物および方法
CN202510808723.2A CN120905310A (zh) 2019-09-27 2020-09-25 治疗液态癌症的组合物和方法
AU2020355222A AU2020355222A1 (en) 2019-09-27 2020-09-25 Compositions and methods for treatment of liquid cancers
JP2024231478A JP2025066723A (ja) 2019-09-27 2024-12-27 液体がんの治療のための組成物および方法

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201962907254P 2019-09-27 2019-09-27
US62/907,254 2019-09-27

Publications (2)

Publication Number Publication Date
WO2021062227A2 true WO2021062227A2 (en) 2021-04-01
WO2021062227A3 WO2021062227A3 (en) 2021-05-06

Family

ID=75166843

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2020/052822 Ceased WO2021062227A2 (en) 2019-09-27 2020-09-25 Compositions and methods for treatment of liquid cancers

Country Status (8)

Country Link
US (1) US12594301B2 (https=)
EP (1) EP4034138A4 (https=)
JP (2) JP7615134B2 (https=)
KR (1) KR20220090512A (https=)
CN (2) CN115279398B (https=)
AU (1) AU2020355222A1 (https=)
CA (1) CA3155667A1 (https=)
WO (1) WO2021062227A2 (https=)

Cited By (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2022056459A1 (en) * 2020-09-14 2022-03-17 Vor Biopharma, Inc. Compositions and methods for cd5 modification
WO2022061115A1 (en) * 2020-09-18 2022-03-24 Vor Biopharma Inc. Compositions and methods for cd7 modification
US11459372B2 (en) 2020-11-30 2022-10-04 Crispr Therapeutics Ag Gene-edited natural killer cells
WO2022228471A1 (zh) * 2021-04-27 2022-11-03 上海驯鹿生物技术有限公司 一种基因编辑的造血干细胞及其与car-t细胞的联合应用
WO2023108107A3 (en) * 2021-12-10 2023-08-17 Beam Therapeutics Inc. Modified immune cells and methods of using the same
WO2023137457A3 (en) * 2022-01-13 2023-08-31 Spotlight Therapeutics Immune response specific guide rnas and uses thereof
US11814620B2 (en) 2021-05-10 2023-11-14 Mammoth Biosciences, Inc. Effector proteins and methods of use
WO2023225665A1 (en) * 2022-05-19 2023-11-23 Lyell Immunopharma, Inc. Polynucleotides targeting nr4a3 and uses thereof
WO2024059824A3 (en) * 2022-09-16 2024-04-25 Arsenal Biosciences, Inc. Immune cells with combination gene perturbations
US12037407B2 (en) 2021-10-14 2024-07-16 Arsenal Biosciences, Inc. Immune cells having co-expressed shRNAS and logic gate systems
US12077775B2 (en) 2022-01-21 2024-09-03 Mammoth Biosciences, Inc. Effector proteins and methods of use
US12241087B2 (en) 2020-12-30 2025-03-04 Crispr Therapeutics Ag Compositions and methods for differentiating stem cells into NK cells
US12257304B2 (en) 2023-03-03 2025-03-25 Arsenal Biosciences, Inc. Systems targeting PSMA and CA9
WO2025126049A3 (en) * 2023-12-11 2025-08-21 Crispr Therapeutics Ag Multiplex gene editing
US12529041B2 (en) 2018-09-07 2026-01-20 Beam Therapeutics Inc. Compositions and methods for delivering a nucleobase editing system
US12576151B2 (en) 2020-09-25 2026-03-17 Beam Therapeutics Inc. Fratricide resistant modified immune cells and methods of using the same
US12594301B2 (en) 2019-09-27 2026-04-07 Beam Therapeutics Inc. Compositions and methods for treatment of liquid cancers
US12600971B2 (en) 2019-02-13 2026-04-14 Beam Therapeutics Inc. Modified immune cells having adenosine deaminase base editors for modifying a nucleobase in a target sequence
WO2026077659A1 (en) * 2024-09-17 2026-04-16 Institut National de la Santé et de la Recherche Médicale Enrichment of genetically modified hematopoietic stem cells through epigenome editing

Families Citing this family (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023034475A1 (en) * 2021-09-01 2023-03-09 Arbor Biotechnologies, Inc. Cells modified by a cas12i polypeptide
EP4683650A2 (en) * 2023-03-21 2026-01-28 Beam Therapeutics Inc. Immunosuppressant-resistant modified allogeneic modified immune cells and methods for use thereof

Family Cites Families (244)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1997006121A1 (en) 1995-08-04 1997-02-20 Jennings, Norman, T. Compositions and method for controlling odor in organic waste material
GB9600384D0 (en) 1996-01-09 1996-03-13 Nyfotek As Dna glycosylases
CA2392490A1 (en) 1999-11-24 2001-05-31 Mcs Micro Carrier Systems Gmbh Polypeptides comprising multimers of nuclear localization signals or of protein transduction domains and their use for transferring molecules into cells
US20040003420A1 (en) 2000-11-10 2004-01-01 Ralf Kuhn Modified recombinase
US20050222030A1 (en) 2001-02-21 2005-10-06 Anthony Allison Modified annexin proteins and methods for preventing thrombosis
US20040115184A1 (en) 2001-02-27 2004-06-17 Smith Harold C Methods and compositions for modifying apolipoprotein b mrna editing
AU2002330714A1 (en) 2001-05-30 2003-01-02 Biomedical Center In silico screening for phenotype-associated expressed sequences
US7300829B2 (en) 2003-06-02 2007-11-27 Applied Materials, Inc. Low temperature process for TFT fabrication
WO2010132092A2 (en) 2009-05-12 2010-11-18 The Scripps Research Institute Cytidine deaminase fusions and related methods
US20110104787A1 (en) 2009-11-05 2011-05-05 President And Fellows Of Harvard College Fusion Peptides That Bind to and Modify Target Nucleic Acid Sequences
US20130011380A1 (en) 2009-12-18 2013-01-10 Blau Helen M Use of Cytidine Deaminase-Related Agents to Promote Demethylation and Cell Reprogramming
US20130109048A1 (en) 2010-07-09 2013-05-02 Ecole Polytechnique Federale De Lausanne (Epfl) Method for in-vitro monitoring of neuronal disorders and use thereof
WO2012145384A1 (en) 2011-04-20 2012-10-26 University Of Washington Through Its Center For Commercialization Beta-2 microglobulin-deficient cells
EP2761006B1 (en) 2011-09-28 2016-12-14 Zera Intein Protein Solutions, S.L. Split inteins and uses thereof
CN103088008B (zh) 2011-10-31 2014-08-20 中国科学院微生物研究所 胞苷脱氨酶及其编码基因和它们的应用
MX2014010185A (es) 2012-02-22 2014-11-14 Univ Pennsylvania Uso de dominio de señalizacion cd2 en receptores de antigeno quimericos de segunda generacion.
US20160289674A1 (en) 2012-04-02 2016-10-06 Moderna Therapeutics, Inc. Modified polynucleotides for the production of membrane proteins
US20150056225A1 (en) 2012-04-17 2015-02-26 University Of Washington Through Its Center For Commercialization HLA Class II Deficient Cells, HLA Class I Deficient Cells Capable of Expressing HLA Class II Proteins, and Uses Thereof
US20150017136A1 (en) 2013-07-15 2015-01-15 Cellectis Methods for engineering allogeneic and highly active t cell for immunotherapy
EP3241902B1 (en) 2012-05-25 2018-02-28 The Regents of The University of California Methods and compositions for rna-directed target dna modification and for rna-directed modulation of transcription
US9102936B2 (en) 2012-06-11 2015-08-11 Agilent Technologies, Inc. Method of adaptor-dimer subtraction using a CRISPR CAS6 protein
DK3431497T3 (da) 2012-06-27 2022-10-10 Univ Princeton Spaltede inteiner, konjugater og anvendelser deraf
EP3363902B1 (en) 2012-12-06 2019-11-27 Sigma Aldrich Co. LLC Crispr-based genome modification and regulation
DK2931898T3 (en) 2012-12-12 2016-06-20 Massachusetts Inst Technology CONSTRUCTION AND OPTIMIZATION OF SYSTEMS, PROCEDURES AND COMPOSITIONS FOR SEQUENCE MANIPULATION WITH FUNCTIONAL DOMAINS
US9234213B2 (en) 2013-03-15 2016-01-12 System Biosciences, Llc Compositions and methods directed to CRISPR/Cas genomic engineering systems
US20140273230A1 (en) 2013-03-15 2014-09-18 Sigma-Aldrich Co., Llc Crispr-based genome modification and regulation
PL3546572T3 (pl) 2013-05-13 2024-07-22 Cellectis Chimeryczny receptor antygenowy swoisty względem cd19 i jego zastosowania
WO2014186686A2 (en) 2013-05-17 2014-11-20 Two Blades Foundation Targeted mutagenesis and genome engineering in plants using rna-guided cas nucleases
US20140356956A1 (en) 2013-06-04 2014-12-04 President And Fellows Of Harvard College RNA-Guided Transcriptional Regulation
EP3004370B1 (en) 2013-06-05 2024-08-21 Duke University Rna-guided gene editing and gene regulation
JP2016528890A (ja) 2013-07-09 2016-09-23 プレジデント アンド フェローズ オブ ハーバード カレッジ CRISPR/Cas系を用いるゲノム編集の治療用の使用
WO2015006294A2 (en) 2013-07-10 2015-01-15 President And Fellows Of Harvard College Orthogonal cas9 proteins for rna-guided gene regulation and editing
WO2015021426A1 (en) 2013-08-09 2015-02-12 Sage Labs, Inc. A crispr/cas system-based novel fusion protein and its application in genome editing
US9388430B2 (en) 2013-09-06 2016-07-12 President And Fellows Of Harvard College Cas9-recombinase fusion proteins and uses thereof
US9526784B2 (en) 2013-09-06 2016-12-27 President And Fellows Of Harvard College Delivery system for functional nucleases
WO2015069922A2 (en) 2013-11-06 2015-05-14 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Alk antibodies, conjugates, and chimeric antigen receptors, and their use
US9994831B2 (en) 2013-12-12 2018-06-12 The Regents Of The University Of California Methods and compositions for modifying a single stranded target nucleic acid
AU2014361781B2 (en) 2013-12-12 2021-04-01 Massachusetts Institute Of Technology Delivery, use and therapeutic applications of the CRISPR -Cas systems and compositions for genome editing
US20150165054A1 (en) 2013-12-12 2015-06-18 President And Fellows Of Harvard College Methods for correcting caspase-9 point mutations
ES2918501T3 (es) 2013-12-19 2022-07-18 Novartis Ag Receptores de antígenos quiméricos de mesotelina humana y usos de los mismos
WO2015092024A2 (en) 2013-12-20 2015-06-25 Cellectis Method of engineering multi-input signal sensitive t cell for immunotherapy
SG11201609211VA (en) 2014-03-05 2016-12-29 Nat Univ Corp Univ Kobe Genomic sequence modification method for specifically converting nucleic acid bases of targeted dna sequence, and molecular complex for use in same
MX373460B (es) 2014-03-11 2020-04-07 Cellectis Metodo para generar celulas t compatibles para el trasplante alogenico.
EP3593812A3 (en) 2014-03-15 2020-05-27 Novartis AG Treatment of cancer using chimeric antigen receptor
WO2015191693A2 (en) 2014-06-10 2015-12-17 Massachusetts Institute Of Technology Method for gene editing
AU2015289644A1 (en) 2014-07-15 2017-02-02 Juno Therapeutics, Inc. Engineered cells for adoptive cell therapy
ES2781175T3 (es) 2014-07-31 2020-08-31 Novartis Ag Subconjunto optimizado de células T que contienen un receptor de antígeno quimérico
JP2017522893A (ja) 2014-07-31 2017-08-17 セレクティスCellectis Ror1特異的多重鎖キメラ抗原受容体
EP3633032A3 (en) 2014-08-28 2020-07-29 North Carolina State University Novel cas9 proteins and guiding features for dna targeting and genome editing
EP2990416B1 (en) 2014-08-29 2018-06-20 GEMoaB Monoclonals GmbH Universal chimeric antigen receptor expressing immune cells for targeting of diverse multiple antigens and method of manufacturing the same and use of the same for treatment of cancer, infections and autoimmune disorders
ES2753391T3 (es) 2014-10-14 2020-04-08 Halozyme Inc Composiciones de adenosina desaminasa 2 (ADA2), variantes de la misma y métodos de uso de las mismas
WO2016061368A1 (en) 2014-10-15 2016-04-21 The Children's Hospital Of Philadelphia Compositions and methods for treating b-lymphoid malignancies
US10258697B2 (en) 2014-10-29 2019-04-16 Massachusetts Eye And Ear Infirmary Efficient delivery of therapeutic molecules in vitro and in vivo
WO2016069282A1 (en) 2014-10-31 2016-05-06 The Trustees Of The University Of Pennsylvania Altering gene expression in modified t cells and uses thereof
US10920215B2 (en) 2014-11-04 2021-02-16 National University Corporation Kobe University Method for modifying genome sequence to introduce specific mutation to targeted DNA sequence by base-removal reaction, and molecular complex used therein
MA40921A (fr) 2014-11-05 2017-09-12 Abbvie Stemcentrx Llc Récepteurs antigéniques chimériques anti-cldn et procédés d'utilisation
US11072644B2 (en) 2014-11-12 2021-07-27 Allogene Therapeutics, Inc. Inhibitory chimeric antigen receptors
EA036379B1 (ru) 2014-12-12 2020-11-02 Блубёрд Био, Инк. Химерные антигенные рецепторы к bcma
US10676737B2 (en) 2014-12-17 2020-06-09 Proqr Therapeutics Ii B.V. Targeted RNA editing
CA2971444A1 (en) 2014-12-20 2016-06-23 Arc Bio, Llc Compositions and methods for targeted depletion, enrichment, and partitioning of nucleic acids using crispr/cas system proteins
WO2016115482A1 (en) 2015-01-16 2016-07-21 Novartis Pharma Ag Phosphoglycerate kinase 1 (pgk) promoters and methods of use for expressing chimeric antigen receptor
MA41613A (fr) 2015-02-23 2018-01-02 Abbvie Stemcentrx Llc Récepteurs antigéniques chimériques anti-dll3 et procédés d'utilisation desdits récepteurs
JP7237449B2 (ja) 2015-02-27 2023-03-13 アイセル・ジーン・セラピューティクス・エルエルシー 血液系腫瘍を標的としたキメラ抗体受容体(CARs)の構成およびその使用方法
EP3265559B1 (en) 2015-03-03 2021-01-06 The General Hospital Corporation Engineered crispr-cas9 nucleases with altered pam specificity
KR20170137079A (ko) 2015-03-11 2017-12-12 셀렉티스 그것들의 지속을 증가시키기 위한 동종이계 t 세포의 조작 및/또는 환자들 내로 이식 방법들
KR20260048600A (ko) 2015-03-27 2026-04-10 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 변형된 t 세포 및 이의 제조 및 사용 방법
CA2982966C (en) 2015-04-24 2024-02-20 Editas Medicine, Inc. Evaluation of cas9 molecule/guide rna molecule complexes
EP3294342A4 (en) 2015-05-08 2018-11-07 President and Fellows of Harvard College Universal donor stem cells and related methods
WO2016183438A1 (en) 2015-05-14 2016-11-17 Massachusetts Institute Of Technology Self-targeting genome editing system
CN106011104B (zh) 2015-05-21 2019-09-27 清华大学 利用拆分Cas系统进行基因编辑和表达调控方法
JP6949728B2 (ja) 2015-05-29 2021-10-13 ジュノー セラピューティクス インコーポレイテッド 遺伝子操作された細胞における阻害相互作用を調節するための組成物および方法
EP3331582A4 (en) 2015-05-29 2019-08-07 Agenovir Corporation METHODS AND COMPOSITIONS FOR THE TREATMENT OF TRANSPLANTATION CELLS
WO2016205759A1 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Engineering and optimization of systems, methods, enzymes and guide scaffolds of cas9 orthologs and variants for sequence manipulation
CA3012607A1 (en) 2015-06-18 2016-12-22 The Broad Institute Inc. Crispr enzymes and systems
US9790490B2 (en) 2015-06-18 2017-10-17 The Broad Institute Inc. CRISPR enzymes and systems
TWI813532B (zh) 2015-06-18 2023-09-01 美商博得學院股份有限公司 降低脱靶效應的crispr酶突變
EP4043556B1 (en) 2015-06-30 2024-02-07 Cellectis Methods for improving functionality in nk cell by gene inactivation using specific endonuclease
US11479793B2 (en) 2015-07-15 2022-10-25 Rutgers, The State University Of New Jersey Nuclease-independent targeted gene editing platform and uses thereof
US20170020922A1 (en) 2015-07-16 2017-01-26 Batu Biologics Inc. Gene editing for immunological destruction of neoplasia
US9512446B1 (en) 2015-08-28 2016-12-06 The General Hospital Corporation Engineered CRISPR-Cas9 nucleases
WO2017040945A1 (en) * 2015-09-04 2017-03-09 Memorial Sloan Kettering Cancer Center Immune cell compositions and methods of use
WO2017048969A1 (en) 2015-09-17 2017-03-23 The Regents Of The University Of California Variant cas9 polypeptides comprising internal insertions
US20180258149A1 (en) 2015-09-17 2018-09-13 Novartis Ag Car t cell therapies with enhanced efficacy
JP7109784B2 (ja) 2015-10-23 2022-08-01 プレジデント アンド フェローズ オブ ハーバード カレッジ 遺伝子編集のための進化したCas9蛋白質
MX2018005618A (es) 2015-11-05 2018-08-01 Juno Therapeutics Inc Receptores quimericos que contienen dominios inductores de traf y composiciones y metodos relacionados.
US11020429B2 (en) 2015-11-05 2021-06-01 Juno Therapeutics, Inc. Vectors and genetically engineered immune cells expressing metabolic pathway modulators and uses in adoptive cell therapy
CA2999649A1 (en) 2015-11-06 2017-05-11 Crispr Therapeutics Ag Materials and methods for treatment of glycogen storage disease type 1a
CA3006618A1 (en) 2015-12-01 2017-06-08 Crispr Therapeutics Ag Materials and methods for treatment of alpha-1 antitrypsin deficiency
EA201891338A1 (ru) 2015-12-04 2018-12-28 Новартис Аг Композиции и способы для иммуноонкологии
ES2949163T3 (es) 2016-01-29 2023-09-26 Univ Princeton Inteínas divididas con actividad de corte y empalme excepcional
KR102438360B1 (ko) 2016-03-04 2022-08-31 에디타스 메디신, 인코포레이티드 암 면역요법을 위한 crispr-cpf1-관련 방법, 조성물 및 구성성분
WO2017165862A1 (en) 2016-03-25 2017-09-28 Editas Medicine, Inc. Systems and methods for treating alpha 1-antitrypsin (a1at) deficiency
TWI773666B (zh) 2016-03-30 2022-08-11 美商英特利亞醫療公司 Crispr/cas 組分之脂質奈米粒子調配物
EP3443001B1 (en) 2016-04-11 2025-04-30 Obsidian Therapeutics, Inc. REGULATED BIOCIRCUIT SYSTEMS
WO2017180993A1 (en) 2016-04-14 2017-10-19 Bluebird Bio, Inc. Salvage chimeric antigen receptor systems
US20200263190A1 (en) 2016-04-19 2020-08-20 The Broad Institute, Inc. Novel crispr enzymes and systems
CN110382692A (zh) 2016-04-19 2019-10-25 博德研究所 新型crispr酶以及系统
BR112019000057A2 (pt) 2016-07-05 2019-04-02 The Johns Hopkins University composições e métodos com base em crispr/cas9 para o tratamento de degeneração de retina
WO2018020323A2 (en) 2016-07-25 2018-02-01 Crispr Therapeutics Ag Materials and methods for treatment of fatty acid disorders
NZ750256A (en) * 2016-08-03 2026-02-27 Dipersio John F Gene editing of car-t cells for the treatment of t cell malignancies with chimeric antigen receptors
KR102547316B1 (ko) 2016-08-03 2023-06-23 프레지던트 앤드 펠로우즈 오브 하바드 칼리지 아데노신 핵염기 편집제 및 그의 용도
US11661590B2 (en) 2016-08-09 2023-05-30 President And Fellows Of Harvard College Programmable CAS9-recombinase fusion proteins and uses thereof
WO2018035388A1 (en) 2016-08-17 2018-02-22 The Broad Institute, Inc. Novel crispr enzymes and systems
US10941402B2 (en) 2016-09-01 2021-03-09 Proqr Therapeutics Ii B.V. Chemically modified single-stranded RNA-editing oligonucleotides
EP3526320A1 (en) 2016-10-14 2019-08-21 President and Fellows of Harvard College Aav delivery of nucleobase editors
KR20240005168A (ko) 2016-11-04 2024-01-11 2세븐티 바이오, 인코포레이티드 항-bcma car t 세포 조성물
WO2018089664A1 (en) 2016-11-11 2018-05-17 The Regents Of The University Of California Variant rna-guided polypeptides and methods of use
CN107043779B (zh) 2016-12-01 2020-05-12 中国农业科学院作物科学研究所 一种CRISPR/nCas9介导的定点碱基替换在植物中的应用
AU2017374044B2 (en) 2016-12-08 2023-11-30 Intellia Therapeutics, Inc. Modified guide RNAs
AU2017379073B2 (en) 2016-12-22 2023-12-14 Intellia Therapeutics, Inc. Compositions and methods for treating alpha-1 antitrypsin deficiency
GB201622044D0 (en) 2016-12-22 2017-02-08 Ucl Business Plc T cell-targeted T cells
EP3559223A1 (en) 2016-12-23 2019-10-30 President and Fellows of Harvard College Gene editing of pcsk9
WO2018119359A1 (en) 2016-12-23 2018-06-28 President And Fellows Of Harvard College Editing of ccr5 receptor gene to protect against hiv infection
WO2018129129A1 (en) 2017-01-05 2018-07-12 Rutgers, The State University Of New Jersey Targeted gene editing platform independent of dna double strand break and uses thereof
JP7717439B2 (ja) * 2017-01-10 2025-08-04 ザ ジェネラル ホスピタル コーポレイション 修飾されたt細胞及びその使用方法
EP4043485A1 (en) 2017-01-26 2022-08-17 Novartis AG Cd28 compositions and methods for chimeric antigen receptor therapy
WO2018152197A1 (en) 2017-02-15 2018-08-23 Massachusetts Institute Of Technology Dna writers, molecular recorders and uses thereof
SG11201907870VA (en) 2017-02-28 2019-09-27 Vor Biopharma Inc Compositions and methods for inhibition of lineage specific proteins
JP2020510038A (ja) * 2017-03-09 2020-04-02 プレジデント アンド フェローズ オブ ハーバード カレッジ がんワクチン
JP2020510439A (ja) 2017-03-10 2020-04-09 プレジデント アンド フェローズ オブ ハーバード カレッジ シトシンからグアニンへの塩基編集因子
CA3057192A1 (en) 2017-03-23 2018-09-27 President And Fellows Of Harvard College Nucleobase editors comprising nucleic acid programmable dna binding proteins
WO2018183888A2 (en) 2017-03-31 2018-10-04 The Board Of Trustees Of The Leland Stanford Junior University Methods of treating t cell exhaustion by inhibiting or modulating t cell receptor signaling
CN106916852B (zh) 2017-04-13 2020-12-04 上海科技大学 一种碱基编辑系统及其构建和应用方法
WO2018195545A2 (en) 2017-04-21 2018-10-25 The General Hospital Corporation Variants of cpf1 (cas12a) with altered pam specificity
US20200078404A1 (en) * 2017-05-01 2020-03-12 Juno Therapeutics, Inc. Combination of a cell therapy and an immunomodulatory compound
EP3625342B1 (en) 2017-05-18 2022-08-24 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
WO2018213708A1 (en) 2017-05-18 2018-11-22 The Broad Institute, Inc. Systems, methods, and compositions for targeted nucleic acid editing
WO2018218066A1 (en) 2017-05-24 2018-11-29 The Regents Of The University Of California Cmv vaccine and method of making and using the same
US20200172895A1 (en) 2017-05-25 2020-06-04 The General Hospital Corporation Using split deaminases to limit unwanted off-target base editor deamination
JP2020525537A (ja) 2017-06-12 2020-08-27 エモリー ユニバーシティー T細胞抗原標的キメラ抗原受容体(car)、及び細胞療法での使用
AU2018290843B2 (en) 2017-06-26 2025-04-24 Massachusetts Institute Of Technology CRISPR/Cas-adenine deaminase based compositions, systems, and methods for targeted nucleic acid editing
WO2019005886A1 (en) 2017-06-26 2019-01-03 The Broad Institute, Inc. CRISPR / CAS-CYTIDINE DEAMINASE COMPOSITIONS, SYSTEMS AND METHODS FOR TARGETED EDITING OF NUCLEIC ACIDS
US11168322B2 (en) 2017-06-30 2021-11-09 Arbor Biotechnologies, Inc. CRISPR RNA targeting enzymes and systems and uses thereof
JP7210534B2 (ja) 2017-07-12 2023-01-23 ザ・ボード・オブ・トラスティーズ・オブ・ザ・リーランド・スタンフォード・ジュニア・ユニバーシティ H3k27m変異を有するがんの処置のための組成物および方法
US11740242B2 (en) 2017-07-14 2023-08-29 Dana-Farber Cancer Institute, Inc. Modulating biomarkers to increase tumor immunity and improve the efficacy of cancer immunotherapy
WO2019023680A1 (en) 2017-07-28 2019-01-31 President And Fellows Of Harvard College METHODS AND COMPOSITIONS FOR EVOLUTION OF BASIC EDITORS USING PHAGE-ASSISTED CONTINUOUS EVOLUTION (PACE)
CN118530967A (zh) 2017-08-23 2024-08-23 通用医疗公司 具有改变的PAM特异性的工程化的CRISPR-Cas9核酸酶
EP3676376B1 (en) 2017-08-30 2025-01-15 President and Fellows of Harvard College High efficiency base editors comprising gam
EP4389889A3 (en) 2017-10-06 2024-09-04 Oregon Health & Science University Compositions and methods for editing rna
KR20250107288A (ko) * 2017-10-16 2025-07-11 더 브로드 인스티튜트, 인코퍼레이티드 아데노신 염기 편집제의 용도
US11400117B2 (en) 2017-12-15 2022-08-02 The Board Of Trustees Of The Leland Stanford Junior University Compositions and methods for inhibiting T cell exhaustion
CN109957569B (zh) 2017-12-22 2022-10-25 苏州齐禾生科生物科技有限公司 基于cpf1蛋白的碱基编辑系统和方法
CN112534044A (zh) * 2018-02-16 2021-03-19 凯德药业股份有限公司 经修饰的多能干细胞及制备和使用方法
CN112292139B (zh) * 2018-03-13 2024-03-08 明尼苏达大学董事会 使用Cas9碱基编辑器的淋巴造血改造
WO2019183000A1 (en) 2018-03-19 2019-09-26 University Of Massachusetts Modified guide rnas for crispr genome editing
EP3781176A4 (en) 2018-04-09 2022-05-25 The Trustees of the University of Pennsylvania METHODS AND COMPOSITIONS USING A VIRAL VECTOR FOR THE EXPRESSION OF A TRANSGENE AND AN EFFECTOR
US12473342B2 (en) 2018-04-27 2025-11-18 The Trustees Of The University Of Pennsylvania Chimeric antigen receptor T regulatory cells for the treatment of atherosclerosis
JP7558929B2 (ja) 2018-05-11 2024-10-01 ビーム セラピューティクス インク. プログラム可能塩基エディターシステムを用いて病原性変異を抑制する方法
AU2019266327B2 (en) 2018-05-11 2025-11-06 Beam Therapeutics Inc. Methods of editing single nucleotide polymorphism using programmable base editor systems
CN121555430A (zh) 2018-05-11 2026-02-24 比姆医疗股份有限公司 使用可编程碱基编辑器系统取代病原性氨基酸的方法
EP3797160A1 (en) 2018-05-23 2021-03-31 The Broad Institute Inc. Base editors and uses thereof
CN110616189B (zh) 2018-06-20 2022-02-18 西安桑尼赛尔生物医药有限公司 通用型靶向cd19抗原嵌合受体t细胞的制备及其应用
CN108753823B (zh) 2018-06-20 2022-09-23 李广磊 利用碱基编辑技术实现基因敲除的方法及其应用
WO2020010239A1 (en) 2018-07-06 2020-01-09 The Board Of Trustees Of The Leland Stanford Junior University Chimeric antigen receptor polypeptides and methods of using same
CN108949825A (zh) 2018-07-30 2018-12-07 苏州茂行生物科技有限公司 一种靶向her2的car-t细胞的制备方法及应用
AU2019316094B2 (en) 2018-08-03 2026-02-19 Beam Therapeutics Inc. Multi-effector nucleobase editors and methods of using same to modify a nucleic acid target sequence
EP3841203A4 (en) 2018-08-23 2022-11-02 The Broad Institute Inc. CAS9 VARIANTS WITH NON-CANONICAL PAM SPECIFICITIES AND THEIR USES
KR20210055733A (ko) 2018-09-07 2021-05-17 빔 테라퓨틱스, 인크. 핵염기 편집 시스템을 전달하기 위한 조성물 및 방법
CN109295186B (zh) 2018-09-30 2023-10-03 中山大学 一种基于全基因组测序检测腺嘌呤单碱基编辑系统脱靶效应的方法及其在基因编辑中的应用
US20220023348A1 (en) 2018-11-28 2022-01-27 Forty Seven, Inc. Genetically modified hspcs resistant to ablation regime
US20220047637A1 (en) 2018-11-29 2022-02-17 Editas Medicine, Inc. Systems and methods for the treatment of hemoglobinopathies
CA3121911A1 (en) 2018-12-06 2020-06-11 The Board Of Trustees Of The Leland Stanford Junior University Regulatable cell surface receptors and related compositions and methods
WO2020132327A1 (en) 2018-12-19 2020-06-25 The Trustees Of The University Of Pennsylvania Use of cd2/5/7 knock-out anti-cd2/5/7 chimeric antigen receptor t cells against t cell lymphomas and leukemias
US20220133790A1 (en) 2019-01-16 2022-05-05 Beam Therapeutics Inc. Modified immune cells having enhanced anti-neoplasia activity and immunosuppression resistance
CN109706121A (zh) * 2019-01-25 2019-05-03 苏州茂行生物科技有限公司 一种基于碱基编辑的通用型car-t细胞及其制备方法和应用
KR20210121113A (ko) 2019-01-31 2021-10-07 빔 테라퓨틱스, 인크. 비-표적 탈아미노화가 감소된 핵염기 편집기 및 핵염기 편집기를 특성규명하기 위한 분석
EP3918077A4 (en) 2019-01-31 2023-03-29 Beam Therapeutics, Inc. NUCLEOBASE EDITORS WITH REDUCED OFF-TARGET DEAMINATION AND METHODS OF USING THEM TO MODIFY A NUCLEOBASE TARGET SEQUENCE
US11946040B2 (en) 2019-02-04 2024-04-02 The General Hospital Corporation Adenine DNA base editor variants with reduced off-target RNA editing
WO2020168122A1 (en) 2019-02-13 2020-08-20 Beam Therapeutics Inc. Modified immune cells having adenosine deaminase base editors for modifying a nucleobase in a target sequence
KR20210126680A (ko) 2019-02-13 2021-10-20 빔 테라퓨틱스, 인크. 알파-1 항트립신 결핍증을 치료하기 위한 조성물 및 방법
AU2020223306A1 (en) 2019-02-13 2021-08-05 Beam Therapeutics Inc. Methods of editing a disease-associated gene using adenosine deaminase base editors, including for the treatment of genetic disease
US20220235347A1 (en) 2019-02-13 2022-07-28 Beam Therapeutics Inc. Compositions and methods for treating hemoglobinopathies
US20220127594A1 (en) 2019-02-13 2022-04-28 Beam Therapeutics Inc. Compositions and methods for treating glycogen storage disease type 1a
US20220098593A1 (en) 2019-02-13 2022-03-31 Beam Therapeutics Inc. Splice acceptor site disruption of a disease-associated gene using adenosine deaminase base editors, including for the treatment of genetic disease
KR20210139265A (ko) 2019-02-13 2021-11-22 빔 테라퓨틱스, 인크. 표적 서열에서 핵염기를 변형하기 위한 아데노신 데아미나제 염기 편집기 및 이의 사용 방법
EP3924467A1 (en) 2019-02-15 2021-12-22 Editas Medicine, Inc. Modified natural killer (nk) cells for immunotherapy
WO2020176897A1 (en) 2019-02-28 2020-09-03 The Board Of Trustees Of The Leland Stanford Junior University Chimeric antigen receptors and uses thereof
JP7654557B2 (ja) 2019-03-27 2025-04-01 ザ トラスティーズ オブ ザ ユニバーシティ オブ ペンシルバニア Tn-MUC1キメラ抗原受容体(CAR)T細胞療法
US12473543B2 (en) 2019-04-17 2025-11-18 The Broad Institute, Inc. Adenine base editors with reduced off-target effects
CA3139319A1 (en) 2019-05-07 2020-11-12 The Board Of Trustees Of The Leland Stanford Junior University Enhancement of polypeptides and chimeric antigen receptors via hinge domains
WO2020227447A1 (en) 2019-05-07 2020-11-12 The Board Of Trustees Of The Leland Stanford Junior University Chimeric antigen receptors targeting glypican-2
US20200370013A1 (en) 2019-05-20 2020-11-26 The Trustees Of The University Of Pennsylvania Engineered Expression of Cell Surface and Secreted Sialidase by CAR T Cells for Increased Efficacy in Solid Tumors
WO2020236982A1 (en) 2019-05-20 2020-11-26 The Broad Institute, Inc. Aav delivery of nucleobase editors
US20220387622A1 (en) 2019-05-21 2022-12-08 Beam Therapeutics Inc. Methods of editing a single nucleotide polymorphism using programmable base editor systems
CN118852456A (zh) 2019-05-29 2024-10-29 Cue生物制药股份有限公司 多聚体t细胞调节多肽及其使用方法
AU2020322021A1 (en) 2019-07-30 2022-02-10 Pairwise Plants Services, Inc. Morphogenic regulators and methods of using the same
KR102258713B1 (ko) 2019-07-31 2021-05-31 한양대학교 산학협력단 사이토신 염기교정용 조성물 및 이의 용도
US20230017979A1 (en) 2019-08-29 2023-01-19 Beam Therapeutics Inc. Compositions and methods for non-toxic conditioning
WO2021042062A2 (en) 2019-08-30 2021-03-04 Joung J Keith Combinatorial adenine and cytosine dna base editors
CN114667149A (zh) 2019-09-09 2022-06-24 比姆医疗股份有限公司 新型核碱基编辑器及其使用方法
JP7814052B2 (ja) 2019-09-17 2026-02-16 ラトガース,ザ ステート ユニバーシティ オブ ニュー ジャージー 標的ゲノム修飾のための高度に効率的なrna-アプタマー動員媒介性dna塩基エディターおよびそれらの使用
EP4034138A4 (en) 2019-09-27 2024-07-31 Beam Therapeutics, Inc. COMPOSITIONS AND METHODS FOR THE TREATMENT OF LIQUID CANCERS
KR20220095193A (ko) 2019-10-11 2022-07-06 더 보드 어브 트러스티스 어브 더 리랜드 스탠포드 주니어 유니버시티 조절 가능한 세포 국재화를 위한 재조합 폴리펩티드
US11591607B2 (en) 2019-10-24 2023-02-28 Pairwise Plants Services, Inc. Optimized CRISPR-Cas nucleases and base editors and methods of use thereof
KR20220110739A (ko) 2019-10-30 2022-08-09 페어와이즈 플랜츠 서비시즈, 인크. 유형 v crispr-cas 염기 편집제 및 그의 사용 방법
US20220380447A1 (en) 2019-11-01 2022-12-01 The Trustees Of The University Of Pennsylvania Fibronectin targeting chimeric antigen receptors (cars)
CN120905142A (zh) 2019-11-20 2025-11-07 卡瑟里克斯私人有限公司 用于提供具有增强功能的免疫细胞的方法
US20230086199A1 (en) 2019-11-26 2023-03-23 The Broad Institute, Inc. Systems and methods for evaluating cas9-independent off-target editing of nucleic acids
EP4076479A4 (en) 2019-12-18 2024-05-22 Editas Medicine, Inc. GENETICALLY MODIFIED CELLS FOR THERAPY
US20210230246A1 (en) 2020-01-15 2021-07-29 The Trustees Of The University Of Pennsylvania Use of inhibitory chimeric receptors to prevent t cell-induced blood brain barrier damage
WO2021158921A2 (en) 2020-02-05 2021-08-12 The Broad Institute, Inc. Adenine base editors and uses thereof
WO2021158999A1 (en) 2020-02-05 2021-08-12 The Broad Institute, Inc. Gene editing methods for treating spinal muscular atrophy
CA3167572A1 (en) 2020-02-14 2021-08-19 Robbie G. MAJZNER Chimeric antigen receptors with cd2 activation
US20230313234A1 (en) 2020-03-04 2023-10-05 Suzhou Qi Biodesign Biotechnology Company Limited Improved cytosine base editing system
AU2021236683A1 (en) 2020-03-19 2022-11-17 Intellia Therapeutics, Inc. Methods and compositions for directed genome editing
WO2021207651A2 (en) 2020-04-09 2021-10-14 Verve Therapeutics, Inc. Chemically modified guide rnas for genome editing with cas12b
EP4179079A1 (en) 2020-07-10 2023-05-17 Horizon Discovery Limited Method for producing genetically modified cells
JP2023534693A (ja) 2020-07-15 2023-08-10 ライフエディット セラピューティクス,インコーポレイティド ウラシル安定化タンパク質並びにその活性断片及びバリアント並びに使用方法
CA3192224A1 (en) 2020-09-11 2022-03-17 Jyun-Liang LIN Base editing enzymes
TWI910226B (zh) 2020-09-11 2026-01-01 美商生命編輯治療學公司 Dna修飾酶及活性片段,及其變異體與使用方法
WO2022061115A1 (en) * 2020-09-18 2022-03-24 Vor Biopharma Inc. Compositions and methods for cd7 modification
AU2021347359A1 (en) 2020-09-25 2023-05-18 Beam Therapeutics Inc. Fratricide resistant modified immune cells and methods of using the same
US20230383277A1 (en) 2020-10-14 2023-11-30 Beam Therapeutics Inc. Compositions and methods for treating glycogen storage disease type 1a
IT202000028688A1 (it) 2020-11-27 2022-05-27 Consiglio Nazionale Ricerche Varianti della citidina deaminasi per l’editazione di basi
JP2024502348A (ja) 2021-01-05 2024-01-18 ホライズン・ディスカバリー・リミテッド Tracr不含 V型Casシステム用のガイドRNAデザインおよび複合体
WO2022150372A1 (en) 2021-01-05 2022-07-14 Horizon Discovery Ltd. Guide rna designs and complexes for type v cas systems
CA3207144A1 (en) 2021-01-05 2022-07-14 Horizon Discovery Limited Method for producing genetically modified cells
EP4274897A4 (en) 2021-01-08 2025-03-05 The General Hospital Corporation GENOMEDITING APPROACHES TO THE TREATMENT OF SPINAL MUSCLE ATROPHY
WO2022178307A1 (en) 2021-02-19 2022-08-25 Beam Therapeutics Inc. Recombinant rabies viruses for gene therapy
CA3214494A1 (en) 2021-03-26 2022-09-29 Beam Therapeutics Inc. Adenosine deaminase variants and uses thereof
AU2022299551A1 (en) 2021-06-23 2024-01-18 Editas Medicine, Inc. Engineered cells for therapy
US20240327859A1 (en) 2021-07-02 2024-10-03 University Of Maryland, College Park Cytidine deaminases and methods of genome editing using the same
AU2022311013A1 (en) 2021-07-16 2024-02-08 President And Fellows Of Harvard College Context-specific adenine base editors and uses thereof
CA3228879A1 (en) 2021-08-16 2023-02-23 Beam Therapeutics Inc. Persistent allogeneic modified immune cells and methods of use thereof
US20240352439A1 (en) 2021-09-03 2024-10-24 The University Of Chicago Polypeptides and methods for modifying nucleic acids
AU2022349449A1 (en) 2021-09-22 2024-04-18 Verve Therapeutics, Inc. Gene editing of pcsk9 or angptl3 and compositions and methods of using same for treatment of disease
WO2023047338A1 (en) 2021-09-24 2023-03-30 Crispr Therapeutics Ag PRODRUG INCORPORATED sgRNA SYNTHESIS
CA3242360A1 (en) 2021-12-10 2023-06-15 Beam Therapeutics Inc. Modified immune cells and methods of using the same
WO2023125814A1 (zh) 2021-12-29 2023-07-06 华东师范大学 腺嘌呤脱氨酶及其应用
CN119013310A (zh) 2022-02-17 2024-11-22 正序(上海)生物科技有限公司 具有改善的编辑精确度的突变的胞嘧啶脱氨酶
CN117925585A (zh) 2022-04-07 2024-04-26 尧唐(上海)生物科技有限公司 腺苷脱氨酶、碱基编辑器融合蛋白、碱基编辑器系统及用途
WO2023227669A2 (en) 2022-05-26 2023-11-30 UCB Biopharma SRL Novel nucleic acid-editing proteins
EP4532697A2 (en) 2022-06-03 2025-04-09 Beam Therapeutics Inc. Modified regulatory t cells and methods of using the same
EP4540378A1 (en) 2022-06-20 2025-04-23 CRISPR Therapeutics AG Base editing proteins and uses thereof
AU2023288909A1 (en) 2022-06-23 2025-01-09 Basf Agricultural Solutions Us Llc Diversifying base editing
WO2024006772A2 (en) 2022-06-27 2024-01-04 Beam Therapeutics Inc. Adenosine deaminase base editors and methods for use thereof
CA3263821A1 (en) 2022-08-16 2024-02-22 The Broad Institute, Inc. ADVANCED CYTOSIN DESAMINASE AND DNA EDITING METHODS USING IT
CN119998447A (zh) 2022-09-23 2025-05-13 基础科学研究院 新型腺嘌呤脱氨酶变体及使用其进行碱基编辑的方法
CA3267375A1 (en) 2022-09-26 2024-04-04 Beam Therapeutics Inc. SYNTHETIC POLYPEPTIDES AND THEIR USES
WO2024179426A2 (en) 2023-02-28 2024-09-06 Accuredit Therapeutics (Suzhou) Co., Ltd. Deaminases for use in base editing
WO2024226156A1 (en) 2023-04-27 2024-10-31 University Of Massachusetts Cas-embedded cytidine deaminase ribonucleoprotein complexes having improved base editing specificity and efficiency
WO2024227047A2 (en) 2023-04-28 2024-10-31 Beam Therapeutics Inc. Modified guide rna
CN121889499A (zh) 2023-06-15 2026-04-17 比姆医疗股份有限公司 用于治疗α1-抗胰蛋白酶缺乏症的方法和组合物
CN117965505A (zh) 2023-06-28 2024-05-03 微光基因(苏州)有限公司 工程化的腺苷脱氨酶及碱基编辑器

Cited By (22)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US12529041B2 (en) 2018-09-07 2026-01-20 Beam Therapeutics Inc. Compositions and methods for delivering a nucleobase editing system
US12600971B2 (en) 2019-02-13 2026-04-14 Beam Therapeutics Inc. Modified immune cells having adenosine deaminase base editors for modifying a nucleobase in a target sequence
US12594301B2 (en) 2019-09-27 2026-04-07 Beam Therapeutics Inc. Compositions and methods for treatment of liquid cancers
WO2022056459A1 (en) * 2020-09-14 2022-03-17 Vor Biopharma, Inc. Compositions and methods for cd5 modification
WO2022061115A1 (en) * 2020-09-18 2022-03-24 Vor Biopharma Inc. Compositions and methods for cd7 modification
US12576151B2 (en) 2020-09-25 2026-03-17 Beam Therapeutics Inc. Fratricide resistant modified immune cells and methods of using the same
US12344655B2 (en) 2020-11-30 2025-07-01 Crispr Therapeutics Ag Gene-edited natural killer cells
US11459372B2 (en) 2020-11-30 2022-10-04 Crispr Therapeutics Ag Gene-edited natural killer cells
US11591381B2 (en) 2020-11-30 2023-02-28 Crispr Therapeutics Ag Gene-edited natural killer cells
US12241087B2 (en) 2020-12-30 2025-03-04 Crispr Therapeutics Ag Compositions and methods for differentiating stem cells into NK cells
CN115443333A (zh) * 2021-04-27 2022-12-06 上海驯鹿生物技术有限公司 一种基因编辑的造血干细胞及其与car-t细胞的联合应用
WO2022228471A1 (zh) * 2021-04-27 2022-11-03 上海驯鹿生物技术有限公司 一种基因编辑的造血干细胞及其与car-t细胞的联合应用
US11814620B2 (en) 2021-05-10 2023-11-14 Mammoth Biosciences, Inc. Effector proteins and methods of use
US12037407B2 (en) 2021-10-14 2024-07-16 Arsenal Biosciences, Inc. Immune cells having co-expressed shRNAS and logic gate systems
WO2023108107A3 (en) * 2021-12-10 2023-08-17 Beam Therapeutics Inc. Modified immune cells and methods of using the same
WO2023137457A3 (en) * 2022-01-13 2023-08-31 Spotlight Therapeutics Immune response specific guide rnas and uses thereof
US12077775B2 (en) 2022-01-21 2024-09-03 Mammoth Biosciences, Inc. Effector proteins and methods of use
WO2023225665A1 (en) * 2022-05-19 2023-11-23 Lyell Immunopharma, Inc. Polynucleotides targeting nr4a3 and uses thereof
WO2024059824A3 (en) * 2022-09-16 2024-04-25 Arsenal Biosciences, Inc. Immune cells with combination gene perturbations
US12257304B2 (en) 2023-03-03 2025-03-25 Arsenal Biosciences, Inc. Systems targeting PSMA and CA9
WO2025126049A3 (en) * 2023-12-11 2025-08-21 Crispr Therapeutics Ag Multiplex gene editing
WO2026077659A1 (en) * 2024-09-17 2026-04-16 Institut National de la Santé et de la Recherche Médicale Enrichment of genetically modified hematopoietic stem cells through epigenome editing

Also Published As

Publication number Publication date
CA3155667A1 (en) 2021-04-01
US20230021636A1 (en) 2023-01-26
JP2022549916A (ja) 2022-11-29
JP2025066723A (ja) 2025-04-23
CN115279398A (zh) 2022-11-01
CN120905310A (zh) 2025-11-07
EP4034138A4 (en) 2024-07-31
KR20220090512A (ko) 2022-06-29
US12594301B2 (en) 2026-04-07
WO2021062227A3 (en) 2021-05-06
EP4034138A2 (en) 2022-08-03
AU2020355222A1 (en) 2022-03-24
JP7615134B2 (ja) 2025-01-16
CN115279398B (zh) 2025-07-04

Similar Documents

Publication Publication Date Title
CN115279398B (zh) 治疗液态癌症的组合物和方法
US12600971B2 (en) Modified immune cells having adenosine deaminase base editors for modifying a nucleobase in a target sequence
US20240287453A1 (en) Persistent allogeneic modified immune cells and methods of use thereof
CN114630904B (zh) 用于无毒调理的组合物和方法
US20230242884A1 (en) Compositions and methods for engraftment of base edited cells
US12576151B2 (en) Fratricide resistant modified immune cells and methods of using the same
US20210102183A1 (en) Engineered cascade components and cascade complexes
US20250090585A1 (en) Modified regulatory t cells and methods of using the same
US20240325533A1 (en) Modified immune cells and methods of using the same
WO2024006772A2 (en) Adenosine deaminase base editors and methods for use thereof
CN118234865A (zh) 持久性同种异体修饰免疫细胞及其使用方法
US20240327802A1 (en) Chimeric pseudotyped recombinant rabies virus
US20260071197A1 (en) Engineered cascade components and cascade complexes

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20868560

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 3155667

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2020355222

Country of ref document: AU

Date of ref document: 20200925

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2022519460

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2020868560

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2020868560

Country of ref document: EP

Effective date: 20220428

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 20868560

Country of ref document: EP

Kind code of ref document: A2

WWG Wipo information: grant in national office

Ref document number: 202080082229.8

Country of ref document: CN

WWG Wipo information: grant in national office

Ref document number: 17762690

Country of ref document: US