WO2020102387A1 - Multispecific binding constructs against checkpoint molecules and uses thereof - Google Patents
Multispecific binding constructs against checkpoint molecules and uses thereof Download PDFInfo
- Publication number
- WO2020102387A1 WO2020102387A1 PCT/US2019/061226 US2019061226W WO2020102387A1 WO 2020102387 A1 WO2020102387 A1 WO 2020102387A1 US 2019061226 W US2019061226 W US 2019061226W WO 2020102387 A1 WO2020102387 A1 WO 2020102387A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- binding
- antigen
- seq
- comprises seq
- unit
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2827—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2818—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
- C07K2317/526—CH3 domain
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/71—Decreased effector function due to an Fc-modification
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance
Definitions
- Cancer is one of the leading causes of death in both the United States and worldwide. While common treatments such as surgery, radiation, chemotherapy, hormone therapy, targeted therapies, and immunotherapy have decreased the rates of cancer-related deaths during the 20 th century, there were 14.1 million new cancer cases diagnosed and 8.2 million cancer deaths worldwide as of 2012. Even with improved overall cancer survival rates during the 20 th century, cancer is still responsible for one in seven deaths worldwide. See American Cancer Society, Global Cancer Facts & Figures 3" 1 Edition, Atlanta: American Cancer Society; 2015.
- Immune cells such as T cells, macrophages, and natural killer cells, can exhibit anti-tumor activity and effectively control the occurrence and growth of malignant tumors. Tumor-specific or - associated antigens can induce immune cells to recognize and eliminate malignancies (Chen & Mellman, (2013) Immunity 39(1): 1-10).
- the present disclosure is based, in part, on novel multispecific and multivalent constructs targeting both PD-1 and PD-L1 , such as a bispecific and tetravalent construct.
- these multispecific constructs have improved in vitro and in vivo potency as compared to combinations of individual antibodies, as well as compared to clinical checkpoint blockade agents.
- novel monoclonal anti -PD-1 antibodies and novel monoclonal anti-PD-L l antibodies share a common light chain, thereby allowing for the generation of multispecific and multivalent constructs having surprising excellent drug-like properties (DLPs) and ease of manufacturability, as well as affinities similar to their parental antibodies.
- DLPs drug-like properties
- the present disclosure is also based, in part, on the discovery that blocking the interaction between PD-1 expressed by an immune cell and its ligand (e.g., PD-L1 or PD-L2) expressed on a second cell, while bridging the immune cell and the second cell (e.g., another immune cell, or a tumor cell that expresses a PD-1 ligand) strongly enhance, for example, T cell proliferation, IFNy production and secretion, and the cytolytic activity of T cells.
- an immune cell and its ligand e.g., PD-L1 or PD-L2
- compositions of the present disclosure with the capacity to‘3 ⁇ 4lock and bridge” provide superior anti-tumor efficacy (as measured, e.g., by IFNy production and secretion and in vivo activity) as compared to, e.g, a cocktail having a stoichiometric amount of agents that separately bind the receptor and ligand; or a single agent that binds either the receptor or the ligand. It was also found that the multispecific and multivalent constructs targeting both PD-1 and PD-L1 described herein cause loss of expression of PD-1 on the cell surface, in a valency-dependent fashion.
- the multispecific and multivalent constructs targeting both PD-1 and PD-L1 described herein provide novel immunotheiapeutic agents with increased potency and efficacy for use in the treatment of cancer.
- any of the multispecific antigen-binding constructs disclosed herein binds to at least two different receptors or epitopes (e.g., PD-1 and PD-L1), wherein the two different receptors or epitopes bound by the multispecific antigen-binding construct are expressed on the surface of the same cell.
- the multispecific antigen-binding construct simultaneously binds to PD-1 and PD-L1, wherein the PD-1 and PD-L1 are expressed on the surface of the same cell.
- any of the multispecific antigen-binding constructs disclosed herein binds to at least two different receptors or epitopes (e.g., PD-1 and PD-L1), wherein the two different receptors or epitopes bound by the multispecific antigen-binding construct are expressed on the surface of two different cells.
- the multispecific antigen-binding construct simultaneously binds to PD-1 expressed on the surface of a first cell and to a PD-1 ligand, e.g., PD-L1 or PD-L2, expressed on the surface of a second cell.
- the disclosure provides for a multispecific antigen-binding construct comprising at least two antigen-binding arms, wherein a first arm binds PD-1 expressed by an immune cell, and a second arm binds a PD-1 ligand which is expressed by a second cell, wherein the multispecific antigen-binding construct blocks the interaction of PD- 1 and PD-1 ligand.
- the PD-1 ligand is PD-L2.
- the PD-1 ligand is PD-L1.
- the immune cell is a T cell.
- the T cell is a CD8+ T cell.
- the immune cell is a natural killer (NK) cell.
- the immune cell is a macrophage.
- the second cell is a second immune cell.
- the second immune cell is any one or more of a T cell, a B cell, a macrophage, a myeloid-derived suppressor cell, a dendritic cell, or a mesenchymal stromal cell.
- the second immune cell is a regulatory T cell.
- the second cell is a tumor cell.
- the tumor cell is selected from the group consisting of a hematological cancer, a lymphoma, a myeloma, a leukemia, a neurological cancer, melanoma, breast cancer, a prostate cancer, a colorectal cancer, lung cancer, head and neck cancer, a gastrointestinal cancer, liver cancer, pancreatic cancer, a genitourinary cancer, a bone cancer, renal cancer, and a vascular cancer.
- both arms have a KD of at least 1 x 10 "7 M, at least 1 x 10 "8 M, at least 1 x 10 "9 M, or at least 1 x 10 "10 M.
- the binding of one arm to its target does not block the binding of the other arm to its target.
- the first arm and second arm bind to their respective targets and both arms remain bound concurrently.
- binding of the first arm and the second arm to their respective targets can bridge the immune cell and the second cell together.
- the bridging of the immune cell and the second cell is determined by flow cytometry'.
- the first arm is an antagonist of PD-1.
- a light chain variable region comprising: (i) a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); (ii) a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and (iii) a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT).
- the CDRH1 of the first arm comprises SEQ ID NO: 73 (FTFSDYAMS), CDRH2 ofthe first arm comprises SEQ ID NO: 71 (SAISNSGTYTYYA) and CDRH3 ofthe first arm comprises SEQ ID NO: 74 (ARGLDFIVGATGNDY).
- the CDRH1 of the first arm comprises SEQ ID NO: 73 (FTFSDYAMS), CDRH2 ofthe first arm comprises SEQ ID NO: 71 (SAISNSGTYTYYA) and CDRH3 ofthe first arm comprises SEQ ID NO: 75 (ARGLDFTVGYTGNDY).
- the CDRH1 ofthe first arm comprises SEQ ID NO: 76 (FTFSSYAMS), CDRH2 of the first arm comprises SEQ ID NO: 71 (SAISNSGTYTYYA) and CDRH3 ofthe first arm comprises SEQ ID NO: 75 (ARGLDFTVGYTGNDY).
- the CDRH1 of the first arm comprises SEQ ID NO: 77 (FTFSSYAML), CDRH2 ofthe first arm comprises SEQ ID NO: 71 (SAISNSGTYTYYA) and CDRH3 ofthe first arm comprises SEQ ID NO: 75 (ARGLDFIV GYTGNDY) .
- the CDRH1 of the first arm comprises SEQ ID NO: 78 (FTFSNYALS), CDRH2 ofthe first arm comprises SEQ ID NO: 71 (SAISNSGTYTYYA) and CDRH3 ofthe first arm comprises SEQ ID NO: 75
- the CDRH1 of the first arm comprises SEQ ID NO: 79 (FTFSAYAMN)
- CDRH2 ofthe first arm comprises SEQ ID NO: 71 (SAISNSGTYTYYA)
- CDRH3 ofthe first arm comprises SEQ ID NO: 75
- the CDRH1 of the first arm comprises SEQ ID NO: 80 (FTFRSYAMS), CDRH2 ofthe first arm comprises SEQ ID NO: 71 (SAISNSGTYTYYA) and CDRH3 ofthe first arm comprises SEQ ID NO: 75
- the CDRH1 ofthe first arm comprises SEQ ID NO: 81 (FTFGRYAMS), CDRH2 of the first arm comprises SEQ ID NO: 71 (SA1SNSGTYTYY A) and CDRH3 of the first arm comprises SEQ ID NO: 75
- the CDRH1 of the first arm comprises SEQ ID NO: 82 (FTFNSYAMS), CDRH2 of the first arm comprises SEQ ID NO: 71 (SAISNSGTYTYYA) and CDRH3 of the first arm comprises SEQ ID NO: 75
- the CDRH1 of the first arm comprises SEQ ID NO: 83 (FTFSNYAMS), CDRH2 of the first arm comprises SEQ ID NO: 71 (SAISNSGTYTYYA) and CDRH3 of the first arm comprises SEQ ID NO: 74
- the CDRHl of the first arm comprises SEQ ID NO: 84 (FTFSGYAMS), CDRH2 of the first arm comprises SEQ ID NO: 71 (SAISNSGTYTYYA) and CDRH3 of the first arm comprises SEQ ID NO: 85
- the CDRHl of the first arm comprises SEQ ID NO: 86 (FTFSSYAMN), CDRH2 of the first arm comprises SEQ ID NO: 71 (SAISNSGTYTYYA) and CDRH3 of the first arm comprises SEQ ID NO: 85
- the CDRHl of the first arm comprises SEQ ID NO: 80 (FTFRSYAMS), CDRH2 of the first arm comprises SEQ ID NO: 71 (SAISNSGTYTYYA) and CDRH3 of the first arm comprises SEQ ID NO: 85
- the CDRL1 of the first arm comprises SEQ ID NO: 9
- CDRL2 of the first arm comprises SEQ ID NO: 5 (AASSLQS) and CDRL3 of the first arm comprises SEQ ID NO: 10 (QQSYSTPLT).
- the heavy chain variable region of the first arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 87. In some embodiments, the heavy chain variable region of the first arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 88. In some embodiments, the heavy chain variable region of the first arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 89. In some embodiments, the heavy chain variable region of the first arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 90. In some embodiments, the heavy chain variable region of the first arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 91.
- the heavy chain variable region of the first arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 92. In some embodiments, the heavy chain variable region of the first arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 93. In some embodiments, the heavy chain variable region of the first arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 94. In some embodiments, the heavy chain variable region of the first arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 95. In some embodiments, the heavy chain variable region of the first arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 96.
- the heavy chain variable region of the first arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 97. In some embodiments, the heavy chain variable region of the first arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 98. In some embodiments, the heavy chain variable region of the first arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 99. In some embodiments, the light chain variable region of the first arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 59.
- the second arm is an antagonist of the PD-1 ligand. In some embodiments, the second arm is an antagonist of PD-L2. In some embodiments, the second arm is an antagonist of PD-L1. In some embodiments, the second arm binds to PD-L1 and comprises: a. a heavy chain variable region comprising (i) a CDRH1 comprising SEQ ID
- a CDRH2 comprising SEQ ID NO: 2 (GGIIPX 1X2GX3 ATYA, wherein Xi is V or 1; X2 is F, L, or V; and X3 is T or A); and (iii) a CDRH3 comprising SEQ ID NO: 3 (ARLKXiELKDAFDI, wherein Xi is G, F, or N); and b.
- a light chain variable region comprising: (i) a CDRLl comprising SEQ ID NO: 4 (RASQXiISSYLN, wherein Xi is S, W, or Q); (ii) a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and (iii) a CDRL3 comprising SEQ ID NO: 6 (XiQSYSTPLT, wherein Xi is Q or F).
- the CDRH1 of the second aim comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 7 (GGIIPILGAATY A) and CDRH3 of the second arm comprises SEQ ID NO: 8 (ARLKGELKDAFDI).
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 7 (GGIIPILGAATYA), CDRH3 of the second arm comprises SEQ ID NO: 8 (ARLKGELKDAFDI); CDRLl of the second arm comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 10
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 11 (GGIIPVFGTATYA), CDRH3 of the second arm comprises SEQ ID NO: 8 (ARLKGELKDAFDI); CDRL1 of the second arm comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 10 (QQSYSTPLT).
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 11 (GGIIPVFGTATYA) and CDRH3 of the second arm comprises SEQ ID NO: 8
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 11 (GGIIPVFGTATYA), CDRH3 of the second arm comprises SEQ ID NO: 8
- CDRL1 of the second arm comprises SEQ ID NO: 12
- CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 10 (QQSYSTPLT).
- AASSLQS AASSLQS
- CDRL3 of the second arm comprises SEQ ID NO: 10 (QQSYSTPLT).
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 11 (GGIIPVFGTATYA), CDRH3 of the second arm comprises SEQ ID NO: 8 (ARLKGELKDAFDI); CDRL1 of the second arm comprises SEQ ID NO: 13 (RASQQISSYLN); CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 10
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 11
- CDRH3 of the second arm comprises SEQ ID NO: 8
- CDRL1 of the second arm comprises SEQ ID NO: 9
- CDRL2 of the second arm comprises SEQ P) NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 10 (QQSYSTPLT).
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 15 (GGIIPIFGIANYA) and CDRH3 of the second arm comprises SEQ ID NO: 8 (ARLKGELKDAFDI). In some embodiments, the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN),
- CDRH2 of the second arm comprises SEQ ID NO: 15 (GGIIPIFGIANYA), CDRH3 of the second arm comprises SEQ ID NO: 8 (ARLKGELKDAFDI); CDRL1 of the second arm comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 10
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 16 (GGIIPNFGTATYA) and CDRH3 of the second arm comprises SEQ ID NO: 17 (ARLKGELKGAGDI).
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 16 (GGHPNFGTATYA), CDRH3 of the second arm comprises SEQ ID NO: 17 (ARLKGELKGAGDI); CDRL1 of the second arm comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 10
- the CDRH1 of the second aim comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second aim comprises SEQ ID NO: 11 (GGIIP VFGTATY A), and CDRH3 of the second aim comprises SEQ ID NO: 18 (ARLKFELKDAFDI).
- the CDRHl of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 11 (GGIIPVFGTATYA), CDRH3 of the second arm comprises SEQ ID NO: 18 (ARLKFELKDAFDI), CDRL1 of the second arm comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second aim comprises SEQ ID NO: 10
- the CDRHl of the second aim comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 11 (GGIIPVFGTATYA), and CDRH3 of the second arm comprises SEQ ID NO: 19 (ARLKGELKDAFDE).
- the CDRHl of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 11 (GGIIPVFGTATYA), CDRH3 of the second arm comprises SEQ ID NO: 19 (ARLKGELKDAFDE), CDRL1 of the second arm comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 10
- the CDRHl of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 11 (GGIIPVFGTATYA), and CDRH3 of the second arm comprises SEQ ID NO: 20 ( ARLKNELKD AFDI) .
- the CDRHl of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 11 (GGIIPVFGTATYA), CDRH3 of the second arm comprises SEQ ID NO: 20 (ARLKNELKDAFDI), CDRL1 of the second arm comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 10
- the CDRHl of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 21 (GGVIPFLGTANYA), and CDRH3 of the second arm comprises SEQ ID NO: 22
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 21
- CDRH3 of the second arm comprises SEQ ID NO: 22
- CDRLl of the second arm comprises SEQ ID NO: 9
- CDRL2 of the second arm comprises SEQ P) NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 10 (QQSYSTPLT).
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 29 (GRHPIFGTADYA), and CDRH3 of the second arm comprises SEQ ID NO: 8 (ARLKGELKDAFDI).
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 29 (GRHPIFGTADYA), CDRH3 of the second arm comprises SEQ ID NO: 8 (ARLKGELKDAFDI), CDRLl of the second arm comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 10
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 31 (GGIIPILGTATY A), and CDRH3 of the second arm comprises SEQ ID NO: 32 (ARRKGELKDAFDI).
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 31 (GGHPILGTATYA), CDRH3 of the second arm comprises SEQ ID NO: 32 (ARRKGELKDAFDI), CDRLl of the second arm comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 10
- the CDRH1 of the second ami comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second ami comprises SEQ ID NO: 33 (GGIIPIVATANYA), and CDRH3 of the second arm comprises SEQ ID NO: 32 (ARRKGELKDAFDI).
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 33 (GGIIPIVATANYA), CDRH3 of the second arm comprises SEQ ID NO: 32 (ARRKGELKDAFDI), CDRLl of the second arm comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 10
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYA1N)
- CDRH2 of the second arm comprises SEQ ID NO: 34 (GG1IP1FGKATYA)
- CDRH3 of the second arm comprises SEQ ID NO: 32 (ARRKGELKDAFDI).
- the CDRH1 of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 34 (GGIIPIFGKATYA), CDRH3 of the second arm comprises SEQ ID NO: 32 (ARRKGELKDAFDI), CDRL1 of the second arm comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 10
- the CDRHl of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 11 (GGIIPVFGTATYA), CDRH3 of the second arm comprises SEQ ID NO: 8 (ARLKGELKDAFDI); CDRL1 of the second arm comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 38 (FQSYSTPLT).
- the CDRHl of the second arm comprises SEQ ID NO: 1 (GTFSSYAIN), CDRH2 of the second arm comprises SEQ ID NO: 11 (GGIIPVFGTATYA), CDRH3 of the second arm comprises SEQ ID NO: 8 (ARLKGELKDAFDI); CDRL1 of the second arm comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 of the second arm comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 of the second arm comprises SEQ ID NO: 39 (QQSYSTILT).
- the second arm comprises: a. a heavy chain variable region comprising (i) a CDRHl comprising SEQ ID NO: 14 (GTFSSYAFS), (ii) a CDRH2 comprising SEQ ID NO: 11 (GGIIPVFGTATYA) and (iii) a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI); and b. a light chain variable region comprising: (i) a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); (ii) a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and (iii) a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT).
- the second arm comprises a heavy chain variable region comprising (i) a CDRHl comprising SEQ ID NO: 23 (GTFSSYAIS), (ii) a CDRH2 comprising SEQ ID NO: 24 (GGIIPIVGIANYA), and (iii) a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI).
- the second arm comprises a light chain variable region comprising: (i) a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); (ii) a CDRL2 comprising SEQ P) NO: 5 (AASSLQS); and (iii) a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT).
- the second arm comprises a heavy chain variable region comprising (i) a CDRH1 comprising SEQ ID NO: 23 (GTFSSYAIS), (ii) a CDRH2 comprising SEQ ID NO: 11 (GGHPVFGTATYA), and (in) a CDRH3 comprising SEQ ID NO: 25 (ARLKGEFKDAFDI).
- the second arm comprises a light chain variable region comprising: (i) a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); (ii) a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and (iii) a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT).
- the second arm comprises a heavy chain variable region comprising (i) a CDRH1 comprising SEQ ID NO: 23 (GTFSSYAIS), (ii) a CDRH2 comprising SEQ ID NO: 26 (GRIIPLFGTAHYA), and (iii) a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI).
- the second arm comprises a light chain variable region comprising: (i) a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); (ii) a CDRL2 comprising SEQ P) NO: 5 (AASSLQS); and (iii) a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT).
- the second arm comprises a heavy chain variable region comprising (i) a CDRH1 comprising SEQ ID NO: 23 (GTFSSYAIS), (ii) a CDRH2 comprising SEQ ID NO: 27 (GRINPILGTANYA), and (iii) a CDRH3 comprising SEQ ID NO: 28 (ARLKGELKDAFSI).
- the second arm comprises a light chain variable region comprising: (i) a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); (ii) a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and (iii) a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT).
- the second arm comprises a heavy chain variable region comprising (i) a CDRH1 comprising SEQ ID NO: 23 (GTFSSYAIS), (ii) a CDRH2 comprising SEQ ID NO: 11 (GGI1PVFGTATY A), and (iii) a CDRH3 comprising SEQ ID NO: 30 (ARLKGELKCAFDI).
- the second arm comprises a light chain variable region comprising: (i) a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); (ii) a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and (iii) a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT).
- the second arm comprises a heavy chain variable region comprising (i) a CDRH1 comprising SEQ ID NO: 122 (GTKSSYAIS), (ii) CDRH2 comprising SEQ ID NO: 11 (GGI1PVFGTATY A), and (iii) a CDRH3 comprising SEQ ID NO: 30 (ARLKGELKCAFDI).
- the second arm further comprises a light chain variable region comprising: (i) a CDRLl comprising SEQ ID NO: 9 (RASQSISSYLN); (ii) a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and (iii) a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT).
- the second ami comprises a heavy chain variable region comprising (i) a CDRH1 comprising SEQ ID NO: 36 (GPFRSHAVS), (ii) a CDRH2 comprising SEQ ID NO: 11 (GGEPVFGTATYA), and (iii) a CDRH3 comprising SEQ ID NO: 37 (ARLKSELKDAFD1).
- the second arm comprises a light chain variable region comprising: (i) a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); (ii) a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and (iii) a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT).
- the second arm that binds PD-L1 comprises a heavy chain variable region comprising an amino acid sequence that is at least 90% identical to any one of SEQ ID NOs: 35, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, or 58 and a light chain variable region comprising an amino acid sequence that is at least 90% identical to any one of SEQ ID NOs: 59, 60, 61, 62, or 63.
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 35
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 40
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 41
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 42
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 43
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 44
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 45
- the heavy- chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 46
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 47
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 48
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 49
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 50
- the heavy- chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 51
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 52 (QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAINWVRQAPGQGLEWMGRIIPIFG TADYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARLKGELKDAFDIWGQ GTLVTVSS). In some embodiments, the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 53
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 54
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 55
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 56
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 57
- the heavy chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 58
- the light chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 59
- the light chain variable region of the second arm comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 60
- the light chain variable region of the second ami comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 61
- the light chain variable region of the second ami comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 62
- the light chain variable region of the second ami comprises an amino acid sequence that is at least 90% identical to SEQ ID NO: 63
- the construct is a bispecific antibody.
- the bispecific antibody is an antagonist of both PD-1 and PD-1 ligand.
- the construct comprises a common light chain.
- one or both of the arms is an aptamer.
- one or both of the arms is a protein other than an antibody.
- the construct comprises at least two bispecific antibodies.
- one of the at least two bispecific antibodies ismonovalent for PD-1.
- one of the at least two bispecific antibodies ismonovalent for PD-1 ligand.
- at least one of the arms is a bivalent antibody specific for PD-1.
- At least one of the arms is a bivalent antibody specific for PD-L1. In some embodiments, at least one of the arms is a bivalent antibody specific for PD-1, and at least one of the arms is a bivalent antibody specific for PD-L1. In some embodiments, at least one of the arms is bivalent for PD-1. In some embodiments, at least one of the arms is bivalent fbr PD-Ll. In some embodiments, at least one of the arms is bivalent for PD-1, and at least one of the arms is bivalent for PD-L1. In some embodiments, the bispecific antibody binds two different epitopes on PD-1. In some embodiments, the bispecific antibody binds two different epitopes on the PD-1 ligand.
- any of the multispecific antigen-binding constructs disclosed herein comprises at least two monospecific antibodies.
- at least one of the monospecific antibodies is an anti -PD-1 antibody.
- the anti-PD- 1 antibody is a bivalent anti-PD-1 antibody.
- at least one of the monospecific antibodies is an anti-PD -LI antibody.
- the anti-PD-1 antibody is a bivalent anti -PD -LI antibody.
- the construct comprises a bivalent anti -PD -1 antibody and a bivalent anti -PD -LI antibody.
- the construct is a fusion construct in which a polypeptide comprising the variable heavy chain of the anti-PD-1 antibody is fused to a polypeptide comprising the variable heavy chain of the anti-PD-Ll antibody.
- the polypeptide comprising the variable heavy chain of the anti-PD-1 antibody is fused to the polypeptide comprising the variable heavy chain of the anti-PD-Ll antibody by means of a linker.
- the fusion construct comprises a common light chain.
- the N-terminal variable heavy chain of the fusion construct binds to PD-1 in the presence of the common light chain
- the C-terminal variable heavy chain of the fusion construct binds to PD-L1 in the presence of the common light chain
- the N-terminal variable heavy chain of the fusion construct binds to PD-L1 in the presence of the common light chain
- the C-terminal variable heavy chain of the fusion construct binds to PD-1 in the presence of the common light chain.
- the disclosure provides for a multispecific antigenbinding construct comprising at least two units of antigen-binding, wherein a first unit of antigen-binding binds PD-1, and a second unit of antigen-binding binds a PD-1 ligand.
- the first unit of antigen-binding binds PD-1 expressed by an immune cell.
- the second unit of antigen-binding binds PD-1 expressed by a second cell.
- the multispecific antigen-binding construct blocks the interaction of PD-1 and a PD-1 ligand, such as PD-L1 or PD-L2.
- the multispecific antigen-binding construct blocks the interaction of PD-1 and a PD-1 ligand, such as PD-L1 or PD-L2. In some embodiments, the multispecific antigen-binding construct comprises at least two units of antigen-binding that bind PD-1. In some embodiments, the multispecific antigen-binding construct comprises two units of antigen-binding that bind PD- 1. In some embodiments, the multispecific antigen-binding construct comprises at least two units of antigen-binding that bind a PD-1 ligand, such as PD-L1 or PD-L2.
- the multispecific antigen-binding construct comprises two units of antigenbinding that bind a PD-1 ligand, such as PD-L1 or PD-L2. In some embodiments, the multispecific antigen-binding construct comprises at least four units of antigen-binding, wherein two units of antigen-binding bind PD-1 and two units of antigen-binding bind a PD-1 ligand, such as PD-L1 or PD-L2.
- the multispecific antigen-binding construct comprises four units of antigen-binding, wherein two units of antigen-binding bind PD-1 and two units of antigen-binding bind a PD-1 ligand, such as PD-L1 or PD-L2.
- each unit of antigen-binding is capable of binding independently to its cognate antigen, i.e., PD-1 or a PD-1 ligand, such as PD-L1 or PD-L2.
- the multispecific antigen-binding construct promotes loss of PD-1 expression from a cell. In some embodiments, the loss of PD-1 expression is due to PD-1 shedding.
- the multispecific antigen-binding construct blocks interaction of PD-1 and the PD-1 ligand, such as PD-L1 or PD-L2.
- the multispecific antigenbinding construct comprises a common light chain.
- at least two units of antigenbinding comprise a common light chain.
- the first unit of antigen-binding binds PD-1 and comprises:
- a light chain variable region comprising: (i) a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); (ii) a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and (iii) a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT).
- the first unit of antigen-binding binds PD-1 and comprises:
- a CDRH1 comprising SEQ ID NO: 76 (FTFSSYAMS), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO:
- a CDRH1 comprising SEQ ID NO: 78 (FTFSNYALS), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO:
- a CDRH1 comprising SEQ ID NO: 80 (FTFRSYAMS), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO:
- a CDRH1 comprising SEQ ID NO: 81 (FTFGRYAMS), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO:
- a CDRH1 comprising SEQ ID NO: 82 FFFNSYAMS
- a CDRH2 comprising SEQ ID NO: 71 SAISNSGTYTYYA
- CDRH1 comprising SEQ ID NO: 83 (FTFSNYAMS), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO:
- a CDRH1 comprising SEQ ID NO: 80 (FTFRSYAMS), a comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO: 85 (ARGLDFIVGRTGNDY).
- the first unit of antigen-binding binds PD-1 and comprises:
- (k) a heavy chain variable region comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 97;
- the first unit of antigen-binding binds PD-1 and comprises a light chain variable region comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 59.
- the second unit of antigen-binding binds PD-L2. In some embodiments, the second unit of antigen-binding binds PD-L1. In some embodiments, the second unit of antigen-binding binds PD-L1 and comprises:
- a heavy chain variable region comprising (i) a CDRH1 comprising SEQ ID NO:
- a CDRH2 comprising SEQ ID NO: 2 (GGHPX1X2GX3ATYA, wherein Xi is V or I; X2 is F, L, or V; and X3 is T or A); and (iii) a CDRH3 comprising SEQ ID NO: 3 (ARLKXiELKDAFDI, wherein Xi is G, F, or N); and b. a light chain variable region comprising: (i) a CDRL1 comprising SEQ ID NO:
- the second unit of antigen-binding binds PD-L1 and comprises: (a) a CDRH1 comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 7 (GGIIPILGAATYA), and a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI);
- a CDRH1 comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 11 (GGIIPVFGTATYA), a CDRH3 comprising SEQ ID NO: 8
- RASQWISSYLN a CDRL2 comprising SEQ ID NO: 5
- AASSLQS a CDRL3 comprising SEQ ID NO: 10
- a CDRH1 comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 15 (GGIIPIFGTANY A), and a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI);
- a CDRH1 comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 15 (GGIIPIFGIANYA), a CDRH3 comprising SEQ ID NO: 8
- a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRHl comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 11 (GGIIPVFGTATYA), a CDRH3 comprising SEQ ID NO: 18 (ARLKFELKD AFDI), a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRHl comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 11 (GGIIPVFGTATYA), and a CDRH3 comprising SEQ ID NO: 19 (ARLKGELKDAFDE);
- ARLKGELKDAFDE a CDRL1 comprising SEQ ID NO: 9
- RASQSISSYLN a CDRL2 comprising SEQ ID NO: 5
- AASSLQS a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRHl comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 11 (GGIIPVFGTATYA), a CDRH3 comprising SEQ ID NO: 20 (ARLKNELKDAFDI), a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRH1 comprising SEQ ID NO: 1 GTFSSYAIN
- a CDRH2 comprising SEQ ID NO: 21 GGVIPFLGTANY A
- a CDRH3 comprising SEQ ID NO: 22 ARLKGILKDALDl
- a CDRL1 comprising SEQ ID NO: 9 RASQSISSYLN
- a CDRL2 comprising SEQ ID NO: 5 AASSLQS
- a CDRL3 comprising SEQ ID NO: 10 QQSYSTPLT
- a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRLl comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRLl comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRH1 comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 34 (GGIIPIFGKATYA), a CDRH3 comprising SEQ ID NO: 32 (ARRKGELKDAFDI), a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRH1 comprising SEQ ID NO: 1 GTFSSYAIN
- a CDRH2 comprising SEQ ID NO: 11 GGIIPVFGTATYA
- a CDRH3 comprising SEQ ID NO: 8 ARLKGELKDAFDI
- a CDRL1 comprising SEQ ID NO: 9 RASQSISSYLN
- a CDRL2 comprising SEQ ID NO: 5 AASSLQS
- a CDRL3 comprising SEQ ID NO: 38 FQSYSTPLT
- cc a CDRH1 comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 11 (GGIIPVFGTATYA), a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI); a CDRLl comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 39 (QQSYSTTLT);
- a CDRH1 comprising SEQ ID NO: 14 (GTFSSYAFS), a CDRH2 comprising SEQ ID NO: 11 (GGIIPVFGTATYA) and a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI); a CDRLl comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRH1 comprising SEQ ID NO: 23 (GTFSSYAIS), a CDRH2 comprising
- SEQ ID NO: 24 (GGIIPIVGIANYA), and a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI);
- SEQ ID NO: 24 (GGIIPIVGIANYA), and a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI); a CDRLl comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT); (gg) a CDRH1 comprising SEQ ID NO: 23 (GTFSSYAIS), a CDRH2 comprising SEQ ID NO: 11 (GGIIPVFGTATYA), and a CDRH3 comprising SEQ ID NO: 25 (ARLKGEFKDAFDI);
- a CDRH1 comprising SEQ ID NO: 23 (GTFSSYAIS), a CDRH2 comprising SEQ ID NO: 11 (GGIIPVFGTATYA), and a CDRH3 comprising SEQ ID NO: 25 (ARLKGEFKDAFDI); a CDRL1 comprising SEQ ID NO: 9 (RASQS1SSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- SEQ ID NO: 26 (GRIIPLFGTAHYA), and a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI);
- SEQ ID NO: 26 (GRIIPLFGTAHYA), and a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI); a CDRLl comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRH1 comprising SEQ ID NO: 23 (GTFSSYAIS), a CDRH2 comprising SEQ ID NO: 27 (GRINPILGTANYA), and a CDRH3 comprising SEQ ID NO: 28 (ARLKGELKDAFSI); a CDRLl comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRH1 comprising SEQ ID NO: 23 (GTFSSYAIS), a CDRH2 comprising SEQ ID NO: 11 (GGIIPVFGTATYA), and a CDRH3 comprising SEQ ID NO: 30 (ARLKGELKCAFDI);
- a CDRH1 comprising SEQ ID NO: 23 (GTFSSYAIS), a CDRH2 comprising SEQ ID NO: 11 (GGIIPVFGTATYA), and a comprising SEQ ID NO: 30 (ARLKGELKCAFDI); a CDRLl comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT); (oo) a CDRH1 comprising SEQ ID NO: 36 (GPFRSHAVS), a CDRH2 comprising SEQ ID NO: 11 (GGIIPVFGTATYA), and a CDRH3 comprising SEQ ID NO: 37 (ARLKSELKDAFDI); or
- a CDRH1 comprising SEQ ID NO: 36 GPFRSHAVS
- a CDRH2 comprising SEQ ID NO: 11 GGIIPVFGTATYA
- a CDRH3 comprising SEQ ID NO: 37 ARLKSELKDAFDI
- a CDRL1 comprising SEQ ID NO: 9 RASQSISSYLN
- a CDRL2 comprising SEQ ID NO: 5 AASSLQS
- a CDRL3 comprising SEQ ID NO: 10 QQSYSTPLT
- the second unit of antigen-binding binds PD-L1 and comprises and comprises a heavy chain variable region comprising an amino acid sequence that is at least 90% identical to any one of SEQ ID NOs: 35, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, or 58, and a light chain variable region comprising an amino acid sequence that is at least 90% identical to any one of SEQ ID NOs: 59, 60, 61, 62, or 63.
- the second unit of antigen-binding binds PD-L1 and comprises a heavy chain variable region comprising:
- the second unit of antigen-binding binds PD-L1 and comprises a light chain variable region comprising:
- a multispecific antigenbinding construct comprising four units of antigen-binding, wherein two units of antigenbinding bind PD-1 and two units of antigen-binding bind PD-L1, and wherein the construct comprises a heavy chain amino acid sequence that is at least 85%, identical to the amino acid sequence of SEQ ID NO: 100 or 102, and a light chain amino acid sequence that is at least 85%, identical to the amino acid sequence of SEQ ID NO: 101 or 103.
- a multispecific antigenbinding construct comprising four units of antigen-binding, wherein two units of antigenbinding bind PD-1 and two units of antigen-binding bind PD-L1, and wherein the construct comprises a heavy chain amino acid sequence that is at least 85%, identical to the amino acid sequence of SEQ ID NO: 100 and a light chain amino acid sequence that is at least 85%, identical to the amino acid sequence of SEQ ID NO: 101.
- a multispecific antigenbinding construct comprising four units of antigen-binding, wherein two units of antigenbinding bind PD-1 and two units of antigen-binding bind PD-L1, and wherein the construct comprises a heavy chain amino acid sequence that is at least 85%, identical to the amino acid sequence of SEQ ID NO: 102 and a light chain amino acid sequence that is at least 85%, identical to the amino acid sequence of SEQ P) NO: 103.
- the construct does not comprise an Fc domain.
- the first arm or second arm, or both comprises a heavy chain comprising one or more immunoglobulin Fc modifications.
- the immunoglobulin Fc domain of the heavy chain comprises one or more amino acid mutations that promote heterodimerization of the first and second arms.
- the mutation is present in a CHS domain of the heavy chain.
- the multispecific antigen-binding construct is produced in a quadroma cell.
- the construct comprises one or more immunoglobulin constant region modifications.
- the immunoglobulin constant region comprises one or more amino acid mutations that promote heterodimerization of antibodies.
- one or more mutations is present in the light chain constant region of one arm and one or more mutations is present in the heavy chain constant region of another arm.
- the bispecific antibody is of a format selected from the group consisting of a bispecific IgG, bispecific antibody fragment, bispecific fusion protein, appended IgG, and bispecific antibody conjugate.
- the Fc region has reduced effector function. In some embodiments, the Fc region enhances half-life of the construct.
- the construct comprises a heavy chain amino acid sequence that is at least 85%, identical to the amino acid sequence of SEQ ID NO: 100 or 102. In some embodiments, the construct comprises a light chain amino acid sequence that is at least 85%, identical to the amino acid sequence of SEQ P) NO: 101 or 103. In some embodiments, the construct comprises a heavy chain amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NO: 100, and wherein the construct comprises a light chain amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NO: 101.
- the construct comprises a heavy chain amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NO: 102, and wherein the construct comprises a light chain amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NO: 103.
- any of the multispecific antigen-binding constructs disclosed herein are aglycosylated.
- the multispecific antigen-binding construct is capable of binding human PD-1.
- the multispecific antigen-binding construct is capable of binding murine PD-1.
- the multispecific antigen-binding construct is capable of binding cynomolgus monkey PD-1.
- the multispecific antigen-binding construct is capable of binding human, murine and cynomolgus monkey PD-1 with similar affinity.
- any of the multispecific antigen-binding constructs disclosed herein is capable of reducing PD-1 levels on a cell.
- the multispecific antigen-binding construct is capable of inducing PD-1 degradation.
- the multispecific antigen-binding construct is capable of reducing PD-1 expression.
- the multispecific antigen-binding construct is capable of reducing PD-1 cell surface expression.
- the multispecific antigen-binding construct is capable of reducing PD-1 cell surface expression by inducing shedding of PD-1 from the cell surface.
- the multispecific antigen-binding construct is capable of binding both PD-1 and PD-L1 and reducing PD-1 levels on a cell.
- the multispecific antigen-binding construct is capable of binding both PD-1 and PD-L1 and inducing PD-1 degradation. In some embodiments, the multispecific antigen-binding construct is capable of binding both PD-1 and PD-L1 and reducing PD-1 expression. In some embodiments, the multispecific antigen-binding construct is capable of inducing shedding of PD-1 from an immune cell. In some embodiments, the multispecific antigen-binding construct is capable of binding both PD-1 and PD-L1 and inducing PD-1 shedding from an immune cell. In some embodiments, the multispecific antigen-binding construct is capable of sequestering PD-L1, such that PD-L1 cannot bind CD80.
- the multispecific antigen-binding construct is capable of sequestering PD-L1, such that PD-L1 cannot bind CD80, and wherein CD80 is free to bind CD28.
- the cell is an immune cell, such as a T cell.
- the immune cell e.g., T cell
- the immune cell is a tumor infiltrating lymphocyte (TIL).
- TIL tumor infiltrating lymphocyte
- engagement of a multispecific antigen-binding molecule described herein to PD-1 expressed by an immune cell in the tumor microenvironment results in the downregulation of PD-1 by the immune cell.
- the immune cell is a T cell.
- the immune cell e.g., T cell
- TIL tumor infiltrating lymphocyte
- any of the multispecific antigen-binding constructs disclosed herein is capable of inducing at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%,
- interferon-gamma levels e.g., as measured in a Staphylococcus aureus Enterotoxin A (“SEA”) assay
- SEA Staphylococcus aureus Enterotoxin A
- a reference antigen-binding construct e.g., pembrolizumab or atezolizumab
- a reference combination of antigen-binding constructs e.g, a composition comprising the PD-1 and PD- LI arms of the multispecific antigen-binding construct, wherein the PD-1 and PD-L1 arms in the composition are not conjugated to one another.
- the multispecific antigen-binding construct is capable of inducing at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 99% greater interleukin-2 levels (e.g, as measured in a SEA assay) as compared to a reference antigen- binding construct (e.g.
- pembrolizumab or atezolizumab or to a reference combination of antigen-binding constructs (e.g, a composition comprising the PD-1 and PD-L1 arms of the multispecific antigen-binding construct, wherein the PD-1 and PD-L1 arms in the composition are not conjugated to one another).
- a reference combination of antigen-binding constructs e.g, a composition comprising the PD-1 and PD-L1 arms of the multispecific antigen-binding construct, wherein the PD-1 and PD-L1 arms in the composition are not conjugated to one another.
- the multispecific antigen-binding constmct induces at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, 200%, 300%, 400%, or 500% more killing of tumor cells (e.g., leukemia cells, lymphoma cells, melanoma, or breast cancer cells), as compared to a reference antigen-binding construct (e.g.
- tumor cells e.g., leukemia cells, lymphoma cells, melanoma, or breast cancer cells
- a reference antigen-binding construct e.g.
- pembrolizumab or atezolizumab or to a reference combination of antigen-binding constructs (e.g., a composition comprising the PD-1 and PD- L1 arms of the multispecific antigen-binding constmct, wherein the PD-1 and PD-L1 arms in the composition are not conjugated to one another).
- a reference combination of antigen-binding constructs e.g., a composition comprising the PD-1 and PD- L1 arms of the multispecific antigen-binding constmct, wherein the PD-1 and PD-L1 arms in the composition are not conjugated to one another.
- the multispecific antigen-binding constmct is capable of extending the survival of a subject suffering from a cancer (e.g. , leukemia, lymphoma, melanoma, and/or breast cancer) by at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, 100%, 200%, 300%, 400%, or 500% longer than a subject administered a reference antigen-binding constmct (e.g, pembrolizumab or atezolizumab) or a reference combination of antigen-binding constructs (e.g.
- a reference antigen-binding constmct e.g, pembrolizumab or atezolizumab
- a reference combination of antigen-binding constructs e.g.
- the multispecific antigen-binding constmct is capable of inducing at least 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, 100%, 200%, 300%, 400%, or 500% more shedding of PD-1 from an immune cell as compared to an untreated immune cell or as compared to an immune cell treated with reference antigen-binding constmct (e.g, pembrolizumab or atezolizumab) or a reference combination of antigen-binding constructs (e.g, a composition comprising the PD-1 and PD-L1 arms of the multispecific antigenbinding constmct,
- pembrolizumab or atezolizumab or a reference combination of antigen-binding constructs (e.g, a composition comprising the PD-1 and PD-L1 arms of the multispecific antigen-binding constmct, wherein the PD-1 and PD-L1 arms in the composition are not conjugated to one another).
- a multispecific antigen-binding molecule described herein to PD-1 expressed by a cell results in the downregulation and/or loss of cell- surface expression of PD-1 by the cell.
- Such down-regulation or loss of cell-surface expression can be due to, in part, for example, shedding of extracellular PD-1 from the surface of the immune cell.
- the cell is an immune cell, such as a T cell.
- the immune cell e.g., T cell
- the immune cell is a tumor infiltrating lymphocyte (TIL).
- TIL tumor infiltrating lymphocyte
- engagement of a multispecific antigen-binding molecule described herein to PD-1 expressed by an immune cell in the tumor microenvironment results in the downregulation of PD-1 by the immune cell.
- the immune cell is a T cell.
- the immune cell e.g., T cell
- TIL tumor infiltrating lymphocyte
- the disclosure provides for a method for treating a proliferative disorder in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of any of the multispecific antigen-binding constructs disclosed herein, thereby treating the proliferative disorder in the subject.
- the proliferative disorder is cancer.
- the cancer is selected from the group consisting of a hematological cancer, a neurological cancer, melanoma, breast cancer, lung cancer, head and neck cancer, a gastrointestinal cancer, liver cancer, pancreatic cancer, a genitourinary cancer, a bone cancer, and a vascular cancer.
- the disclosure provides for a method of enhancing an immune response in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of any of the multispecific antigen-binding constructs disclosed herein, thereby enhancing the immune response in the subject.
- the enhanced immune response includes any one or more of enhanced T cell function, enhanced NK cell function, or enhanced macrophage function.
- the enhancement of T cell function is greater upon administration of the multispecific antigen-binding construct, as compared to an agent that binds either PD-1 or a PD-1 ligand, or a cocktail comprising an agent that binds PD-1 and an agent that binds a PD-1 ligand.
- the T cell function is any one or more of increased IRNg production from T cells, enhanced T cell survival, increased T cell proliferation, or rescue from an exhausted T cell phenotype.
- the enhanced T cell function is greater upon administration of the multispecific antigen-binding construct, as compared to an agent that binds either PD-1 or a PD-1 ligand, or a cocktail comprising an agent that binds PD-1 and an agent that binds a PD-1 ligand.
- the multispecific antigen-binding constmct is administered subcutaneously, intravenously, intradermally, intraperitoneally, orally, intramuscularly or intracranially.
- the multispecific antigen-binding constmct binds to PD-1 and to PD-L1 expressed on the surface of the same cell in the subject. In some embodiments, the multispecific antigen-binding constmct binds to PD-1 expressed on the surface of a first cell in the subject, and wherein the multispecific antigen-binding constmct binds to PD-L1 expressed on the surface of a second cell in the subject.
- the anti -PD-1 antibody or antigen-binding fragment comprises: (a) a heavy chain variable region comprising (i) a CDRH1 comprising the amino acid sequence of any one of SEQ ID NOs: 73, 76, 77, 78, 79, 80, 81, 82, 83, 84, or 86; (ii) a CDRH2 comprising the amino acid sequence of SEQ ID NO: 71; and (iii) a CDRH3 comprising the amino acid sequence of any one of SEQ ID NOs: 74,
- the heavy chain variable region comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of any one of SEQ ID NOs: 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99.
- the light chain variable region comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of SEQ ID NO: 59.
- the disclosure provides for an anti -PD -LI antibody or antigenbinding fragment thereof, wherein the anti-PD-Ll antibody or antigen-binding fragment comprises: a. a heavy- chain variable region comprising (i) a CDRH1 comprising SEQ ID NO:
- a CDRH2 comprising SEQ ID NO: 2 (GGIIPX 1X2GX3 ATY A, w-herein Xi is V or I; X2 is F, L, or V; and X3 is T or A); and (iii) a CDRH3 comprising SEQ ID NO: 3 (ARLKXiELKDAFDI, wherein Xi is G, F, or N); and b.
- a light chain variable region comprising: (i) a CDRLl comprising SEQ ID NO: 4 (RASQXiISSYLN, wherein Xi is S, W, or Q); (ii) a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and (iii) a CDRL3 comprising SEQ ID NO: 6 (XiQSYSTPLT, wherein Xi is Q or F).
- the anti-PD-Ll antibody or antigen-binding fragment comprises: (a) a heavy chain variable region comprising (i) a CDRH1 comprising the amino acid sequence of any one of SEQ ID NOs: 1, 14, 23, 36, or 122; (ii) a CDRH2 comprising the amino acid sequence of any one of SEQ ID NOs: 11, 15, 16, 21, 24, 26, 27, 29, 31, 33, or 34; and (iii) a CDRH3 comprising the amino acid sequence of any one of SEQ ID NOs: 8, 17, 18, 19, 20, 22, 25, 28, 30, 32, or 37; and (b) a light chain variable region comprising: (i) a CDRL1 comprising the amino acid sequence of any one of SEQ ID NOs: 9, 12, or 13; (ii) a CDRL2 comprising the amino acid sequence of SEQ ID NO: 5; and (iii) a CDRL3 comprising the amino acid sequence of any one of SEQ ID NOs: 10, 38 or 39.
- a heavy chain variable region comprising (i)
- the heavy chain variable region comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of any one of SEQ ID NOs: 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57,
- the light chain variable region comprises an amino acid sequence that is at least 85% identical to the amino acid sequence of any one of SEQ ID NOs:
- the disclosure provides for a method for treating a proliferative disorder in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of any of the antibodies or antigen-binding constructs disclosed herein, thereby treating the proliferative disorder in the subject.
- the proliferative disorder is cancer.
- the cancer is selected from the group consisting of a hematological cancer, a neurological cancer, melanoma, breast cancer, lung cancer, head and neck cancer, a gastrointestinal cancer, liver cancer, pancreatic cancer, a genitourinary cancer, a bone cancer, and a vascular cancer.
- the disclosure provides for a method of enhancing an immune response in a subject in need thereof, comprising administering to the subject a
- any of the methods described herein can involve detecting the presence or absence of PD-1 expression by one or more cells (or a population of cells, such as TILs) before and/or after contact with a multispecific antigen-binding molecule described herein.
- any of the methods described herein can involve detecting the presence or absence of PD-1 expression by one or more cells (or a population of cells, such as TILs) before and/or after administration of a multispecific antigen-binding molecule described herein to a subject (e.g., a cancer patient).
- a subject e.g., a cancer patient.
- Such methods are useful, e.g., determining a therapeutically effective amount of the molecule for use in treatment of a given patient or patient population.
- Methods of detecting the presence, reduction in expression, and/or absence of PD-1 expression are known to those of skill in the art, for example, using flow cytometry, Western blotting, ELISA, etc.
- the disclosure features a method comprising measuring the level of PD-1 expression by one or more cells (or a population of cells, such as TILs) before and/or after contact with a multispecific antigen-binding molecule described herein.
- the method comprises measuring the level of PD-1 expression by one or more cells (or a population of cells, such as TILs) before and/or after administration of a multispecific antigen-binding molecule described herein to a subject (e.g., a cancer patient).
- the disclosure features a method comprising measuring the level of PD-1 expression by one or more cells (or a population of cells, such as TILs) before and/or after contact with a multispecific antigen-binding molecule described herein.
- any of the methods described herein can involve measuring the level of PD-1 expression by one or more cells (or a population of cells, such as TILs) before and/or after administration of a multispecific antigen-binding molecule described herein to a subject (e.g., a cancer patient).
- a subject e.g., a cancer patient.
- Such methods are useful for, among other things, detecting or measuring a biological effect of a molecule described herein on the subject.
- a reduction in the level of PD-1 expression by an immune cell (e.g., TILs isolated from a patient) following treatment with a multispecific antigen-binding molecule described herein indicates that the molecule has had a biological effect in the subject.
- a reduction in the level of PD-1 expression by an immune cell (e.g., TILs isolated from a patient) following treatment with a multispecific antigen-binding molecule described herein indicates that the patient should receive one or more doses of the molecule, or otherwise continue on a therapy comprising the molecule.
- the disclosure features methods for determining whether a biological effect has occurred in a patient or population of patients treated with a
- the method comprises detecting the presence or amount of PD-1 expression by one or more test immune cells (e.g., effector immune cells, such as those in the tumor microenvironment) obtained from a patient or patients who have been administered a multispecific antigen-binding molecule described herein, wherein a reduced level of PD-1 expression (e.g., cell surface expression) of PD-1 by the one or more immune cells relative to a control expression level (e.g., the expression level of PD-1 by immune cells of the same histological type as the test immune cells prior to administration of the molecule) indicates that a biological effect has occurred in the patient or population of patients.
- test immune cells e.g., effector immune cells, such as those in the tumor microenvironment
- a reduced level of PD-1 expression e.g., cell surface expression
- a control expression level e.g., the expression level of PD-1 by immune cells of the same histological type as the test immune cells prior to administration of the molecule
- the method comprises administering the multispecific antigen-binding molecule prior to the detecting. In some embodiments, the method comprises administering a multispecific antigen-binding molecule to the patient or population of patients in whom the occurrence of a biological effect has been determined. In some embodiments, control PD-1 expression level is approximately the median or average expression level of PD-1 by immune cells of the same histological type in a population of subjects who have not been diagnosed as having a cancer.
- control PD-1 expression level is approximately the median or average expression level of PD-1 by immune cells of the same histological type in a population of subjects who have not been administered a multispecific antigen-binding molecule described herein and/or an agent that binds to and/or inhibits PD-1.
- the disclosure features a method for reducing the expression of PD-1 by one or more immune cells in a subject (e.g., a cancer patient), the method comprising administering a multispecific antigen-binding molecule described herein to a subject to thereby reduce the expression of PD-1 by one or more immune cells in the subject.
- the method comprises determining whether a reduction in PD-1 expression by one or more immune cells in the patient has occurred.
- the method comprises obtaining from the subject a biological sample (e.g., a tumor biopsy) comprising one or more immune cells (e.g., after administration of the molecule to the subject).
- the method comprises measuring the level of PD-1 expression by one or more immune cells in the biological sample.
- the disclosure features a method for inhibiting binding between PD-L1 and CD80 in a subject (e.g., a cancer patient), the method comprising administering a multispecific antigen-binding molecule described herein to a subject to thereby inhibit binding between PD-L1 and CD80 in the subject.
- Figure 1 shows the induction of interferon-gamma (IFNy) in a mixed lymphocyte reaction (MLR) assaytreated with various antibody cocktails or bispecific antibodies including a PembrolizumabxAtezolizumab bispecific, aNivolumabxAtezolizumab bispecific, a cocktail of KEYTRUDA and Atezolizumab, and a cocktail of Nivolumab and
- Atezolizumab as compared to KEYTRUDA alone.
- the results show the concentration of IFNy as pg/mL at the final concentrations of antibodies tested, as indicated.
- FIG. 2 shows the induction of interferon-gamma (IFNy) in mixed lymphocyte reaction (MLR) assaytreated with various monoclonal and bispecific antibodies including a PembrolizumabxNivolumab bispecific, AtezolizumabxAtezolizumab tetravalent fusion, Nivolumab, and Atezolizumab, as compared to KEYTRUDA alone.
- IFNy interferon-gamma
- MLR mixed lymphocyte reaction
- Figure 3 shows a schematic and amino acid sequence for a
- Pembrolizumab_aglyco-IgGl-(G4S)4 heavy chain (H chain; SEQ ID NO: 104) and light chain (L chain; SEQ ID NO: 105)
- Atezolizumab_ FabH-(G4S)4 heavy chain H chain; SEQ ID NO: 106
- L chain L chain; SEQ ID NO: 107
- Figure 4 shows a schematic and amino acid sequence for a NivolumabxAtezolizumab bispecific. Separate sequences are given for the Nivolumab aglyco-IgGl-(G4S)4 heavy chain (H chain; SEQ ID NO: 108) and light chain (L chain; SEQ ID NO: 109) and for the
- Figure 5 shows a schematic and amino acid sequence for a 949 aglyco- IgGlxAtezolizumab bispecific. Separate sequences are given for the 949_aglyco-IgGl- (648)4 heavy chain (H chain; SEQ ID NO: 110) and light chain (L chain; SEQ ID NO: 111) and for the Atezolizumab_ FabH -(G4S)4 heavy chain (H chain; SEQ ID NO: 106) and light chain (L chain; SEQ ID NO: 107).
- Figure 6 shows a schematic and amino acid sequence for an Atezolizumab xNivolumab bispecific. Separate sequences are given for the Atezolizumab aglyco-IgGl - (G4S)4 heavy chain (H chain; SEQ ID NO: 112) and light chain (L chain; SEQ ID NO: 107) and Nivolumab_HC Fab-(G4S)4 heavy chain (H chain; SEQ ID NO: 113) and light chain (L chain; SEQ ID NO: 109).
- Figure 7 shows IFN ⁇ y release, in pg/mL, in a mixed lymphocyte reaction (MLR) assay as a function of antibodies tested at various concentrations (right panel).
- MLR mixed lymphocyte reaction
- Figure 8 shows an example of a workflow for identifying multispecific (e.g. , bispecific) antibodies that demonstrate synergy.
- the process includes an unbiased screen of checkpoint blocker combinations in a mixed lymphocyte reaction (MLR) assay, which measures IFN-g release, in pg/mL, at various concentrations.
- MLR mixed lymphocyte reaction
- common light chain bispecifics were generated to further test their efficacy; here, various bispecific formats are depicted.
- the identified bispecific formats outperform known PD-1 blockers in a T-cell activation assay.
- Figures 9A-9B show that Bispecific 3 induced higher killing of K562-CD32-PDL1 target cells (Figure 9A) and increased IFNy production (Figure 9B) by CD3/CD28 expanded T-cells in an antigen non-specific T cell assay, as compared to both an isotype control antibody and KEYTRUDA. This increased killing by Bispecific 3 was seen even at low concentrations of 0.01 nM.
- Figures 10A-10B show an effect of Bispecific 3 on tumor cell killing.
- Figure 10A shows that Bispecific 3 increased the specific killing of K562-A2-CMV-PDL1 tumor antigen target cells by CMV specific T-cells at low concentrations of 0.001 through 0.01 nM, as compared to both KEYTRUDA and the combination of mAbl and mAb28, indicating that Bispecific 3 can be used to mediate antigen-specific killing of target cells at lower doses.
- FIG. 10B shows that Bispecific 3 was more effective than either KEYTRUDA or the combination of mAbl and mAb28 in the specific killing of Raji-A2-CMV-PDL1 cell tumor antigen target cells by CMV specific T-cells at low concentrations of 0.001 nM, again indicating that Bispecific 3 can be used to mediate antigen-specific killing of target cells at lower doses.
- FIG 11 shows that Bispecific 3 induced more IL-2 than KEYTRUDA at all tested doses in an SEA stimulation assay. Importantly, Bispecific 3 induced increased IL-2 production starting at lower concentrations of antibody as compared to both KEYTRUDA and mAbl and mAb28.
- Figures 12A-12G demonstrate that Bispecific 3 has a unique ability to cause the internalization and subsequent degradation or loss of expression of PD- 1, and that this property is dependent on engagement of both the PD-1 and PD-L1 targeting arms of the molecule.
- Figures 12A-12B demonstrate that only Bispecific 3 results in internalization and subsequent degradation or loss of expression of PD-1 , when compared to isotype control, KEYTRUDA, mAbl and mAb28, Atezolizumab, or Atezolizumab and KEYTRUDA.
- Bispecific 5 was made having a first N- terminal Fab binding PD-L1 based on the VH and VL sequences of mAbl and having a second N-terminal Fab binding PD-1 based on the VH and VL sequences of mAb28.
- Bispecific 5 has one monovalent arm binding PD-L1 and one monovalent arm binding PD-1, as compared to Bispecific 3, which has bivalent arms binding PD-L1 and bivalent arms binding PD-1.
- loss of PD-1 expression starts to occur at higher doses of Bispecific 5 (bivalent) versus Bispecific 3 (tetravalent), suggesting that the increased valency of
- Bispecific 3 is responsible for this difference.
- Figure 12F demonstrates that pretreatment with Batimastat, a broad-spectrum inhibitor of multiple MMPs and ADAMs, sheddases or proteases responsible for cleaving proteins off the plasma membrane of cells, greatly reduces the amount of cell-associated PD-1 loss, suggesting that PD-1 loss or shedding is due to cleavage by an MMP or ADAM protease.
- Figure 12G suggests that Bispecific 3 drives loss of cell-surface PD-1 expression primarily when it binds to PD-1 and PD-L1 that are in the trans configuration, i.e., are being expressed by different cells.
- Figures 13A-13B shows in vivo results using Bispecific 3.
- Figure 13A depicts a schematic of the experimental protocol.
- Figure 13B demonstrates that both Bispecific 3 and the combination rtiAb 1 and mAb28 groups had significant delays in tumor growth as compared to both the isotype and KEYTRUDA groups.
- Bispecific 3 the group treated with a combination of mAbl and mAb28, with Bispecific 3 causing a greater delay in tumor growth as compared to the combination.
- the No T cell transfer group had tumors that grew more aggressively than any group containing T cells.
- KEYTRUDA gave no benefit in delaying KACP tumor growth as compared to the isotype control.
- Figures 14A-14B shows in vivo results using Bispecific 3 in a K562-A2-CMV-PD- L1 tumor mouse model.
- Figures 14A and 14B are graphs illustrating that, while each of the different treatment groups resulted in a delay in average tumor growth as compared to untreated mice, treatment with T cells and Bispecific 3 resulted in the greatest delay in average tumor growth over time.
- the No T cell transfer group had tumors that grew more aggressively than any group containing T cells.
- KEYTRUDA gave no benefit in delaying K562-A2-CMV -PD-L 1 tumor growth as compared to the isotype control.
- Figures 15A-15B illustrate in vivo results using Bispecific 3 in several syngeneic tumor models.
- Figure 15A is a graph showing that treatment of an EMT-6 syngeneic tumor model with Bispecific 3 resulted in a greater delay in tumor growth as compared to the control treatment.
- Figure 15B is a graph showing that treatment of an MB49 syngeneic tumor model with Bispecific 3 resulted in a greater delay in tumor growth as compared to the control treatment.
- Figures 16A-16B show in vivo results using Bispecific 1 in an MC38-hPD-Ll model in humanized PD-1/PD-L1 transgenic mice.
- Figure 16A shows that both KEYTRUDA and Bispecific 1 treatment effectively controlled tumor growth in the MC38-hPD-Ll tumor mice as compared to control-treated mice.
- Figure 16B is a survival graph and illustrates that Bispecific 1 increased the survival of MC38-PD-L1 tumor mice as compared to control- treated mice.
- Figures 17A-17F illustrate in vivo results using Bispecific 3 in a B16F10-hPD-Ll model.
- Figure 17A shows individual tumor volume traces for each group. Metastases were identified in multiple mice that died prior to the tumor-sizing cutoff.
- Figure 17B shows differences in mean tumor volume across treatment groups, demonstrating that by 15 days after tumor cell inoculation, Bispecific 3 treatment delayed average tumor growth significantly longer than any of the other treatments tested in B16F10-HuPD-Ll mice. ⁇ ***, P ⁇ 0.0001; **, P ⁇ 0.01, *, P ⁇ 0.05, Two-way ANOVA and Tukey's multiple comparisons test.
- Figure 17B is a graph comparing the effect of different treatments on tumor volume measured at a 15 -day cutoff in B16F10-HuPD-Ll mice.
- FIG. 17E is a survival graph and illustrates that treatment with Bispecific 3 increased the survival of B16F10-HuPD-Ll tumor mice as compared to survival with any of the other treatments tested.
- Figure 17F provides a Table showing the number of tumor-free mice for each of the different treatment groups. The group treated with Bispecific 3 had 3 mice that were tumor-free, while the combination of KEYTRUDA and avelumab had 1 mouse that was tumor-free.
- FIGs 18A-18D demonstrate that Bispecific 3 has drug-like properties (DLP’s) similar to a well-behaved monoclonal antibody and maintains parental PD-1 and PD-L1 binding.
- Figure 18A shows that Bispecific 3 shows similar binding to CHO cells expressing human PD-1 as parental clone mAb28 (top) and to CHO cells expressing human PD-L1 as parental clone mAbl (bottom).
- Figure 18B shows that Bispecific 3 shows similar binding to CHO cells expressing cynomolgus PD-1 as parental clone mAb28 (top) and to CHO cells expressing cynomolgus PD-L1 as parental clone mAbl (bottom).
- FIG 18C show's that Bispecific 3 shows similar binding to CHO cells expressing mouse PD-1 as parental clone mAb28 (top) and to CHO cells expressing mouse PD-L1 as parental clone mAbl (bottom).
- Figure 18D shows a size-exclusion chromatography trace of Bispecific 3 after Protein A chromatography (top) demonstrating a single peak with greater than 98% purity and a differential scanning fluorimetry (DSF) trace of Bispecific 3 (bottom) demonstrating that the molecule has high thermal stability.
- DSF differential scanning fluorimetry
- the term“about” is used to modify, for example, the quantity of an ingredient in a composition, concentration, volume, process temperature, process time, yield, flow rate, pressure, and like values, and ranges thereof, employed in describing the embodiments of the disclosure.
- the term“about” refers to variation in the numerical quantity that can occur, for example, through typical measuring and handling procedures used for making compounds, compositions, concentrates or use formulations; through inadvertent error in these procedures; through differences in the manufacture, source, or purity of starting materials or ingredients used to carry out the methods, and like proximate considerations.
- the terms“specific binding,”“specifically binds to,”“specific for,”“selectively binds,” and“selective for” a particular antigen (e.g. , a polypeptide target) or an epitope on a particular antigen mean binding that is measurably different from a non-specific or non- selective interaction.
- Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule.
- Specific binding can also be determined by competition with a control molecule that is similar to the target, such as an excess of non-labeled target. In that case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by the excess non-labeled target.
- epitope means a component of an antigen capable of specific binding to an antigen-binding protein.
- Epitopes frequently consist of surface-accessible ammo acid residues and/or sugar side chains and can have specific three-dimensional structural characteristics, as well as specific charge characteristics. Conformational and non- conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
- An epitope can comprise amino acid residues that are directly involved in the binding, and other amino acid residues, which are not directly involved in the binding.
- the epitope to which an antigen-binding protein binds can be determined using known techniques for epitope determination such as, for example, testing for antigen-binding protein binding to antigen variants with different point-mutations.
- Percent“identity” between a polypeptide sequence and a reference sequence is defined as the percentage of amino acid residues in the polypeptide sequence that are identical to the amino acid residues in the reference sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. Alignment for purposes of determining percent amino acid sequence identify can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, MEGALIGN (DNASTAR), CLUSTALW, or CLUSTAL OMEGA software. In some embodiments, alignment is performed using the CLUSTAL OMEGA software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- any of the multispecific antigen-binding constructs or methods disclosed herein has the ability to achieve a specified property in the appropriate context (as would be understood by the skilled worker), but is not required to be associated with that property at any particular moment in time.
- any of the multispecific antigen-binding constructs disclosed herein may be capable of binding PD-1 and/or PD-L1 when administered to cells expressing PD-1 and/or PD-L1 , but the constructs would not be expected to bind PD-1 and/or PD-L1 when the constructs are in a composition devoid of PD-1 or PD-L1 protein.
- A“conservative substitution” or a“conservative amino acid substitution,” refers to the substitution of one or more amino acids with one or more chemically or functionally similar ammo acids. Conservative substitution tables providing similar amino acids are well known in the art. Polypeptide sequences having such substitutions are known as “conservatively modified variants,” or“variants.” Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles. Some examples of conservative substitutions can be found, for example, in Creighton,
- a polypeptide disclosed herein can comprise an amino acid sequence which is not naturally occurring. Such variants necessarily have less than 100% sequence identify or similarity with the starting molecule. In certain embodiments, the variant will have an amino acid sequence from about 75% to less than 100% amino acid sequence identity or similarity with the amino acid sequence of the starting (e.g. , naturally-occurring or wild-type) polypeptide, more preferably from about 80% to less than 100%, more preferably from about 85% to less than 100%, more preferably from about 90% to less than 100% (e.g, 91%, 92%,
- an“antibody,” as used herein, can refer to an intact antibody (e.g. , an intact immunoglobulin) and antibody portion, for example, an antigen-binding portion.
- Antigen- binding portions comprise at least one antigen-binding domain.
- an antigenbinding domain is an antigen-binding domain formed by a VH-VL dimer.
- Antibodies and antigen-binding portions can be described by the antigen to which they specifically bind.
- a PD-L1 antibody, or anti -PD -LI antibody is an antibody that specifically binds to PD-L1.
- the VH and VL regions can be further subdivided into regions of hypervariability (hypervariable regions (HVRs), also called complementarity determining regions (CDRs)) interspersed with regions that are more conserved.
- the more conserved regions are called framework regions (FRs).
- Each VH and VL generally comprises three CDRs and four FRs, arranged in the following order (from N-terminus to C-terminus): FR1 - CDR1 - FR2 - CDR2 - FRS - CDRS - FR4.
- the CDRs are involved in antigen-binding, and confer antigen specificity and binding affinity to the antibody.
- CDRs are involved in antigen binding and confer antigen specificity and binding affinity to the antibody.
- CDR1, CDR2 and CDRS are designated CDR1, CDR2 and CDRS, for each of the variable domains.
- the term“CDR set’' as used herein refers to a group of three CDRs that occur in a single heavy or light chain variable domain capable of binding a target antigen.
- CDRHl The three heavy chain CDRs can be referred to as CDRHl, CDRH2, and CDRHS, and the three light chain CDRs can be referred to as CDRL1, CDRL2, and CDRL3.
- Rabat also referred to as‘"numbered according to Rabat,” “Rabat numbering,”“Rabat definitions,” and“Rabat labeling,” provides an unambiguous residue numbering system applicable to any variable domain of an antibody, and provides precise residue boundaries defining the three CDRs of each chain.
- CDRs are referred to as Rabat CDRs and comprise about residues 24-34 (CDR1), 50-56 (CDR2) and 89-97 (CDR3) in the light chain variable domain, and 31-35 (CDR1), 50-65 (CDR2) and 95-
- CDR3 CDR3 in the heavy chain variable domain.
- the light chain FR residues are positioned at about residues 1-23 (LCFR1), 35-49 (LCFR2), 57-88 (LCFR3), and 98-107 (LCFR4) and the heavy chain FR residues are positioned about at residues 1-30 (HCFRl), 36-49 (HCFR2), 66-94 (HCFR3), and 103-113 (HCFR4) in the heavy chain residues.
- The“EU index as in Rabat” refers to the residue numbering of the human IgGl EU antibody.
- CDRs can be referred to as“Chothia CDRs,”“Chothia numbering,” or “numbered according to Chothia,” and comprise about residues 24-34 (CDR1), 50-56 (CDR2) and 89-97 (CDR3) in the light chain variable domain, and 26-32 (CDR1), 52-56 (CDR2) and 95-102 (CDR3) in the heavy chain variable domain.
- CDR1 residues 24-34
- CDR2 50-56
- CDR3 89-97
- CDR3 26-32
- CDR1, 52-56 (CDR2) and 95-102 (CDR3) in the heavy chain variable domain.
- MacCallum also referred to as“numbered according to MacCallum,” or“MacCallum numbering ⁇ ” comprises about residues 30-36 (CDR1), 46-55 (CDR2) and 89-96 (CDR3) in the light chain variable domain, and 30-35 (CDR1), 47-58
- CDR2 CDR2
- CDR3 93-101
- AbM The system described by AbM, also referred to as“numbering according to AbM,” or “AbM numbering” comprises about residues 24-34 (CDR1), 50-56 (CDR2) and 89-97 (CDR3) in the light chain variable domain, and 26-35 (CDR1), 50-58 (CDR2) and 95-102 (CDR3) in the heavy chain variable domain.
- IMGT INTERNATIONAL IMMUN OGENETIC S INFORMATION SYSTEM
- numbering of variable regions can also be used, which is the numbering of the residues in an immunoglobulin variable heavy or light chain according to the methods of the IIMGT, as described in Lefranc, M.-P., "The IMGT unique numbering for immunoglobulins, T cell Receptors and Ig-like domains", The Immunologist, 7, 132-136 (1999), and is expressly incorporated herein in its entirety by reference.
- IMGT sequence numbering or“numbered according to IMTG,” refers to numbering of the sequence encoding a variable region according to the IMGT.
- the hypervariable region ranges from amino acid positions 27 to 38 for CDR1, amino acid positions 56 to 65 for CDR2, and amino acid positions 105 to 117 for CDR3.
- the hypervariable region ranges from amino acid positions 27 to 38 for CDR1, amino acid positions 56 to 65 for CDR2, and amino acid positions 105 to 117 for CDR3.
- the CDRs recited herein comprise about residues 24-34 (CDR1), 49-56 (CDR2) and 89-97 (CDR3) in the light chain variable domain, and 27-35 (CDR1), 49-60 (CDR2) and 93-102 (CDR3) in the heavy chain variable domain, when numbered according to Chothia numbering.
- CDR2 in the light chain variable domain can comprise amino acids 49-56, when numbered according to Chothia numbering.
- the immune system has the capability of recognizing and eliminating tumor cells; however, tumors can use multiple strategies to evade immunity.
- Recent studies have shown that inhibitory immune checkpoint molecules promote cancer progression through various antitumor inhibitory mechanisms. Blockade of immune checkpoints is one of the approaches to activating or reactivating therapeutic antitumor immunity.
- Various ligands have been described for a number of cognate inhibitory immune checkpoint receptors. Reviewed in, e.g., Nair & Elkord, Immunology & Cell Biology (2016), 96:21-33; and Jenkins et al., British J. of Cancer (2017), 118:9-16.
- the Programmed Death 1 (PD-1) protein is an inhibitory member of the extended CD28/CTLA-4 family of T cell regulators (Okazaki et al. (2002) Curr Opin Immunol 14: 391779-82; Bennett et al. (2003) J. Immunol. 170:711-8).
- Other members of the CD28 family include CD28, CTLA-4, ICOS and BTLA.
- PD-1 is suggested to exist as a monomer, lacking the unpaired cysteine residue characteristic of other CD28 family members. PD-1 is expressed on activated B cells, T cells, and monocytes.
- the PD-1 gene encodes a 55 kDa type I transmembrane protein (Agata et al. (1996) Int Immunol. 8:765-72). Although structurally similar to CTLA-4, PD-1 lacks the MYPPY motif that is important for B7-1 and B7-2 binding.
- Two ligands for PD-1 have been identified, PD-L1 (B7-H1) and PD-L2 (B7-DC), that have been shown to downregulate T cell activation upon binding to PD-1 (Freeman et al. (2000) J. Exp. Med. 192: 1027-34; Carter et al. (2002) Eur. J. Immunol. 32:634-43).
- Both PD-L1 and PD-L2 are B7 homologs that bind to PD-1, but do not bind to other CD28 family members.
- PD-L1 is abundant in a variety of human cancers (Dong et al. (2002) Nat. Med. 8:787-9).
- PD-1 is known as an immunoinhibitory protein that negatively regulates TCR signals (Ishida, Y. et al. (1992) EMBO J. 11:3887-3895; Blank, C. et al. (Epub 2006 Dec. 29) Immunol. Immunother. 56(5):739-745).
- the interaction between PD-1 and PD-L1 can act as an immune checkpoint, which can lead to, e.g., a decrease in tumor infiltrating lymphocytes, a decrease in T-cell receptor mediated proliferation, and/or immune evasion by cancerous cells (Dong et al. (2003) J. Mol. Med. 81:281-7; Blank et al. (2005) Cancer Immunol.
- Immune suppression can be reversed by inhibiting the local interaction of PD-1 with PD-L1 or PD-L2; the effect is additive when the interaction of PD-1 with PD-L2 is blocked as well (Iwai et al. (2002) Proc. Nat'l. Acad. Sci. USA 99: 12293-7; Brown et al. (2003) J Immunol. 170: 1257-
- PD-L1 also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7- H1 ), is a 40kDa type 1 transmembrane protein that plays a role in suppressing the immune system during particular events such as pregnancy, tissue allografts, autoimmune disease and other disease states such as hepatitis.
- human PD-L1 comprises the amino acid sequence of SEQ ID NO: 115 (UniProt Q9NZQ7). Normally the immune system reacts to foreign antigens that are associated with exogenous or endogenous danger signals, which triggers a proliferation of antigen-specific CD8+ T cells and/or CD4+ helper cells.
- PD-L1 expressed on cancer cells binds to its ligand PD-1 on immune effector cells, for example, T cells.
- the binding of PD-L1 to PD-1 transmits an inhibitory signal that reduces the proliferation of antigen-specific T-cells in lymph nodes, while simultaneously reducing apoptosis in regulatory T cells (anti-inflammatory, suppressive T cells).
- the PD- 1/PD-Ll interaction also induces apoptosis of tumor-specific T cells, promotes the differentiation of CD4 1 T cells into Foxp3 + regulatory T cells, and promotes resistance of tumor cells to cytotoxic T lymphocyte (CTL) attack, thus allowing tumors to evade the host immune system.
- CTL cytotoxic T lymphocyte
- PD-1 and its ligand e.g., PD-L1 and/or PD-L2
- novel multispecific and multivalent constructs such as a bispecific and tetravalent construct, that block the interaction between PD-1 and its ligand (e.g., PD-1 and/or PD-L2) while promoting the interaction of (bridging) the cells on which PD-1 and its ligand are expressed.
- compositions of the present disclosure with the capacity to‘3 ⁇ 4lock and bridge” have increased potency in vitro and in vivo and strongly enhance, for example, T cell proliferation, IRNg production and/or secretion, the cytolytic activity of T cells, and/or rescue T cells from functional exhaustion, to provide superior anti-tumor efficacy (a biological effect which can be manifested by various means, including, but not limited to, e.g. , a decrease in tumor volume, a decrease in the number of tumor cells, a decrease in tumor cell proliferation, and/or a decrease in tumor cell survival), as compared to combinations of individual antibodies, as well as compared to clinical checkpoint blockade agents.
- novel monoclonal anti-PD-1 antibodies and antigen-binding fragments thereof and novel monoclonal anti-PD-Ll antibodies and antigen-binding fragments thereof, for use in such multispecific and multivalent constructs.
- Some of these novel monoclonal anti-PD-1 antibodies and novel monoclonal anti-PD-L 1 antibodies share a common light chain, thereby allowing for the generation of multispecific and multivalent constructs having excellent drug-like properties and manufacturability, as well as affinities similar to their parental antibodies.
- the disclosure provides a multispecific antigen-binding construct comprising at least two antigen-binding arms or units of antigen-binding, wherein a first arm or unit of antigen-binding binds PD-1 expressed by an immune cell, and a second arm or unit of antigen-binding binds one or more PD-1 ligands (e.g., PD-L1 and/or PD-L2) which is expressed by a second cell.
- the multispecific antigen-binding construct blocks the interaction of PD-1 and its ligand.
- the multispecific antigen-binding construct bridges the cells on which PD-1 and its ligand are expressed to promote the interaction and/or efficacy of the immune cell that expresses PD-1.
- at least one of the antigen-binding arms is bivalent for PD-1.
- at least one of the antigen-binding arms is bivalent for PD-L1.
- at least one of the antigen-binding arms is bivalent for PD-1, and at least one of the antigen-binding arms is bivalent for PD-L1.
- the multispecific antigen-binding construct comprises at least two units of antigen-binding that bind PD-1.
- the multispecific antigen-binding construct comprises two units of antigen-binding that bind PD-1. In some embodiments, the multispecific antigen-binding construct comprises at least two units of antigen-binding that bind a PD- 1 ligand, such as PD- L1 or PD-L2. In some embodiments, the multispecific antigen-binding construct comprises two units of antigen-binding that bind a PD-1 ligand, such as PD-L1 or PD-L2.
- the multispecific antigen-binding construct comprises at least four units of antigen-binding, wherein two units of antigen-binding bind PD-1 and two units of antigen- binding bind a PD-1 ligand, such as PD-L1 or PD-L2. In some embodiments, the
- the multispecific antigen-binding construct comprises four units of antigen-binding, wherein two units of antigen-binding bind PD-1 and two units of antigen-binding bind a PD-1 ligand, such as PD-L1 or PD-L2.
- the construct is a bispecific antibody.
- the bispecific antibody is an antagonist of both PD-1 and PD-1 ligand.
- the construct comprises a common light chain.
- one or both of the antigen-binding arms is an aptamer.
- one or both of the antigen-binding arms is a protein other than an antibody.
- the construct comprises at least two antibodies.
- At least one of the antigen-binding arms is a bivalent antibody specific for PD-1. In some embodiments, at least one of the antigen-binding arms is a bivalent antibody specific for PD-L1. In some embodiments, at least one of the antigen-binding arms is a bivalent antibody specific for PD-1, and at least one of the antigen-binding arms is a bivalent antibody specific for PD-L1 , such that the construct is tetravalent. In some embodiments, the bispecific antibody binds two different epitopes on PD-1. In some embodiments, the bispecific antibody binds two different epitopes on the PD-1 ligand.
- novel isolated antibodies and antigen-binding portions thereof that specifically bind PD-L1 or PD-1.
- these novel isolated antibodies and antigen-binding portions thereof such as CDRs, variable heavy chains, and/or variable light chains, that specifically bind PD-L1 or PD-1 can be used in one or more arms or units of antigen-binding of the multispecific antigen-binding constructs described herein.
- the disclosed multispecific antigen-binding constructs include bispecific, trispecific, tetraspecific, or multispecific antibodies or antigenbinding portions thereof.
- the described multispecific constructs are preferably bivalent for at least one, preferably both, antigen-binding arm(s), r. e. , are bispecific and bivalent, or bispecific and tetravalent molecules.
- the multispecific constructs described herein can, in various aspects and embodiments, comprise one or more antibodies and/or antigen-binding portions thereof.
- an antigen-binding arm can comprise a variable heavy and/or variable light chain, or complementarity determining regions (CDRs) thereof, of a given antibody to PD- 1 and/or a given antibody to PD-L 1.
- CDRs complementarity determining regions
- the first antigen-binding arm, second antigen-binding arm, first unit of antigen-binding, second unit of binding, or any combination thereof can comprise an antibody or an antigen-binding portion thereof.
- the first antigen-binding arm, second antigen-binding arm, first unit of antigen-binding, second unit of binding, or any combination thereof is an antibody or an antigen-binding portion thereof.
- the disclosure provides for anti -PD -LI antagonists.
- the anti-PD-Ll antagonist is any of the anti-PD-Ll antibodies or antigen-binding molecules disclosed herein.
- the anti-PD-Ll antibody or antigen-binding molecule is not a part of a multispecific antigen-binding construct, i.e., the anti-PD-Ll antibody or antigen-binding molecule is not a part of a protein construct that binds to multiple epitopes.
- the anti-PD-Ll antibody or antigenbinding portion can be combined with a different antibody or antigen-binding portion to form a multispecific antigen-binding construct.
- the multispecific antigenbinding construct is capable of binding an epitope on PD-L1 and an epitope on another protein.
- the epitope on the other protein is on PD-1.
- the antibody or antigenbinding portion thereof that specifically binds PD-L1 comprises (a) a heavy chain variable region comprising (i) a CDRH1 comprising SEQ ID NO: 1 (GTFSSYAIN); (ii) a CDRH2 comprising SEQ ID NO: 2 (GGHPX1X2GX3ATYA, wherein Xi is V or I; X2 is F, L, or V; and Xa is T or A); and (iii) a CDRH3 comprising SEQ ID NO: 3 (ARLKXiELKDAFDI, wherein Xi is G, F, or N); and (b) a light chain variable region comprising: (i) a CDRL1 comprising SEQ ID NO: 4 (RASQXiISSYLN, wherein Xi is S, W, or Q); (ii) a CDRL2
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 7
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 7 (GGIIPILGAATYA)
- CDRH3 comprises SEQ ID NO: 8 (ARLKGELKDAFDI)
- CDRL1 comprises SEQ ID NO: 9 (RASQSISSYLN)
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS);
- CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and tight chain variable CDR regions is mAbl .
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 11
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 11 (GGIIPVFGTATYA)
- CDRH3 comprises SEQ ID NO: 8 (ARLKGELKDAFDI); CDRL1 comprises SEQ ID NO:
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 11 (GGIIPVFGTATYA)
- CDRH3 comprises SEQ ID NO: 8 (ARLKGELKDAFDI)
- CDRL1 comprises SEQ ID NO: 13 (RASQQISSYLN); CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 11
- CDRH3 comprises SEQ ID NO: 8 (ARLKGELKDAFDI); CDRL1 comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 comprises SEQ ID NO: 5
- a representative antibody having such heavy and light chain variable CDR regions is mAb4.
- Another representative antibody having such heavy and light chain variable CDR regions is mAb24.
- CDRH1 comprises SEQ ID NO: 14 (GTFSSYAFS)
- CDRH2 comprises SEQ ID NO: 11
- CDRH3 comprises SEQ ID NO: 8 (ARLKGELKDAFDI).
- CDRHl comprises SEQ ID NO: 14 (GTFSSYAFS)
- CDRH2 comprises SEQ ID NO: 11 (GGUPVFGTATYA)
- CDRH3 comprises SEQ ID NO: 8 (ARLKGELKDAFDI); CDRL1 comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAb5.
- CDRHl comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 15
- CDRHl comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 15 (GGUPIFGIANYA)
- CDRH3 comprises SEQ ID NO: 8 (ARLKGELKDAFDI)
- CDRL1 comprises SEQ ID NO: 9
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and tight chain variable CDR regions is mAb6.
- CDRHl comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 16
- CDRH3 comprises SEQ ID NO: 17 (ARLKGELKGAGDI) .
- SEQ ID NO: 1 GTFSSYAIN
- CDRH2 comprises SEQ ID NO: 16 (GGIIPNFGTATYA)
- CDRH3 comprises SEQ ID NO: 17 (ARLKGELKGAGDI)
- CDRL1 comprises SEQ ID NO: 9 (RASQSISSYLN)
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS)
- CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAb7.
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 11
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 11 (GGUPVFGTATYA)
- CDRH3 comprises SEQ ID NO: 18 (ARLKFELKDAFDI)
- CDRL1 comprises SEQ ID NO: 9 (RASQSISSYLN)
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS);
- CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAb8.
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 11
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 11 (GGIIPVFGTATY A)
- CDRH3 comprises SEQ ID NO: 19 (ARLKGELKDAFDE)
- CDRLl comprises SEQ ID NO: 9 (RASQSISSYLN)
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS);
- CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAb9.
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 11
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 11 (GGUPVFGTATYA)
- CDRH3 comprises SEQ ID NO: 20 (ARLKNELKDAFDI)
- CDRLl comprises SEQ ID NO:
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAblO.
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 21
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 21 (GGVIPFLGTANYA)
- CDRH3 comprises SEQ ID NO: 22 (ARLKGILKDALDI)
- CDRLl comprises SEQ ID NO: 9 (RASQSISSYLN)
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS);
- CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAbl 1.
- CDRH1 comprises SEQ ID NO: 23 (GTFSSYAIS)
- CDRH2 comprises SEQ ID NO: 24
- CDRH3 comprises SEQ ID NO: 8 ( ARLKGELKDAFDI) .
- CDRH1 comprises SEQ ID NO: 23 (GTFSSYAIS)
- CDRH2 comprises SEQ ID NO: 24 (GGIIPIVGIANY A)
- CDRH3 comprises SEQ ID NO: 8 (ARLKGELKDAFDI), CDRLl comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and tight chain variable CDR regions is mAbl 2.
- CDRH1 comprises SEQ ID NO: 23 (GTFSSYAIS)
- CDRH2 comprises SEQ ID NO: 11
- CDRH1 comprises SEQ ID NO: 23 (GTFSSYAIS)
- CDRH2 comprises SEQ ID NO: 11 (GGIIPVFGTATYA)
- CDRH3 comprises SEQ ID NO: 25 (ARLKGEFKDAFDl)
- CDRLl comprises SEQ ID NO:
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and tight chain variable CDR regions is mAbl 3.
- CDRH1 comprises SEQ ID NO: 23 (GTFSSYAIS)
- CDRH2 comprises SEQ ID NO: 26
- CDRH1 comprises SEQ ID NO: 23 (GTFSSYAIS)
- CDRH2 comprises SEQ ID NO: 26 (GRIIPLFGTAHYA)
- CDRH3 comprises SEQ ID NO: 8 (ARLKGELKDAFDI)
- CDRLl comprises SEQ ID NO: 9 (RASQSISSYLN)
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS);
- CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and tight chain variable CDR regions is mAbl 4.
- CDRH1 comprises SEQ ID NO: 23 (GTFSSYAIS)
- CDRH2 comprises SEQ ID NO: 27 (GRINPILGTANYA)
- CDRH3 comprises SEQ ID NO: 28 (ARLKGELKDAFSI).
- CDRH1 comprises SEQ ID NO: 23 (GTFSSYAIS)
- CDRH2 comprises SEQ ID NO: 27 (GRINPILGTANYA)
- CDRH3 comprises SEQ ID NO: 28 (ARLKGELKDAFSI)
- CDRL1 comprises SEQ ID NO: 9 (RASQSISSYLN)
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS);
- CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAbl5.
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 29
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 29 (GRIIPIFGTADYA)
- CDRH3 comprises SEQ ID NO: 8 (ARLKGELKDAFDI)
- CDRL1 comprises SEQ ID NO: 9 (RASQSISSYLN)
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS);
- CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAbl6.
- CDRH1 comprises SEQ ID NO: 23 (GTFSSYAIS)
- CDRH2 comprises SEQ ID NO: 11
- CDRH1 comprises SEQ ID NO: 23 (GTFSSYAIS)
- CDRH2 comprises SEQ ID NO: 11 (GGIIPVFGTATYA)
- CDRH3 comprises SEQ ID NO: 30 (ARLKGELKCAFDI)
- CDRLl comprises SEQ ID NO:
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- CDRH1 comprises SEQ ID NO: 122 (GTKSSYAIS)
- CDRH2 comprises SEQ ID NO: 11
- CDRH1 comprises SEQ ID NO: 122 (GTKSSYAIS)
- CDRH2 comprises SEQ ID NO: 11 (GGIIPVFGTATYA)
- CDRH3 comprises SEQ ID NO: 30 (ARLKGELKCAFDI)
- CDRLl comprises SEQ ID NO:
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 31
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 31 (GGIIPILGTATYA)
- CDRH3 comprises SEQ ID NO: 32 (ARRKGELKDAFDI)
- CDRL1 comprises SEQ ID NO:
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAbl 8.
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 33
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 33 (GGIIPIVATANYA)
- CDRH3 comprises SEQ ID NO: 32 (ARRKGELKDAFDI)
- CDRL1 comprises SEQ ID NO:
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAbl 9.
- CDRHl comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 34
- CDRHl comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 34 (GGIIPIFGKATYA)
- CDRH3 comprises SEQ ID NO: 32 (ARRKGELKDAFDI)
- CDRL1 comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises
- SEQ ID NO: 10 QQSYSTPLT.
- a representative antibody having such heavy and light chain variable CDR regions is mAb20.
- CDRHl comprises SEQ ID NO: 36 (GPFRSHAVS)
- CDRH2 comprises SEQ ID NO: 11
- CDRHl comprises SEQ ID NO: 36 (GPFRSHAVS)
- CDRH2 comprises SEQ ID NO: 11 (GGIIPVFGTATYA)
- CDRH3 comprises SEQ ID NO: 37 (ARLKSELKDAFDI)
- CDRL1 comprises SEQ ID NO: 9 (RASQSISSYLN)
- CDRL2 comprises SEQ ID NO: 5 (AASSLQS);
- CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and tight chain variable CDR regions is mAb21.
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 11
- CDRH3 comprises SEQ ID NO: 8 (ARLKGELKDAFDI); CDRL1 comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 comprises SEQ ID NO: 5
- a representative antibody having such heavy and tight chain variable CDR regions is mAb22.
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 11
- CDRH3 comprises SEQ ID NO: 8 (ARLKGELKDAFDI); CDRL1 comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 comprises SEQ ID NO: 5
- a representative antibody having such heavy and tight chain variable CDR regions is mAb23.
- CDRH1 comprises SEQ ID NO: 1 (GTFSSYAIN)
- CDRH2 comprises SEQ ID NO: 11
- CDRH3 comprises SEQ ID NO: 8 (ARLKGELKDAFDI); CDRL1 comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 comprises SEQ ID NO: 5
- a representative antibody having such heavy and tight chain variable CDR regions is mAb24.
- embodiments comprising a sequence having at least 90% (e.g , at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) identity to the recited sequence (e.g., SEQ ID NO: 1-34 and 36-39) are also provided.
- the disclosure also provides, in some aspects, an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising an amino acid sequence that is at least 90% identical (e.g, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO: 35, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, or 58, and alight chain variable region comprising an amino acid sequence that is at least 90% identical (e.g, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO: 59, 60, 61,
- the disclosure also provides, in some aspects, an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising an amino acid sequence that is at least 90% identical (e.g., at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID
- alight chain variable region comprising an amino acid sequence that is at least 90% identical (e.g., at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO: 59.
- the disclosure also provides, in some aspects, an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising an amino acid sequence that is at least 90% identical (e.g., at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO: 35 and a light chain variable region comprising an amino acid sequence that is at least 90% identical (e.g., at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO: 35 and a light chain variable region comprising an amino acid sequence that is at least
- Antibodies mAbl-mAb23 are affinity matured antibodies derived from parent antibody mAb24, as described in the Examples.
- An affinity matured antibody or antigenbinding portion thereof is an antibody or antigen-binding fragment with one or more alterations (e.g, in one or more CDRs or FRs) that result in an improvement in the affinity of an antibody for its antigen, compared to a parent antibody lacking the alteration(s).
- an affinity matured antibody has nanomolar or picomolar affinity for PD-L1.
- the PD-L1 antibody or antigen-binding portion thereof has a KD of at least 1 x 10 7 M, at least 1 x 10 8 M, at least 1 x 10 9 M, at least 1 x 10 10 M, at least 1 x 10 u M, at least 1 x 10 12 M, or at least 1 x 10 13 M.
- Table 1 shows the binding affinities (KD) of mAbl, mAb2, mAb3, mAb4, mAb5, mAb6, mAb7, mAb8, mAb9, mAblO, mAbl 1, mAbl2, mAbl3, mAbl4, mAbl5, mAbl6, mAbl7, mAbl8, mAbl9, mAb20, mAb21, mAb22, and mAb23 (i.e., affinity matured variants of mAb24) to human PD-L1.
- k d (sec '1 ) refers to the dissociation rate constant of a particular antibody-antigen interaction. The value is also referred to as the koff value.
- ka (M -1 x sec 1 ), as used herein, refers to the association rate constant of a particular antibody-antigen interaction. The value is also referred to as the kon value.
- Table 2 provides cell binding data for mAbl, mAb2, mAb3, mAH, mAb5, mAb6, mAb7, mAb8, mAb9, mAblO, mAbl 1, mAb 12, mAbl3, mAb 14, mAbl5, mAbl6, mAb 17, mAb 18, mAbl9, mAb20, mAb21, mAb22, and mAb23 (i.e., affinity matured variants of mAb24) to human PD-L1 ("huPDLl"), cyno PD-L1, or murine PD-L1 ("muPDLl").
- Human or cyno PD-L1 was expressed on HEK cells; murine PD-L1 was expressed on A20 cells. Binding is expressed as an ECso value, which can be estimated from titrating different concentrations of mAb on cells that exogenously express the antigen of interest. Fluorescent tagged secondaries can be used to detect and quantify the mAb binding. The data shown in Table 2 was fit to a 1:1 binding model using built-in functions in GRAPHPAD, which yielded the ECso value. Table 2. Cell binding of mAbl - mAb23 to human, cyno, and murine PD-L1 expressed on cells
- the disclosure also provides an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising an amino acid sequence that is at least 90% identical (for example, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical) to any one of SEQ ID NOs: 35, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, or 58, and a light chain variable region comprising an amino acid sequence that is at least 90% identical (for example, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98% or at least 99% identical) to any one of SEQ ID NO: 59, 60, 61, 62
- the heavy chain variable region comprises an amino acid sequence that differs by 15 amino acids or less, 14 amino acids or less, 13 amino acids or less, 12 amino acids or less, 11 amino acids or less, 10 amino acids or less, 9 amino acids or less, 8 amino acids or less, 7 amino acids or less, 6 amino acids or less, 5 ammo acids or less, 4 amino acids or less, 3 amino acids or less, 2 amino acids or less, or 1 amino acid from any one of SEQ ID NOs: 35, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, or 58.
- the light chain variable region comprises an amino acid sequence that differs by 15 amino acids or less, 14 amino acids or less, 13 amino acids or less, 12 amino acids or less, 11 amino acids or less, 10 amino acids or less, 9 amino acids or less, 8 amino acids or less, 7 amino acids or less, 6 amino acids or less, 5 amino acids or less, 4 amino acids or less, 3 amino acids or less, 2 amino acids or less, or 1 amino acid from any one of SEQ ID NO: 59, 60, 61, 62, or 63.
- Tables 3 and 4 provide the sequences for heavy chain variable sequences SEQ ID Nos: 35 and 40-58, and light chain variable sequences SEQ ID Nos: 59-63, respectively.
- the disclosure also provides, in some embodiments, an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding portion thereof comprises heavy chain CDRs of any of the heavy chain variable regions of SEQ ID NOs: 35, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, or 58, and light chain CDRs of any of the light chain variable regions of SEQ ID NOs: 59, 60, 61, 62, or 63.
- the disclosure also provides, in some embodiments, an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding portion thereof comprises heavy chain CDRs of any of the heavy chain variable regions of SEQ ID NOs: 35, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, or 58, and light chain CDRs of any of the light chain variable regions of SEQ ID NOs: 59, 60, 61, 62, or 63, wherein the heavy and light chain CDR residues are numbered according to Kabat.
- the disclosure also provides, in some embodiments, an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding portion thereof comprises heavy chain CDRs of any of the heavy- chain variable regions of
- the disclosure also provides, in some embodiments, an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding portion thereof comprises heavy chain CDRs of any of the heavy- chain variable regions of SEQ ID NOs: 35, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, or 58, and light chain CDRs of any of the light chain variable regions of SEQ ID NOs: 59, 60, 61, 62, or 63, wherein the heavy and light chain CDR residues are numbered according to
- the disclosure also provides, in some embodiments, an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding portion thereof comprises heavy chain CDRs of any of the heavy- chain variable regions of SEQ ID NOs: 35, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, or 58, and light chain CDRs of any of the light chain variable regions of SEQ ID NOs: 59, 60, 61, 62, or 63, wherein the heavy and light chain CDR residues are numbered according to AbM.
- the disclosure also provides, in some embodiments, an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding portion thereof comprises heavy chain CDRs of any of the heavy chain variable regions of
- the disclosure provides for anti -PD-1 antagonists.
- the anti -PD-1 antagonist is any of the anti -PD-1 antibodies or antigenbinding molecules disclosed herein.
- the anti -PD-1 antibody or antigen-binding molecule is not a part of a multispecific antigen-binding construct, i.e., the anti-PD-1 antibody or antigen-binding molecule is not a part of a protein construct that binds to multiple epitopes.
- the anti -PD -1 antibody or antigen-binding portion can be combined with a different antibody or antigen-binding portion to form a multispecific antigen-binding construct.
- the multispecific antigenbinding construct is capable of binding an epitope on PD-1 and an epitope on another protein. In some embodiments, the epitope on the other protein is on PD-L1.
- any of the multispecific antigen-binding constructs disclosed herein comprises a PD-1 antagonist.
- the PD-1 antagonist is an “inhibitory receptor.”
- an“inhibitory receptor” refers generally to an immune checkpoint molecule that, when bound by a cognate ligand, causes suppression or inhibition of an immune response, such as those known to enhance tumor evasion. However, in some instances as used herein,“inhibitory receptor” refers specifically to PD-1.
- PD-1 is an immune checkpoint inhibitory receptor that contains an“Immunoreceptor Tyrosine-based Inhibition Motif’ or“P ⁇ M” comprising a conserved sequence of amino acids (S/I/V/L)xYxx(I/V/L) where x is any amino acid.
- Methods for assaying whether PD-1 activity has been inhibited are known in the art and can be readily designed by those of skill in the art. Such assays include, for example, testing the effects of any downstream signaling pathway(s) of PD-1 in vitro or in vivo.
- the ITIM motif becomes phosphorylated by enzymes of, e.g., the Src kinase family, allowing them to recruit other enzymes, e.g., the phosphotyrosine phosphatases SHP-1 and SHP-2, or the inositol- phosphatase called SHIP.
- Src kinase family e.g., the Src kinase family
- SHIP the inositol- phosphatase
- downstream factors such as phosphotyrosine phosphatases
- downstream factors e.g. , nuclear factor of activated T- cells - NFAT - as a measure of PD-1 inhibition
- simple binding assays can be used to determine whether the construct of the present disclosure can block binding PD-1 and its ligand, as discussed above.
- CDRHl comprises SEQ ID NO: 73 (FTFSDYAMS)
- CDRH2 comprises SEQ ID NO: 71
- CDRHl comprises SEQ ID NO: 73 (FTFSDYAMS); CDRH2 comprises SEQ ID NO: 71
- a representative antibody having such heavy and light chain variable CDR regions is mAb25.
- CDRHl comprises SEQ ID NO: 73 (FTFSDYAMS)
- CDRH2 comprises SEQ ID NO: 71
- CDRHl comprises SEQ ID NO: 73 (FTFSDYAMS)
- CDRH2 comprises SEQ ID NO: 71
- a representative antibody having such heavy and light chain variable CDR regions is mAb26.
- CDRHl comprises SEQ ID NO: 76 (FTFSSYAMS), CDRH2 comprises SEQ ID NO: 71
- CDRH3 comprises SEQ ID NO: 75 (ARGLDFIVGYTGNDY).
- CDRHl comprises SEQ ID NO: 76 (FTFSSYAMS)
- CDRH2 comprises SEQ ID NO: 71
- a representative antibody having such heavy and light chain variable CDR regions is mAb27.
- CDRHl comprises SEQ ID NO: 77 (FTFSSYAML)
- CDRH2 comprises SEQ ID NO: 71
- CDRH3 comprises SEQ ID NO: 75 (ARGLDFIVGYTGNDY).
- CDRH1 comprises SEQ ID NO: 77 (FTFSSYAML)
- CDRH2 comprises SEQ ID NO: 71
- CDRH3 comprises SEQ ID NO: 75 (ARGLDFTVGYTGNDY); CDRLl comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAb28.
- CDRH1 comprises SEQ ID NO: 78 (FTFSNYALS)
- CDRH2 comprises SEQ ID NO: 71
- CDRH3 comprises SEQ ID NO: 75 (ARGLDFIVGYTGNDY) .
- CDRH1 comprises SEQ ID NO: 78 (FTFSNYALS);
- CDRH2 comprises SEQ ID NO: 71
- CDRH3 comprises SEQ ID NO: 75 (ARGLDFIVGYTGNDY); CDRLl comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAb29.
- CDRH1 comprises SEQ ID NO: 79 (FTFSAYAMN)
- CDRH2 comprises SEQ ID NO: 71
- CDRH3 comprises SEQ ID NO: 75 (ARGLDFIVGYTGNDY).
- CDRH1 comprises SEQ ID NO: 79 (FTFSAYAMN);
- CDRH2 comprises SEQ ID NO: 71
- a representative antibody having such heavy and light chain variable CDR regions is mAb30.
- CDRH1 comprises SEQ ID NO: 80 (FTFRSYAMS)
- CDRH2 comprises SEQ ID NO: 71
- CDRH3 comprises SEQ ID NO: 75 (ARGLDFTVGYTGNDY).
- CDRHl comprises SEQ ID NO: 80 (FTFRSYAMS);
- CDRH2 comprises SEQ ID NO: 71
- CDRH3 comprises SEQ ID NO: 75 (ARGLDFIVGYTGNDY); CDRLl comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAb31.
- CDRH1 comprises SEQ ID NO: 81 (FTFGRYAMS)
- CDRH2 comprises SEQ ID NO: 71
- CDRH3 comprises SEQ ID NO: 75 (ARGLDF1VGYTGNDY) .
- CDRH1 comprises SEQ ID NO: 81 (FTFGRYAMS);
- CDRH2 comprises SEQ ID NO: 71
- a representative antibody having such heavy and light chain variable CDR regions is mAb32.
- CDRH1 comprises SEQ ID NO: 82 (FTFNSYAMS)
- CDRH2 comprises SEQ ID NO: 71
- CDRH3 comprises SEQ ID NO: 75 (ARGLDFIVGYTGNDY).
- CDRH1 comprises SEQ ID NO: 82 (FTFNSYAMS);
- CDRH2 comprises SEQ ID NO: 71
- a representative antibody having such heavy and light chain variable CDR regions is mAb33.
- CDRHl comprises SEQ ID NO: 83 (FTFSNYAMS), CDRH2 comprises SEQ ID NO: 71
- CDRH3 comprises SEQ ID NO: 74 (ARGLDFIVGATGNDY) .
- CDRHl comprises SEQ ID NO: 83 (FTFSNYAMS);
- CDRH2 comprises SEQ ID NO: 71
- a representative antibody having such heavy and light chain variable CDR regions is mAb34.
- CDRHl comprises SEQ ID NO: 84 (FTFSGYAMS), CDRH2 comprises SEQ ID NO: 71
- CDRHl comprises SEQ ID NO: 84 (FTFSGYAMS); CDRH2 comprises SEQ ID NO: 71 (SAISNSGTYTYYA); CDRH3 comprises SEQ ID NO: 85 (ARGLDFTVGRTGNDY); CDRLl comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- FFFSGYAMS FSGYAMS
- CDRH2 comprises SEQ ID NO: 71 (SAISNSGTYTYYA)
- CDRH3 comprises SEQ ID NO: 85 (ARGLDFTVGRTGNDY)
- CDRLl comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAb35.
- CDRH1 comprises SEQ ID NO: 86 (FTFSSYAMN)
- CDRH2 comprises SEQ ID NO: 71
- CDRH1 comprises SEQ ID NO: 86 (FTFSSYAMN); CDRH2 comprises SEQ ID NO: 71 (SAISNSGTYTYYA); CDRH3 comprises SEQ ID NO: 85 (ARGLDFTVGRTGNDY); CDRL1 comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAb36.
- CDRHl comprises SEQ ID NO: 80 (FTFRSYAMS), CDRH2 comprises SEQ ID NO: 71
- CDRHl comprises SEQ ID NO: 80 (FTFRSYAMS); CDRH2 comprises SEQ ID NO: 71 (SAISNSGTYTYYA); CDRH3 comprises SEQ ID NO: 85 (ARGLDFIVGRTGNDY); CDRLl comprises SEQ ID NO: 9 (RASQSISSYLN); CDRL2 comprises SEQ ID NO: 5 (AASSLQS); and CDRL3 comprises SEQ ID NO: 10 (QQSYSTPLT).
- a representative antibody having such heavy and light chain variable CDR regions is mAb37.
- embodiments comprising a sequence having at least 85%, (e.g, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) identity to the recited sequence (e.g, SEQ ID NO: 5, 9, 10, or 71-86) are also provided.
- the disclosure also provides, in some aspects, an antibody or antigen-binding portion thereof that specifically binds PD-1, wherein the antibody or antigen-binding portion thereof comprises a heavy chain variable region comprising an amino acid sequence that is at least 85%, (e.g.
- the heavy chain variable region comprises an amino acid sequence that is at least 85%, (e.g., at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO: 90, and a light chain variable region comprising an amino acid sequence that is at least 85%, (e.g., at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO: 59.
- the heavy chain variable region comprises an amino acid sequence that differs by 15 amino acids or less, 14 amino acids or less, 13 amino acids or less, 12 amino acids or less, 11 amino acids or less, 10 amino acids or less, 9 amino acids or less, 8 amino acids or less, 7 amino acids or less, 6 amino acids or less, 5 amino acids or less, 4 amino acids or less, 3 amino acids or less, 2 amino acids or less, or 1 amino acid from any one of SEQ ID NOs: 87-99.
- the light chain variable region comprises an amino acid sequence that differs by 15 amino acids or less, 14 amino acids or less, 13 amino acids or less, 12 amino acids or less, 11 amino acids or less, 10 amino acids or less, 9 amino acids or less, 8 amino acids or less, 7 amino acids or less, 6 amino acids or less, 5 amino acids or less, 4 amino acids or less, 3 amino acids or less, 2 amino acids or less, or 1 amino acid from SEQ ID NO: 59.
- Antibodies mAb26-mAb37 are affinity matured antibodies derived from parent antibody mAb25, as described in the Examples.
- An affinity matured antibody or antigenbinding portion thereof is an antibody or antigen-binding fragment with one or more alterations (e.g, in one or more CDRs or FRs) that result in an improvement in the affinity of an antibody for its antigen, compared to a parent antibody lacking the alteration(s).
- an affinity matured antibody has nanomolar or picomolar affinity for PD-1.
- the PD-1 antibody or antigen-binding portion thereof has a KD of at least 1 x 10 7 M, at least 1 x 10 8 M, at least 1 x 10 9 M, at least 1 x 10 10 M, at least 1 x 10 ‘u M, at least 1 x 10 12 M, or at least 1 x 10 13 M.
- Tables 5 and 6 provide cell binding data for mAb25, mAb26, mAb27, mAb28, mAb29, mAb30, mAb31, mAb32, mAb33, rtiAb34, mAb35, mAb36, and mAb37 (i.e., affinity matured variants of mAb25) to human PD-1 (“huPD-1”), cyno PD-1 (“cyPD-1”), or murine PD-1 (“muPD-1”). Human, cyno, or murine PD-1 was expressed on CHO cells.
- Binding is expressed as an ECso value, which can be estimated from titrating different concentrations of mAb on cells that exogenously express the antigen of interest. Fluorescent tagged secondaries can be used to detect and quantify the mAb binding.
- Table 5 The data shown in Table 5 was fit to a 1:1 binding model using built-in functions in GRAPHPAD, which yielded the ECso value.
- Table 6 Cell binding of mAb25 - mAb37to human, cyno, and murine PD-1 expressed on cells
- the disclosure also provides, in some embodiments, an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding
- portion thereof comprises heavy chain CDRs of any of the heavy chain variable regions of
- the disclosure also provides, in some embodiments, an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding portion thereof comprises heavy chain CDRs of any of the heavy chain variable regions of SEQ ID NOs: 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99, and light chain CDRs of the light chain variable region of SEQ ID NO: 59, wherein the heavy and light chain CDR residues are numbered according to Kabat.
- the disclosure also provides, in some embodiments, an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding portion thereof comprises heavy chain CDRs of any of the heavy chain variable regions of SEQ ID NOs: 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99, and light chain CDRs of the light chain variable region of SEQ ID NO: 59, wherein the heavy and light chain CDR residues are numbered according to Chothia.
- the disclosure also provides, in some embodiments, an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding portion thereof comprises heavy chain CDRs of any of the heavy chain variable regions of
- the disclosure also provides, in some embodiments, an antibody or antigen-binding portion thereof that specifically binds PD-L 1 , wherein the antibody or antigen-binding portion thereof comprises heavy chain CDRs of any of the heavy chain variable regions of SEQ ID NOs: 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99, and light chain CDRs of the light chain variable region of SEQ ID NO: 59, wherein the heavy- and light chain CDR residues are numbered according to AbM.
- the disclosure also provides, in some embodiments, an antibody or antigen-binding portion thereof that specifically binds PD-L1, wherein the antibody or antigen-binding portion thereof comprises heavy chain CDRs of any of the heavy chain variable regions of SEQ ID NOs: 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99, and light chain CDRs of the light chain variable region of SEQ ID NO: 59, wherein the heavy and light chain CDR residues are numbered according to IMGT.
- compositions and methods for enhancing an immune response to tumor cells by inhibiting the interaction between PD-L1 and PD-1 for example, the interaction between PD-L1 expressed on a tumor cell and PD-1 expressed on a T cell.
- Antibodies or antigen-binding portions thereof that specifically or selectively bind PD-L1 or PD-1 are provided.
- the terms“specifically binds to,”“specific for,”“selectively binds” and“selective for” PD-L1 or PD-1, or an epitope on PD-L1 or PD-1 mean binding that is measurably different from a non-specific or non- selective interaction.
- the antibody or antigen-binding portion thereof specifically binds to human PD-L1 or PD-1 and/or mouse PD-L1 or PD-1.
- Specific binding can be measured, for example, by determining binding of a molecule compared to binding of a control molecule. Specific binding can also be determined by competition with a control molecule that is similar to the target, such as an excess of non-labeled target. In that case, specific binding is indicated if the binding of the labeled target to a probe is competitively inhibited by tire excess non-labeled target.
- any of the multispecific antigen-binding constructs disclosed herein binds to at least two different receptors or epitopes (e g., PD-1 and PD-L1), wherein the two different receptors or epitopes bound by the multispecific antigen-binding construct are expressed on the surface of the same cell.
- the multispecific antigen-binding construct simultaneously binds to PD-1 and PD-L1, wherein the PD-1 and PD-L1 are expressed on the surface of the same cell.
- any of the multispecific antigen-binding constructs disclosed herein binds to at least two different receptors or epitopes (e.g., PD-1 and PD-L1), wherein the two different receptors or epitopes bound by the multispecific antigen-binding construct are expressed on the surface of two different cells.
- the multispecific antigen-binding construct simultaneously binds to PD-1 expressed on the surface of a first cell and to PD-L1 expressed on the surface of a second cell.
- the multispecific antigen-binding construct is capable of binding human PD-1. In some embodiments, the multispecific antigen-binding construct is capable of binding murine PD-1. In some embodiments, the multispecific antigen-binding construct is capable of binding cynomolgus monkey PD-1. In some embodiments, the multispecific antigen-binding construct is capable of binding human, murine, and cynomolgus monkey PD-1 with similar affinity.
- the disclosure provides for a multispecific antigenbinding construct comprising at least two units of antigen-binding, wherein a first unit of antigen-binding binds PD-1, and a second unit of antigen-binding binds a PD-1 ligand.
- the first unit of antigen-binding binds PD-1 expressed by an immune cell.
- the second unit of antigen-binding binds PD-1 expressed by a second cell.
- the multispecific antigen-binding construct blocks the interaction of PD-1 and a PD-1 ligand, such as PD-L1 or PD-L2.
- the multispecific antigen-binding construct blocks the interaction of PD-1 and a PD-1 ligand, such as PD-L1 or PD-L2. In some embodiments, the multispecific antigen-binding construct comprises at least two units of antigen-binding that bind PD- 1. In some embodiments, the multispecific antigen-binding construct comprises two units of antigen-binding that bind PD- 1. In some embodiments, the multispecific antigen-binding construct comprises at least two units of antigen-binding that bind a PD-1 ligand, such as PD-L1 or PD-L2.
- the multispecific antigen-binding construct comprises two units of antigen- binding that bind a PD-1 ligand, such as PD-L1 or PD-L2. In some embodiments, the multispecific antigen-binding construct comprises at least four units of antigen-binding, wherein two units of antigen-binding bind PD-1 and two units of antigen-binding bind a PD-1 ligand, such as PD-L1 or PD-L2.
- the multispecific antigen-binding construct comprises four units of antigen-binding, wherein two units of antigen-binding bind PD-1 and two units of antigen-binding bind a PD-1 ligand, such as PD-L1 or PD-L2.
- each unit of antigen-binding is capable of binding independently to its cognate antigen, i.e., PD-1 or a PD-1 ligand, such as PD-L1 or PD-L2.
- the multispecific antigen-binding construct promotes loss of PD-1 expression from a cell. In some embodiments, the loss of PD-1 expression is due to PD-1 shedding.
- the multispecific antigen-binding construct blocks interaction of PD-1 and the PD-1 ligand, such as PD-L1 or PD-L2.
- the multispecific antigenbinding construct comprises a common light chain.
- at least two units of antigenbinding comprise a common light chain.
- the first unit of antigen-binding binds PD-1 and comprises:
- a light chain variable region comprising: (i) a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); (ii) a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and (iii) a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT).
- the first unit of antigen-binding binds PD-1 and comprises: (a) a CDRH1 comprising SEQ ID NO: 73 (FTFSDYAMS), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO:
- a CDRH1 comprising SEQ ID NO: 76 (FTFSSYAMS), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO: 75 (ARGLDFIVGYTGNDY);
- a CDRH1 comprising SEQ ID NO: 77 (FTFSSYAML), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO: 75 (ARGLDFIVGYTGNDY);
- a CDRH1 comprising SEQ ID NO: 78 (FTFSNYALS), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO: 75 (ARGLDFIVGYTGNDY);
- a CDRH1 comprising SEQ ID NO: 79 (FTFSAYAMN), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO: 75 (ARGLDFIVGYTGNDY);
- a CDRH1 comprising SEQ ID NO: 80 (FTFRSYAMS), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO: 75 (ARGLDFIVGYTGNDY);
- a CDRH1 comprising SEQ ID NO: 81 (FTFGRYAMS), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO: 75 (ARGLDFIVGYTGNDY);
- a CDRH1 comprising SEQ ID NO: 82 FFFNSYAMS
- a CDRH2 comprising SEQ ID NO: 71 SAISNSGTYTYYA
- a CDRH3 comprising SEQ ID NO: 75 ARGLDFIVGYTGNDY
- a CDRH1 comprising SEQ ID NO: 83 (FTFSNYAMS), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO: 74 (ARGLDFIVGATGNDY);
- a CDRH1 comprising SEQ ID NO: 84 (FTFSGYAMS), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO: 85 (ARGLDFIVGRTGNDY);
- a CDRH1 comprising SEQ ID NO: 86 (FTFSSYAMN), a CDRH2 comprising SEQ ID NO: 71 (SAISNSGTYTYYA) and a CDRH3 comprising SEQ ID NO: 85 (ARGLDFIVGRTGNDY); or
- a CDRH1 comprising SEQ ID NO: 80 (FTFRSYAMS), a comprising SEQ P) NO: 71 (SAISNSGTYTYYA), and a CDRH3 comprising SEQ ID NO: 85 (ARGLDFIVGRTGNDY).
- the first unit of antigen-binding binds PD-1 and comprises:
- (k) a heavy chain variable region comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 97;
- the first unit of antigen-binding binds PD-1 and comprises a light chain variable region comprising an amino acid sequence that is at least 90% identical to SEQ ID NO: 59.
- the second unit of antigen-binding binds PD-L2. In some embodiments, the second unit of antigen-binding binds PD-L1. In some embodiments, the second unit of antigen-binding binds PD-L1 and comprises:
- a heavy chain variable region comprising (i) a CDRH1 comprising SEQ ID NO:
- a CDRH2 comprising SEQ ID NO: 2 (GGIIPX1X2GX3 A ⁇ A, wherein Xi is V or I; X2 is F, L, or V; and X3 is T or A); and (iii) a CDRH3 comprising SEQ ID NO: 3 (ARLKXiELKDAFDI, wherein Xi is G, F, or N); and b. a light chain variable region comprising: (i) a CDRL1 comprising SEQ ID NO:
- tire second unit of antigen-binding binds PD-L1 and comprises:
- a CDRH1 comprising SEQ ID NO: 1 GTFSSYAIN
- a CDRH2 comprising SEQ ID NO: 7 GGIIPILGAATYA
- a CDRH3 comprising SEQ ID NO: 8 ARLKGELKDAFDI
- a CDRL1 comprising SEQ ID NO: 9 RASQSISSYLN
- a CDRL2 comprising SEQ ID NO: 5 AASSLQS
- a CDRL3 comprising SEQ ID NO: 10 QQSYSTPLT
- a CDRH1 comprising SEQ ID NO: 1 GTFSSYAIN
- a CDRH2 comprising SEQ ID NO: 11 GGHPVFGTATYA
- a CDRH3 comprising SEQ ID NO: 8 ARLKGELKDAFDI
- a CDRL1 comprising SEQ ID NO: 9 RASQSISSYLN
- a CDRL2 comprising SEQ ID NO: 5 AASSLQS
- a CDRL3 comprising SEQ ID NO: 10 QQSYSTPLT
- a CDRHl comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 11 (GGHPVFGTATYA), a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI); a CDRL1 comprising SEQ ID NO: 12
- RASQW1SSYLN a CDRL2 comprising SEQ ID NO: 5
- AASSLQS a CDRL3 comprising SEQ ID NO: 10
- a CDRHl comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 15 (GGHPIFGIANYA), and a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI);
- a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRHl comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 11 (GGHPVFGTATYA), a CDRH3 comprising SEQ ID NO: 18 (ARLKFELKDAFDI), a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRH1 comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 11 (GGHPVFGTATYA), and a CDRH3 comprising SEQ ID NO: 19 (ARLKGELKDAFDE);
- a CDRH1 comprising SEQ ID NO: 1 GTFSSYAIN
- a CDRH2 comprising SEQ ID NO: 11 GGHPVFGTATYA
- a CDRH3 comprising SEQ ID NO: 19 ARLKGELKDAFDE
- a CDRL1 comprising SEQ ID NO: 9 RASQSISSYLN
- a CDRL2 comprising SEQ ID NO: 5 AASSLQS
- a CDRL3 comprising SEQ ID NO: 10 QQSYSTPLT
- a CDRH1 comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 11 (GGHPVFGTATYA), and a CDRH3 comprising SEQ ID NO: 20 (ARLKNELKDAFDI);
- a CDRH1 comprising SEQ ID NO: 1 GTFSSYAIN
- a CDRH2 comprising SEQ ID NO: 11 GGHPVFGTATYA
- a CDRH3 comprising SEQ ID NO: 20 ARLKNELKDAFDI
- a CDRL1 comprising SEQ ID NO: 9 RASQSISSYLN
- a CDRL2 comprising SEQ ID NO: 5 AASSLQS
- a CDRL3 comprising SEQ ID NO: 10 QQSYSTPLT
- a CDRH1 comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 21 (GGVIPFLGTANY A), and a CDRH3 comprising SEQ ID NO: 22 (ARLKGILKDALDI);
- a CDRHl comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 21 (GGVIPFLGTANYA), a CDRH3 comprising SEQ ID NO: 22 (ARLKGILKDALDI), a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRH1 comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 31 (GGIIPILGTATYA), and a CDRH3 comprising SEQ ID NO: 32 (ARRKGELKDAFDI);
- a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRH1 comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 34 (GGIIPIFGKATYA), a CDRH3 comprising SEQ ID NO: 32 (ARRKGELKDAFDI), a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRH1 comprising SEQ ID NO: 1 GTFSSYAIN
- a CDRH2 comprising SEQ ID NO: 11 GGHPVFGTATY A
- a CDRH3 comprising SEQ ID NO: 8 ARLKGELKDAFDI
- a CDRL1 comprising SEQ ID NO: 9 RASQSISSYLN
- a CDRL2 comprising SEQ ID NO: 5 AASSLQS
- a CDRL3 comprising SEQ ID NO: 38 FQSYSTPLT
- cc a CDRH1 comprising SEQ ID NO: 1 (GTFSSYAIN), a CDRH2 comprising SEQ ID NO: 11 (GGUPVFGTATYA), a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI); a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 39 (QQSYSTTLT);
- a CDRH1 comprising SEQ ID NO: 14 (GTFSSYAFS), a CDRH2 comprising SEQ ID NO: 11 (GGUPVFGTATYA) and a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI); a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRH1 comprising SEQ ID NO: 23 (GTFSSYAIS), a CDRH2 comprising
- SEQ ID NO: 24 (GGIIPIVGIANYA), and a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI);
- SEQ ID NO: 24 (GGIIPIVGIANYA), and a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI); a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRH1 comprising SEQ ID NO: 23 (GTFSSYAIS), a CDRH2 comprising SEQ ID NO: 11 (GGUPVFGTATYA), and a CDRH3 comprising SEQ ID NO: 25 (ARLKGEFKDAFDI); a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- SEQ ID NO: 26 (GRIIPLFGTAHYA), and a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI);
- SEQ ID NO: 26 (GRIIPLFGTAHYA), and a CDRH3 comprising SEQ ID NO: 8 (ARLKGELKDAFDI); a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- nn a CDRH1 comprising SEQ ID NO: 23 (GTFSSYAIS), a CDRH2 comprising SEQ ID NO: 11 (GGHPVFGTATYA), and a comprising SEQ ID NO: 30 (ARLKGELKCAFDI); a CDRL1 comprising SEQ ID NO: 9 (RASQSISSYLN); a CDRL2 comprising SEQ ID NO: 5 (AASSLQS); and a CDRL3 comprising SEQ ID NO: 10 (QQSYSTPLT);
- a CDRH1 comprising SEQ ID NO: 36 GPFRSHAVS
- a CDRH2 comprising SEQ ID NO: 11 GGHPVFGTATYA
- a CDRH3 comprising SEQ ID NO: 37 ARLKSELKDAFDI
- a CDRL1 comprising SEQ ID NO: 9 RASQSISSYLN
- a CDRL2 comprising SEQ ID NO: 5 AASSLQS
- a CDRL3 comprising SEQ ID NO: 10 QQSYSTPLT
- the second unit of antigen-binding binds PD-L1 and comprises a heavy chain variable region comprising an amino acid sequence that is at least 90% identical to any one of SEQ HD NOs: 35, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, or 58, and a light chain variable region comprising an amino acid sequence that is at least 90% identical to any one of SEQ HD NOs: 59, 60, 61, 62, or 63.
- the second unit of antigen-binding binds PD-L1 and comprises a heavy chain variable region comprising:
- the second unit of antigen-binding binds PD-L1 and comprises a light chain variable region comprising:
- the disclosure provides for a multispecific antigen-binding construct comprising any of the PD-1 antagonists disclosed herein and any of the antagonists of a PD-1 ligand, such as PD-L1, disclosed herein.
- Bispecific 3 is a multispecific, tetravalent antigen-binding construct that specifically binds human PD-1 and human PD-L1.
- the construct comprises an anti -PD-1 IgGl antibody (mAb28) in which the heavy chain of the antibody is a fusion protein further comprising at its C-terminus the heavy chain variable region of an anti-PD-Ll antibody (mAbl), which is connected to the Fc region of the anti-BCMA antibody by way of a poly-GGGS (SEQ ID NO: 120) linker.
- the light chains for the anti -PD-1 portion and the anti-PD-Ll portions of the construct are identical (SEQ ID NO: 101).
- Bispecific 3 the structure for which is represented by the illustration in FIG. 13A, comprises the heavy chain sequence recited in SEQ ID NO: 100 and the light chain sequence recited in SEQ ID NO: 101.
- the disclosure provides for a multispecific antibody or antigenbinding portion thereof that specifically binds PD-1 and PD-L1, wherein the antibody or antigen-binding portion thereof comprises a heavy chain region comprising an amino acid sequence that is at least 85%, (e.g, at least 85%, at least 90%, at least 91 %, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO: 100 or 102 and a light chain region comprising an amino acid sequence that is at least 85%, (e.g., at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO: 101 or 103.
- the antibody or antigen-binding portion thereof comprises a heavy chain region comprising an amino acid sequence that is at least
- the disclosure provides for a multispecific antibody or antigenbinding portion thereof that specifically binds PD-1 and PD-L1, wherein the antibody or antigen-binding portion thereof comprises a heavy chain region comprising an amino acid sequence that is at least 85%, (e.g., at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO: 100, and a light chain region comprising an amino acid sequence that is at least 85%, (e.g, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO: 101.
- a heavy chain region comprising an amino acid sequence that is at least 85%, (e.g., at least 85%, at least 90%,
- the heavy chain region comprises an amino acid sequence that differs by 15 amino acids or less, 14 amino acids or less, 13 amino acids or less, 12 amino acids or less, 11 amino acids or less, 10 amino acids or less, 9 amino acids or less, 8 amino acids or less, 7 amino acids or less, 6 amino acids or less, 5 amino acids or less, 4 amino acids or less, 3 amino acids or less, 2 amino acids or less, or 1 amino acid from SEQ ID NO: 100.
- the light chain region comprises an amino acid sequence that differs by 15 amino acids or less, 14 amino acids or less, 13 amino acids or less, 12 amino acids or less, 11 amino acids or less, 10 amino acids or less, 9 amino acids or less, 8 amino acids or less, 7 amino acids or less, 6 amino acids or less, 5 amino acids or less, 4 amino acids or less, 3 amino acids or less, 2 amino acids or less, or 1 amino acid from SEQ ID NO: 101.
- the disclosure provides for a multispecific antibody or antigen- binding portion thereof that specifically binds PD-1 and PD-L1, wherein the antibody or antigen-binding portion thereof comprises a heavy chain region comprising an amino acid sequence that is at least 85%, (e.g, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO: 102, and a light chain region comprising an amino acid sequence that is at least 85%, (e.g., at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical) to SEQ ID NO: 103.
- the antibody or antigen-binding portion thereof comprises a heavy chain region comprising an amino acid sequence that is at least 85%, (e
- the heavy chain region comprises an amino acid sequence that differs by 15 amino acids or less, 14 amino acids or less, 13 amino acids or less, 12 amino acids or less, 11 amino acids or less, 10 amino acids or less, 9 amino acids or less, 8 amino acids or less, 7 amino acids or less, 6 amino acids or less, 5 amino acids or less, 4 amino acids or less, 3 amino acids or less, 2 amino acids or less, or 1 amino acid from SEQ ID NO: 102.
- the light chain region comprises an amino acid sequence that differs by 15 amino acids or less, 14 amino acids or less, 13 amino acids or less, 12 amino acids or less, 11 amino acids or less, 10 amino acids or less, 9 amino acids or less, 8 amino acids or less, 7 amino acids or less, 6 amino acids or less, 5 amino acids or less, 4 amino acids or less, 3 amino acids or less, 2 amino acids or less, or 1 amino acid from SEQ ID NO: 103.
- a multispecific antigen- binding construct comprising four units of antigen-binding, wherein two units of antigenbinding bind PD-1 and two units of antigen-binding bind PD-L1, and wherein the construct comprises a heavy chain amino acid sequence that is at least 85%, identical to the amino acid sequence of SEQ ID NO: 100 or 102, and a light chain amino acid sequence that is at least 85%, identical to the amino acid sequence of SEQ ID NO: 101 or 103.
- a multispecific antigenbinding construct comprising four units of antigen-binding, wherein two units of antigenbinding bind PD-1 and two units of antigen-binding bind PD-L1, and wherein the construct comprises a heavy chain amino acid sequence that is at least 85%, identical to the amino acid sequence of SEQ ID NO: 100 and a light chain amino acid sequence that is at least 85%, identical to the amino acid sequence of SEQ P) NO: 101.
- a multispecific antigenbinding construct comprising four units of antigen-binding, wherein two units of antigenbinding bind PD-1 and two units of antigen-binding bind PD-L1, and wherein the construct comprises a heavy chain amino acid sequence that is at least 85%, identical to the amino acid sequence of SEQ ID NO: 102 and a light chain amino acid sequence that is at least 85%, identical to the amino acid sequence of SEQ ID NO: 103.
- multispecific antigen-binding construct refers to bispecific, tri- specific, or multispecific antigen-binding constructs, and antigen-binding portions or fragments thereof.
- a multispecific antigen-binding construct can be a single multifunctional polypeptide, or it can be a multimeric complex of two or more molecules (e g., polypeptides and/or aptamers) that are covalently or non-covalently associated with one another.
- multispecific antigen-binding constructs includes antibodies (or antigen-binding fragments thereof) that may be linked to or co -expressed with another functional molecule, e.g, another peptide, protein, and/or aptamer.
- an antibody or fragment thereof can be functionally linked (e.g, by chemical coupling, genetic fusion, non-covalent association or otherwise) to one or more other molecular entities, such as a protein or fragment thereof to produce a bispecific or a multispecific antigen-binding molecule with a second binding specificity.
- multispecific antigen-binding constructs also includes bispecific, trispecific or multispecific antibodies or antigen-binding fragments thereof.
- an antibody is functionally linked to another antibody or antigenbinding fragment thereof to produce a bispecific antibody with a second binding specificity. Bispecific and multispecific antibodies of the present invention are described elsewhere herein.
- an antigen-binding“arm” refers to a unit, domain, region, or the like, of the multispecific antigen-binding construct that forms an area of the construct that binds to an antigen.
- a“first arm” forms a separate binding area of the multispecific antigen- binding construct from a“second arm” of the construct, each arm forming a unit of antigen binding.
- one“arm” (first arm) is distinct from the other“arm” (second arm) in its antigen binding or antigen specificity.
- one arm of the antibody binds to antigen A, while the other arm of the antibody- binds to antigen B.
- one arm of the antibody binds to antigen A, while the other arm of the antibody binds to antigen B or C (cross-reacts with two antigens such as PD-L1 and PD-L2 due to, e.g., similarity in structure).
- antigen A binds to antigen A
- antigen B or C cross-reacts with two antigens such as PD-L1 and PD-L2 due to, e.g., similarity in structure.
- one“arm” refers to the area of the antibody that binds to antigen A (even if two binding sites - of a bivalent antibody - bind to antigen A) and the“other arm” refers to the area of the antibody that binds to antigen B (even if two binding sites - of a bivalent antibody - bind to antigen B).
- the“other arm” refers to the area of the antibody that binds to antigen B (even if two binding sites - of a bivalent antibody - bind to antigen B).
- a tetravalent bispecific antibody formed, e.g.
- one“arm” refers to the area of the antibody that binds to antigen A (even if two binding sites - of a bivalent antibody - bind to antigen A) and the “other arm” refers to the area of the antibody that binds to antigen B or C (even if two binding sites - of a bivalent antibody - can bind to antigen B or C).
- the “other arm” refers to the area of the antibody that binds to antigen B or C (even if two binding sites - of a bivalent antibody - can bind to antigen B or C).
- an antigen-binding protein comprises more than one recognition site (e g., when an antigen-binding protein is an IgG, which has two recognition sites in its variable regions), each recognition site can specifically recognize the same epitope on tire same antigen, or different epitopes, whether on the same or different antigens.
- Multivalency can increase the avidity, i.e., the strength of binding between an antigen-binding arm or construct and the pertinent antigen or target receptor.
- Avidity is related to both the affinity between an epitope or antigenic determinant and its binding site on the antigen-binding unit, and the actual number of pertinent binding sites present on the antigen-binding unit.
- any of the multispecific antigen-binding constructs disclosed herein comprises a multivalent (e.g. , bivalent) antibody or antigen-binding fragment, wherein at least two of the valencies specifically bind PD-1.
- any of the multispecific antigen-binding constructs disclosed herein comprises a multivalent (e.g., bivalent) antibody or antigen-binding fragment, wherein at least two of the valencies specifically bind a PD-1 ligand (e.g, PD-L1 or PD-L2).
- any of the multispecific antigen-binding constructs disclosed herein comprises a multivalent (e.g.
- any of the multispecific antigen-binding constructs disclosed herein comprises a first multivalent (e.g, bivalent) antibody or antigenbinding fragment and a second multivalent (e.g, bivalent) antibody or antigen-binding fragment, wherein at least two of the valencies of the first multivalent antibody or antigenbinding fragment specifically bind PD-1, and wherein at least two of the valencies of the second multivalent antibody or antigen-binding fragment specifically bind PD-L1.
- any of the multispecific antigen-binding constructs disclosed herein is a tetravalent construct, wherein the tetravalent construct comprises a first bivalent antibody or antigen-binding fragment and a second bivalent antibody or antigen-binding fragment, wherein both valencies of the first bivalent antibody or antigen-binding fragment are specific for the same epitope on PD-1, and wherein both valencies of the second bivalent antibody or antigen-binding fragment are specific for the same epitope on PD-L1.
- the first and second bivalent antibody or antigen-binding fragment or portion thereof use a light chain having the same amino acid sequence.
- the tetravalent construct comprises a common light chain. For example, a light chain having the sequence of SEQ ID NO: 101 or SEQ ID NO: 103.
- the first arm is an antagonist of PD-1.
- the second arm is an antagonist of a PD-1 ligand - e.g, PD-L1 and/or PD-L2.
- the first arm is an antagonist of PD-1
- the second arm is an antagonist of cognate PD-1 ligand - e.g, PD-L1 and/or PD-L2.
- antigen-binding arm when used to refer to the biological activity of the antigen-binding arm indicate that the antigen-binding arm binds its target (e.g. , PD-1) on the respective cell and partially or fully blocks, inhibits, and/or reduces the biological response through PD-1. In some embodiments, inhibition in the presence of the antagonist is observed in a dose-dependent manner.
- target e.g. , PD-1
- inhibition in the presence of the antagonist is observed in a dose-dependent manner.
- the measured signal (e.g., biological activity) is at least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 100% lower than the signal measured with a negative control under comparable conditions. Also disclosed herein, are methods of identifying antagonists suitable for use in the methods of the disclosure.
- these methods include, but are not limited to, binding assays such as enzyme-linked immuno- ab sorbent assay (ELISA), FORTE BIO ⁇ systems, and radioimmunoassay (RIA).
- binding assays such as enzyme-linked immuno- ab sorbent assay (ELISA), FORTE BIO ⁇ systems, and radioimmunoassay (RIA).
- ELISA enzyme-linked immuno- ab sorbent assay
- RIA radioimmunoassay
- a functional assay may comprise contacting a polypeptide with a candidate antagonist molecule and measuring a detectable change in one or more biological activities normally associated with the polypeptide.
- the potency of an antagonist is usually defined by its ICso value (concentration required to inhibit 50% of the agonist response). The lower the ICso value the greater the potency of the antagonist and the lower the concentration that is required to inhibit the maximum biological response.
- At least one antigen-binding arm has a KD of at least 1 x 10 '7 M, at least 1 x 10 "8 M, at least 1 x 10 "9 M, at least 1 x 10 "10 M, at least 1 x 10 "11 M, at least 1 x 10 12 M, or at least 1 x 10 13 M.
- both antigen-binding arms have the same or similar KD.
- KD KD
- the binding of one arm (e.g., the first arm) of the multispecific antigen-binding construct to its target does not block the binding of the other arm (e.g. , the second arm) to its target.
- the binding of one arm does not sterically hinder the second arm from binding its target.
- the second arm is free to bind a ligand of PD-1 (e.g., PD-L1 and/or PD-L2).
- the first arm and second arm bind to their respective targets and both arms remain bound concurrently.
- binding of the first arm and the second arm to their respective targets bridges the immune cell and the second cell together, bringing the two cells in closeproximity.
- “bridge” refers to the joining of two cell types (e.g, one immune cell that expresses PD-1, and a second cell that expresses its ligand - PD-L1), or bringing of the two cells together in close proximity; the two cells need not be in physical contact.
- the multispecific antigen-binding construct acts as a connecter (e.g., a bridge) to the two cells, each one expressing PD-1 or either of its ligands.
- the bridging of the immune cell and the second cell is determined by, e.g, flow cytometry, FRET, immunoprecipitation, microscopy, or fluorescence plate reader.
- binding of the first arm and the second arm of a multispecific construct to their respective targets results in down-regulation and/or shedding of the ectodomain and/or degradation of a target, e.g, PD-1.
- “down-regulation” refers to the process by which a cell decreases the quantity of a cellular component, such as RNA or protein. In the case of cell-surface protein receptors, down-regulation can occur through internalization of the receptor as a consequence of binding to a ligand or any of the constructs described herein.
- Shedding or ectodomain shedding refers to a process by which cell surface proteins are proteolytically cleaved resulting in the release of their ectodomains into the extracellular milieu.
- Non-limiting examples of sheddases that regulate ectodomain shedding include members of the disintigrin and metalloproteinase (ADAM) family, such as ADAMS, ADAM9, ADAM 10, ADAM 12, ADAM15, ADAM 17, and ADAM 28, and matrix metalloproteinases (MMPs), such as MMP2, MMP3, MMP7, MMP9, and MMP14. It is believed that the distance from the plasma membrane and structure of the cleavage site region are more important than the specific sequence in ectodomain shedding.
- ADAM disintigrin and metalloproteinase
- MMPs matrix metalloproteinases
- Protein degradation or proteolysis refers to a set of processes that result in the hydrolysis of one or more of the peptide bonds in a protein, either through catalysis by proteolytic enzymes called proteases, or nonenzymatically, for example at very low or very high pH.
- proteases proteolytic enzymes
- Methods for determining whether a target receptor is down-regulated and/or shedded and/or degraded by a multispecific construct disclosed herein are known in the art, and are described in the Examples, see, for example, Figures 12A-12C; e.g., flow cytometry. Western blotting, immunoprecipitation, microscopy, or fluorescence plate reader.
- the constructs of the present invention can bridge an immune cell that expresses PD-1, and a second cell that expresses its ligand, such as a second immune cell, and/or a cancer or tumor cell.
- a second cell that expresses its ligand
- the type of immune cell depends on the context of the disease to be treated; the particular type of immune cell can be readily determined depending on the disorder under consideration.
- the immune cell is a T cell, e.g., regulatory T cells (a.k.a.
- the immune cell is a natural killer (NK) cell.
- the immune cell is a B cell.
- the immune cell is a macrophage.
- the second cell (the cell that expresses a PD-1 ligand) is a second immune cell, e.g., a regulatory immune cell.
- the regulatory immune cell is any one or more of a regulatory T cell, a B cell, a macrophage, a myeloid-derived suppressor cell, a dendritic cell, or a mesenchymal stromal cell.
- the regulatory immune cell is a regulatory T cell, e.g., CD8+ T cell or CD4+ T cell.
- the second cell is a tumor cell.
- tumor cell is sometimes used interchangeably with“cancer cell”, but also encompasses non-malignant (non-cancerous) cells exhibiting increased proliferation as compared to a normal cell.
- the tumor cell is a cancer that can be treated by blocking the interaction between PD-1 expressed by an immune cell and its ligand (e.g, PD-L1 or PD-L2) expressed on a second cell, while bridging the immune cell and the tumor cell.
- the tumor cell is selected from the group consisting of a hematological cancer, a lymphoma, a myeloma, a leukemia, a neurological cancer, melanoma, breast cancer, a prostate cancer, a colorectal cancer, lung cancer, head and neck cancer, a gastrointestinal cancer, liver cancer, pancreatic cancer, a genitourinary cancer, a bone cancer, renal cancer, and a vascular cancer.
- the tumor cell is selected from the group consisting of Kaposi's sarcoma, leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, myeloblasts promyelocyte myelomonocytic monocytic erythroleukemia, chronic leukemia, chronic myelocytic (granulocytic) leukemia, chronic lymphocytic leukemia, mantle cell lymphoma, primary central nervous system lymphoma, Burkitt’s lymphoma and marginal zone B cell lymphoma, Polycythemia vera Lymphoma, Hodgkin's disease, non-Hodgkin' s disease, multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, solid tumors, sarcomas, and carcinomas, fibrosarcoma, myxosarcoma, liposarcoma, chrondrosarcoma, osteogenic sarcoma
- multispecific antigen-binding constructs of the present invention include bispecific, trispecific, tetraspecific, or multispecific antibodies (immunoglobulins) or antigen-binding portions or fragments thereof.
- immunoglobulin refers to a class of structurally related proteins generally comprising two pairs of polypeptide chains: one pair of light (L) chains and one pair of heavy
- each heavy chain typically comprises a heavy chain variable region (VH) and a heavy chain constant region (CH).
- the heavy chain constant region typically comprises three domains, CHI, Cm, and Cm.
- Each light chain typically comprises a light chain variable region (VL) and a light chain constant region.
- the tight chain constant region typically comprises one domain, abbreviated CL.
- the term“immunoglobulin’ (Ig) is sometimes used interchangeably with the term“antibody” herein.
- antibody describes a type of immunoglobulin molecule and is used herein in its broadest sense.
- An antibody specifically includes intact antibodies (e.g, intact immunoglobulins), and antibody fragments such as antigen-binding fragments of an antibody, as described herein.
- “antibody” can refer to an intact antibody as well as an antigenbinding fragment thereof.
- Antibodies comprise at least one antigen-binding domain.
- One example of an antigen-binding domain is an antigen binding domain formed by a VH-VL dimer.
- Antibodies can be described by the antigen to which they specifically bind.
- a PD-1 antibody alternatively referred to as an anti-PD-1 antibody, is an antibody that specifically binds to the inhibitory receptor PD-1.
- the VH and VL regions can be further subdivided into regions of hypervariability (“hypervariable regions (HVRs);” also called“complementarity determining regions”
- CDRs CDRs interspersed with regions that are more conserved.
- the more conserved regions are called framework regions (FRs).
- Each VH and VL generally comprises three CDRs and four FRs, arranged in the follow'ing order (from N-terminus to C-terminus): FR1 - CDR1 - FR2 - CDR2 - FRS - CDRS - FR4.
- the CDRs are involved in antigen binding, and confer antigen specificity and binding affinity to the antibody. See Kabat et al., Sequences of Proteins of
- the light chain from vertebrate species can be assigned to one of two types, called kappa and lambda, based on the sequence of the constant domain.
- the heavy chain from vertebrate species can be assigned to one of five different classes (or isotypes): IgA, IgD, IgE, IgG, and IgM. These classes are also designated o, d, e, g, and m, respectively.
- the IgG and IgA classes are further divided into subclasses on the basis of differences in sequence and function. Humans express the following subclasses: IgGl, IgG2, IgG3, IgG4, IgAl, and IgA2.
- chimeric antibody refers to an antibody in which a component of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
- “Humanized” forms of non-human antibodies are chimeric antibodies that contain minimal sequence derived from the non-human antibody.
- a humanized antibody is generally a human immunoglobulin (recipient antibody) in which residues from one or more CDRs are replaced by residues from one or more CDRs of a non-human antibody (donor antibody).
- the donor antibody can be any suitable non-human antibody, such as a mouse, rat, rabbit, chicken, or non-human primate antibody having a desired specificity', affinity, or biological effect.
- selected framework region residues of the recipient antibody are replaced by the corresponding framework region residues from the donor antibody.
- Humanized antibodies can also comprise residues that are not found in either the recipient antibody or the donor antibody. Such modifications can be made to further refine antibody function. For further details, see Jones et al., (1986) Nature, 321:522-525; Riechmann et al., (1988) Nature, 332:323-329; and Presta, (1992) Curr. Op. Struct. Biol., 2:593-596, each of w'hich is incorporated by reference in its entirety.
- A“human antibody” is one which possesses an amino acid sequence corresponding to that of an antibody produced by a human or a human cell, or derived from a non-human source that utilizes a human antibody repertoire or human antibody-encoding sequences (e.g. , obtained from human sources or designed de novo). Human antibodies specifically exclude humanized antibodies.
- an antibody molecule comprises a diabody, and a single-chain molecule, as w'ell as an antigen-binding fragment of an antibody (e.g.. Fab, F(ab')2, and Fv).
- an antibody molecule can include a heavy (H) chain variable domain sequence (abbreviated herein as VH), and a light (L) chain variable domain sequence (abbreviated herein as VL).
- VH heavy chain variable domain sequence
- VL light chain variable domain sequence
- an antibody molecule comprises or consists of a heavy chain and a light chain (referred to as a half antibody).
- an antibody- molecule includes two heavy (H) chain variable domain sequences and two light (L) chain variable domain sequence, thereby forming two antigen binding sites, such as Fab, Fab', F(ab')2, Fc, Fd, Fd', Fv, single chain antibodies (scFv, for example), single variable domain antibodies, diabodies (Dab) (bivalent and bispecific), and chimeric (e.g, humanized) antibodies, which may be produced by the modification of whole antibodies or those synthesized de novo using recombinant DNA technologies. These functional antibody fragments retain the ability to selectively bind with their respective antigen.
- Antibodies and antibody fragments can be from any class of antibodies including, but not limited to, IgG, IgA, IgM, IgD, and IgE, and from any subclass (e.g., IgAl, IgA2, IgGl, IgG2, IgG3, and IgG4) of antibodies.
- the preparation of antibody molecules can be monoclonal or polyclonal.
- An antibody molecule can also be a human, humanized, CDR-grafted, or in vitro generated antibody.
- the antibody can have a heavy chain constant region chosen from, e.g, IgGl, IgG2, IgG3, or IgG4.
- the antibody can also have a light chain chosen from, e.g. , kappa or lambda.
- the antibody comprises an IgGl heavy chain constant region having an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 64
- the antibody comprises an IgG4 heavy chain constant region having an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 68
- the antibody comprises an IgG4 heavy chain constant region having an amino acid sequence that is at least 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 69
- Antigen-binding portions or fragments of an antibody molecule are well known in the art, and include, for example: (i) a Fab fragment, a monovalent fragment consisting of the
- VL, ⁇ , CL and CHI domains (ii) a F(ab')2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment consisting of the VH and CHI domains; (iv) a Fv fragment consisting of the VL and VH domains of a single arm of an antibody, (v) a diabody (dAb) fragment, which consists of a VH domain; (vi) a camelid or camelized variable domain; (vii) a single chain Fv (scFv), see e.g. , Bird et al. (1988) Science 242:423-426; and Huston et al.
- scFv single chain Fv
- Antibody molecules can also be single domain antibodies.
- Single domain antibodies can include antibodies whose complementary determining regions are part of a single domain polypeptide. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies.
- Single domain antibodies may be any of the art, or any future single domain antibodies.
- Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, fish, shark, goat, rabbit, and bovine.
- a single domain antibody is a naturally-occurring singledomain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO 9404678, for example. For clarity reasons, this variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain
- VHHs immunoglobulins.
- VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, llama, dromedary, alpaca and guanaco.
- Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention.
- the multispecific antigen-binding construct comprises a bispecific antibody.
- a bispecific antibody has specificity for no more than two antigens, but can have more than two binding sites, as described herein.
- a bispecific antibody molecule is characterized by a first immunoglobulin variable domain sequence which has binding specificity for a first antigen (e.g., PD-1) and a second immunoglobulin variable domain sequence that has binding specificity for a second antigen (e.g., a PD-1 ligand such as PD-L1 ligand).
- a bispecific antibody molecule comprises a scFv, or fragment thereof, have binding specificity for a first antigen and a scFv, or fragment thereof, have binding specificity for a second antigen. See, e.g., Kontermann & Brinkmann, (2015), Drug Discovery Today, 20(7):838-47, incorporated by reference in its entirety.
- formats and methods are known in the art that can be used to generate the multivalent and/or multispecific constructs described herein, such as multivalent and/or multispecific antibody formats of both asymmetric and symmetric architectures.
- Non-limiting examples of such formats include (i) Fc-less bispecific antibody formats, such as tandem single-chain variable fragments (scFv2, taFv) and triplebodies, including bi-specific T cell engager (BiTE) and bispecific killer cell engagers (BiKE) molecules; bispecific singledomain antibody fusion proteins comprising single-domain antibodies, such as VH or VL domains, VHH, VNAR and Nanobodies; diabodies and diabody derivatives, including tandem diabody and dual-affinity retargeting (DART) proteins; Fab fusion proteins; and other Fc-less fusion proteins, through the use of heterodimerizing peptides or miniantibodies from various proteins, e.g, leucine zippers with a coiled coil structure; (ii) bi
- WO 07/110205 Fab arm exchange as described in, e.g, WO 08/119353, WO 2011/131746, and WO 2013/060867; double antibody conjugate, e.g, by antibody cross-linking to generate a bi-specific structure using a heterobifunctional reagent having an amine-reactive group and a sulfhydryl reactive group as described in, e.g, U.S. Pat. No. 4,433,059; bispecific antibody determinants generated by recombining half antibodies (heavy-light chain pairs or Fabs) from different antibodies through cycle of reduction and oxidation of disulfide bonds between the two heavy- chains, as described in, e.g, U.S. Pat. No. 4,444,878; trifimctional antibodies, e.g, three Fab' fragments cross-linked through sulfhdryl reactive groups, as described in, e.g. ,
- biosynthetic binding proteins e.g., pair of scFvs cross-linked through C-terminal tails preferably through disulfide or amine-reactive chemical cross- linking, as described in, e.g., U.S. Pat. No. 5,534,254
- bifunctional antibodies e.g, Fab fragments with different binding specificities dimerized through leucine zippers (e.g, c-fos and c-jun) that have replaced the constant domain, as described in, e.g, U.S. Pat. No.
- bispecific and oligospecific mono- and oligovalent receptors e.g, VH-CH1 regions of two antibodies (two Fab fragments) linked through a polypeptide spacer between the CHI region of one antibody and the VH region of the other antibody typically with associated light chains, as described in, e.g, U.S. Pat. No. 5,591,828; bispecific DNA- antibody conjugates, e.g, crosslinking of antibodies or Fab fragments through a double stranded piece of DNA, as described in, e.g, U.S. Pat. No. 5,635,602; bispecific fusion proteins, e.g.
- an expression construct containing two scFvs with a hydrophilic helical peptide linker between them and a full constant region as described in, e.g, U.S. Pat. No. 5,637,481; multivalent and multispecific binding proteins, e.g, dimer of polypeptides having first domain with binding region of Ig heavy chain variable region, and second domain with binding region of Ig light chain variable region, generally termed diabodies (higher order structures are also encompassed creating for bispecifc, trispecific, or tetraspecific molecules, as described in, e.g, U.S. Pat. No.
- FVs FVs (or scFvs), as described in, e.g, U.S. Pat. No. 5,864,019; and single chain binding polypeptides with both a VH and a VL domain linked through a peptide linker are combined into multivalent structures through non-covalent or chemical crosslinking to form, e.g., homobivalent, heterobivalent, bivalent, and tetravalent structures using both scFV or diabody type format, as described in, e.g, U.S. Pat. No. 5,869,620. Additional exemplary
- the multispecific antigen-binding constmct of the present invention is a bispecific antibody.
- Bispecific antibodies according to the present disclosure can be generated against PD-1 and PD-L1, or against PD-1 and PD-L2.
- the antibody arms of the bispecific antibody can be generated by standard techniques, as disclosed herein.
- any known antibodies against PD-1 and its ligand can be used to generate a bispecific antibody according to the present disclosure.
- bispecific constructs have been exemplified herein (see, for example, Pcmbrolizumab (PD-1 antibody) joined with Atezolizumab (PD-L1 antibody) in Figure 3; Nivolumab (PD-1 antibody) joined with Atezolizumab (PD-L1 antibody) in Figure 4).
- multispecific antigen-binding constructs e.g . , bispecific antibodies
- described herein can be generated using known and/or available antibodies in the art.
- the bispecific antibody is bivalent - e.g., one arm is monovalent for PD-1 while the other arm is monovalent for either PD-L1 or PD-L2, or both - e.g., cross-reacts with both ligands).
- the bispecific antibody is tetravalent, such as the novel Bispecific 3 and Bispecific 4 antibodies described herein.
- the Pembrolizumab binding arm is bivalent for PD-1, each binding the same epitope on PD-1, while the Atezolizumab binding arm is bivalent for PD- Ll, each binding the same epitope on PD-L1.
- the bispecific format in Figure 8 (the exemplary common light chain bispecific illustrated in the left panel of step 2 of the workflow presented in Figure 8).
- the exemplary common light chain bispecific format in Figure 8 (the format illustrated in the right panel of step 2 of the workflow) represents another example of a tetravalent bispecific format.
- each Fab of the first antigen binding arms is joined to each Fab of the second antigen binding arm.
- one a Fab of the first antigen binding arm is linked to a Fab of the second antigen binding arm using a linker, where each antigen binding arm shares a common light chain. See, Figure 8, the format illustrated in the right panel of step 2 of the workflow'.
- the bispecific antibody is tetravalent, wherein one arm is bivalent for PD-1, each binding two different epitopes on PD-1. In some embodiments, the bispecific antibody is tetravalent, wherein one arm is bivalent for a ligand of PD-1 (PD-L1 and/or PD-L2), each binding two different epitopes on a ligand of PD- 1. In some embodiments, the bispecific antibody is tetravalent, wherein one arm is bivalent for PD-1, each binding two different but overlapping epitopes on PD-1.
- the bispecific antibody is tetravalent, wherein one arm is bivalent for PD-1 ligand (PD-L1 and/or PD-L2), each binding two different but overlapping epitopes on the PD-1 ligand (PD-L1 and/or PD-L2). In some embodiments, the bispecific antibody is tetravalent, wherein one arm is bivalent for PD-1 and each binds the same epitope on PD-1.
- the bispecific antibody is tetravalent, wherein one arm is bivalent for a PD-1 ligand (PD-L1 and/or PD-L2), and each binds the same epitope on the PD-1 ligand (PD-L1 and/or PD-L2).
- the bispecific antibody is tetravalent, where one arm is bivalent for a same epitope on PD-1 ; and the other arm is bivalent for a same epitope on a PD-1 ligand (PD-L1 and/or PD-L2).
- the bispecific antibody is an antagonist of both PD-1 and POLL In some embodiments, the bispecific antibody is an antagonist of both PD-1 and PD-L2. In some embodiments, the bispecific antibody is an antagonist of PD-1 and both ligands PD/LI and PD-L2 (e.g, cross reacts with both ligands).
- the first antigen-binding arm and the second antigen-binding arm are linked by at least one amino linker amino acid sequence.
- the linker amino acid sequence comprises GGGGSx (SEQ ID NO: 121), wherein x is an integer between and including 1 to 6.
- the multispecific antigen-binding construct does not comprise an immunoglobulin Fc domain.
- the construct comprises an immunoglobulin Fc domain.
- the first arm or second arm, or both, of the construct comprises a heavy chain comprising one or more immunoglobulin Fc modifications.
- the immunoglobulin Fc domain of the heavy chain comprises one or more amino acid mutations that, e.g., promote heterodimerization of the first and second arms, promote serum half-life, and/or modify effector function.
- the mutation is present in a CH3 domain of the heavy chain. See, e.g, Xu et al., mAbs 7(1): 231-42, 2015.
- one means by which interaction between specific polypeptides may be promoted is by engineering protuberance-into-cavity (knob-into-holes) complementary regions such as described in Arathoon et al., U.S.7, 183,076; Carter et al., U.S.5,731,168; and Kumar et al., WO 2016/164089, incorporated herein by reference in their entireties.
- Protuberances are constructed by replacing small amino acid side chains from the interface of the first polypeptide (e.g., a first interaction pair) with larger side chains (e.g., tyrosine or tryptophan).
- Complementary“cavities” of identical or similar size to the protuberances are optionally created on the interface of the second polypeptide (e.g., a second interaction pair) by replacing large amino acid side chains with smaller ones (e.g. , alanine or threonine).
- protein complexes disclosed herein make use of the attractive interactions for promoting heteromultimer formation (e.g. , heterodimer formation), and optionally repulsive interactions for hindering homodimer formation (e.g. , homodimer formation) by carrying out site directed mutagenesis of charged interface residues.
- the IgGl CH3 domain interface comprises four unique charge residue pairs involved in domain-domain interactions: Asp356-Lys439’, Glu357-Lys370’, Lys392- Asp399’, and Asp399-Lys409’ [residue numbering in the second chain is indicated by Q] .
- Q Asp399-Lys409
- the numbering scheme used here to designate residues in the IgGl CH3 domain conforms to the EU numbering scheme of Kabat. Due to the 2-fold symmetry present in the CH3-CH3 domain interactions, each unique interaction will be represented twice in the structure (e.g, Asp-399-Lys409’ and Lys409-Asp399’).
- K409-D399’ favors both heterodimer and homodimer formation.
- a single mutation switching the charge polarity (e.g., K409E; positive to negative charge) in the first chain leads to unfavorable interactions for the formation of the first chain homodimer. The unfavorable interactions arise due to the repulsive interactions occurring between the same charges (negative-negative; K409E-D399' and D399-K409E’).
- a similar mutation switching the charge polarity (D399K’; negative to positive) in the second chain leads to unfavorable interactions (K409’-D399K’ and D399K-K409’) for the second chain homodimer formation.
- the multispecific antigen-binding constructs (e.g., bispecific constructs) described herein can comprise a constant domain of an
- a first arm may comprise an amino acid sequence that is derived from an Fc domain of an IgG (lgGl, IgG2, IgG3, or IgG4), IgA (IgAl or IgA2), IgE, or IgM immunoglobulin.
- a second arm may comprise an amino acid sequence that is derived from an Fc domain of an IgG (IgGl, lgG2, lgG3, or IgG4), IgA (IgAl or IgA2), IgE, or IgM.
- immunoglobulin domains may comprise one or more amino acid modifications (e.g. , deletions, additions, and/or substitutions) that promote heterodimer formation.
- a multispecific antigen-binding construct is of the IgGl isotype.
- a multispecific antigen-binding construct is of the IgGl isotype and comprises a substitution.
- a multispecific antigen-binding construct is of the IgG3 isotype.
- a multispecific antigen-binding construct is of the IgG4 isotype.
- a multispecific antigen-binding construct is of the IgG4 isotype and comprises a substitution.
- the substitution is at Ser228 when numbered according to EU numbering.
- tire substitution at Ser228 is S228P.
- a first arm and a second arm comprise Fc domains derived from the same immunoglobulin class and subtype.
- a first arm and a second arm comprise Fc domains derived from different immunoglobulin classes or subtypes.
- a first arm and/or a second arm e.g., an asymmetric pair or an unguided interaction pair
- a modified constant domain of an immunoglobulin including, for example, one or more amino acid modifications (e.g, deletions, additions, and/or substitutions) that promote heterodimer formation.
- amino acid modifications e.g, deletions, additions, and/or substitutions
- the Fc domain can be modified to enhance serum half-life of the multispecific antigen-binding construct disclosed herein.
- Fc domains comprising one or more mutations which enhance or diminish antibody binding to the Fc receptor, e.g., at acidic pH as compared to neutral pH, are known in the art.
- the constructs disclosed herein may comprise a mutation in the CH2 or a CH3 region of the Fc domain, wherein the mutation(s) increases the affinity of the Fc domain to FcRn in an acidic environment (e.g, in an endosome where pH ranges from about 5.5 to about 6.0). Such mutations may result in an increase in serum half-life of the construct when administered to an animal.
- Methods of modifying the Fc domain for desired characteristics, such as enhanced serum half-life are known in the art.
- the constructs described herein comprise an altered heavy chain constant region that has reduced (or no) effector function relative to its corresponding unaltered constant region.
- Effector functions involving the constant region of the constructs described herein may be modulated by altering properties of the constant or Fc region.
- Altered effector functions include, for example, a modulation in one or more of the following activities: antibody-dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC), apoptosis, binding to one or more Fc-receptors, and pro-inflammatory responses.
- ADCC antibody-dependent cellular cytotoxicity
- CDC complement-dependent cytotoxicity
- apoptosis binding to one or more Fc-receptors
- pro-inflammatory responses include, for example, a modulation in one or more of the following activities: antibody-dependent cellular cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC), apoptosis, binding to one or more Fc-receptors, and pro-inflammatory responses.
- An altered constant region with altered FcR binding affinity and/or ADCC activity and/or altered CDC activity is a polypeptide which has either an enhanced or diminished FcR binding activity and/or ADCC activity and/or CDC activity compared to the unaltered form of the constant region.
- An altered constant region which displays increased binding to an FcR binds at least one FcR with greater affinity than the unaltered polypeptide.
- An altered constant region which displays decreased binding to an FcR binds at least one FcR with lower affinity than the unaltered form of the constant region.
- Such variants which display decreased binding to an FcR may possess little or no appreciable binding to an FcR, e.g.
- 0 to 50% e.g, less than 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1%) of the binding to the FcR as compared to the level of binding of a native sequence immunoglobulin constant or Fc region to the FcR Similarly, an altered constant region that displays modulated ADCC and/or CDC activity may exhibit either increased or reduced ADCC and/or CDC activity compared to the unaltered constant region.
- any one or more of the antibodies described herein comprising an altered constant region can exhibit approximately 0 to 50% (e.g, less than 50, 49, 48, 47, 46, 45, 44, 43, 42, 41, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1%) of the ADCC and/or CDC activity of the unaltered form of the constant region.
- a multispecific antigen-binding construct described herein comprising an altered constant region displaying reduced ADCC and/or CDC can exhibit reduced or no ADCC and/or CDC activity'.
- the multispecific antigen-binding constructs described herein exhibit reduced or no effector function.
- the multispecific antigenbinding constructs comprise a hybrid constant region, or a portion thereof, such as a G2/G4 hybrid constant region (see e.g. , Burton et al. ( 1992) Adv Immun 51:1-18; Canfield et al.
- the multispecific antigen-binding constructs described herein can contain an altered constant region exhibiting enhanced or reduced complement dependent cytotoxicity (CDC).
- Modulated CDC activity can be achieved by introducing one or more amino acid substitutions, insertions, or deletions in an Fc region of the antibody. See, e.g., U.S. patent no. 6,194,551.
- constructs and antigen-binding arms described herein can comprise, in part, scaffold domains, proteins, or portions, e.g, molecules which do not provide target receptorbinding activity, but which can provide a portion or domain of the construct which provides spatial organization, structural support, a means of linking of multiple receptor-binding units, or other desired characteristics, e.g, improved half-life.
- Various scaffold technologies and compositions are known in the art and can be readily linked or conjugated to the antigenbinding units described herein.
- the scaffold domain, protein, or portion can be derived from an antibody or not derived from an antibody.
- Such scaffold proteins, and domains thereof are, generally, obtained through combinatorial chemistry-based adaptation of preexisting antigen-binding proteins.
- Non-antibody protein scaffolds can be considered to fell into two structural categories, domain-sized constructs (in the range of 6 to 20 kDa), and constrained peptides (in the 2-4 kDa range).
- Domain-sized non-antibody scaffolds include, but are not limited to, affibodies, affilins, anticalins, atrimers, DARPins, FN3 scaffolds (such as adnectins and centyrins), fynomers, Kunitz domains, pronecdns and OBodies.
- Peptide-sized non-antibody scaffolds include, for example, avimers, bicyclic peptides and cysteine knots.
- nonantibody scaffolds and the underlying proteins or peptides on which they are based or from which they have been derived are reviewed by, e.g., Simeon and Chen, Protein Cell 9(1): 3- 14 (2016); Vazquez-Lombardi etal, Drag Discovery Today 20: 1271-1283 (2015), and by Binz etal, Nature Biotechnol. 23: 1257-1268 (2005), the contents of each of which are herein incorporated by reference in their entireties.
- Advantages of using non-antibody scaffolds include increased affinity, target neutralization, and stability.
- Various non-antibody scaffolds also can overcome some of the limitations of antibody scaffolds, e.g. , in terms of tissue penetration, smaller size, and thermostability.
- non-antibody scaffolds can also permit easier construction, not being hindered, for example, by the light chain association issue when bispecific constructs are desired.
- Methods of constructing constructs on a nonantibody scaffold are known to those of ordinary skill in the art. While not formally on an antibody scaffold, such constructs often include antibody binding domains, whether in the form of single-domain antibodies, scFvs or other antibody binding-domain variants that provide specific target-binding capabilities.
- a construct can comprise anon-antibody scaffold protein.
- at least one of the receptor-binding units can comprise a non-antibody scaffold protein.
- the scaffold portion of a nonantibody scaffold protein can include, in some embodiments, e.g., an adnectin scaffold or a portion derived from human tenth fibronectin type IP domain (10Fn3); an anticalin scaffold derived from human lipocalin (e.g, such as those described in, e.g, W02015/104406); an avimer scaffold or a protein fragment derived from the A-domain of low density-related protein (LRP) and/or very low density lipoprotein receptor (VLDLR); a fynomer scaffold or portion of the SH3 domain of FYN tyrosine kinase; a kunitz domain scaffold or portion of Kunitz-type protease inhibitors
- elaterium an affibody scaffold or all or part of the Z domain of S. aureus protein A; a b-Hairpin mimetic scaffold; a Designed ankyrin repeat protein (DARPin) scaffold or artificial protein scaffolds based on ankyrin repeat (AR) proteins; or any scaffold derived or based on human transferrin, human CTLA-4, human crystallin, and human ubiquitin.
- DARPin Designed ankyrin repeat protein
- AR ankyrin repeat
- the binding site of human transferrin for human transferrin receptor can be diversified to create a diverse library of transferrin variants, some of which have acquired affinity for different antigens. See, e.g., Ali etal. (1999) J Biol Chem. 274:24066- 24073.
- the portion of human transferrin not involved with binding the receptor remains unchanged and serves as a scaffold, like framework regions of antibodies, to present the variant binding sites.
- the libraries are then screened, as an antibody library is, and in accordance with the methods described herein, against a target antigen of interest to identify those variants having optimal selectivity and affinity for the target antigen. See, e.g., Hey et al. (2005 ) TRENDS Biotechnol. 23(10):514-522.
- methods for producing the construct of the present invention includes methods for preparing an antibody, and/or fragments thereof as described herein. Such methods are well-known in the art, and can include, e.g. , immunizing a subject (e.g. , a non-human mammal) with an appropriate immunogen. For example, to generate an antibody that binds to PD-1, a skilled artisan can immunize a suitable subject (e.g.
- a non-human mammal such as a rat, a mouse, a gerbil, a hamster, a dog, a cat, a pig, a goat, a horse, or a non-human primate
- a full-length PD-1 polypeptide such as a full-length human PD-1 polypeptide comprising the amino acid sequence depicted in SEQ ID NO.: 114 (GenBank accession number NP_005009.2; UniProt Q 15116), an antigenic fragment thereof, and/or variant thereof.
- a skilled artisan can immunize a suitable subject with a full-length PD-L1 polypeptide such as a full-length human PD-L1 polypeptide comprising the amino acid sequence depicted in SEQ ID NO.: 115 (GenBank accession number NP 054862.1, UniProt Q9NZQ7), an antigenic fragment thereof, and/or variant thereof.
- a full-length PD-L1 polypeptide such as a full-length human PD-L1 polypeptide comprising the amino acid sequence depicted in SEQ ID NO.: 115 (GenBank accession number NP 054862.1, UniProt Q9NZQ7), an antigenic fragment thereof, and/or variant thereof.
- a skilled artisan can immunize a suitable subject with a full-length PD-L2 polypeptide such as a full-length human PD-L2 polypeptide comprising the amino acid sequence depicted in SEQ ID NO.: 116 (GenBank accession number NP_079515.2, UniProt Q9BQ51), an antigenic fragment thereof, and/or variant thereof.
- a full-length PD-L2 polypeptide such as a full-length human PD-L2 polypeptide comprising the amino acid sequence depicted in SEQ ID NO.: 116 (GenBank accession number NP_079515.2, UniProt Q9BQ51), an antigenic fragment thereof, and/or variant thereof.
- a full-length polypeptide (PD-1, PD-L1, or PD-L2) can be used as an antigen and antibodies can be screened for desired binding properties (e.g, blocks PD- 1/ligand interaction; capacity ⁇ to bridge cells on which PD-1 and its ligand are expressed).
- antigenic fiagments of a polypeptide (PD-1, PD-L1, or PD-L2) can be selected based on known structural features of the polypeptide. For example, the PD-1/PD-L1 and PD-1ZPD-L2 interactions have been structurally well -characterized (see, e.g., Zak, K., et al.
- regions within, e.g., PD-1, PD-L1, and/or PD-L2, based on receptor/ligand interface information available in the art, can be used to design a suitable antigenic fragment having desired binding properties.
- the PD- 1 ectodomain contains a single IgV domain typical of the CD28 family, wherein PD-L1 and PD-L2 are composed of IgV and IgC domains typical of the B7 family.
- the structures of PD-1 , PD-L1 and/or PD-L2 show a 1 : 1 stoichiometry, with interaction primarily between the faces of the IgV domains.
- An IgV domain comprises about 120 amino aieds organized into nine parallel beta strands (ABCC’C’DEFG) with loops connecting the strands.
- PD-1 uses the front beta-face (GFCC’ strands and CC ⁇ CC”, and FG loops) to bind to the beta-face of PD-L1 (GFCC’) or PD-L2 (AGFC strands and FG loop).
- six amino acids of the C, F, and G strands of PD-1 form a concave, hydrophobic core that interacts with the F and G strands as well as the FG loop of PD-L2.
- Eight if 14 residues involved in binding to PD-1 are indentical or highly conserved between PD-L1 and PD-L2.
- those of skill in the art can determine suitable antigenic regions to generate antibodies having desirable properties. For example, those of skill in the art can generate an antibody that cross reacts with both ligands PD-L1 and PD-L2 (see, e.g, US Patent 9845356).
- a suitable subject e.g, a non-human mammal
- the immunogen can be administered to a subject (e.g, a non-human mammal) with an adjuvant.
- Adjuvants useful in producing an antibody in a subject include, but are not limited to, protein adjuvants; bacterial adjuvants, e.g, whole bacteria (BCG, Corynebacterium parvum or Salmonella minnesotd) and bacterial components including cell wall skeleton, trehalose dimycolate, monophosphoryl lipid A, methanol extractable residue (MER) of tubercle bacillus, complete or incomplete Freund’s adjuvant; viral adjuvants; chemical adjuvants, e.g, aluminum hydroxide, and iodoacetate and cholesteryl hemisuccinate.
- Other adjuvants that can be used in the methods for inducing an immune response include, e.g.
- the methods include preparing a hybridoma cell line that secretes a monoclonal antibody that binds to the immunogen.
- a suitable mammal such as a laboratory mouse is immunized with a polypeptide (e.g., PD-1, PD-L1, PD-L2) or antigenic fragment as described above.
- Antibody-producing cells e.g., B cells of the spleen
- the cells can be fused in the presence of a fusion promoter such as, e.g.
- the hybrid cells obtained in the fusion are cloned, and cell clones secreting the desired antibodies are selected.
- spleen cells of Balb/c mice immunized with a suitable immunogen can be fused with cells of the myeloma cell line PAI or the myeloma cell line Sp2/0-Ag 14.
- the cells are expanded in suitable culture medium, which is supplemented with a selection medium, for example HAT medium, at regular intervals in order to prevent normal myeloma cells from overgrowing the desired hybridoma cells.
- suitable culture medium which is supplemented with a selection medium, for example HAT medium, at regular intervals in order to prevent normal myeloma cells from overgrowing the desired hybridoma cells.
- the obtained hybridoma cells are then screened for secretion of the desired antibodies, e.g, an antibody that binds to PD-1.
- a skilled artisan can identify an anti -PD-1 antibody from a non-immune biased library as described in, e.g, U.S. patent no. 6,300,064 (to Knappik et al.; Morphosys AG) and Schoonbroodt et al. (2005) Nucleic Acids Res 33(9):e81.
- the methods described herein can involve, or be used in conjunction with, e.g, phage display technologies, bacterial display, yeast surface display, eukaryotic viral display, mammalian cell display, and cell-free (e.g, ribosomal display) antibody screening techniques (see, e.g., Etz et al. (200 V J Bacteriol 183:6924-6935;
- phage display methods functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them.
- phage can be utilized to display antigen-binding domains of antibodies, such as Fab, Fv, or disulfide- bond stabilized Fv antibody fragments, expressed from a repertoire or combinatorial antibody library (e g., human or murine).
- Phage used in these methods are typically filamentous phage such as fd and M13.
- the antigen binding domains are expressed as a rccombinantly-fused protein to any of the phage coat proteins pH!, pVIII, orpIX. See, e.g., Shi et al. (2010) JMB 397:385-396. Examples of phage display methods that can be used to make the
- immunoglobulins, or fragments thereof, described herein include those disclosed in Brinkman et al. (1995) J Immunol Methods 182:41-50; Ames et al. (1995) J Immunol Methods 184: 177- 186; Kettleborough et al. (1994) EurJ Immunol 24:952-958; Persic et al. (1997) Gene 187:9- 18; Burton et al. (1994) Advances in Immunology 57: 191-280; and PCT publication nos. WO 90/02809, WO 91/10737, WO 92/01047, WO 92/18619, WO 93/11236, WO 95/15982, and
- WO 95/20401 Suitable methods are also described in, e.g., U.S. patent nos. 5,698,426; 5,223,409; 5,403,484; 5,580,717; 5,427,908; 5,750,753; 5,821,047; 5,571,698; 5,427,908; 5,516,637; 5,780,225; 5,658,727; 5,733,743 and 5,969,108.
- the phage display antibody libraries can be generated using mRNA collected from B cells from the immunized mammals.
- a splenic cell sample comprising B cells can be isolated from mice immunized with a PD-1 polypeptide as described above.
- mRNA can be isolated from the cells and converted to cDNA using standard molecular biology techniques. See, e.g., Sambrook et al. (1989)“Molecular Cloning: A Laboratory Manual, 2 nd Edition,” Cold Spring Harbor Laboratory- Press, Cold Spring Harbor, N.Y.; Harlow and Lane (1988), supra, ⁇ Benny K. C. Lo (2004), supra, ⁇ and Borrebaek (1995), supra.
- the cDNA coding for the variable regions of the heavy chain and light chain polypeptides of immunoglobulins are used to construct the phage display library.
- Methods for generating such a library- are described in, e.g., Merz et al. (1995) JNeurosci Methods 62(l-2):213-9; Di Niro et al. (2005) Biochem J 388(Pt 3):889-894; and Engberg et al. (1995) Methods Mol Biol 51 :355-376.
- a combination of selection and screening can be employed to identify an antibody of interest from, e.g. , a population of hybridoma-derived antibodies or a phage display antibody library.
- Suitable methods are known in the art and are described in, e.g., Hoogenboom (1997) Trends in Biotechnology 15:62-70; Brinkman et al. (1995), supra, ⁇ Ames et al. (1995), supra, ⁇ Kettleborough et al. (1994), supra, ⁇ Persic et al. (1997), supra, ⁇ and
- phagemid vectors each encoding a fusion protein of a bacteriophage coat protein (e.g, pill, pVIII, or pIX of Ml 3 phage) and a different antigen-combining region are produced using standard molecular biology techniques and then introduced into a population of bacteria (e.g. , E. coli).
- a population of bacteria e.g. , E. coli.
- Expression of the bacteriophage in bacteria can, in some embodiments, require use of a helper phage. In some embodiments, no helper phage is required (see, e.g. , Chasteen et al., (2006) Nucleic Acids Res 34(21):el45).
- Phage produced from the bacteria are recovered and then contacted to, e.g, a target antigen bound to a solid support (immobilized). Phage may also be contacted to antigen in solution, and the complex is subsequently bound to a solid support.
- a subpopulation of antibodies screened using the above methods can be characterized for their specificity and binding affinity for a particular antigen (e.g, human PD-1) using any immunological or biochemical based method known in the art.
- a particular antigen e.g, human PD-1
- specific binding of an antibody to PD-1 may be determined for example using immunological or biochemical based methods such as, but not limited to, an ELISA assay, SPR assays, immunoprccipitation assay, affinity chromatography, and equilibrium dialysis as described above.
- Immunoassays which can be used to analyze immunospecific binding and cross-reactivity of the antibodies include, but are not limited to, competitive and non-competitive assay systems using techniques such as Western blots, RIA, ELISA (enzyme linked immunosorbent assay), “sandwich” immunoassays, immunoprecipitation assays, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, and protein A immunoassays. Such assays are routine and well known in the art.
- nucleic acids encoding the CDRs can be chemically synthesized as described in, e.g, Shiraishi et al. (2007) Nucleic Acids Symposium Series 51(1): 129-130 and U.S. Patent No. 6,995,259.
- nucleic acid sequence encoding an acceptor antibody the region of the nucleic acid sequence encoding the CDRs can be replaced with the chemically synthesized nucleic acids using standard molecular biology techniques.
- the 5’ and 3’ ends of the chemically synthesized nucleic acids can be synthesized to comprise sticky end restriction enzyme sites for use in cloning the nucleic acids into the nucleic acid encoding the variable region of the donor antibody.
- fragments of chemically synthesized nucleic acids, together capable of encoding an antibody can be joined together using DNA assembly techniques known in the art (e.g. Gibson Assembly).
- Any antibody of choice can be further modified to generate an antigen-binding fragment, as described herein, and/or manipulated using known techniques in the art to generate the multispecific antigen-binding constmcts as described herein.
- cross-linking methods can be used to generate a bispecific structure using a
- heterobifunctional reagent having an amine-reactive group and a sulfhydryl reactive group as described in, e.g., U.S. Pat. No. 4,433,059
- bispecific antibody determinants can be generated by recombining half antibodies (heavy-light chain pairs or Fabs) from different antibodies through cycle of reduction and oxidation of disulfide bonds betw een the two heavy chains, as described in, e.g., U.S. Pat. No. 4,444,878
- trifunctional antibodies e.g., three Fab' fragments can be cross-linked through sulfhdryl reactive groups, as described in, e.g., U.S. Pat. No. 5,273,743.
- the multispecific antigen-binding constmcts thereof described herein can be produced using a variety of techniques known in the art of molecular biology and protein chemistry.
- a nucleic acid encoding the multispecific antigen-binding construct (as a single multifunctional polypeptide, or as separate molecules of a multimeric complex - e.g, one antigen-binding arm separately from the other antigen-binding arm) can be inserted into an expression vector that contains transcriptional and translational regulatory sequences, which include, e.g, promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, transcription terminator signals, polyadenylation signals, and enhancer or activator sequences.
- the regulatory sequences include a promoter and transcriptional start and stop sequences.
- the expression vector can include more than one replication system such that it can be maintained in two different organisms, for example in mammalian or insect cells for expression and in a prokaryotic host for cloning and amplification.
- Several possible vector systems are available for the expression of cloned heavy chain and light chain polypeptides from nucleic acids in mammalian cells.
- One class of vectors relies upon the integration of the desired gene sequences into the host cell genome.
- Cells which have stably integrated DNA can be selected by simultaneously introducing drag resistance genes such as E. coli gpt (Mulligan and Berg (1981) Proc Natl Acad Sci USA 78:2072) or Tn5 neo (Southern and Berg (1982) MolAppl Genet 1:327).
- the selectable marker gene can be either linked to the DNA gene sequences to be expressed, or introduced into the same cell by co-transfection (Wigler et al. (1979) Cell 16:77).
- a second class of vectors utilizes DNA elements which confer autonomously replicating capabilities to an extrachromosomal plasmid.
- These vectors can be derived from animal viruses, such as bovine papillomavirus (Sarver et al. (1982) Proc Natl Acad Sci USA, 79:7147),
- cytomegalovirus cytomegalovirus
- polyoma virus Deans et al. (1984) Proc Natl Acad Sci USA 81 : 1292
- SV40 vims SV40 vims
- the expression vectors can be introduced into cells in a manner suitable for subsequent expression of the nucleic acid.
- the method of introduction is largely dictated by the targeted cell type, discussed below.
- Exemplary methods include CaPO* precipitation, liposome fusion, cationic liposomes, electroporation, viral infection, dextran-mediated transfection, polybrene-mediated transfection, protoplast fusion, and direct microinjection.
- Appropriate host cells for the expression of antibodies or antigen-binding fragments thereof include yeast, bacteria, insect, plant, and mammalian cells. Of particular interest are bacteria such as E. coli, fungi such as Saccharomyces cerevisiae and Pichia pastoris, insect cells such as SF9, mammalian cell lines (e.g., human cell lines), as well as primary cell lines.
- an antibody or fragment thereof can be expressed in, and purified from, transgenic animals (e.g., transgenic mammals).
- transgenic animals e.g., transgenic mammals
- an antibody can be produced in transgenic non-human mammals (e.g, rodents) and isolated from milk as described in, e.g., Houdebine (2002) Curr Opin Biotechnol 13(6):625-629; van Kuik- Romeijn et al. (2000) Transgenic Res 9(2): 155-159; and Pollock et al. (1999) J Immunol Methods 231(1-2): 147-157.
- the antibodies and fragments thereof can be produced from the cells by culturing a host cell transformed wife the expression vector containing nucleic acid encoding the antibodies or fragments, under conditions, and for an amount of time, sufficient to allow expression of the proteins.
- Such conditions for protein expression will vary with the choice of the expression vector and the host cell, and will be easily ascertained by one skilled in the art through routine experimentation.
- antibodies expressed in E. coli can be refolded from inclusion bodies (see, e.g., Hou et al. (1998) Cytokine 10:319-30).
- antibodies and fragments thereof can be isolated.
- An antibody or fragment thereof can be isolated or purified in a variety of ways known to those skilled in the art depending on what other components are present in the sample. Standard purification methods include electrophoretic, molecular, immunological, and
- an antibody can be purified using a standard anti-antibody column (e.g, aprotein-A or protein-G column).
- Ultrafiltration and diafiltration techniques, in conjunction with protein concentration, are also useful. See, e.g., Scopes (1994)“Protein Purification, 3 rd edition,” Springer-Veriag, New York City, New York. The degree of purification necessary will vary depending on tire desired use. In some instances, no purification of the expressed antibody or fragments thereof will be necessary.
- Methods for determining the yield or purity of a purified antibody or fragment thereof include, e.g. , Bradford assay, UV spectroscopy, Biuret protein assay, Lowry protein assay, amido black protein assay, high pressure liquid chromatography
- HPLC high resolution liquid crystal display
- MS mass spectrometry
- gel electrophoretic methods e.g, using a protein stain such as Coomassie Blue or colloidal silver stain.
- the multispecific antigen-binding constructs can be modified following their expression and purification as a single multifunctional polypeptide, or as separate molecules of a multimeric complex - e.g, one antigen-binding arm separately from the other antigenbinding arm.
- the modifications can be covalent or non-covalent modifications.
- Such modifications can be introduced into the antibodies or antigen-binding fragments by, e.g, reacting targeted amino acid residues of the polypeptide with an organic derivatizing agent that is capable of reacting with selected side chains or terminal residues.
- Suitable sites for modification can be chosen using any of a variety' of criteria including, e.g. , structural analysis or amino acid sequence analysis of the antibodies or fragments.
- amino acid sequences provided herein are set forth in single-letter amino acid code which can be used interchangeably with three-letter amino acid code.
- An amino acid refers to any monomer unit that can be incorporated into a peptide, polypeptide, or protein.
- the twenty natural or genetically encoded alpha-amino acids are as follows: alanine (Ala or A), arginine (Arg or R), asparagine (Asn or N), aspartic acid (Asp or D), cysteine (Cys or C), glutamine (Gin or Q), glutamic acid (Glu or E), glycine (Gly or G), histidine (His or H), isoleucine (lie or I), leucine (Leu or L), lysine (Lys or K), methionine (Met or M), phenylalanine (Phe or F), praline (Pro or P), serine (Ser or S), threonine (Thr or T), tryptophan (Tr
- amino acid also includes unnatural amino acids, modified amino acids (e.g., having modified side chains and/or backbones), and amino acid analogs.
- nucleic acids or polypeptide sequences refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same (e.g., 90%, or 95% or greater identity over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms or by manual alignment and visual inspection.
- Identity or similarity with respect to a sequence is defined as the percentage of amino acid residues in the candidate sequence that are identical (i.e. , same residue) with the starting amino acid residues, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity.
- Methods of alignment of sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be conducted, for example, by the local homology algorithm of Smith and Waterman (Adv. Appl. Math. 2:482, 1970), by the homology alignment algorithm of Needleman and Wunsch (J. Mol. Biol. 48:443, 1970), by the search for similarity method of Pearson and Lipman
- Nonconservative substitutions for example, substituting a proline with glycine, are also contemplated.
- the constructs, antibodies or antigen-binding portions thereof can be conjugated to a heterologous moiety.
- the heterologous moiety can be, e.g., a heterologous polypeptide, a therapeutic agent (e.g., a toxin or a drug), or a detectable label such as, but not limited to, a radioactive label, an enzymatic label, a fluorescent label, a heavy metal label, a luminescent label, or an affinity tag such as biotin or streptavidin.
- Suitable heterologous polypeptides include, e.g, an antigenic tag (e.g., FLAG (DYKDDDDK) (SEQ ID NO: 117), polyhistidine (6-His; HHHHHH (SEQ ID NO: 118)), hemagglutinin (HA; YPYDVPDYA (SEQ ID NO: 119)), glutathione-S-transferase (GST), or maltose-binding protein (MBP)) for use in purifying the antibodies or fragments.
- an antigenic tag e.g., FLAG (DYKDDDDK) (SEQ ID NO: 117), polyhistidine (6-His; HHHHHH (SEQ ID NO: 118)), hemagglutinin (HA; YPYDVPDYA (SEQ ID NO: 119)), glutathione-S-transferase (GST), or maltose-binding protein (MBP)
- an antigenic tag e.g
- Suitable radioactive labels include, e.g, 32 P, 33 P, 14 C, 125 1, 13 *1, 35 S, and 3 H.
- Suitable fluorescent labels include, without limitation, fluorescein, fluorescein isothiocyanate (FITC), green fluorescent protein (GFP), DYLIGHTTM 488, phycoerythrin (PE), propidium iodide (PI), PeiCP, PE-ALEXA FLUOR® 700, Cy5, allophycocyanin, and Cy7.
- Luminescent labels include, e.g.
- any of a variety of luminescent lanthanide (e.g, europium or terbium) chelates include the europium chelate of diethylene triamine pentaacetic acid (DTPA) or
- Enzymatic labels include, e.g, alkaline phosphatase, CAT, luciferase, and horseradish peroxidase.
- Two proteins e.g., an antibody and a heterologous moiety
- cross linkers are those which link two amino acid residues via a linkage that includes a“hindered” disulfide bond.
- a disulfide bond within the cross-linking unit is protected (by hindering groups on either side of the disulfide bond) from reduction by the action, for example, of reduced glutathione or the enzyme disulfide reductase.
- One suitable reagent 4- succinimidyloxycarbonyl-a-methyl-o(2-pyridyldithio) toluene (SMPT), forms such a linkage between two proteins utilizing a terminal lysine on one of the proteins and a terminal cysteine on the other.
- SMPT 4- succinimidyloxycarbonyl-a-methyl-o(2-pyridyldithio) toluene
- Heterobifunctional reagents that cross-link by a different coupling moiety on each protein can also be used.
- cross-linkers include, without limitation, reagents which link two amino groups (e.g., N-5-azido-2-nitrobenzoyloxysuccinimide), two sulfhydryl groups (e.g., 1,4-bis-maleimidobutane), an amino group and a sulfhydryl group (e.g, m- maleimidobenzoyl-N-hydroxysuccinimide ester), an amino group and a carboxyl group (e.g, 4-[p-azidosalicylamido]butylamine), and an amino group and a guanidinium group that is present in the side chain of arginine (e.g , p-azidophenyl glyoxal monohydrate).
- reagents which link two amino groups e.g., N-5-azido-2-nitrobenzoyloxysuccinimide
- two sulfhydryl groups e.g., 1,4
- a radioactive label can be directly conjugated to the amino acid backbone of the antibody.
- the radioactive label can be included as part of a larger molecule (e.g, 125 I in meta-[ 1M I]iodophenyl-N-hydroxysuccinimide ([ 125 I]mIPNHS) which binds to free amino groups to form meta-iodophenyl (mIP) derivatives of relevant proteins (see, e.g., Rogers et al. (1997) JNuclMed 38:1221-1229) or chelate (e.g., to DOTA or DTPA) which is in turn bound to the protein backbone.
- a larger molecule e.g, 125 I in meta-[ 1M I]iodophenyl-N-hydroxysuccinimide ([ 125 I]mIPNHS) which binds to free amino groups to form meta-iodophenyl (mIP) derivatives of relevant proteins (see, e.g.,
- Methods for conjugating a fluorescent label (sometimes referred to as a
- fluorophore to a protein (e.g. , an antibody) are known in the art of protein chemistry.
- fluorophores can be conjugated to free amino groups (e.g, of lysines) or sulfhydryl groups (e.g, cysteines) of proteins using succinimidyl (NHS) ester or tetrafluorophenyl (IFF) ester moieties attached to the fluorophores.
- the fluorophores can be conjugated to a heterobifunctional cross-linker moiety such as sulfo-SMCC.
- Suitable conjugation methods involve incubating an antibody protein, or fragment thereof, with the fluorophore under conditions that facilitate binding of the fluorophore to the protein. See, e.g., Welch and Redvanly (2003)“Handbook ofRadiopharmaceuticals: Radiochemistry and Applications,” John Wiley and Sons (ISBN 0471495603).
- the antibodies or fragments can be modified, e.g. , with a moiety that improves the stabilization and/or retention of the antibodies in circulation, e.g, in blood, serum, or other tissues.
- the antibody or fragment can be PEGylated as described in, e.g., Lee et al. (1999) Bioconjug Chem 10(6): 973-8; Kinstler et al. (2002) Advanced Drug Deliveries Reviews 54:477-485; and Roberts et al. (2002) Advanced Drug Delivery Reviews 54:459-476 or HESylated (Fresenius Kabi, Germany; see, e.g., Pavisic et al.
- the stabilization moiety can improve the stability, or retention of, the antibody (or fragment) by at least 1.5 (e.g. , at least 2, 5, 10, 15, 20, 25, 30, 40, or 50 or more) fold.
- the antibodies or antigen-binding fragments thereof described herein can be glycosylated.
- an antibody or antigen-binding fragment thereof described herein can be subjected to enzymatic or chemical treatment, or produced from a cell, such that the antibody or fragment has reduced or absent glycosylation.
- Methods for producing antibodies with reduced glycosylation are known in the art and described in, e.g., U.S. patent no. 6,933,368; Wright et al. (1991) EMBO J 10(10):2717-2723; and Co et al. (1993) Mol Immunol 30: 1361.
- the antibodies or antigen-binding fragments thereof are aglycosylated.
- the present disclosure also provides for a pharmaceutical composition
- a pharmaceutical composition comprising the multispecific antigen-binding constructs of the present disclosure with a pharmaceutically acceptable diluent, carrier, solubilizer, emulsifier, preservative and/or adjuvant to be used with the methods disclosed herein.
- Such pharmaceutical compositions can be used in a subject having e.g. , cancer, as disclosed herein.
- acceptable formulation materials preferably are nontoxic to recipients at the dosages and concentrations employed.
- the formulation material(s) are for s.c. and/or I.V. administration.
- the pharmaceutical composition can contain formulation materials for modifying, maintaining or preserving, for example, the pH, osmolality, viscosity, clarity, color, isotonicity, odor, sterility, stability, rate of dissolution or release, adsorption or penetration of the composition.
- suitable formulation materials include, but are not limited to, amino acids (such as glycine, glutamine, asparagine, arginine or lysine); antimicrobials; antioxidants (such as ascorbic acid, sodium sulfite or sodium hydrogen- sulfite); buffers (such as borate, bicarbonate, Tris-HCl, citrates, phosphates or other organic acids); bulking agents (such as mannitol or glycine); chelating agents (such as ethylenediamine tetraacetic acid (EDTA)); complexing agents (such as caffeine, polyvinylpyrrolidone, beta-cyclodextrin or
- hydroxypropyl-beta- cyclodextrin fillers; monosaccharides; disaccharides; and other carbohydrates (such as glucose, mannose or dextrins); proteins (such as serum albumin, gelatin or immunoglobulins); coloring, flavoring and diluting agents; emulsifying agents; hydrophilic polymers (such as polyvinylpyrrolidone); low molecular weight polypeptides; salt-forming counterions (such as sodium); preservatives (such as benzalkonium chloride, benzoic acid, salicylic acid, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid or hydrogen peroxide); solvents (such as glycerin, propylene glycol or polyethylene glycol); sugar alcohols (such as mannitol or sorbitol); suspending agents; surfactants or wetting agents (such as pluronics, PEG, sorbitan est
- the formulation comprises PBS; 20 rriM NaOAC, pH 5.2, 50 mM NaCl; and/or 10 mM NAOAC, pH 5.2, 9% Sucrose.
- the optimal pharmaceutical composition will be determined by one skilled in the art depending upon, for example, the intended route of administration, delivery format and desired dosage. See, for example, Remington's Pharmaceutical Sciences, supra. In certain embodiments, such compositions may influence the physical state, stability, rate of in vivo release and/or rate of in vivo clearance of the multispecific antigen-binding construct.
- the primary vehicle or carrier in a pharmaceutical composition can be either aqueous or non-aqueous in nature.
- a suitable vehicle or carrier can be water for injection, physiological saline solution or artificial cerebrospinal fluid, possibly supplemented with other materials common in compositions for parenteral administration.
- the saline comprises isotonic phosphate-buffered saline.
- neutral buffered saline or saline mixed with serum albumin are further exemplary vehicles.
- pharmaceutical compositions comprise Tris buffer of about pH 7.0-8.5, or acetate buffer of about pH 4.0-5.5, which can further include sorbitol or a suitable substitute therefore.
- a composition comprising the multispecific antigen-binding constructs disclosed herein can be prepared for storage by mixing the selected composition having the desired degree of purity with optional formulation agents (Remington's Pharmaceutical Sciences, supra) in the form of a lyophilized cake or an aqueous solution. Further, in certain embodiments, a composition comprising the multispecific antigen-binding construct disclosed herein can be formulated as a lyophilizate using appropriate excipients such as sucrose.
- the pharmaceutical composition can be selected for parenteral delivery. In certain embodiments, the compositions can be selected for inhalation or for delivery through the digestive tract, such as orally.
- the preparation of such pharmaceutically acceptable compositions is within the ability of one skilled in the art.
- the formulation components are present in concentrations that are acceptable to the site of administration.
- buffers are used to maintain the composition at physiological pH or at a slightly lower pH, typically within a pH range of from about 5 to about 8.
- a therapeutic composition when parenteral administration is contemplated, can be in the form of a pyrogen-free, parenterally acceptable aqueous solution comprising a multispecific antigen-binding construct, in a pharmaceutically acceptable vehicle.
- a vehicle for parenteral injection is sterile distilled water in which a multispecific antigen-binding construct is formulated as a sterile, isotonic solution, and properly preserved.
- the preparation can involve the formulation of the desired molecule with an agent, such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that can provide for the controlled or sustained release of the product which can then be delivered via a depot injection.
- an agent such as injectable microspheres, bio-erodible particles, polymeric compounds (such as polylactic acid or polyglycolic acid), beads or liposomes, that can provide for the controlled or sustained release of the product which can then be delivered via a depot injection.
- hyaluronic acid can also be used, and can have the effect of promoting sustained duration in the circulation.
- implantable drug delivery devices can be used to introduce the desired molecule.
- a pharmaceutical composition can be formulated for inhalation.
- a multispecific antigen-binding construct can be formulated as a dry powder for inhalation.
- an inhalation solution comprising a multispecific antigen-binding construct can be formulated with a propellant for aerosol delivery.
- solutions can be nebulized. Pulmonary
- formulations can be administered orally.
- a multispecific antigen-binding construct that is administered in this fashion can be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules.
- a capsule can be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre-systemic degradation is minimized.
- at least one additional agent can be included to facilitate absorption of a multispecific antigen-binding construct.
- diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders can also be employed.
- a pharmaceutical composition can involve an effective quantity of a multispecific antigen-binding construct in a mixture with non-toxic excipients which are suitable for the manufacture of tablets.
- suitable excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia; or lubricating agents such as magnesium stearate, stearic acid, or talc.
- sustained-release preparations can include semipermeable polymer matrices in the form of shaped articles, e.g. films, or microcapsules.
- Sustained release matrices can include polyesters, hydrogels, polylactides (U.S. Pat. No. 3,773,919 and EP 058,481), copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al., Biopolymers, 22:547-556 (1983)), poly (2-hydroxyethyl-methacrylate)
- sustained release compositions can also include liposomes, which can be prepared by any of several methods known in the art. See, e.g., Eppstein et al, Proc. Natl. Acad. Sci. USA, 82:3688-3692 (1985); EP 036,676; EP 088,046 and EP 143,949.
- the pharmaceutical composition to be used for in vivo administration typically is sterile. In certain embodiments, this can be accomplished by filtration through sterile filtration membranes. In certain embodiments, where the composition is lyophilized, sterilization using this method can be conducted either prior to or following lyophilization and reconstitution. In certain embodiments, the composition for parenteral administration can be stored in lyophilized form or in a solution. In certain embodiments, parenteral
- compositions generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- a sterile access port for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.
- the pharmaceutical composition once the pharmaceutical composition has been formulated, it can be stored in sterile vials as a solution, suspension, gel, emulsion, solid, or as a dehydrated or lyophilized powder. In certain embodiments, such formulations can be stored either in a ready-to-use form or in a form (e.g. , lyophilized) that is reconstituted prior to administration.
- kits are provided for producing a single-dose administration unit.
- the kit can contain both a first container having a dried protein and a second container having an aqueous formulation.
- kits containing single and multi-chambered pre-filled syringes e.g., liquid syringes and lyosyringes are included.
- the effective amount of a pharmaceutical composition comprising a multispecific antigen-binding construct to be employed therapeutically will depend, for example, upon the therapeutic context and objectives.
- the appropriate dosage levels for treatment will thus vary depending, in part, upon the molecule delivered, the indication for which a multispecific antigen-binding construct is being used, the route of administration, and the size (body weight, body surface or organ size) and/or condition (the age and general health) of the patient.
- the clinician can titer the dosage and modify the route of administration to obtain the optimal therapeutic effect.
- the frequency of dosing will take into account the pharmacokinetic parameters of a multispecific antigen-binding construct in the formulation used.
- a clinician will administer the composition until a dosage is reached that achieves the desired effect.
- the composition can therefore be administered as a single dose or as two or more doses (which may or may not contain the same amount of the desired molecule) over time, or as a continuous infusion via an implantation device or catheter. Further refinement of the appropriate dosage is routinely made by those of ordinary skill in the art and is within the ambit of tasks routinely performed by them.
- appropriate dosages can be ascertained through use of appropriate dose-response data.
- the route of administration of the pharmaceutical composition is in accord with known methods, e.g. orally, through injection by intravenous, intraperitoneal, intracerebral (intra-parenchymal), intrace rebroventricular, intramuscular, subcutaneously, intra-ocular, intraarterial, intraportal, or intralesional routes; by sustained release systems or by implantation devices.
- the compositions can be administered by bolus injection or continuously by infusion, or by implantation device.
- individual elements of the combination therapy may be administered by different routes.
- the composition can be administered locally via implantation of a membrane, sponge or another appropriate material onto which the desired molecule has been absorbed or encapsulated.
- the device can be implanted into any suitable tissue or organ, and delivery of the desired molecule can be via diffusion, timed-release bolus, or continuous administration.
- it can be desirable to use a pharmaceutical composition comprising a multispecific antigen-binding construct in an ex vivo manner. In such instances, cells, tissues and/or organs that have been removed from the patient are exposed to a pharmaceutical composition comprising a multispecific antigen-binding construct after which tire cells, tissues and/or organs are subsequently implanted back into the patient.
- a multispecific antigen-binding construct can be delivered by implanting certain cells that have been genetically engineered, using methods such as those described herein, to express and secrete the polypeptides.
- such cells can be animal or human cells, and can be autologous, heterologous, or xenogeneic.
- the cells can be immortalized.
- the cells in order to decrease the chance of an immunological response, the cells can be encapsulated to avoid infiltration of surrounding tissues.
- the encapsulation materials are typically biocompatible, semi-permeable polymeric enclosures or membranes that allow the release of the protein product(s) but prevent the destruction of the cells by the patient's immune system or by other detrimental factors from the surrounding tissues.
- the present disclosure provides a method of treating a proliferative disorder in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of a multispecific antigen-binding construct of the present disclosure.
- the present disclosure provides a method of enhancing an immune response (e.g.
- enhanced T cell function such as rescue from T cell functional exhaustion; enhanced T cell-mediated response; increased inflammtary cytokine secretion and/or production, e.g., IFNy secretion and/or production from T cells; enhanced NK cell function; enhanced macrophage function) in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of a multispecific antigen- binding construct of the present disclosure.
- the enhancement of the immune response is greater upon administration of the multispecific antigen-binding construct disclosed herein as compared to an agent (e.g., antibody) that binds either PD-1 or its ligand (e.g, PD-L1 or PD-L2), or a cocktail comprising an agent (e.g, antibody) that binds PD-1 and an agent (e.g, antibody) that binds its ligand.
- an agent e.g., antibody
- the enhancement of the immune response e.g. , enhanced T cell function, such as rescue from T cell functional exhaustion; enhanced T cell-mediated response; increased inflammtary cytokine, IFNysecretion and/or production from T cells; enhanced NK cell function;
- enhanced macrophage function is greater by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 100%, or more, as compared to an agent (e.g, antibody) that binds either PD-1 or its ligand, or a cocktail comprising an agent (e.g, antibody) that binds PD-1 and an agent (e.g, antibody) that binds its ligand.
- an agent e.g, antibody
- an agent e.g, antibody
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Peptides Or Proteins (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicinal Preparation (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020217014530A KR102929153B1 (ko) | 2018-11-13 | 2019-11-13 | 체크포인트 분자에 대한 다중특이적 결합 작제물 및 이의 용도 |
| MX2021005594A MX2021005594A (es) | 2018-11-13 | 2019-11-13 | Constructos multiespecificos de union contra moleculas de puntos de control y usos de los mismos. |
| AU2019379576A AU2019379576A1 (en) | 2018-11-13 | 2019-11-13 | Multispecific binding constructs against checkpoint molecules and uses thereof |
| BR112021008795-8A BR112021008795A2 (pt) | 2018-11-13 | 2019-11-13 | Construtos de ligação multiespecíficos contra moléculas de ponto de verificação e seus usos |
| CA3119161A CA3119161A1 (en) | 2018-11-13 | 2019-11-13 | Multispecific binding constructs against checkpoint molecules and uses thereof |
| EP19883556.3A EP3880716A4 (en) | 2018-11-13 | 2019-11-13 | MULTISPECIFIC BINDING CONSTRUCTS DIRECTED AGAINST CHECKPOINT MOLECULES AND ASSOCIATED USES |
| KR1020267004678A KR20260042520A (ko) | 2018-11-13 | 2019-11-13 | 체크포인트 분자에 대한 다중특이적 결합 작제물 및 이의 용도 |
| JP2021525728A JP7497351B2 (ja) | 2018-11-13 | 2019-11-13 | チェックポイント分子に対する多重特異性結合性構築物およびその使用 |
| CN202411951887.2A CN119735694A (zh) | 2018-11-13 | 2019-11-13 | 对抗检查点分子的多特异性结合构建体及其用途 |
| SG11202104864QA SG11202104864QA (en) | 2018-11-13 | 2019-11-13 | Multispecific binding constructs against checkpoint molecules and uses thereof |
| CN201980074538.8A CN113166269B (zh) | 2018-11-13 | 2019-11-13 | 对抗检查点分子的多特异性结合构建体及其用途 |
| IL283087A IL283087A (en) | 2018-11-13 | 2021-05-09 | Multispecific binding structures against checkpoint compounds and their uses |
| MX2025006617A MX2025006617A (es) | 2018-11-13 | 2021-05-12 | Constructos multiespecificos de union contra moleculas de puntos de control y usos de los mismos |
| MX2025006616A MX2025006616A (es) | 2018-11-13 | 2021-05-12 | Constructos multiespecificos de union contra moleculas de puntos de control y usos de los mismos |
| JP2024086951A JP7802858B2 (ja) | 2018-11-13 | 2024-05-29 | チェックポイント分子に対する多重特異性結合性構築物およびその使用 |
| JP2026001401A JP2026053733A (ja) | 2018-11-13 | 2026-01-07 | チェックポイント分子に対する多重特異性結合性構築物およびその使用 |
Applications Claiming Priority (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201862760801P | 2018-11-13 | 2018-11-13 | |
| US62/760,801 | 2018-11-13 | ||
| US201962855580P | 2019-05-31 | 2019-05-31 | |
| US62/855,580 | 2019-05-31 | ||
| US201962898991P | 2019-09-11 | 2019-09-11 | |
| US62/898,991 | 2019-09-11 | ||
| US201962931478P | 2019-11-06 | 2019-11-06 | |
| US62/931,478 | 2019-11-06 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2020102387A1 true WO2020102387A1 (en) | 2020-05-22 |
Family
ID=70731958
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2019/061226 Ceased WO2020102387A1 (en) | 2018-11-13 | 2019-11-13 | Multispecific binding constructs against checkpoint molecules and uses thereof |
Country Status (13)
| Country | Link |
|---|---|
| US (4) | US11046769B2 (cg-RX-API-DMAC7.html) |
| EP (1) | EP3880716A4 (cg-RX-API-DMAC7.html) |
| JP (3) | JP7497351B2 (cg-RX-API-DMAC7.html) |
| KR (2) | KR102929153B1 (cg-RX-API-DMAC7.html) |
| CN (2) | CN113166269B (cg-RX-API-DMAC7.html) |
| AU (1) | AU2019379576A1 (cg-RX-API-DMAC7.html) |
| BR (1) | BR112021008795A2 (cg-RX-API-DMAC7.html) |
| CA (1) | CA3119161A1 (cg-RX-API-DMAC7.html) |
| IL (1) | IL283087A (cg-RX-API-DMAC7.html) |
| MX (3) | MX2021005594A (cg-RX-API-DMAC7.html) |
| SG (1) | SG11202104864QA (cg-RX-API-DMAC7.html) |
| TW (2) | TWI840442B (cg-RX-API-DMAC7.html) |
| WO (1) | WO2020102387A1 (cg-RX-API-DMAC7.html) |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2021244392A1 (zh) * | 2020-06-02 | 2021-12-09 | 三生国健药业(上海)股份有限公司 | 一种抗pd1×pdl1的双特异性抗体 |
| EP3964530A4 (en) * | 2020-05-15 | 2023-01-18 | Sunshine Guojian Pharmaceutical (Shanghai) Co., Ltd. | Anti-pd-1 and pd-l1 tetravalent bispecific antibody |
| JP2024511589A (ja) * | 2021-03-31 | 2024-03-14 | メルス ナムローゼ フェンノートシャップ | 新規のpd-1結合ドメイン |
Families Citing this family (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11046769B2 (en) | 2018-11-13 | 2021-06-29 | Compass Therapeutics Llc | Multispecific binding constructs against checkpoint molecules and uses thereof |
| CN118974094A (zh) * | 2022-04-08 | 2024-11-15 | 江苏济烨生物制药有限公司 | 一种抗原结合蛋白及其应用 |
| CN116574192A (zh) * | 2023-03-30 | 2023-08-11 | 上海妙聚生物科技有限公司 | 一种可条件性释放并激活的细胞因子融合蛋白及其制备和用途 |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016061142A1 (en) * | 2014-10-14 | 2016-04-21 | Novartis Ag | Antibody molecules to pd-l1 and uses thereof |
| WO2017106656A1 (en) * | 2015-12-17 | 2017-06-22 | Novartis Ag | Antibody molecules to pd-1 and uses thereof |
| WO2019009726A1 (en) * | 2017-07-06 | 2019-01-10 | Merus N.V. | BINDING MOLECULES FOR MODULATING THE BIOLOGICAL ACTIVITY EXPRESSED BY A CELL |
Family Cites Families (213)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US3710795A (en) | 1970-09-29 | 1973-01-16 | Alza Corp | Drug-delivery device with stretched, rate-controlling membrane |
| US4263428A (en) | 1978-03-24 | 1981-04-21 | The Regents Of The University Of California | Bis-anthracycline nucleic acid function inhibitors and improved method for administering the same |
| US4433059A (en) | 1981-09-08 | 1984-02-21 | Ortho Diagnostic Systems Inc. | Double antibody conjugate |
| US4444878A (en) | 1981-12-21 | 1984-04-24 | Boston Biomedical Research Institute, Inc. | Bispecific antibody determinants |
| DE3374837D1 (en) | 1982-02-17 | 1988-01-21 | Ciba Geigy Ag | Lipids in the aqueous phase |
| NZ207394A (en) | 1983-03-08 | 1987-03-06 | Commw Serum Lab Commission | Detecting or determining sequence of amino acids |
| US4496654A (en) | 1983-04-08 | 1985-01-29 | Quidel | Detection of HCG with solid phase support having avidin coating |
| DE3474511D1 (en) | 1983-11-01 | 1988-11-17 | Terumo Corp | Pharmaceutical composition containing urokinase |
| EP0173552B1 (en) | 1984-08-24 | 1991-10-09 | The Upjohn Company | Recombinant dna compounds and the expression of polypeptides such as tpa |
| US5168062A (en) | 1985-01-30 | 1992-12-01 | University Of Iowa Research Foundation | Transfer vectors and microorganisms containing human cytomegalovirus immediate-early promoter-regulatory DNA sequence |
| US6548640B1 (en) | 1986-03-27 | 2003-04-15 | Btg International Limited | Altered antibodies |
| US5869620A (en) | 1986-09-02 | 1999-02-09 | Enzon, Inc. | Multivalent antigen-binding proteins |
| US4863457A (en) | 1986-11-24 | 1989-09-05 | Lee David A | Drug delivery device |
| US5026773A (en) | 1987-03-11 | 1991-06-25 | Samuel Steel | Apparatus for a solid phase synthesis of peptide analogs |
| JPH021556A (ja) | 1988-06-09 | 1990-01-05 | Snow Brand Milk Prod Co Ltd | ハイブリッド抗体及びその作製方法 |
| EP0436597B1 (en) | 1988-09-02 | 1997-04-02 | Protein Engineering Corporation | Generation and selection of recombinant varied binding proteins |
| EP0368684B2 (en) | 1988-11-11 | 2004-09-29 | Medical Research Council | Cloning immunoglobulin variable domain sequences. |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6291159B1 (en) | 1989-05-16 | 2001-09-18 | Scripps Research Institute | Method for producing polymers having a preselected activity |
| US6291158B1 (en) | 1989-05-16 | 2001-09-18 | Scripps Research Institute | Method for tapping the immunological repertoire |
| DE3920358A1 (de) | 1989-06-22 | 1991-01-17 | Behringwerke Ag | Bispezifische und oligospezifische, mono- und oligovalente antikoerperkonstrukte, ihre herstellung und verwendung |
| US5071909A (en) | 1989-07-26 | 1991-12-10 | Millipore Corporation | Immobilization of proteins and peptides on insoluble supports |
| US5164188A (en) | 1989-11-22 | 1992-11-17 | Visionex, Inc. | Biodegradable ocular implants |
| US5859205A (en) | 1989-12-21 | 1999-01-12 | Celltech Limited | Humanised antibodies |
| AU7247191A (en) | 1990-01-11 | 1991-08-05 | Molecular Affinities Corporation | Production of antibodies using gene libraries |
| ES2225816T5 (es) | 1990-02-01 | 2014-08-21 | Siemens Healthcare Diagnostics Products Gmbh | Producción y utilización de bancos de genes de anticuerpos humanos ("bibliotecas de anticuerpos humanos") |
| CZ280777B6 (cs) | 1990-02-02 | 1996-04-17 | Ústav Organické Chemie A Biochemie Avčr | Mnohonásobná automatizovaná syntéza peptidů na planárních nosičích |
| US5273743A (en) | 1990-03-09 | 1993-12-28 | Hybritech Incorporated | Trifunctional antibody-like compounds as a combined diagnostic and therapeutic agent |
| GB9012995D0 (en) | 1990-06-11 | 1990-08-01 | Celltech Ltd | Multivalent antigen-binding proteins |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
| KR0185215B1 (ko) | 1990-11-30 | 1999-05-01 | 요시다 쇼오지 | 서방성 안구삽입용 약제 |
| US5582996A (en) | 1990-12-04 | 1996-12-10 | The Wistar Institute Of Anatomy & Biology | Bifunctional antibodies and method of preparing same |
| ATE414768T1 (de) | 1991-04-10 | 2008-12-15 | Scripps Research Inst | Bibliotheken heterodimerer rezeptoren mittels phagemiden |
| DE4118120A1 (de) | 1991-06-03 | 1992-12-10 | Behringwerke Ag | Tetravalente bispezifische rezeptoren, ihre herstellung und verwendung |
| US6511663B1 (en) | 1991-06-11 | 2003-01-28 | Celltech R&D Limited | Tri- and tetra-valent monospecific antigen-binding proteins |
| US5637481A (en) | 1993-02-01 | 1997-06-10 | Bristol-Myers Squibb Company | Expression vectors encoding bispecific fusion proteins and methods of producing biologically active bispecific fusion proteins in a mammalian cell |
| NL9101953A (nl) | 1991-11-21 | 1993-06-16 | Seed Capital Investments | Testinrichting omvattende een plaat met een veelvoud van putjes met een bijbehorende doseerinrichting, alsmede een kit die deze inrichtingen omvat en toepassing van de inrichtingen. |
| US5932448A (en) | 1991-11-29 | 1999-08-03 | Protein Design Labs., Inc. | Bispecific antibody heterodimers |
| PT1024191E (pt) | 1991-12-02 | 2008-12-22 | Medical Res Council | Produção de auto-anticorpos a partir de reportórios de segmentos de anticorpo e exibidos em fagos |
| CA2372813A1 (en) | 1992-02-06 | 1993-08-19 | L.L. Houston | Biosynthetic binding protein for cancer marker |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| EP0640130B1 (en) | 1992-05-08 | 1998-04-15 | Creative Biomolecules, Inc. | Chimeric multivalent protein analogues and methods of use thereof |
| US5287082A (en) | 1992-07-02 | 1994-02-15 | Cornell Research Foundation, Inc. | Submicron isolated, released resistor structure |
| US6005079A (en) | 1992-08-21 | 1999-12-21 | Vrije Universiteit Brussels | Immunoglobulins devoid of light chains |
| DK1621554T4 (da) | 1992-08-21 | 2012-12-17 | Univ Bruxelles | Immunoglobuliner blottet for lette kæder |
| US5844094A (en) | 1992-09-25 | 1998-12-01 | Commonwealth Scientific And Industrial Research Organization | Target binding polypeptide |
| GB9221657D0 (en) | 1992-10-15 | 1992-11-25 | Scotgen Ltd | Recombinant bispecific antibodies |
| EP0627932B1 (en) | 1992-11-04 | 2002-05-08 | City Of Hope | Antibody construct |
| GB9323648D0 (en) | 1992-11-23 | 1994-01-05 | Zeneca Ltd | Proteins |
| ES2156149T3 (es) | 1992-12-04 | 2001-06-16 | Medical Res Council | Proteinas de union multivalente y multiespecificas, su fabricacion y su uso. |
| ES2162863T3 (es) | 1993-04-29 | 2002-01-16 | Unilever Nv | Produccion de anticuerpos o fragmentos (funcionalizados) de los mismos derivados de inmunoglobulinas de cadena pesada de camelidae. |
| US6476198B1 (en) | 1993-07-13 | 2002-11-05 | The Scripps Research Institute | Multispecific and multivalent antigen-binding polypeptide molecules |
| US5635602A (en) | 1993-08-13 | 1997-06-03 | The Regents Of The University Of California | Design and synthesis of bispecific DNA-antibody conjugates |
| WO1995009917A1 (en) | 1993-10-07 | 1995-04-13 | The Regents Of The University Of California | Genetically engineered bispecific tetravalent antibodies |
| WO1995015982A2 (en) | 1993-12-08 | 1995-06-15 | Genzyme Corporation | Process for generating specific antibodies |
| DE69534347T2 (de) | 1994-01-31 | 2006-05-24 | Trustees Of Boston University, Boston | Bibliotheken aus Polyklonalen Antikörpern |
| EP0787185A2 (en) | 1994-10-20 | 1997-08-06 | MorphoSys AG | Targeted hetero-association of recombinant proteins to multi-functional complexes |
| US5556752A (en) | 1994-10-24 | 1996-09-17 | Affymetrix, Inc. | Surface-bound, unimolecular, double-stranded DNA |
| US5731168A (en) | 1995-03-01 | 1998-03-24 | Genentech, Inc. | Method for making heteromultimeric polypeptides |
| CA2222055A1 (en) | 1995-05-23 | 1996-11-28 | Morphosys Gesellschaft Fur Proteinoptimierung Mbh | Multimeric proteins |
| ES2176484T3 (es) | 1995-08-18 | 2002-12-01 | Morphosys Ag | Bancos de proteinas/(poli)peptidos. |
| BR9606706A (pt) | 1995-10-16 | 1999-04-06 | Unilever Nv | Análogo de fragmento de anticorpo biespecífico ou bivalente uso processo para produzir o mesmo |
| WO1997038102A1 (en) | 1996-04-04 | 1997-10-16 | Unilever Plc | Multivalent and multispecific antigen-binding protein |
| US6001329A (en) | 1996-05-06 | 1999-12-14 | Uab Research Foundation | Radiolabeled fusion toxins for cancer therapy |
| EP0979102A4 (en) | 1997-04-30 | 2005-11-23 | Enzon Inc | DETAILED POLYPEPTIDE MODIFIED BY POLYALKYLENE OXIDE |
| US20020062010A1 (en) | 1997-05-02 | 2002-05-23 | Genentech, Inc. | Method for making multispecific antibodies having heteromultimeric and common components |
| US20030207346A1 (en) | 1997-05-02 | 2003-11-06 | William R. Arathoon | Method for making multispecific antibodies having heteromultimeric and common components |
| WO1998056906A1 (en) | 1997-06-11 | 1998-12-17 | Thoegersen Hans Christian | Trimerising module |
| DK1027439T3 (da) | 1997-10-27 | 2010-05-10 | Bac Ip Bv | Multivalente antigenbindende proteiner |
| PT1049787E (pt) | 1998-01-23 | 2005-04-29 | Vlaams Interuniv Inst Biotech | Derivados de anticorpos multipropositos |
| CZ121599A3 (cs) | 1998-04-09 | 1999-10-13 | Aventis Pharma Deutschland Gmbh | Jednořetězcová molekula vázající několik antigenů, způsob její přípravy a léčivo obsahující tuto molekulu |
| DE19819846B4 (de) | 1998-05-05 | 2016-11-24 | Deutsches Krebsforschungszentrum Stiftung des öffentlichen Rechts | Multivalente Antikörper-Konstrukte |
| GB9812545D0 (en) | 1998-06-10 | 1998-08-05 | Celltech Therapeutics Ltd | Biological products |
| US6333396B1 (en) | 1998-10-20 | 2001-12-25 | Enzon, Inc. | Method for targeted delivery of nucleic acids |
| US6995259B1 (en) | 1998-10-23 | 2006-02-07 | Sirna Therapeutics, Inc. | Method for the chemical synthesis of oligonucleotides |
| CA2704600C (en) | 1999-04-09 | 2016-10-25 | Kyowa Kirin Co., Ltd. | A method for producing antibodies with increased adcc activity |
| US7527787B2 (en) | 2005-10-19 | 2009-05-05 | Ibc Pharmaceuticals, Inc. | Multivalent immunoglobulin-based bioactive assemblies |
| US7534866B2 (en) | 2005-10-19 | 2009-05-19 | Ibc Pharmaceuticals, Inc. | Methods and compositions for generating bioactive assemblies of increased complexity and uses |
| JP5004390B2 (ja) | 1999-08-23 | 2012-08-22 | デイナ ファーバー キャンサー インスティチュート,インコーポレイテッド | 新規b7−4分子およびその用途 |
| DK1234031T3 (en) | 1999-11-30 | 2017-07-03 | Mayo Foundation | B7-H1, AN UNKNOWN IMMUNE REGULATORY MOLECULE |
| JP2003531588A (ja) | 2000-04-11 | 2003-10-28 | ジェネンテック・インコーポレーテッド | 多価抗体とその用途 |
| US8288322B2 (en) | 2000-04-17 | 2012-10-16 | Dyax Corp. | Methods of constructing libraries comprising displayed and/or expressed members of a diverse family of peptides, polypeptides or proteins and the novel libraries |
| CA2409991A1 (en) | 2000-05-24 | 2001-11-29 | Imclone Systems Incorporated | Bispecific immunoglobulin-like antigen binding proteins and method of production |
| CA2410551A1 (en) | 2000-06-30 | 2002-01-10 | Vlaams Interuniversitair Instituut Voor Biotechnologie Vzw (Vib) | Heterodimeric fusion proteins |
| WO2002008293A2 (en) | 2000-07-25 | 2002-01-31 | Immunomedics Inc. | Multivalent target binding protein |
| US6946292B2 (en) | 2000-10-06 | 2005-09-20 | Kyowa Hakko Kogyo Co., Ltd. | Cells producing antibody compositions with increased antibody dependent cytotoxic activity |
| EP1197755A1 (en) | 2000-10-11 | 2002-04-17 | Pepscan Systems B.V. | Identification of protein binding sites |
| US20040242847A1 (en) | 2000-10-20 | 2004-12-02 | Naoshi Fukushima | Degraded agonist antibody |
| WO2002061071A2 (en) | 2000-12-18 | 2002-08-08 | Dyax Corp. | Focused libraries of genetic packages |
| US7829084B2 (en) | 2001-01-17 | 2010-11-09 | Trubion Pharmaceuticals, Inc. | Binding constructs and methods for use thereof |
| WO2002072635A2 (en) | 2001-03-13 | 2002-09-19 | University College London | Specific binding members |
| DK1399484T3 (da) | 2001-06-28 | 2010-11-08 | Domantis Ltd | Dobbelt-specifik ligand og anvendelse af denne |
| US6833441B2 (en) | 2001-08-01 | 2004-12-21 | Abmaxis, Inc. | Compositions and methods for generating chimeric heteromultimers |
| EP1293514B1 (en) | 2001-09-14 | 2006-11-29 | Affimed Therapeutics AG | Multimeric single chain tandem Fv-antibodies |
| AU2002357072A1 (en) | 2001-12-07 | 2003-06-23 | Centocor, Inc. | Pseudo-antibody constructs |
| WO2003087341A2 (en) | 2002-01-23 | 2003-10-23 | The University Of Utah Research Foundation | Targeted chromosomal mutagenesis using zinc finger nucleases |
| JP2006502091A (ja) | 2002-03-01 | 2006-01-19 | イミューノメディクス、インコーポレイテッド | クリアランス速度を高めるための二重特異性抗体点変異 |
| WO2003080809A2 (en) | 2002-03-21 | 2003-10-02 | Sangamo Biosciences, Inc. | Methods and compositions for using zinc finger endonucleases to enhance homologous recombination |
| WO2003087163A1 (en) | 2002-04-15 | 2003-10-23 | Chugai Seiyaku Kabushiki Kaisha | METHOD OF CONSTRUCTING scDb LIBRARY |
| EP1514114A4 (en) | 2002-06-05 | 2007-03-21 | Sopherion Therapeutics Inc | PROCESS FOR SCREENING LIGANDS USING EUKARYONTIC CELL DISPLAY |
| AU2003281200A1 (en) | 2002-07-03 | 2004-01-23 | Tasuku Honjo | Immunopotentiating compositions |
| EP2806025B1 (en) | 2002-09-05 | 2019-04-03 | California Institute of Technology | Use of zinc finger nucleases to stimulate gene targeting |
| GB0230203D0 (en) | 2002-12-27 | 2003-02-05 | Domantis Ltd | Fc fusion |
| GB0305702D0 (en) | 2003-03-12 | 2003-04-16 | Univ Birmingham | Bispecific antibodies |
| WO2004094613A2 (en) | 2003-04-22 | 2004-11-04 | Ibc Pharmaceuticals | Polyvalent protein complex |
| NZ544924A (en) | 2003-06-27 | 2009-03-31 | Biogen Idec Inc | Modified binding molecules comprising connecting peptides |
| KR20060041205A (ko) | 2003-07-01 | 2006-05-11 | 이뮤노메딕스, 인코오포레이티드 | 양특이성 항체들의 다가 담체들 |
| US7696322B2 (en) | 2003-07-28 | 2010-04-13 | Catalent Pharma Solutions, Inc. | Fusion antibodies |
| US20070134796A1 (en) | 2005-07-26 | 2007-06-14 | Sangamo Biosciences, Inc. | Targeted integration and expression of exogenous nucleic acid sequences |
| US8409861B2 (en) | 2003-08-08 | 2013-04-02 | Sangamo Biosciences, Inc. | Targeted deletion of cellular DNA sequences |
| US7888121B2 (en) | 2003-08-08 | 2011-02-15 | Sangamo Biosciences, Inc. | Methods and compositions for targeted cleavage and recombination |
| JPWO2005035586A1 (ja) | 2003-10-08 | 2007-11-22 | 協和醗酵工業株式会社 | 融合蛋白質組成物 |
| EP1697748A4 (en) | 2003-12-22 | 2007-07-04 | Centocor Inc | METHODS FOR GENERATING MULTIMEDIA MOLECULES |
| GB0329825D0 (en) | 2003-12-23 | 2004-01-28 | Celltech R&D Ltd | Biological products |
| US20050266425A1 (en) | 2003-12-31 | 2005-12-01 | Vaccinex, Inc. | Methods for producing and identifying multispecific antibodies |
| CA2553676A1 (en) | 2004-01-28 | 2005-08-11 | Research Development Foundation | Human soluble neuropilin-1 primary polyadenylation signal and uses thereof |
| US8383575B2 (en) | 2004-01-30 | 2013-02-26 | Paul Scherrer Institut | (DI)barnase-barstar complexes |
| US8685435B2 (en) | 2004-04-30 | 2014-04-01 | Allergan, Inc. | Extended release biodegradable ocular implants |
| JP2008511286A (ja) | 2004-06-02 | 2008-04-17 | ダイアテック・ピーティワイ・リミテッド | サメ類のIgNARドメインに基づく結合成分 |
| EP1786918A4 (en) | 2004-07-17 | 2009-02-11 | Imclone Systems Inc | NEW BISPECIFIC ANTIBODY TETRAVALENT |
| WO2006012414A2 (en) | 2004-07-20 | 2006-02-02 | Critical Therapeutics, Inc. | Novel polyadenylation signal for use in expression vectors |
| WO2006028936A2 (en) | 2004-09-02 | 2006-03-16 | Genentech, Inc. | Heteromultimeric molecules |
| AU2006210660B2 (en) | 2005-02-01 | 2011-12-01 | Morphosys Ag | Libraries and methods for isolating antibodies |
| AU2006232287B2 (en) | 2005-03-31 | 2011-10-06 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
| CA2604032C (en) | 2005-04-06 | 2017-08-22 | Ibc Pharmaceuticals, Inc. | Methods for generating stably linked complexes composed of homodimers, homotetramers or dimers of dimers and uses |
| ES2971647T3 (es) | 2005-04-15 | 2024-06-06 | Macrogenics Inc | Diacuerpos covalentes y usos de los mismos |
| US20060263367A1 (en) | 2005-05-23 | 2006-11-23 | Fey Georg H | Bispecific antibody devoid of Fc region and method of treatment using same |
| PT1907424E (pt) | 2005-07-01 | 2015-10-09 | Squibb & Sons Llc | Anticorpos monoclonais humanos para o ligando 1 de morte programada (pd-l1) |
| NZ612578A (en) | 2005-08-19 | 2014-11-28 | Abbvie Inc | Dual variable domain immunoglobin and uses thereof |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| ATE452913T1 (de) | 2005-08-26 | 2010-01-15 | Pls Design Gmbh | Bivalente igy antikörperkonstrukte für diagnostische und therapeutische anwendungen |
| WO2007044887A2 (en) | 2005-10-11 | 2007-04-19 | Transtarget, Inc. | Method for producing a population of homogenous tetravalent bispecific antibodies |
| KR20080073293A (ko) | 2005-10-14 | 2008-08-08 | 메디뮨 엘엘씨 | 항체 라이브러리의 세포 디스플레이 |
| ES2577292T3 (es) | 2005-11-07 | 2016-07-14 | Genentech, Inc. | Polipéptidos de unión con secuencias hipervariables de VH/VL diversificadas y consenso |
| EP1962961B1 (en) | 2005-11-29 | 2013-01-09 | The University Of Sydney | Demibodies: dimerisation-activated therapeutic agents |
| MX2008010561A (es) | 2006-02-15 | 2009-03-02 | Imclone Systems Inc | Anticuerpos funcionales. |
| CA2646508A1 (en) | 2006-03-17 | 2007-09-27 | Biogen Idec Ma Inc. | Stabilized polypeptide compositions |
| EP2006379B1 (en) | 2006-03-23 | 2016-08-31 | Tohoku University | High functional bispecific antibody |
| WO2007112362A2 (en) | 2006-03-24 | 2007-10-04 | The Regents Of The University Of California | Construction of a multivalent scfv through alkyne-azide 1,3-dipolar cycloaddition |
| PT1999154E (pt) | 2006-03-24 | 2013-01-24 | Merck Patent Gmbh | Domínios proteicos heterodiméricos modificados |
| EP2009101B1 (en) | 2006-03-31 | 2017-10-25 | Chugai Seiyaku Kabushiki Kaisha | Antibody modification method for purifying bispecific antibody |
| ES2469676T3 (es) | 2006-05-25 | 2014-06-18 | Bayer Intellectual Property Gmbh | Complejos moleculares dim�ricos |
| US20070274985A1 (en) | 2006-05-26 | 2007-11-29 | Stefan Dubel | Antibody |
| NZ573646A (en) | 2006-06-12 | 2012-04-27 | Wyeth Llc | Single-chain multivalent binding proteins with effector function |
| US8759297B2 (en) | 2006-08-18 | 2014-06-24 | Armagen Technologies, Inc. | Genetically encoded multifunctional compositions bidirectionally transported between peripheral blood and the cns |
| WO2008027236A2 (en) | 2006-08-30 | 2008-03-06 | Genentech, Inc. | Multispecific antibodies |
| KR20090105913A (ko) | 2006-11-02 | 2009-10-07 | 다니엘 제이 카폰 | 이동 부분을 갖는 하이브리드 면역글로불린 |
| ES2593484T3 (es) | 2007-03-29 | 2016-12-09 | Genmab A/S | Anticuerpos biespecíficos y métodos de producción de los mismos |
| EP2144930A1 (en) | 2007-04-18 | 2010-01-20 | ZymoGenetics, Inc. | Single chain fc, methods of making and methods of treatment |
| KR20100058509A (ko) | 2007-07-31 | 2010-06-03 | 메디뮨 엘엘씨 | 다중특이적 에피토프 결합 단백질 및 이의 용도 |
| CA2696263C (en) | 2007-08-15 | 2017-06-13 | Bing Liu | Monospecific and multispecific antibodies and method of use |
| US8877688B2 (en) | 2007-09-14 | 2014-11-04 | Adimab, Llc | Rationally designed, synthetic antibody libraries and uses therefor |
| EP3124497B1 (en) | 2007-09-14 | 2020-04-15 | Adimab, LLC | Rationally designed, synthetic antibody libraries and uses therefor |
| US7947495B2 (en) | 2007-11-01 | 2011-05-24 | Abbott Biotherapeutics Corp. | Immunoglobulin display vectors |
| EP2650311A3 (en) | 2007-11-27 | 2014-06-04 | Ablynx N.V. | Amino acid sequences directed against heterodimeric cytokines and/or their receptors and polypeptides comprising the same |
| US20090148905A1 (en) | 2007-11-30 | 2009-06-11 | Claire Ashman | Antigen-binding constructs |
| US8227577B2 (en) | 2007-12-21 | 2012-07-24 | Hoffman-La Roche Inc. | Bivalent, bispecific antibodies |
| US8242247B2 (en) | 2007-12-21 | 2012-08-14 | Hoffmann-La Roche Inc. | Bivalent, bispecific antibodies |
| US9266967B2 (en) | 2007-12-21 | 2016-02-23 | Hoffmann-La Roche, Inc. | Bivalent, bispecific antibodies |
| US20090162359A1 (en) | 2007-12-21 | 2009-06-25 | Christian Klein | Bivalent, bispecific antibodies |
| JP6157046B2 (ja) | 2008-01-07 | 2017-07-05 | アムジェン インコーポレイテッド | 静電的ステアリング(electrostaticsteering)効果を用いた抗体Fcヘテロ二量体分子を作製するための方法 |
| WO2009089295A2 (en) | 2008-01-07 | 2009-07-16 | Government Of The United States Of America, As Represented By The Secretary, Dept. Of Health And Human Services | Anti-hiv domain antibodies and method of making and using same |
| DE102008010362A1 (de) | 2008-02-18 | 2009-08-20 | Florian Prof. Dr. Lang | Sgk1 als therapeutisches und diagnostisches Target für virale Erkrankungen |
| JP5780951B2 (ja) | 2008-04-24 | 2015-09-16 | ダイアックス コーポレーション | 新規のhccdr1、cdr2、およびcdr3設計、ならびに新規のlccdr1、cdr2、およびcdr3設計を含む、遺伝子パッケージのライブラリ |
| WO2010028791A1 (en) | 2008-09-10 | 2010-03-18 | Philochem Ag | Display library for antibody selection |
| US8552154B2 (en) * | 2008-09-26 | 2013-10-08 | Emory University | Anti-PD-L1 antibodies and uses therefor |
| EP3255060A1 (en) | 2008-12-09 | 2017-12-13 | F. Hoffmann-La Roche AG | Anti-pd-l1 antibodies and their use to enhance t-cell function |
| WO2010129304A2 (en) | 2009-04-27 | 2010-11-11 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
| SG10201700096VA (en) | 2009-07-17 | 2017-02-27 | Bioatla Llc | Simultaneous, Integrated Selection And Evolution Of Antibody/Protein Performance And Expression In Production Hosts |
| EP2478013B1 (en) | 2009-09-16 | 2018-10-24 | F.Hoffmann-La Roche Ag | Coiled coil and/or tether containing protein complexes and uses thereof |
| HRP20241208T1 (hr) | 2010-04-20 | 2024-11-22 | Genmab A/S | Heterodimerni proteini koji sadrže fc fragment protutijela i postupci za njihovu proizvodnju |
| KR102318383B1 (ko) | 2010-07-16 | 2021-10-27 | 아디맵 엘엘씨 | 항체 라이브러리 |
| CN102760801B (zh) | 2011-04-29 | 2015-04-01 | 清华大学 | 发光二极管的制备方法 |
| ES2893855T3 (es) | 2011-08-11 | 2022-02-10 | Ono Pharmaceutical Co | Agente terapéutico para enfermedades autoinmunes que comprende agonista de PD-1 |
| SG11201401422VA (en) | 2011-10-27 | 2014-09-26 | Genmab As | Production of heterodimeric proteins |
| CN111499755A (zh) | 2012-08-03 | 2020-08-07 | 丹娜法伯癌症研究院 | 抗-pd-l1和pd-l2双结合抗体单一试剂及其使用方法 |
| HK1213788A1 (zh) | 2012-10-12 | 2016-07-15 | 布里格姆及妇女医院股份有限公司 | 免疫應答的增强 |
| US8697359B1 (en) | 2012-12-12 | 2014-04-15 | The Broad Institute, Inc. | CRISPR-Cas systems and methods for altering expression of gene products |
| CN113684185A (zh) | 2013-02-26 | 2021-11-23 | 纪念斯隆-凯特琳癌症中心 | 用于免疫疗法的组合物和方法 |
| BR112016000853A2 (pt) | 2013-07-16 | 2017-12-12 | Genentech Inc | métodos para tratar ou retardar, reduzir ou inibir a recidiva ou a progressão do câncer e a progressão de uma doença imune-relacionada em um indivíduo, para aumentar, melhorar ou estimular uma resposta ou função imune em um indivíduo e kit |
| US10519251B2 (en) | 2013-12-30 | 2019-12-31 | Epimab Biotherapeutics, Inc. | Fabs-in-tandem immunoglobulin and uses thereof |
| US10835595B2 (en) | 2014-01-06 | 2020-11-17 | The Trustees Of The University Of Pennsylvania | PD1 and PDL1 antibodies and vaccine combinations and use of same for immunotherapy |
| AU2015205530B8 (en) | 2014-01-13 | 2019-09-19 | Pieris Pharmaceuticals Gmbh | Multi-specific polypeptide useful for localized tumor immunomodulation |
| TWI681969B (zh) | 2014-01-23 | 2020-01-11 | 美商再生元醫藥公司 | 針對pd-1的人類抗體 |
| US10899840B2 (en) | 2014-02-04 | 2021-01-26 | Pfizer Inc. | Combination of a PD-1 antagonist and a 4-1BB agonist for treating cancer |
| US9300829B2 (en) | 2014-04-04 | 2016-03-29 | Canon Kabushiki Kaisha | Image reading apparatus and correction method thereof |
| JP6666905B2 (ja) | 2014-05-29 | 2020-03-18 | スプリング バイオサイエンス コーポレーション | Pd−l1抗体及びその使用 |
| KR102476226B1 (ko) | 2014-08-05 | 2022-12-12 | 아폴로믹스 인코포레이티드 | 항-pd-l1 항체 |
| WO2016023875A1 (en) | 2014-08-14 | 2016-02-18 | F. Hoffmann-La Roche Ag | Combination therapy of antibodies activating human cd40 and antibodies against human pd-l1 |
| EP3183269A2 (en) | 2014-08-22 | 2017-06-28 | Bristol-Myers Squibb Company | Treatment of cancer using a combination of an anti-pd-1 antibody and an anti-cd137 antibody |
| WO2016030455A1 (en) | 2014-08-28 | 2016-03-03 | Medimmune Limited | Anti-b7-h1 and anti-ctla-4 antibodies for treating non-small lung cancer |
| GB201500319D0 (en) | 2015-01-09 | 2015-02-25 | Agency Science Tech & Res | Anti-PD-L1 antibodies |
| CA2973720A1 (en) | 2015-01-14 | 2016-07-21 | Compass Therapeutics Llc | Multispecific immunomodulatory antigen-binding constructs |
| CN108112254B (zh) | 2015-03-13 | 2022-01-28 | 西托姆克斯治疗公司 | 抗-pdl1抗体、可活化的抗-pdl1抗体、及其使用方法 |
| KR20250004095A (ko) | 2015-04-17 | 2025-01-07 | 브리스톨-마이어스 스큅 컴퍼니 | 항-pd-1 항체 및 또 다른 항체의 조합물을 포함하는 조성물 |
| EP3313186A4 (en) | 2015-06-29 | 2019-04-03 | Biomed Valley Discoveries, Inc. | LPT-723 AND IMMUNE CONTROL POINT COMBINATIONS AND TREATMENT PROCEDURES |
| EP3349792A1 (en) | 2015-09-14 | 2018-07-25 | Compass Therapeutics LLC | Compositions and methods for treating cancer via antagonism of the cd155/tigit pathway and tgf- |
| AU2016334623A1 (en) | 2015-10-07 | 2018-02-15 | F. Hoffmann-La Roche Ag | Bispecific antibodies with tetravalency for a costimulatory TNF receptor |
| WO2017124002A1 (en) | 2016-01-13 | 2017-07-20 | Compass Therapeutics Llc | Multispecific immunomodulatory antigen-binding constructs |
| US11421028B2 (en) * | 2016-02-06 | 2022-08-23 | Epimab Biotherapeutics, Inc. | Fabs-in-tandem immunoglobulin and uses thereof |
| JP2019513415A (ja) | 2016-04-04 | 2019-05-30 | イーティーエッチ チューリッヒ | タンパク質産生及びライブラリー生成のための哺乳類細胞株 |
| AR108377A1 (es) * | 2016-05-06 | 2018-08-15 | Medimmune Llc | Proteínas de unión biespecíficas y sus usos |
| UA126905C2 (uk) * | 2016-06-13 | 2023-02-22 | Ай-Маб Байофарма Юес Лімітед | Антитіло до pd-l1 та його застосування |
| RU2769282C2 (ru) | 2016-06-20 | 2022-03-30 | Кимаб Лимитед | Анти-PD-L1 и IL-2 цитокины |
| WO2018005682A2 (en) | 2016-06-29 | 2018-01-04 | Checkpoint Therapeutics, Inc. | Pd-l1-specific antibodies and methods of using the same |
| DK3592769T3 (da) | 2017-03-09 | 2024-08-12 | Genmab As | Antistoffer mod pd-l1 |
| EP3608341A4 (en) * | 2017-04-01 | 2021-01-06 | Beijing Hanmi Pharmaceutical Co., Ltd. | HETERODIMER BIS SPECIFIC ANTI-PD-1 / ANTI-HER2 ANTIBODIES WITH NATURAL ANTIBODY STRUCTURE AND PRODUCTION OF IT |
| EP3612565A4 (en) | 2017-04-18 | 2021-06-16 | R-Pharm Overseas, Inc. | ANTI-PD-L1 ANTIBODIES AND USES THEREOF |
| AR112603A1 (es) * | 2017-07-10 | 2019-11-20 | Lilly Co Eli | Anticuerpos biespecíficos inhibidores de punto de control |
| WO2020006605A1 (en) | 2018-07-04 | 2020-01-09 | Honeycomb Media Pty Ltd | Method and system for providing incentives to users |
| US11046769B2 (en) | 2018-11-13 | 2021-06-29 | Compass Therapeutics Llc | Multispecific binding constructs against checkpoint molecules and uses thereof |
-
2019
- 2019-11-13 US US16/682,756 patent/US11046769B2/en active Active
- 2019-11-13 EP EP19883556.3A patent/EP3880716A4/en active Pending
- 2019-11-13 TW TW108141266A patent/TWI840442B/zh active
- 2019-11-13 KR KR1020217014530A patent/KR102929153B1/ko active Active
- 2019-11-13 MX MX2021005594A patent/MX2021005594A/es unknown
- 2019-11-13 CA CA3119161A patent/CA3119161A1/en active Pending
- 2019-11-13 CN CN201980074538.8A patent/CN113166269B/zh active Active
- 2019-11-13 AU AU2019379576A patent/AU2019379576A1/en active Pending
- 2019-11-13 JP JP2021525728A patent/JP7497351B2/ja active Active
- 2019-11-13 SG SG11202104864QA patent/SG11202104864QA/en unknown
- 2019-11-13 WO PCT/US2019/061226 patent/WO2020102387A1/en not_active Ceased
- 2019-11-13 CN CN202411951887.2A patent/CN119735694A/zh active Pending
- 2019-11-13 BR BR112021008795-8A patent/BR112021008795A2/pt unknown
- 2019-11-13 TW TW113112353A patent/TWI903448B/zh active
- 2019-11-13 KR KR1020267004678A patent/KR20260042520A/ko active Pending
-
2021
- 2021-05-09 IL IL283087A patent/IL283087A/en unknown
- 2021-05-12 MX MX2025006617A patent/MX2025006617A/es unknown
- 2021-05-12 MX MX2025006616A patent/MX2025006616A/es unknown
- 2021-05-20 US US17/325,268 patent/US11970538B2/en active Active
-
2024
- 2024-03-19 US US18/609,108 patent/US12503511B2/en active Active
- 2024-05-29 JP JP2024086951A patent/JP7802858B2/ja active Active
-
2025
- 2025-11-24 US US19/398,817 patent/US20260085121A1/en active Pending
-
2026
- 2026-01-07 JP JP2026001401A patent/JP2026053733A/ja active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016061142A1 (en) * | 2014-10-14 | 2016-04-21 | Novartis Ag | Antibody molecules to pd-l1 and uses thereof |
| WO2017106656A1 (en) * | 2015-12-17 | 2017-06-22 | Novartis Ag | Antibody molecules to pd-1 and uses thereof |
| WO2019009726A1 (en) * | 2017-07-06 | 2019-01-10 | Merus N.V. | BINDING MOLECULES FOR MODULATING THE BIOLOGICAL ACTIVITY EXPRESSED BY A CELL |
Non-Patent Citations (1)
| Title |
|---|
| See also references of EP3880716A4 * |
Cited By (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3964530A4 (en) * | 2020-05-15 | 2023-01-18 | Sunshine Guojian Pharmaceutical (Shanghai) Co., Ltd. | Anti-pd-1 and pd-l1 tetravalent bispecific antibody |
| WO2021244392A1 (zh) * | 2020-06-02 | 2021-12-09 | 三生国健药业(上海)股份有限公司 | 一种抗pd1×pdl1的双特异性抗体 |
| JP2024511589A (ja) * | 2021-03-31 | 2024-03-14 | メルス ナムローゼ フェンノートシャップ | 新規のpd-1結合ドメイン |
Also Published As
| Publication number | Publication date |
|---|---|
| TW202031288A (zh) | 2020-09-01 |
| KR20210107628A (ko) | 2021-09-01 |
| US20240262914A1 (en) | 2024-08-08 |
| MX2025006617A (es) | 2025-07-01 |
| US20210284736A1 (en) | 2021-09-16 |
| TWI840442B (zh) | 2024-05-01 |
| CN119735694A (zh) | 2025-04-01 |
| CN113166269A (zh) | 2021-07-23 |
| US20260085121A1 (en) | 2026-03-26 |
| SG11202104864QA (en) | 2021-06-29 |
| CN113166269B (zh) | 2025-01-07 |
| CA3119161A1 (en) | 2020-05-22 |
| KR102929153B1 (ko) | 2026-02-23 |
| MX2021005594A (es) | 2021-10-22 |
| US11970538B2 (en) | 2024-04-30 |
| JP2026053733A (ja) | 2026-03-25 |
| KR20260042520A (ko) | 2026-03-31 |
| BR112021008795A2 (pt) | 2021-08-31 |
| US20200181266A1 (en) | 2020-06-11 |
| JP2022507253A (ja) | 2022-01-18 |
| EP3880716A1 (en) | 2021-09-22 |
| JP7802858B2 (ja) | 2026-01-20 |
| AU2019379576A1 (en) | 2021-06-03 |
| EP3880716A4 (en) | 2022-08-03 |
| JP7497351B2 (ja) | 2024-06-10 |
| US11046769B2 (en) | 2021-06-29 |
| TWI903448B (zh) | 2025-11-01 |
| US12503511B2 (en) | 2025-12-23 |
| MX2025006616A (es) | 2025-07-01 |
| JP2024109911A (ja) | 2024-08-14 |
| TW202430572A (zh) | 2024-08-01 |
| IL283087A (en) | 2021-06-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12503511B2 (en) | Multispecific binding constructs against checkpoint molecules and uses thereof | |
| US20200109195A1 (en) | Compositions and methods for enhancing the killing of target cells by nk cells | |
| AU2018233976B2 (en) | Fc-optimized anti-CD25 for tumour specific cell depletion | |
| KR102629403B1 (ko) | Vista 항원 결합 분자 | |
| WO2022256563A1 (en) | Anti-ccr8 antibodies and uses thereof | |
| EP4267617A1 (en) | Human ccr8 binders | |
| KR20240158314A (ko) | 새로운 면역 조절제의 개발 및 적용 | |
| WO2019226658A1 (en) | Multispecific antigen-binding compositions and methods of use | |
| US12460004B2 (en) | Antibodies that bind CD277 and uses thereof | |
| HK40118852A (zh) | 对抗检查点分子的多特异性结合构建体及其用途 | |
| TW202604964A (zh) | 對抗檢查點分子之多特異性結合構築體及其用途 | |
| WO2020033925A2 (en) | Antibodies that bind cd277 and uses thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 19883556 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 3119161 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2021525728 Country of ref document: JP Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20217014530 Country of ref document: KR Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112021008795 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2019379576 Country of ref document: AU Date of ref document: 20191113 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2019883556 Country of ref document: EP Effective date: 20210614 |
|
| ENP | Entry into the national phase |
Ref document number: 112021008795 Country of ref document: BR Kind code of ref document: A2 Effective date: 20210505 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 201980074538.8 Country of ref document: CN |
|
| WWG | Wipo information: grant in national office |
Ref document number: MX/A/2021/005594 Country of ref document: MX |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 327452 Country of ref document: IL |