WO2019117684A1 - a-syn/IGF1R에 대한 이중 특이 항체 및 그 용도 - Google Patents

a-syn/IGF1R에 대한 이중 특이 항체 및 그 용도 Download PDF

Info

Publication number
WO2019117684A1
WO2019117684A1 PCT/KR2018/015953 KR2018015953W WO2019117684A1 WO 2019117684 A1 WO2019117684 A1 WO 2019117684A1 KR 2018015953 W KR2018015953 W KR 2018015953W WO 2019117684 A1 WO2019117684 A1 WO 2019117684A1
Authority
WO
WIPO (PCT)
Prior art keywords
seq
antibody
amino acid
variable region
chain variable
Prior art date
Application number
PCT/KR2018/015953
Other languages
English (en)
French (fr)
Inventor
안진형
안성원
김동인
성은실
엄재현
이상훈
유원규
김주희
박경진
정혜진
정진원
이보라
성병제
김연주
손용규
안세원
송대해
유지선
박영돈
염동훈
이요섭
정재호
Original Assignee
에이비엘바이오 주식회사
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2018385230A priority Critical patent/AU2018385230B2/en
Priority to EP24170761.1A priority patent/EP4403218A2/en
Priority to CN201880089354.4A priority patent/CN111886251A/zh
Priority to US16/770,728 priority patent/US12071483B1/en
Priority to JP2020531764A priority patent/JP7212391B2/ja
Priority to KR1020207009513A priority patent/KR102263812B1/ko
Priority to CA3085572A priority patent/CA3085572A1/en
Priority to EA202091183A priority patent/EA202091183A1/ru
Application filed by 에이비엘바이오 주식회사 filed Critical 에이비엘바이오 주식회사
Priority to CN202310369584.9A priority patent/CN116731173A/zh
Priority to EP18889608.8A priority patent/EP3725806A4/en
Priority to BR112020011875-3A priority patent/BR112020011875A2/pt
Publication of WO2019117684A1 publication Critical patent/WO2019117684A1/ko
Priority to JP2022059697A priority patent/JP7513651B2/ja
Priority to AU2022241522A priority patent/AU2022241522A1/en
Priority to JP2023000428A priority patent/JP2023052217A/ja
Priority to US18/480,071 priority patent/US20240101687A1/en
Priority to JP2024061429A priority patent/JP2024096805A/ja

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6845—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a cytokine, e.g. growth factors, VEGF, TNF, a lymphokine or an interferon
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
    • A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
    • A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
    • A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
    • A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00—Drugs for disorders of the nervous system
    • A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
    • A61P25/16—Anti-Parkinson drugs
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00—Medicinal preparations containing antigens or antibodies
    • A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/35—Valency
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52—Constant or Fc region; Isotype
    • C07K2317/526—CH3 domain
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565—Complementarity determining region [CDR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/567—Framework region [FR]
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622—Single chain antibody (scFv)
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/77—Internalization into the cell
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K2317/00—Immunoglobulins specific features
    • C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/94—Stability, e.g. half-life, pH, temperature or enzyme-resistance

Definitions

  • the present invention relates to alpha-synuclein and A pharmaceutical composition for the prevention and / or treatment of synovial disease ( 1 - 5 1111 (: 1 11 ( 31 ; 1 1 3 ) comprising a bispecific antibody, an epitope duplex antibody, A1
  • the present invention relates to a method for providing information for detecting an alpha-synuclein aggregate or for diagnosing a synuclein disease.
  • Alpha-synuclein ((1-3 1111 (1 ⁇ 11, (1-311) is expressed mainly from around the synaptic terminals of neurons, present in a naturally in an unfolded state monomer in the normal state. Alfa-synuclein helps regulate the release of dopamine, a key neurotransmitter that controls the onset and stop of spontaneous and involuntary movements. In particular, the function of alpha-synuclein is important as synaptic activity increases and ages, and is an important factor in neurodegeneration.
  • a phospholipid bilayer or causes a structural change by a combination and interaction of folded or poll the secondary structure of the coded 01-helical form of lipid membrane, such as To form agglomerates comprising dimer 11161 ⁇ oligomer ( 0 ⁇ 0111 ) and / or molecules in the form of fibers.
  • alpha-synuclein aggregates are known to cause toxicity to cells 2019/117684 1 »(1 ⁇ 1 ⁇ 2018/015953 had Parkinson's disease Parkinson's disease, PD), Parkinson's disease, dementia Parkinson's disease dementia, PDD), the system atrophy multiple system atrophy, MSA), Rui small body dementia, dementia with Lewy bodies, DLB), and other abnormal aggregations of proteins found in neurons of various diseases.
  • alpha-synuclein kills dopaminergic neurons in animal and cell experiments, induces inflammatory responses, and induces motor symptoms similar to Parkinson's disease in experimental animals in addition, alpha-lane Vishnu large aggregation of Parkinson's disease Parkinson's disease, dementia, Lewy body dementia, multi-system atrophy and other 10 large number of nerve axons quality It is known to be associated with a group of neurodegenerative diseases called a-synucleinopathies .
  • Antibodies to alpha-synuclein or fragments of alpha-synuclein to induce such antibodies have been proposed as methods of immunotherapy for sinus inferior disease.
  • brain infiltration of antibodies is limited by the blood brain barrier (BBB) .
  • BBB blood brain barrier
  • An example of the present invention provides a protein complex comprising the antigen-binding site for alpha-synuclein and an antigen-binding site for aberrant cytoplasm or a method for producing the protein complex.
  • Another example provides a polynucleotide encoding the protein complex, a recombinant vector comprising the same, and a recombinant cell comprising the polynucleotide.
  • Another example is a protein obtained from the protein complex. And a bispecific antibody against a crime and a method for producing the same.
  • a bispecific antibody to ⁇ comprising a pharmaceutically acceptable excipient, alpha-synuclein disease ((1 -3 1111 (: 1 6 ⁇ 1 (31;] 1 3) prevention and / or treatment of substances ≪ / RTI >
  • An example of the present invention is a protein complex comprising an antigen-binding site for an alpha-synuclein and an antigen-binding site for an offense and an alpha-synuclein (3) obtained from the protein complex and a bispecific antibody , Anti- 3 - / anti-viral double-specific antibody).
  • the bispecific antibody according to the present invention can recognize and bind both alpha-synuclein and ancillary antigen.
  • the anti-a_syn / anti-IGF1R bispecific antibody according to the present invention comprises the above anti-a_syn antibody or an antigen-binding fragment thereof and specifically recognizes alpha-synuclein And can be used especially for the prevention, treatment and / or diagnosis of synuclein diseases which are capable of binding on the C-terminal part of alpha-synuclein and which are diseases associated with alpha-synuclein or its aggregates.
  • Sinu Klein disease is a diverse group of neurodegenerative disorders that share common pathological features: in neuropathologic studies, distinctive lesions are found within the selected population of neurons and oligoendrocyte, - Including abnormal aggregation of the synuclein protein can be detected.
  • Alpha-synuclein (initially identified as PARK1 and PARK4) is a 140 amino acid protein that is widely expressed in the neocortex, hippocampus, dentate gyrus, posterior nerve, striatum, thalamus and cerebellum.
  • Alpha Sinus disease associated with Klein aggregate is a neurodegenerative disease in a group called May called synuclein disease, neurons and astrocytes (gl ia) alpha in the tumor, including a group-synuclein and aggregation is found, dopamine degradation of the property system, changes in exercise capacity, has a characteristic such as cognitive disorders and Lewy body and / or the formation of new right Louis (Ki m et a l Alzheimer's R esearch & T herapy 2014, 6:73;.
  • M cKeith et al These diseases include Parkinson's disease, Parkinson's disease dementia, 10 rheumatoid arthritis, Alzheimer's disease, Alzheimer's disease and Parkinson's disease, multiple system atrophy, and a number of other neuronal axons ( Neurology 1996: 47: 1113-24) Diseases.
  • the antibodies according to the present invention are effectively used for the treatment of Parkinson's disease.
  • the anti- a-syn / anti - IGF1R double-specific antibody comprises an anti-IGF 1R antibody or antigen binding fragment thereof, wherein the anti- a-syn antibody or antigen binding fragment thereof passes through 15 blood brain barrier Allowing the brain to exert its action, and extending the half-life to maintain its long-term efficacy.
  • the anti-a-syn / anti-IGF 1R bispecific antibody according to the present invention binds to IGF 1R on the cell surface but does not affect the binding of the ligand and does not affect the signal transduction pathway through IGF 1R , And thus does not inhibit IGF 1R and its ligand binding and signaling through 20 IGF 1R , thus providing a means of shuttling through the blood brain barrier May be used as 2019/117684.
  • the anti-IGF1R antibody or antigen-binding fragment according to the present invention specifically recognizes IGF1R (Insulin-1 ike Growth Factor 1 Receptor) and specifically recognizes IGF1R, particularly human IGF1R, mouse IGF1R, rat IGF1R and monkey IGF1R And does not interfere with the binding of IGF1R, IGF-1, IGF-2, and / or insulin to IGF1R, does not inhibit signaling through IGF1R and can be used for transcytosis, And has no ADCC (Anti body-dependent cel 1 -mediated cytotoxicity), and repeated administration to animals does not decrease the level of IGF1R in the brain and does not have toxicity.
  • IGF1R Insulin-1 ike Growth Factor 1 Receptor
  • the anti-IGF1R antibody according to the present invention binds to IGF1R present on the surface of brain endothelial cells constituting BBB,
  • the anti-IGF1R antibody of the present invention is internalized into cells using a cell line expressing IGF1R (for example, MCF-7 or the like).
  • the affinity variants of the anti-IGF1R antibodies of the present invention for example 1564, 48G5, 54H4, 60H6, B11 and 1564, (3) 4, F06, VH2, VH5, VH7, VH9, VH16,
  • VH32 and VH35 showed a higher internal ization ion compared to the negative control.
  • the results suggest that the degree of internalization of the tested anti-IGF1R antibodies is specific for the IGF1R on the cell surface.
  • the scFv of an anti-IGF1R antibody may be a therapeutic antibody, for example, a bispecific antibody that is covalently bound to the C-terminus of an a-syn antibody, ⁇ ⁇ 0 2019/117684 1 » (: 1 ⁇ 1 ⁇ 2018/015953
  • the IGF1R antibody has a high binding affinity for the antigen on the cell surface, leading to a 5 internalization effect, which may lead to the ability to pass through the BBB.
  • the antibody since the antibody has the ability to pass through BBB and interfere with the signaling of IGF1R, it may cause side effects. Therefore, it is a non-blockin g antibody against IGF1R signal while having a binding force capable of functioning as BBB shuttle Feature.
  • the anti-IGF1R antibody or antigen-binding fragment has good development ease.
  • a post-translational modification such as deamidation, which occurs in the CDR region of the anti-IGKLR antibody and reduces the stability and efficacy of the antibody, is eliminated.
  • the substitution of the amino acid for deamidation increases the stability and efficacy of the antibody against the parental, while the binding of the antigen IGF1R to the ECD is unchanged.
  • the site of antibody deamidation was analyzed by ELISA for binding to IGF1R for mutants to 15 other residues including Q, H, and K , one by one Asn. The binding of the mutant was similar to that of the parental anti-IGF1R antibody Respectively.
  • the anti- IGF1R antibody according to the present invention when linked to a physiologically active substance acting in the brain, it can induce improved BBB passage ability and efficacy as compared with the physiologically active substance alone.
  • a second antibody for various therapeutic 1 ⁇ 1 ⁇ 2018/015953 may be used as a dual specific antibody, a human IPSC derived from in vitro passage experiments of the BBB system, therapeutic antibody only passing 15 times the BBB compared to antibody alone configured Function: 2019/117684 1 »( (Fig. 7A).
  • the anti-IGF1R antibody bound to the second antibody may be monovalent or bivalent.
  • the anti-IGF1R antibody when the anti-IGF1R antibody is monovalent or bivalent, the anti-IGF1R antibody may be monovalent or divalent when the anti-IGF1R antibody is mono-
  • the specific antibody showed up to 5-fold increased serum antibody and up to 5-fold increased CSF antibody compared to the parental anti-IGF1R antibody (1564 clones). Exhibit approximately 3-fold increased CSF and approximately 4.5-fold increased brain penetration compared to parental anti-IGF1R antibody (1564 clone) (Figure 7c).
  • Ta 10 because, the term improvement of the above method-bispecific antibody of IGF1R antibody is expected to be beam of Brain passage capacity of up to about 15 times the CSF and about 23 times as compared to single antibodies that consist of only a second antibody for therapy do.
  • IGF1R antibodies can be useful like IGF1R, especially human, source wins, rat, and mouse are not confirmed to bind to IGF1R of mammals including seueul, switch 15, cleaning, clinical trials for a drug development .
  • the anti-IGF1R antibody or antigen-binding fragment according to the present invention is an antibody or an antigen-binding fragment thereof that specifically recognizes IGF1R (Insulin-like Growth Factor 1 receptor) .
  • the road IGF1R antibody or antigen-binding fragment has a dissociation constant 20 (dissociation constant, KD) ⁇ 10-6 affinity according to the present invention, such as its antigen 2019/117684 1 »(: 1 ⁇ 1 is referred to as the ⁇ 2018/015953 target" specifically bind ""
  • the antibody is hoc EC50 (concentration effect ive 50 when the KD is ⁇ lx 10-8 M) is 2 > nM.
  • the antibody or antigen-binding fragment thereof binds to IGF1R or human IGF1R with K D < 1 X 10 8. It was confirmed that the antibody binds to IGF1R, particularly human IGF1R, mouse IGF1R, rat IGF1R, and monkey IGF1R.
  • the term " epitope" is understood to mean a portion of an antigen recognized by an antibody as an antigenic determinant.
  • the anti-IGF1R The binding site of the antibody may be an extracellular domain of IGF1R protein 10 , such as the human IGF1R protein (SEQ ID NO: 99).
  • the binding site for the human IGF1R protein of the 1564 clone antibody is a protein consisting of the amino acid sequence of SEQ ID NO: 99, the binding site 1 comprises Y775, P776, F778, R650, S791, L798 and Glu779, , H808, E809 and L813, and the binding 15 site 3 includes V397, D435, W434, Y460 and C488.
  • the epitope of the IGF1R antibody may be a conformat epitope pe containing all or a portion of the above three binding sites.
  • Antibody “means in the present invention, as meaning a made whether the substances by stimulation of antigen within the immune system, is produced in a living body, is produced recombinantly, may be synthesized by 20 or artificially and , And the kind thereof is not particularly limited.
  • Antibodies in the context of the invention include both animal, chimeric, humanized, and human antibodies.
  • an antibody refers to an antigen-binding fragment of an antibody having an antigen-binding ability.
  • the antibody also includes a monoclonal antibody and a polyclonal antibody, and the monoclonal antibody may be a human antibody, a humanized antibody, or a chimeric antibody, a separate antibody specifically binding to IGF1R.
  • the monoclonal antibody is an IgGl, IgG2, IgG3 or IgG4 type, separated antibody that specifically binds to IGF1R.
  • Antibodies in accordance with the present invention include, but are not limited to, bispecific antibodies, minibodies, domain antibodies, antibody mimetics (or synthetic antibodies), antibody fusions (or antibody conjugates), and fragments thereof.
  • the structures of the various antibodies are further disclosed herein below.
  • the term "antigen binding fragment" refers to a portion of an antibody having a specific binding ability to an antigen or a polypeptide comprising the same.
  • an antigen binding fragment may interact with an antigen (e.g., an epitope)
  • Binding fragment may be a part or an polypeptide comprising an antibody comprising an amino acid residue that confer specificity and / or affinity for an antigen.
  • Such antigen-binding fragments typically comprise one or more "Complementary Determining " Region, or CDR), and may additionally include one or more "framework” regions.
  • the CDR is an amino acid sequence that contributes to the specificity and affinity of the antigen binding of the antibody and the framework region is an amino acid sequence region that contributes to maintaining the proper conformativity of these CDRs and promotes binding between the antigen binding region and the antigen can do.
  • 2019/117684 1 »(1 ⁇ 1 ⁇ 2018/015953 in the present invention” complementarity determining region (Complementar i ty-determining regions, CDR) "Abraham, among the variable regions of the antibody site at which imparts the binding specificity of the antigen .
  • the antibody may be selected from any subtype of the immunoglobulin (e.g., IgA, IgD, IgE, IgG (IgGl, IgG2, IgG3, IgG4), IgM, etc.).
  • the antibodies of the IgG type IgGl, IgG2, IgG3 , Or an IgG4 subtype, such as an IgG1 or IgG2 subtype.
  • the antibody of the IgG type includes two heavy chains and two light chains, and each heavy chain and light chain are bonded through a disulfide bond to form two heavy chain-light chain structures (dimer) -
  • the light chain has a form linked through a disulfide bond at the Fc site of the heavy chain.
  • the IgG type of antibody comprises an antigen binding site for the same antigen in both heavy chain-light chain constructs to target one antigen Specific antibody that targets two antigens, including antigen-binding sites for different antigens on a single target antibody or both heavy-chain light chain constructs.
  • the term "antigen binding fragment " of an antibody or immunoglobulin chain refers to a portion of an antibody that lacks some amino acids as compared to the full-
  • Such antigen-binding fragments can be said to be biologically active in terms of being capable of specifically binding to a target antigen or competing with another antibody or antigen-binding fragment for binding to a specific epitope.
  • the antigen-binding fragment comprises the complementarity determining region May be selected from the group consisting of an antibody fragment comprising one or more of the following: ( ⁇ 1 ⁇ X02, -, -, and ( 2 )
  • the present invention is not limited thereto.
  • These biologically active fragments can be produced by recombinant technology, or can be produced, for example, by enzymatic or chemical cleavage of a warmed antibody. Immunologically functional 5 immunoglobulin fragments are not limited thereto.
  • a "variant " of a polypeptide such as an antigen binding fragment, a protein, or an antibody is a polypeptide that undergoes insertion, deletion, addition, and / or substitution of one or more amino acid residues in comparison to another polypeptide sequence , Fusion polypeptides.
  • a portion of the antibody may comprise the heavy or light chain, the variable region or
  • derivative of a polypeptide means a polypeptide chemically modified through conjugation with another chemical moiety, which is different from insertion, deletion, addition or substitution mutants.
  • the anti-flat antibody or antigen-binding fragment 2019/117684 1 »(1 ⁇ 1 ⁇ 2018/015953, can be used to effectively pass the blood-brain barrier through a transport system cytokines.
  • Human IGF1R can be activated by insulin-like growth factors, IGF-1 and IGF-2 and insulin (INS). Signal transduction via IGF1R promotes cell growth and survival through an IRS adapter protein that is dependent on activation of the PI3 Kinase / Akt pathway. IGF1R signals to its major substrates, IRS-1, IRS-2, IRS-3 and IRS-4 and the She protein. Resulting in activation of the Ras / Raf / MAP kinase and PI3 kinase Mkt signaling pathways. Compared with other transcytosis targets known to be expressed in endothelial cells of the brain, the 10 expression of seedlings is relatively high in the brain, in order to improve the BBB transitivity, which is mainly used up to IGF1R.
  • INS insulin-like growth factors
  • the anti-IGF1R antibodies according to the present invention do not interfere with binding of IGF1, IGF2 and / or insulin to IGF1R and do not interfere with the signal transduction pathway as described above via IGF1R. Also, in one embodiment of the present invention, IGF1R is expressed in normal brain and peripheral tissues when compared to other targets currently being developed for use in enhancing BBB transitivity of therapeutic antibodies, such as transferrin receptor, 15 insulin receptor , Such as liver, lung, and colon.
  • IGF1R is the target of Receptor Mediated Transcytosis (RMT), which can pass useful substances through the brain to the brain through the Blood Brain Barrier (BBB).
  • RMT Receptor Mediated Transcytosis
  • BBB Blood Brain Barrier
  • the anti-offending antibody or antigen-binding fragment thereof according to the present invention is a trans-
  • the other antibody is located in the same position as the cerebral blood vessels of the mouse when the mouse is injected with blood.
  • the biological barrier is a cell, membrane or structure that prevents effective spreading or transmission of a cell, tissue membrane or biological molecule.
  • the biological barrier comprises a nerve cell / tissue, connective tissue, muscle, or epithelial membrane (e.g. the mucosa or blood vessels), cells may be mentioned for example a typical 15 blood-brain barrier.
  • the "blood brain barrier carrier” can pass through the blood brain barrier to deliver the brain activator substance, and the brain activator substance can be, for example, For example, proteins, nucleic acids, antibodies, or low molecular compounds, including compounds, peptides, and polypeptides.
  • Antibodies according to the present invention can be generated and selected from the above-described ones using, for example, hybridoma technology, antigen-specific human mAb humanized electron-transfer mice with the desired specificity.
  • Such antibodies can be cloned and expressed using appropriate vectors and host cells, or the antibodies can be isolated from cultured hybridoma cells.
  • the antibody may be derived from a phage-display library (phage-di splice librari).
  • Phage display technology is a method of displaying an antibody repertoire on the surface of a filamentous bacteriophage and mimicking an immune select ion that selects a phage that binds to the desired antigen.
  • One such technique may refer to an embodiment of the present invention or to PCT Publication WO 99/10494.
  • the humanized IGF1R antibodies of the invention are screened through a phage display method.
  • the present invention relates to a separated antibody or an antigen-binding fragment thereof that specifically binds to IGF1R, wherein the antibody or antigen-binding fragment comprises a complementarity determining region of a heavy chain and a complementary determining region of a light chain and specifically binds to IGF1R Lt; / RTI > polypeptide, protein or antibody or antigen-binding fragment thereof.
  • the following description relates to an antibody specifically binding to IGF1R.
  • the anti-IGF1R antibody or antigen-binding fragment according to the present invention specifically recognizes IGF1R (Insulin-like Growth Factor 1 Receptor) and specifically recognizes IGF1R, particularly human IGF1R, mouse IGF1R, rat IGF1R and monkey IGF1R And does not interfere with the binding of IGF1R, IGF-1, IGF-2, and / or insulin to IGF1R, does not inhibit signal transduction through IGF1R and can be used for transcytosis, And has no ADCC (Anti body-dependent cel 1 -mediated cytotoxicity), and repeated administration to animals does not reduce the level of IGF1R in the brain and does not have toxicity.
  • IGF1R Insulin-like Growth Factor 1 Receptor
  • the anti-IGF1R antibody according to the present invention binds to IGF1R present on the surface of brain endothelial cells constituting BBB,
  • the anti-IGF1R antibody of the present invention is internalized into cells using a cell line expressing IGF1R (for example, MCF-7 or the like).
  • the affinity variants of the anti-IGF1R antibodies of the present invention for example 1564, 48G5, 54H4, 60H6, B11 and 1564, (3) 4, F06, VH2, VH5, VH7, VH9, VH16,
  • VH32 and VH35 showed a higher internal ization ion compared to the negative control.
  • the results suggest that the degree of internalization of the tested anti-IGF1R antibodies is specific for the IGF1R on the cell surface.
  • the scFv of an anti-IGF1R antibody may be a therapeutic antibody, for example, a bispecific antibody that is covalently bound to the C-terminus of an a-syn antibody, 2019/117684 1 » (: 1/10 ⁇ 018/015953
  • the IGF1R antibody has a high binding affinity for the antigen on the cell surface, leading to a 5 internalization effect, which may lead to the ability to pass through the BBB.
  • to the antibody is because it can give rise to side effects reduce the interference in the IGF1R signaling while having the BBB passing capacity, while having a bonding force that may be as BBB shutt le at the same time the non-blockin g antibodies to IGF1R signal Feature.
  • the anti-IGF1R antibody or antigen-binding fragment has good development ease.
  • the substitution of the amino acid for deamidation increases the stability and efficacy of the antibody against the parental, while the binding of the antigen IGF1R to the ECD is unchanged.
  • the site of antibody deamidation occurs when the binding affinity to IGF1R is analyzed by ELISA for mutants of Q, H, and K containing 15 Asn in the Fc region of the anti-IGF1R antibody, Mutagenicity was similar to that of the parental anti - IGF1R antibody.
  • the anti-IGF1R antibody according to the present invention has improved BBB-passing ability and efficacy when compared with the physiologically active substance alone,
  • - IGF1R antibody can be used as a bispecific antibody comprising a variety of therapeutic supply second antibody, a human-derived in vitro BBB system IPSC (Fig. 7A), which was 15 times higher than the single antibody consisting of the therapeutic antibody alone.
  • the bispecific antibody the anti-IGF1R antibody bound to the second antibody may be monovalent or bivalent.
  • the anti-IGF1R antibody when the anti-IGF1R antibody is monophasic or bivalent, the anti-IGF1R antibody is monovalent or divalent, and when the anti-IGF1R antibody is monovalent or bivalent, Antibodies showed up to 5-fold increased serum antibody and up to 5-fold increased CSF antibody compared to parental anti-IGF1R antibody (1564 clones). Showing about 3-fold increased CSF and about 4.5-fold increased brain penetration compared to parental anti-IGF1R antibody (1564 clone) 10 (FIGS. 7c and 7d). Thus, it is expected that the bispecific antibody of the improved anti-IGF1R antibody in the above method will exhibit up to about 15-fold higher CSF and about 23-fold higher than the single antibody consisting of only the therapeutic second antibody.
  • Anti-IGF1R antibody in accordance with the present invention can be useful like scan cleaning, clinical trials have determined to bind to IGF1R, especially human, monkey, rat, and mouse 15 IGF1R of mammals including seueul, for drug development.
  • the anti-IGF1R antibody or antigen-binding fragment according to the present invention is an antibody or an antigen-binding fragment thereof that specifically recognizes IGF1R (Insulin-like Growth Factor 1 receptor ).
  • the anti-IGF1R antibody or antigen-binding fragment according to the invention has a dissociation constant 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953
  • the antibody or an antigen binding fragment 3 ⁇ 4 ⁇ IGF1R or human to 1x10 ⁇ 8 IGF1R The antibodies disclosed in the present invention have been found to bind to IGF1R, particularly human IGF1R, mouse IGF1R, rat IGF1R, and monkey IGF1R.
  • the term "epi tope” is an antigenic determinant, which is interpreted to mean a portion of an antigen recognized by an antibody.
  • the binding site of an anti-IGF1R antibody according to the invention may be an extracellular domain of an IGF1R protein, such as the human IGF1R protein (SEQ ID NO: 99).
  • the binding site for the human IGF1R protein of the anti-IGF1R antibody according to the present invention is a protein consisting of the amino acid sequence of SEQ ID NO: 174, the binding site 1 is Y775, P776, F778 , R650, S791, L798 and Glu779, binding site 2 includes L641, H808, E809 and L813, and binding site 3 includes V397, D435, W434, Y460 and C488.
  • the epitope of the IGF1R antibody according to the present invention is a conformat epi tope, which may include all or some of the above three binding sites.
  • the term "antibody " refers to a substance produced by stimulation of an antigen in the immune system.
  • the antibody is produced in vivo, recombinantly produced, 2019/117684 1 »(1 ⁇ 1 ⁇ be one synthesized by 2018/015953 or artificially, and the kind is not particularly limited.
  • the antibody includes both an animal antibody chimeric antibody, a humanized antibody, and a human antibody.
  • an antibody refers to an antigen-binding fragment of an antibody having an antigen-binding ability.
  • the antibody also includes a monoclonal antibody and a polyclonal antibody, and the monoclonal antibody may be a separate antibody that specifically binds to a human antibody, a humanized antibody, or a chimeric antibody, IGF1R .
  • Monoclonal antibody to the monoclonal antibody is an isolated antibody that specifically binds to IgGl, IgG2, IgG3, or of type I gG4 IGF1R.
  • Antibodies in accordance with the present invention include, but are not limited to, bispecific antibodies, minibodies, domain antibodies, 10 antibody mimetics (or synthetic antibodies), antibody fusions (or antibody conjugates), and fragments thereof.
  • the structures of the various antibodies are further disclosed herein below.
  • An "antigen-binding fragment" as described herein refers to a portion of an antibody having a specific binding ability to an antigen or a polypeptide comprising the antibody.
  • an antigen-binding fragment can be a polypeptide or a portion of an antibody comprising an amino acid residue that interacts with an antigen (e. G., An epitope) to confer specificity and / or 15 affinity for the antigen to the antibody.
  • Such antigen-binding fragments can typically include one or more " Complementary Determining Regions " ( CDRs ) and may additionally include one or more" framework " regions.
  • CDR is an amino acid sequence that contributes to the specificity and affinity of the antigen binding of the antibody and the framework region is an amino acid sequence that contributes to maintaining the conformativity of these 20 CDRs
  • complementary determining regions refers to a site that imparts binding specificity to an antigen in the variable region of the antibody.
  • the antibody may be any subtype of immunoglobulin (e.g., IgA, IgD, IgE, IgG),
  • I gGl Immunoglobulin Gl
  • I gG2, I gG3, I gG4 antibodies of the IgG type I gGl, I gG2, I gG3, or I gG4 subtypes, such as I gGl or Lt; / RTI > subtype.
  • the IgG forms of the antibody are included, and each of the heavy and light chains are coupled via a disulfide bond of two heavy chains of two heavy chains and two light chains - to form a path 10 chain structure (dimer), with two defined above
  • the heavy chain-light chain has a form that is linked through a disulfide bond at the Fc site of the heavy chain.
  • the IgG type antibody includes an antigen binding site for the same antigen in both heavy chain-light chain structures, Or a double-specific antibody 15 that targets two antigens, including antigen-binding sites for different antigens, to either heavy-chain-light chain structure.
  • an "antigen binding fragment" of an antibody or immunoglobulin chain includes a portion of an antibody that lacks some amino acids as compared to the full-length chain, but can specifically bind to an antigen
  • These antigen-binding fragments can bind specifically to the target antigen, or can be biologically active in that they can compete with other antibodies or antigen-binding fragments 20 for binding to a particular epitope 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953.
  • the antigen-binding fragment is selected from the group consisting of an antibody fragment comprising at least one of the complementary crystal domains, such as scFv, scFv2, scFv-Fc, Fab, Fab 'and F (ab') 2 But is not limited thereto.
  • These biologically active fragments may be produced by recombinant DNA technology or may be produced, for example, by enzymatic or chemical cleavage of a warming antibody.
  • Immunologically functional immunoglobulin fragments are not limited thereto.
  • a "variant" of a polypeptide such as an antigen binding fragment, a protein, or an antibody is a polypeptide that undergoes insertion, deletion, addition, and / or substitution of one or more amino acid residues in comparison to another polypeptide sequence , Fusion polypeptides.
  • some of the antibodies comprise conservative amino acid substitutions at one or more residues of the heavy or light chain, variable region or CDR sequence.
  • “Derivative " of a polypeptide in the present invention means a polypeptide chemically modified through conjugation with another chemical moiety, which is different from insertion, deletion, addition or substitution mutants.
  • the anti-IGF1R antibody or antigen-binding fragment does not prevent IGF-1, IGF-2, and / or insulin, which is a ligand of IGF1R, from binding to IGF1R.
  • the ligand of IGF1R does not inhibit the binding of IGF1R to the IGF1R located in the cell membrane and does not inhibit signaling through IGF1R and also affects the expression of IGF1R on the cell surface 0 2019/117684 1 » (: 1 ⁇ 1 ⁇ 2018/015953 There is an advantage not to hit.
  • the anti-IGF1R antibody or antigen-binding fragment according to the present invention can be effectively used to pass blood brain barrier through transcytosis.
  • Human IGF1R can be activated 5 times for insulin-like growth factor, IGF-1 and IGF-2 and insulin (INS). Signal transduction through IGF1R promotes cell growth and survival through the ms adapter protein, which is dependent on activation of the PI3 Kinase / Akt pathway. IGF1R signals to its major substrates, IRS-1, IRS-2, IRS-3 and IRS-4 and the She protein. Resulting in activation of the Ras / Raf / MAP kinase and PI3 kinase / Akt signaling pathways. Compared with other transcytosis targets known to be expressed in endothelial 10 cells of the brain, the expression of IGF1R is relatively high in brain.
  • the anti-IGF1R antibodies according to the present invention do not interfere with binding of IGF1, IGF2 and / or insulin to IGF1R and do not interfere with the signal transduction pathway as described above via IGF1R.
  • IGF1R is different targets that are being developed as BBB passage 15 functions enhance the use of therapeutic antibodies, e.g., transferrin rece ptor, insulin rece ptor shale normal brain and per ipheral tissue were compared as , Such as liver, lung, and colon.
  • IGF1R is a target 20 of eunhyeol fluid-brain barrier (Blood Brain Barrier, BBB) by RMKRece ptor Mediated Transcytosis) which can deliver the valuable substances into the brain pass through.
  • BBB Blood Brain Barrier
  • RMKRece ptor Mediated Transcytosis eunhyeol fluid-brain barrier
  • the anti-Jang ' s antibody and its antigen-binding fragments according to the present invention can be used as a shuttle path through the blood brain barrier because it does not inhibit the signal transmission through the ligand binding and the criminal crypts of the criminal.
  • the anti-convulsant antibody or antigen-binding fragment thereof according to the present invention is preferably a trans- It is possible to pass through the endothelial cells of the brain.
  • the antibody according to the present invention is located at the same position as the cerebral blood vessel of the mouse when the mouse is injected with blood.
  • biological barriers refer to cells, membranes, or structures that prevent effective passage, diffusion or transmission of cells, tissues, membranes or biological molecules.
  • biological barriers include nerve cells / tissues, connective tissues, muscles, membranes or epithelia (e.g., mucosal or blood vessel) cells.
  • a representative example is the blood brain barrier.
  • These barriers are very tight, limiting the passage of low molecular weight substances of about 600 3 molecular weight into the brain.
  • Brain blood barrier, spinal cord vascular spinal cord barrier, and retinal hemorrhage The retinal barrier is a continuous capillary barrier within the central nervous system, commonly referred to as BBB.
  • a "blood brain barrier carrier” can pass through the blood brain barrier to deliver the brain action factor material, for example, a protein comprising a compound, a peptide and a polypeptide, Nucleic acids, antibodies, or low molecular compounds.
  • Antibodies in accordance with the present invention can be generated and selected from the above-described ones using antigen-specific human mAb humanized electron-transfer mice with the desired specificity, using hybridoma technology.
  • Such antibodies can be cloned and expressed using appropriate vectors and host cells, or the antibodies can be harvested from cultured hybridoma cells.
  • the antibody may be derived from a phage-display library (phage-di splice librari).
  • Phage display technology is a method of displaying an antibody repertoire on the surface of a filamentous bacteriophage and mimicking an immune select ion that selects the phage binding to the desired antigen from the antibody repertoire.
  • One such technique may refer to embodiments of the present invention or PCT Publication No.
  • the humanized IGF1R antibodies of the invention are screened through a phage display method.
  • the present invention relates to a separated antibody or an antigen-binding fragment thereof that specifically binds to IGF1R, wherein the antibody or antigen-binding fragment comprises a complementarity determining region of a heavy chain and a complementary determining region of a light chain and specifically binds to IGF1R Polypeptides, proteins 2019/117684 1 »(1 ⁇ 1 ⁇ 2018/015953 may be, or antibody or antigen-binding fragment of a number of days.
  • a heavy chain variable region comprising at least one heavy chain complementarity determining region selected from the group consisting of (0 1) 1, ⁇ 1 1 2 and ⁇ 3 ⁇ , or the at least one heavy chain complementarity determining region;
  • a light chain variable region comprising at least one light chain complementarity determining region selected from the group consisting of 0 1, 1: 2, and 1 light chain;
  • the light chain variable region may comprise one or more light chain frameworks selected from the group consisting of 1 1, 1 2, 3, and 1 4.
  • the term " substantial identity " means that the present invention retains the effects described in the present invention in which the sequence mutation is present.
  • the heavy chain variable region of the anti-human antibody according to the present invention is shown in Table 1 H-CDR1, H-CDR2, and H-CDR3 as described in Table 3, or additionally includes H-FR1, H-FR2, H- It may include the heavy chain framework of FR4.
  • the light chain variable region of the anti-IGF1R antibody according to the present invention includes L-CDR1, L-CDR2 and L-CDR3 shown in Table 3 below, or L-FR1, L- FR3, and L-FR4 light chain frameworks.
  • the anti-IGF1R antibody or antigen-binding fragment thereof comprises CDR-H1, CDR-H2 and CDR-H3 of each of the clones selected from the group consisting of the amino acid sequences of CDR-H1, CDR- CDR-L2 and CDR-L3 of each of the clones selected in the group consisting of the heavy chain variable region comprising CDR-H3 and the amino acid sequences of CDR-L1, CDR-L2 and CDR-L3 shown in Table 2 Can be.
  • the amino acid mutation in the Fc region of the anti-IGF1R antibody eg, deamindat ion removal of the amino acid, does not alter the binding capacity of the antigen IGF1R to ECD, Thereby extending the half-life of the antibody.
  • the position of the amino acid from which the deamidate ion is removed from the anti-IGF1R antibody can be N51D, N95aH, N95aR, N95aD of light chain LCDR2, N95aK, N95aR, N95aD of LCDR3, N54D or N54Q in HCDR2 of heavy chain in clone 1564
  • Table 3 Framework sequences of antibody clones and heavy chain variable regions of the invention
  • Antibodies according to the present invention may be antibodies comprising light chain variable domains and heavy chain variable regions and the various heavy and light chain variable regions disclosed herein may be represented by
  • the heavy chain variable region and the light chain variable region described in Tables 5 and 6 below can be freely combined for the production of various types of antibodies. Examples of combinations of the above heavy chain variable region and light chain variable region are shown in Table 5 . 2019/117684 1 »(: 1/10 ⁇ 018/015953
  • the various heavy and light chain variable regions disclosed herein are set forth in Table 5 and Table 6 . Each of these variable regions may be joined to the heavy and light chain constant regions to form respective heavy and light chains of the intact antibody.
  • Examples of the combination of the heavy chain variable region and the light chain variable region constituting the anti-parallel antibody according to an example of the present invention may be a combination of the heavy chain variable region and the light chain variable region according to the same clone name as shown in Table 5 below .
  • Heavy chain 0 1 1 Air ⁇ acid including one of the In a particular embodiment of the invention, the amino acid sequence of SEQ ID NO: 1 to SEQ ID NO: 9,
  • Heavy chain 0 2 0 1 2) comprises one of the amino acid sequence of SEQ ID NO: 10 to SEQ ID NO: 49,
  • Light chain 01? 2 (1,? 2) comprising one of the amino acid sequences of SEQ ID NO: 114 to SEQ ID NO: 132, and
  • a light chain comprising at least one of the amino acid sequences of SEQ ID NOS: 133 to 161; and 3) at least one selected from the group consisting of light chain 0 to 3).
  • the antibody or antigen-binding fragment thereof according to the present invention is a heavy chain comprising one of the amino acid sequences of SEQ ID NO: 1 to SEQ ID NO: 9. (3-01-part.), One of SEQ ID NO: 10 to SEQ ID NO: 49 ≪ / RTI > 1 to 2), and one of the amino acid sequences of SEQ ID NOS: 50 to 80, A heavy chain variable region comprising a heavy chain variable region,
  • a light chain comprising one of the amino acid sequences of SEQ ID NO: 96 to SEQ ID NO: 113, a light chain comprising one of SEQ ID NO: 114 to SEQ ID NO: 132, (1-001), and light chain (3-0) (1-0-3) comprising one of the amino acid sequences of SEQ ID NO: 133 to SEQ ID NO: 161.
  • the anti-first antibody or antigen-binding fragment thereof is a protein comprising the amino acid sequence of SEQ ID NO: 174 in an amount of 775, 776, F778, 0, 3791, 1798, 0 779, 41, 809, 1813, ⁇ 397, 0435, ⁇ 434, ⁇ 460 and 0488 are specifically recognized and bound to each other. May be 1 ⁇ 1 ⁇ 2018/015953 or an antigen-binding fragment thereof: 2019/117684 1 »(.
  • the anti-offending antibody fragment or antigen-binding fragment thereof binds to at least one binding site selected from the binding site 1 to the binding site 3 in the protein comprising the amino acid sequence of SEQ ID NO: ,
  • the binding site 1 comprises at least one amino acid selected from the group consisting of 775, 776, 778, 1, 50, 3791, 98 and 11779 and the binding site 2 comprises 1641, 11808, 809 and 13
  • binding site 3 may comprise one or more amino acids selected from the group consisting of: 397, 0435, 34, 460 and 0488.
  • the heavy chain variable region of the antibody or antigen-binding fragment thereof comprises a heavy chain variable region framework 1 (1) 1 located at one end in II-3, comprising one of the amino acid sequences of SEQ ID NOS: 81-84,
  • the light chain variable of the antibody or antigen-binding fragment of this according to the invention region comprising one of the amino acid sequence of SEQ ID NO: 162 to 164, 1 1 ⁇ 1 light chain variable region framework, which is located across the first end of the first one (dre criminal),
  • a light chain variable region framework (1 < r > 2), located between 1 < 2019/117684 1 »( : 1 ⁇ 1 ⁇ 2018/015953
  • the heavy chain variable region and light chain variable region disclosed in Tables 5 and 6 may be used as separate domain antibodies or may be freely combined with each other to form various antibodies
  • Domain antibody &quot in the present invention is an immunologically functional immunoglobulin fragment comprising only a variable region of the heavy chain or a variable region of the light chain.
  • a region on a two covalently linked by a peptide linker also forms the main antibody of divalent ⁇ ). These two areas of the main highway 2 antibody may be targeted to the same or a different antigen.
  • Antigen-binding fragment of the anti- ⁇ antibodies according to the invention is an antibody comprising at least the complementarity determining regions or to a fragment, e.g., 3 acid (3 acid), 2, 3 new -1; (:, ',') Mini-body, and diabody.
  • the antigen-binding fragment is coupled from one antigen with a structure having a light chain variable region and heavy chain variable region and the constant region of the heavy chain and the first constant domain of the light chain (to-1)
  • a hinge region 0 1 6 011 including a tail residue is produced in which two cysteine residues in the hinge region form a disulfide bond.
  • Single-chain variable fragment scFv
  • double-chain Fv two-chain 2019/117684 1 (1) ⁇ 2018/015953 var i able fragment.
  • the double-stranded Fv is non-covalently linked so that the heavy chain variable region and the light chain variable region can be linked.
  • the short chain can be either a covalent linkage of the heavy chain variable region and the light chain variable region either directly or through a peptide linker,
  • the peptide linker may be as described above, for example,
  • the peptide linker can determine its length in various ways, without affecting the function of the antibody.
  • the type of amino acid contained in the peptide linker is, for example, composed of one or more amino acids selected from the group consisting of SEQ ID NO: 11
  • the peptide linker may be 4343) 11 , and the silver may be represented by an integer of 1 to 10, for example, an integer of 2 to 5, particularly 3 or 4,
  • An example of the peptide linker may be a peptide comprising the amino acid sequence of SEQ ID NO: 172 or 173.
  • SEQ ID NO: 172 (SEQ ID NO: 172) ( ⁇ 50 ( ⁇ 30 ( ⁇ 5 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953
  • the polypeptide produced can form an antigen-binding monomer by folding, or can form a multimer (e. G., Dimer, trimer or tetramer) depending on the length of the flexible linker between the two five variable domains have.
  • a multimer e. G., Dimer, trimer or tetramer
  • the antigen-binding fragment can be obtained using a protein hydrolyzing enzyme (for example,
  • the single chain antibodies disclosed in the present invention can be used in combination with the domain combinations of the heavy and light chain variable domains
  • the anti-yaw coupling the antibody and an antigen fragment, 15, including the heavy chain variable region may comprise a light chain comprising the heavy chain and the light chain variable region.
  • the heavy chain variable region and the light chain variable region can be joined to the heavy chain constant region and the light chain constant region, and the heavy chain and light chain sequences can also be combined to form an intact antibody structure.
  • Such a constant region sequence that can be combined with a variable region according to the present invention is exemplary 20
  • the constant region is an immunoglobulin (e.g., human immunoglobulin) heavy chain constant 2019/117684 1 »(: 1 ⁇ 1 may be appropriately selected from ⁇ 2018/015953 region and a light chain constant region, for example, the heavy chain constant region 1 yongya
  • the side region may be a kappa constant region or a lambda light chain constant region, but is not limited thereto.
  • variable region according to the invention can be joined to a constant region to form the heavy and light chain sequences described below. Combinations of the heavy and light chains are shown in Table 9. Also, It is described in 10. the constant region may be properly selected from the heavy chain constant region and a light chain constant region of an immunoglobulin (such as human immunoglobulin).
  • immunoglobulin such as human immunoglobulin
  • ISA / KR includes two types of biologically active or dual functional antibodies, which are either related or not related to each other. 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953 is an artificial hybrid antibody which recognizes a target bispecific antibodies can be prepared using a variety of methods, such as fusion or ⁇ 'fragment of hybridoma connection have.
  • multispecific antigen binding protein or “multispecific antibody” refers to two or more antigens or epitopes, and includes two or more antigen binding sites 5.
  • double specific antigen binding protein or antibody is a hybrid antigen binding protein or antibody having two different antigen binding sites.
  • bispecific antibodies are a type of multi-specific antigen binding proteins or multi-specific antibodies, a variety of methods known for example, For example, by fusion of hybridomas or by coupling of fragments.
  • Antibodies and antigen-binding fragments thereof capable of producing the above-mentioned multispecific antibody may include both the above-mentioned anti-microbial antibody and the antigen-binding fragment thereof, And the antigen-
  • the antigen-binding fragment of the anti-cancer antibody can be linked to the antigen-binding fragment through a linker such as a peptide linker.
  • the peptide linker can be as described above.
  • the anti-crest antibody and its antigen-binding fragment are bound 2019/117684
  • a method for delivering a second antibody or antigen binding fragment thereof targeting different antigens or epitopes to the brain through a blood brain barrier can be performed.
  • the second antibody may be an antibody that exerts an effect on the brain, but is not particularly limited.
  • the anti-IGF1R antibody or antigen-binding fragment thereof may share a specific region or sequence with a different second antibody.
  • an anti-IGF1R antibody can share a constant region of an antibody or antigen-binding fragment of a second antibody, or share Fc brilliance.
  • the structure of the bispecific antibody in the present invention is a bivalent form in which the scFv of the anti-IGF1R antibody is linked to the Fc region of two full-length immunoglobulin heavy chains, for example, form double antibody and a monovalent double antibody in which the scFv of the anti-IGF1R antibody is directly linked to the end of one heavy chain of the two immunoglobulins, either directly or through a linker, but a monovalent double antibody is preferable Do.
  • the half-life of a monovalent form clone is improved compared to that of a bivalent form, wherein the structure of the monovalent form clone is bound to IGF1R as a linker at only one heavy chain end in the form of a complete immunoglobulin (ScFv) are linked.
  • a full immunoglobulin form one heavy chain is linked to a domain antibody that binds to an IGF1R antigen that contains a linker at the C terminus, and the other heavy chain has two constant It is a heterodimer type with Knob-In-hole technique including heavy chain.
  • an anti-IGF1R antibody or antigen-binding fragment thereof 2019/117684 1 »(1 ⁇ 1 and the second antibody that binds to ⁇ 2018/015953 may be an isolated antibody specifically binding to the human antibody humanized antibodies, chimeric antibodies, or IGF1R.
  • the second antibody includes, but is not limited to, a complete antibody, bispecific antibody, minibody, domain antibody, antibody mimetic (or synthetic antibody), antibody fusions (or antibody conjugates) and fragments thereof.
  • the present invention relates to an anti- syn antibody and an antigen-binding fragment thereof.
  • the alpha-synuclein recognized by the antibody provided herein as an antigen may be selected from the group consisting of human alpha-synuclein, monkey alpha-synuclein (e.g., Rhesus alpha-synuclein), mouse alpha-synuclein, rat alpha-synuclein May be selected from mammalian alpha-synucleins, e.g., human alpha-synuclein may be alpha-synuclein ( NCBI ID : NP - 000336 ), but is not limited thereto.
  • human alpha-synuclein may be alpha-synuclein ( NCBI ID : NP - 000336 ), but is not limited thereto.
  • alpha-synuclein may refer to human alpha-synuclein, and the antibody or antigen-binding fragment thereof provided herein may be used in combination with human alpha synuclein, as well as monkeys such as Rhesus, , And / or mouse alpha-synuclein.
  • C- terminal region for example residues 110 to 120 times may be a C- terminal region that contains the moiety or continuously at least 11 or 12 amino acid peptide consisting of residues containing 111 times to 122 times residue.
  • the antibody or antigen-binding fragment thereof recognizes the antigen recognition site and binds to the ⁇ -synuclein aggregate with high affinity.
  • affinity or affinity &quot is the strength of an interaction between an antibody or antigen-binding fragment thereof and an antigen, and includes the CDR sequence of the antibody or antigen-binding fragment, and / The nature of the antigen, such as the size, shape, and / or charge of the antigen, etc.
  • the method of determining such affinity is well known in the art , And typically a dissociation constant (KD), but is not limited thereto.
  • alpha-synuclein aggregates specifically binds to alpha-synuclein protein or alpha-synuclein aggregates means that the affinity for alpha-synuclein protein or alpha-synuclein aggregates is relatively high compared to other antigens
  • alpha-synuclein aggregates in particular amyloid fibrils, protofibrs and oligomers, especially amyloid fibrils, which have an affinity for amyloid fibrils, but are not limited to, 0.1 x 10 _ 1 ° M to 2 x 10 10 M, or 0.05 x 10 _ 1 ⁇ M to 0.3 x 10 __ in Octet and SPR analyzes, respectively.
  • humanized alpha-synuclein antibodies comprising light and heavy chains according to an example of the present invention, such as Hull Fll (ver. L), Hull FlKver.2), and Hull Fll_ABL2-4, Exhibit high phagocytosis promoting activity.
  • the binding force to alpha-synuclein aggregates, eg, cell-based assays, has similar or superior activity to chimeric alpha-synuclein antibodies.
  • the alpha-synuclein antibody according to the present invention is an antibody to alpha-synuclein in which the alpha-synuclein aggregates secreted outside the nerve cells in the subject's nervous system migrate from extracellular space to other normal cells, Inhibiting cel 1-to-cel 1 transmission of aggregates, and also has the ability to promote phagocytosis of alpha-synuclein aggregates located in the extracellular space of microglial cells.
  • Alpha-synuclein aggregates spread from one cell to another in the same manner as a prion, resulting in synuclein disease, as alpha-synuclein, particularly alpha-synuclein aggregates, spread throughout the brain.
  • alpha-synuclein aggregates are toxic to brain neurons
  • brain inflammation neuroinfla_ation
  • Sinus garre disease for example, Parkinson's disease
  • a disturbance of cognitive function appears.
  • the alpha-synuclein antibody of the present invention inhibits the neuronal cell migration of alpha-synuclein or alpha-synuclein aggregates so that the alpha-synuclein aggregates bind to the brain
  • the phagocyte action of the microglial cells is promoted, and the reduction of the alpha-synuclein 5 aggregates existing outside the nerve cells in the target nervous system.
  • the level of alpha-synuclein aggregates which are causative agents, may be reduced to reduce brain neuronal cell death and brain inflammatory response, and further to improve, alleviate or prevent the symptoms and disease progression of Sinus Klein's disease, such as Parkinson's disease.
  • the alpha-synuclein antibody according to the present invention inhibits neuronal cell migration of 0) alpha-synuclein or 10- alpha-synuclein aggregates, and (11) - It has excellent activity in that it can perform both functions in relation to the reduction of the level of sinuchlein agglutinates (I 061 1 -
  • Alpha-synuclein antibodies because of one thing active in the (0 and 01) active, 15 which alpha of the present application - that is advantageous in the prevention or treatment of high synuclein disease than synuclein antibody-synuclein antibodies are known alpha .
  • the alpha-synuclein antibody according to the present invention is more potent in suppressing the elimination and reduction of alpha-synuclein aggregates and inhibiting the action as a pathogen, and thus is useful for the treatment of sinus gar disease or related symptomatic diseases Etc.).
  • An antibody according to the present invention having a high affinity for 20 alpha-synuclein aggregates or 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953 antigen binding fragment of alpha-synuclein can reduce the aggregate formation may lower the concentration of aggregates in the brain also a high affinity for the alpha-synuclein aggregates
  • the antibody or antigen-binding fragment according to the present invention can reduce the formation of alpha-synuclein aggregates outside of the central nervous system, thereby eventually modifying the equilibrium state between the forms of alpha-synuclein 5 bound to the blood-brain barrier, The effect of lowering the concentration of
  • the antibody is not limited to, for example, but can be administered in the same manner as a simpler subcutaneous injection, resulting in sufficient efficacy. Furthermore, it has a high affinity for alpha synuclein aggregates
  • Antibodies or antigen-binding fragments according to the present invention can inhibit and / or reduce the formation and / or accumulation of alpha-synuclein aggregates and / or cells, thereby lowering the concentration of aggregates in the brain.
  • Antibodies or antigen-binding fragments according to the present invention having a high affinity for them can reduce the formation of alpha-synuclein aggregates outside the central nervous system and eventually alter the equilibrium state between the forms of alpha-synuclein 15 bound to the blood-brain barrier
  • the antibody or antigen-binding fragment according to the present invention may inhibit the formation of aggregates or remove both monomers and aggregates through removal of the monomers. .
  • An antibody or antigen-binding fragment thereof that specifically binds to an alpha-synuclein protein or alpha-synuclein 20 aggregate provided herein is a naturally occurring 2019/117684 1 »(part 1 ⁇ 1 ⁇ 2018/015953 it may not (11011-11 710 31 1 00 11 11 I ⁇ !; For example, chemically synthesized or recombinantly produced). Such recombinant techniques are well known in the art.
  • an antibody means an intact immunoglobulin of any isotype, or an antigen binding fragment capable of competing with an intact antibody for binding to a target antigen, for example, chimeric, Or an antigen-binding fragment thereof.
  • An antibody is itself a kind of antigen binding protein.
  • An intact antibody generally comprises at least two full-length heavy chains and two full-length light chains, but in some cases The antibody may comprise only the heavy chain.
  • the antibody or antigen-binding fragment thereof may be derived only from a single source (muscle), or it may be a chimera.
  • a chimeric antibody comprises a portion derived from two different antibodies and is described in more detail below.
  • Antibody or antigen binding fragments thereof may be produced by enzymatic or chemical cleavage of hybridomas, recombinant techniques or intact antibodies.
  • the term antibody herein includes two full-length heavy chains and two antibody comprising two full-length light chains, as well as containing the derivatives thereof, variants, fragments, and mutants, examples of which the Baba described below with same.
  • the antibody is a monoclonal antibody, a bispecific antibody, a minibody, a domain antibody, an antibody mimetic (or synthetic antibody), a chimeric antibody, a humanized antibody, a human antibody, an antibody fusion (or antibody conjugate) But are not limited to, fragments thereof and include various forms of antibodies disclosed herein.
  • 2019/117684 1 » (: 1 ⁇ 1 ⁇ 2018/015953
  • the fragment (s), diabody or heavy chain variable region and light chain variable region may be single chain, single chain antibody molecules linked through a spacer.
  • the term "light chain” includes full-length light chains and fragments thereof having sufficient variable region sequences to provide binding specificity for an antigen or epitope.
  • the full-length light chain comprises the variable region domain 1, and the constant domain domain ratio.
  • the variable region domain of the light chain is present at the amino terminus of the light chain polypeptide.
  • kinds of light chains include kappa and lambda chains.
  • the "heavy chain” includes full-length heavy chain and fragments thereof having a 10 sufficient variable region sequence to provide a binding specificity for the antigen or epitope.
  • Full-length heavy chain variable region domain ssae and three constant region domains for 1, ⁇ 2 and a ⁇ 3. domain is present at the amino terminus of the heavy chain polypeptide and (domain is present in the carboxy terminal end, the location ⁇ 3 the closest to the carboxy terminus.
  • heavy chain ⁇ 6 (1 Dragon, 1 ⁇ 2, ⁇ 3 and 64 subtypes), 1 show (including 1 show 1 and 1 show 2 subtypes), ⁇ and 15 £ : isotype.
  • an "antigen-binding fragment” refers to a portion of an antibody having a specific binding capacity for an antigen or a polypeptide comprising the same.
  • an antigen binding fragment can interact with an antigen (eg, an epitope)
  • a portion of an antibody comprising an amino acid residue that confers a specificity and / It may be a polypeptide comprising the polypeptide of SEQ ID NO: 201.
  • Such antigen-binding fragments can typically include one or more "complementarity determining regions” (CDRs), and in addition, can include one or more "framework” regions.
  • the framework region is an amino acid sequence region that contributes to maintaining the proper conformations of these CDRs, and can promote binding between the antigen binding region and the antigen.
  • an "antigen-binding fragment" of an antibody or immunoglobulin chain includes a portion of an antibody that lacks some amino acids as compared to the full-length chain, but is capable of specifically binding to an antigen .
  • Such fragments may be specifically biologically active in terms of being capable of binding specifically to the target antigen or competing with another antibody or antigen binding fragment for binding to a particular epitope.
  • Such biologically active fragments may be produced by recombinant DNA technology, Can be produced by enzymatic or chemical cleavage of intact antibodies.
  • Immunologically functional immunity Fragments including but not limited to Fab, Fab, F (ab ') 2, Fv, domain antibodies and single chain antibodies (such as scFv, scFv-Fc, etc.) , Mouse, rat, camelid or rabbit.
  • the functional portion of the antibody such as one or more of the CDRs disclosed herein, may be derived from a second protein or a small molecule 2019/117684 1 »(1 ⁇ 1 is connected to ⁇ 2018/015953 compound with a covalent bond can be used as a target for a therapeutic agent to a specific target.
  • the term "" in the present application includes two molecules of heavy chain fragments including the 3 ⁇ 42 and ( 3 domains of the antibody.
  • the two heavy chain fragments are coupled by a combination of two or more disulfide and (hydrophobic interaction 3 ⁇ 43 domain.
  • Chain hindered sulfide bonds can be formed to form 1 ' ) 2 molecules.
  • single chain antibody is a single polypeptide chain of the heavy and light chain variable regions 20 connected by a flexible linker antigen binding region.
  • Single chain antibodies can be found, for example, in U.S. Patent No. 5,260,203.
  • Divalent antigen binding protein "or Divalent antibody “ includes two antigen binding sites.
  • the two antigen binding sites included in such a bivalent antibody may have the same antigen specificity, or may be bispecific antibodies each binding to a different antigen.
  • a “multispecific antigen binding protein” or “multispecific antibody” is one that targets two or more antigens or epitopes.
  • biospecific " or "bispecific” antigen binding protein or antibody is a hybrid antigen binding protein or antibody having two different antigen binding sites.
  • specific antibodies may be multispecific antigen binding proteins or multispecific As a kind of antibody, it can be produced by various known methods such as fusion of a hybridoma or linkage of this fragment.
  • biospecific " or "bispecific” antigen binding protein or antibody is a hybrid antigen binding protein or antibody having two different antigen binding sites.
  • specific antibodies are multispecific antigen binding proteins or multispecific
  • various known methods such as hybridization of hybridomas or fragments thereof 2019/117684 1 » (: 1 ⁇ 1 ⁇ 2018/015953
  • Bispecific antigen binding protein or two of two different epitopes from each other to the antigen binding site that binding of the antibody may be located on the same or different target proteins.
  • the 5 antibody according to the present invention may take the form of a bispecific antibody, further comprising a binding to a carrier for delivery through the blood vessel brain barrier.
  • delivery systems such as glucose and amino acid transporters, receptor-mediated transcytosis of insulin or transferrin, which are inherent in cells.
  • conjugate refers to a chimeric molecule of an antibody or antigen-binding fragment thereof described herein with other molecules, particularly vascular brain barrier carriers or therapeutic agents as described below.
  • the fragment is physically bound 15 by a method including, for example, covalent bonding or van der Waals or physical forces by hydrophobic interaction, encapsulation embedding, or combination thereof with other molecules.
  • the antibody or antigen-binding fragment thereof according to the present invention may be linked via a peptide linker.
  • the present disclosure also includes one or more amino acid sequences having substantial sequence identity with one or more of the amino acid sequences disclosed herein.
  • substantial identity herein is meant maintaining the effect disclosed herein in which the sequence variation is present.
  • sequences of the antibodies or antigen-binding fragments disclosed herein Rather than in the skeleton of the variable region.
  • the antibody or antigen-binding fragment thereof specifically binding to alpha-synuclein or an aggregate thereof comprises a heavy chain variable region comprising a complementarity determining region of 001, 002 and 003; And a light chain variable region comprising 001 < 1 >, 001 < 2 > and 0 complementarity determining regions of 3.
  • the anti-alpha-synuclein antibody or antigen-binding fragment thereof may comprise 10 sequences:
  • a heavy chain comprising one of the amino acid sequences of SEQ ID NO: 1 and SEQ ID NO: 6
  • a heavy chain 0 2 (ball example 2) comprising one of the amino acid sequences of SEQ ID NOS: 2 to 4 and SEQ ID NOS: 7 to 8,
  • SEQ ID NO: 10 and SEQ ID NO: 13 which contains one of the amino acid sequences of SEQ ID NO: 10 and SEQ ID NO: 13,
  • Light chain 20 0 2 (Jade Example 2) comprising one of the amino acid sequences of SEQ ID NO: 11 and SEQ ID NO: 14, and 2019/117684 1 »(1 ⁇ 1 ⁇ 2018/015953 SEQ ID NO: 12 and a light chain ⁇ comprising one of the amino acid sequence of SEQ ID NO: 15 Example 30 ⁇ 3).
  • the anti-heavy chain comprises one of the amino acid sequence of the alpha synuclein antibody or antigen-binding fragment thereof, the heavy chain 0 1 0 1 3 ⁇ 41) comprising the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 to 4 0 example 2 01 to 2), and SEQ ID NO: heavy chain variable region comprising the heavy chain 0 example 3 example 3 control) comprising the amino acid sequence of 5; ? And a light chain comprising the amino acid sequence of SEQ ID NO: 10 (one's) 11), the light chain 0 for containing the amino acid sequence of SEQ ID NO: 11, 2 (false?” Example 2), and the amino acid sequence of SEQ ID NO: 12 And a light chain variable region comprising a light chain 0 3 (1: 3 ) comprising a sequence.
  • the anti-alpha-heavy chain 0 example comprising one of the amino acid sequence of synuclein antibody or an antigen-binding fragment is a heavy chain 0, 01 ⁇ 1 (Example 1) comprising the amino acid sequence of SEQ ID NO: 6, SEQ ID NO: 7 to 8 2 control 2) and a heavy chain ⁇ seedlings 301 comprising the amino acid sequence of SEQ ID NO: 93) heavy chain variable region containing the;
  • SEQ ID NO: 13 the light chain 0 0 seedlings containing the amino acid sequence 1 (1 to «1), SEQ ID NO: light chain 02 comprising the amino acid sequence of the 14 (1 I: 2) and SEQ ID NO: contains 15 amino acid sequence of light chain 0 example 3 0 to: 3) can be the light chain comprises a light chain variable region comprising.
  • a polypeptide fragment comprising one of the amino acid sequences of SEQ ID NOS: 18 to 19 and SEQ ID NOS: 41 to 44 ,
  • a heavy chain variable region framework ⁇ which is located on the side of the terminal 1, it comprises a polypeptide fragment containing one of the amino acid sequence of SEQ ID NO: 53 to 58 and SEQ ID NO 71 to 77,
  • Y 1 and I 1 a heavy chain variable region framework (1 3 ⁇ 42) located between the two, one of the amino acid sequence of SEQ ID NO: 59 to 61 and SEQ ID NO: 78 to 81
  • Example 2 and 13 heavy chain variable region framework which is located between (1 ⁇ 3 ⁇ 43) as, including a polypeptide fragment comprising one of the amino acid sequence of SEQ ID NO: 62 to 67 and SEQ ID NO 82 to 88, and / or 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953
  • the heavy chain variable region framework (SEQ ID NO: 4) located at the 0 end of Example 3 may comprise a polypeptide fragment comprising one of SEQ ID NOs: 68 to 70 and SEQ ID NO: 89.
  • heavy chain variable region framework sequences are illustrated in Tables 3 and 4, in the light chain variable region framework and in Tables 5 and 6.
  • the anti-alpha-synuclein antibody or antigen-binding fragment thereof is selected from the group consisting of SEQ ID NO: 1 and SEQ ID NO: 6, a heavy chain variable region comprising one of the amino acid sequences of SEQ ID NO: 4 and the amino acid sequences of SEQ ID NOS: 7 to 8
  • the heavy chain variable region comprises a heavy chain variable region framework comprising one of SEQ ID NOs: 16 to 17 and one of SEQ ID NOs: 35 to 40), one of SEQ ID NOs: 20 to 31 and SEQ ID NOs: 45 to 50 3) in the heavy chain variable region framework comprising one of the amino acid sequences of SEQ ID NOS: 20 to 31 and SEQ ID NOS: 45 to 50, and SEQ ID NOS: 32 to 34 and SEQ ID NOS: 4), which comprises one of the amino acid sequences of SEQ ID NOS: 51-52. More specifically, the heavy chain variable region comprises the amino acid sequence of SEQ ID NO: 17, 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953
  • the anti-alpha-synuclein antibody or antigen-binding fragment thereof comprises a light chain 0? 1 (1? 1 kit 1) comprising one of the amino acid sequences of SEQ ID NO: 10 and SEQ ID NO: 13, 0 < / RTI > example 2 (I-O example 2) comprising one of the amino acid sequences of SEQ ID NO: 14 and SEQ ID NO: 15, A light chain variable region,
  • the light chain variable region further comprises a light chain variable region framework comprising one of SEQ ID NOS: 53-58 and one of SEQ ID NOS: 71-77 SEQ ID NO:
  • the light chain variable region comprises 1? 1 comprising the amino acid sequence of SEQ ID NO: 58, 1 2 including the amino acid sequence of SEQ ID NO: 59, 1? 3 including the amino acid sequence of SEQ ID NO: 67, 34 amino acids You can include it.
  • the anti-alpha-synuclein antibody or antigen-binding fragment thereof according to the present invention may comprise the heavy chain 0 of Examples 1 to 3 consisting of the amino acid sequences of SEQ ID NOS: 1, 2 and 5, 2019/117684 1 > (its 1 '/ Table 1 /
  • the anti-alpha-synuclein antibody or antigen-binding fragment thereof comprises the heavy chain 0 of the amino acid sequence of SEQ ID NOs: 6, 7 and 9 and the amino acid sequence of SEQ ID NO: Amino acid sequence of SEQ ID NO: 35, 41, 45, and 51
  • an antibody comprising the heavy chain variable region sequence of SEQ ID NO: 90 (( ⁇ 11 11 - ⁇ 3 ⁇ 4) and the light chain variable region sequence of SEQ ID NO: 109 ((soil 11 -1) or the heavy chain variable region of SEQ ID NO: (SEQ ID NO: 11) and the light chain variable region sequence of SEQ ID NO: 116 (SEQ ID NO: 11-1) are not included in the anti-alpha-synuclein antibody according to the present invention.
  • An anti-alpha-synuclein antibody or antigen-binding fragment thereof according to a specific embodiment of the present invention comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 1,
  • a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 5; And a light chain comprising the amino acid sequence of SEQ ID NO: 10 (Light chain 0 # 2 containing the amino acid sequence of SEQ ID NO: 11 (1: 2) and light chain 0 ⁇ 3 comprising the amino acid sequence of SEQ ID NO: 12 3), < / RTI >
  • the heavy chain variable region is a heavy chain variable region framework comprising one of the amino acid sequences of SEQ ID NOS: 16 to 17), a heavy chain variable region framework variant 2) comprising one of the amino acid sequences of SEQ ID NOS: 18 to 19, A heavy chain variable region framework comprising at least one of the amino acid sequences of SEQ ID NOS: 20-31, and heavy chain variable framework frameworks 1-4 comprising at least one of the amino acid sequences of SEQ ID NOS: 32-34,
  • the light chain variable region comprises a light chain variable region framework () comprising one of the amino acid sequences of SEQ ID NOS: 53 to 58, a light chain variable region framework comprising one of the amino acid sequences of SEQ ID NOS: SEQ ID NOs:
  • a light chain variable region framework (1 ⁇ 3) comprising one of the amino acid sequences of SEQ ID NOS: 68-70
  • a light chain variable region framework (1 ⁇ 4) comprising one of the amino acid sequences of SEQ ID NOS: 68-70.
  • the anti-alpha-synuclein antibody or antigen-binding fragment thereof comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2 and SEQ ID NO: And a heavy chain variable region comprising light chain variable regions comprising SEQ ID NO: 10, SEQ ID NO: 11 and SEQ ID NO: 12, and light chain variable regions comprising light chain 0 to 1 to 0 SEQ ID NO: 3, 17 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953
  • a grape seedlings 3 comprising one of the amino acid sequences of SEQ ID Nos. 29 to 31,
  • the anti-alpha-synuclein antibody or antigen-binding fragment thereof comprises a heavy chain of a heavy chain comprising the amino acid sequence of SEQ ID NO: 6), an amino acid sequence of SEQ ID NO: 7 to 8 A heavy chain variable region comprising heavy chain 3), and heavy chain variable region comprising 3) heavy chain 3) comprising the amino acid sequence of SEQ ID NO: 9; And light chain 0 (SEQ ID NO: 1) comprising the amino acid sequence of SEQ ID NO: 13, 2 (1 ⁇ 13 ⁇ 42) of light chain 0 containing the amino acid sequence of SEQ ID NO: 14, and light chain . ≪ / RTI >
  • the antibody may comprise a light chain variable region comprising a band (13)
  • said heavy chain variable region comprises one of the amino acid sequences of SEQ ID NOS: 35-40
  • a heavy chain variable region framework comprising one of the amino acid sequences of SEQ ID NOs: 45 to 50), and an amino acid sequence of SEQ ID NOs: 51 to 53
  • One heavy chain variable region 2019/117684 1 »(1 ⁇ 1 ⁇ 2018/015953 the light chain variable region framework, the light chain variable region (L-FR1), the amino acid of SEQ ID Nos. 78 to 81 comprising one of the amino acid sequence of SEQ ID NO: 71 to 77 light chain variable region framework comprises one of the sequences L-FR2), the light chain variable region framework (the amino acid sequence of the L-FR3), and 5, SEQ ID NO: 89, including one of the amino acid sequence of SEQ ID NO: 82 to 88 ( L-FR4) . & Lt; / RTI >
  • variable and constant regions are joined by a "J" region that is at least about 12 amino acids in length, and the heavy chain also includes a "D " region of about 10 or more amino acids. .. (.. Paul, ff , 10 ed) Fundamental Immunolo gy, 2nd ed, Ch 7 1989, New York:. you can see Raven Press, typically in the variable region of the light chain / heavy chain pair of antibody sites antigen binding .
  • variable regions of the immunoglobulin chain generally have the same overall structure and include a relatively conserved framework region (FR) followed by three hypervariable regions referred to as " complementary determining regions or regions or domains " do.
  • CDRs of each chain-derived variable region constituting the 15 heavy / light chain pairs are typically aligned by framework regions to form a structure that specifically binds to a specific epitope of the target protein ( alpha-synuclein).
  • These elements of the naturally occurring light and heavy chain variable regions are typically encompassed from the N-terminus to the C-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
  • the position of the amino acid 20 sequence corresponding to each of these in the variable region was determined using the Kabat Sequences of Proteins of 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953
  • an anti-alpha-synuclein antibody or antigen-binding fragment thereof according to the present invention may comprise one heavy chain variable region of the amino acid sequences of SEQ ID Nos.
  • the anti-alpha-synuclein antibody or antigen-binding fragment thereof may comprise a heavy chain variable region of one of the amino acid sequences of SEQ ID NOS: 98-101 and a light chain variable region of the amino acid sequence of SEQ ID NO: 115 2019/117684 1 »(1 ⁇ 1 ⁇ 2018/015953, or (for example, 1 ⁇ 1111 7 11_ (61 ⁇ .1), 3 ⁇ 4111 7 11_ (61 .2), 3 ⁇ 4111 7 11_ ( ⁇ d .3), 3 ⁇ 4111 may include 7 11_ (.4 ⁇ ), and so on) or a heavy chain comprising the amino acid sequence of SEQ ID NO: 92 SEQ ID NO: 113 and the variable region light chain variable region having the amino acid sequence (for example, ⁇ 11? 11_ (new 12 4) antibody), provided that said anti-alpha-synuclein antibody or antigen-binding fragment thereof comprises the sequence of SEQ ID NO:
  • Table 9 Also shown in Table 9 are exemplary antibodies comprising a constant region and a combination of heavy chain variable region and light chain variable region of an antibody or antigen binding fragment according to one embodiment.
  • the heavy chain variable region and the light chain variable region disclosed herein can be joined to the heavy chain constant region and light chain constant region, respectively, to form heavy and light chains of the intact antibody.
  • Each heavy and light chain thus generated may be suitably paired to form a heavy chain-light chain combination, wherein the heavy chain-light chain combination forms a poly- Type antibody to form a duplex) to achieve an intact antibody structure.
  • the constant region may be suitably selected in the heavy chain constant region and the light chain constant region of an immunoglobulin (e.g., human immunoglobulin).
  • an immunoglobulin e.g., human immunoglobulin.
  • the light chain constant region may be a kappa constant region or a lambda light chain constant region, but is not limited thereto.
  • the light chain constant region may be a light chain constant region, a light chain constant region,
  • Other types of constant regions or modified constant regions 5 may be appropriately selected and used for antibody stability, manufacturability, antigen affinity, and / or other desired properties, which will be apparent to those skilled in the art .
  • the heavy and light chain variable regions disclosed in Tables 7 and 8 above can be freely combined with one another to form various antibodies,
  • the antibodies disclosed herein share certain regions or sequences with other antibodies disclosed herein.
  • the constant region of the antibody or antigen binding fragment may be shared.
  • regions may be shared.
  • the anti-alpha-synuclein antibody provided herein may be a monoclonal antibody or a polyclonal antibody.
  • the anti-alpha-synuclein 15 antibody may be a human antibody, a humanized antibody, a chimeric antibody, or an animal-derived antibody.
  • the anti-alpha-synuclein antibody may be recombinantly or chemically synthesized.
  • the antigen-binding or antibody fragment of an antibody disclosed herein is
  • the antibody is a human antibody or a humanized antibody, and a variety of isotypes provided herein (e. G., 1 ⁇ 1, 1 ⁇ 2, 103, 1804, ⁇ 1 or I 1)) may be, in particular ⁇ 1- 1, 1 ⁇ 3 _ 2 1 ⁇ or 1 ⁇ 4- type, for example, 1 ⁇ 1 _ ⁇ 1 or 2 may be a type.
  • the anti-alpha-synuclein antibody may comprise only the light or variable heavy chain as described above. In other embodiments, the anti-alpha-cinnamulin antibody may comprise only the light or variable heavy chain variable region have.
  • an antibody is generally understood by those skilled in the art that it is not prepared, including two regions 00 ⁇ 2.
  • the antibody may be a monoclonal antibody or a polyclonal antibody.
  • Antibodies disclosed herein include monoclonal antibodies that bind to alpha-synuclein.
  • Monoclonal antibodies can be prepared using any technique known in the art. For example, it can be produced by immortalizing splenocytes harvested from immunized transgenic animals.
  • Monoclonal antibodies secreted by hybridoma cell lines can be purified using techniques known in the art. 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953
  • the antibody can be an animal-derived antibody (e.g., a mouse antibody, etc.), a chimeric antibody (e.g., a mouse-human chimeric antibody), a humanized antibody, or a human antibody.
  • Antibodies can also be modified in a variety of ways for a variety of purposes. Chimeric and humanized antibodies are also provided. Chimeric antibodies are antibodies in which polypeptide fragments derived from different antibodies are linked by covalent bonds to form an immunologically functional light chain, heavy chain or fragment thereof. In such a monoclonal antibody, a particular amino acid residue, which typically constitutes the non-antigen recognition portion of the antibody, is modified to be homologous to the corresponding residue of the corresponding isotype of the human antibody.
  • Humanization can be performed, for example, by substituting at least a portion of the rodent variable region with the corresponding region of a human antibody, using a variety of known methods (U. S. Patent Nos. 5,585, 089 and 5, 693 , 762; Jones et al., 1986, Nature 321: 522-525; Riechmann et al. , 1988, Nature 332: 323-27; Verhoeyen et al. , 1988, Science 239: 1534-1536).
  • a fully human antibody can be produced by immunizing a transgenic animal (typically a mouse) capable of producing a human antibody in the absence of endogenous immunoglobulin production.
  • Fully human antibodies can also be derived from the phage-display library (phage-di-splice library). The use of a fully human antibody can minimize the immunogenic and allergic reactions that can be induced by administration of a mouse or mouse-derived mAb to humans. In one embodiment, the human alpha-synuclein antibodies herein are screened through a phage display method.
  • Alpha-synuclein-specific < RTI ID 0.0 > 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953 recombinant method for the conversion of monoclonal antibody to the pie not full IgG (full IgG) type was used, wherein - for each single recombinant jejoeul of synuclein antibody-alpha Obtain the sequence of the clone phage antibody. In the ensured sequence, the heavy chain variable region sequence is transcribed into the heavy chain constant region sequence, the light chain variable region sequence is transcribed into the light chain constant region sequence, and then the amino acid sequence is changed into the nucleic acid sequence through the 5 codon optimization method.
  • a host cell for protein production such as CHO cells is transformed with the above vector and cultured.
  • the recombinant antibody is separated and purified using a purification technique such as affinity chromatography.
  • the antibody may have an exemplary structure of an antibody found in nature or may have an altered structure.
  • An antibody having such a typical structure may have a polymodal structure comprising structural monomers comprising two different polypeptide chains (i.e., heavy and light chains).
  • the two different polypeptide chains may comprise a full length light chain (about 25 kDa) and a 15 full length heavy chain (about 50 to 70 kDa) .
  • Each chain represents a characteristic folding pattern and consists of several immunoglobulin domains, consisting of about 90 to 110 amino acids. Such domains are the basic monomers that make up the antibody polypeptide.
  • the terminal portion will typically include a portion, referred to as a part of the variable region or V region which recognizes an antigen-carboxy-amino of each chain.
  • Terminal portion is 20 amino - was preserved more evolutionarily more terminal constant regions or C regions
  • the human light chain generally comprises kappa ( K) and lambda ( X) Each of these is classified as a light chain, each of which contains one variable region and one constant region.
  • the heavy chain is generally classified as mu (b), delta (5), gamma (Y), alpha (a) or epsilon ( l) chains, which are defined as IgM, IgD, IgG, IgA and IgE isotypes, respectively.
  • IgG has a number of subtypes including but not limited to IgGl, IgG2, IgG3, and IgG4.
  • the heavy chain constant region typically comprises one or more domains that exhibit effector function.
  • the number of heavy chain constant domain domains depends on the isotype.
  • the IgG heavy chain includes, for example, three C region domains known as CHI, CH2 and CH3, respectively.
  • the antibodies disclosed herein may be any of these isotypes and subtypes.
  • the anti-alpha-synuclein antibody may be an IgG isotype, such as an IgGl, IgG2 or IgG4 subtype.
  • the term "Sinu Klein disease &quot includes all neurodegenerative disorders characterized by pathological synuclein aggregates. Parkinson's disease, Parkinson's disease dementia (PDD), dementia with multiple system atrophy (MSA), multiple nervous system atrophy and cerebral iron deposition associated with Parkinson's syndrome with dementia.
  • neurodegenerative disorders including NBIA Type I, are collectively grouped as synuclein diseases.
  • Alpha-synuclein aggregation is also found secondary to Alzheimer's disease (Kim et al. Alzheimer ' s Research & Therapy 2014, 6:73).
  • Sinu Klein disease is characterized by a variety of neurodegenerative disorders that share common pathological features
  • specific lesions were found in a selected group of neurons and oligoendendocyte, with alpha-synuclein Including abnormal aggregation of proteins can be detected.
  • Alpha-synuclein (initially identified as PARK1 and PARK4) is a 140 amino acid protein that is widely expressed in the neocortex, hippocampus, dentate gyrus, posterior nerve, striatum, thalamus and cerebellum.
  • Alpha-synuclein is also highly expressed in hematopoietic cells, including protein spheres and platelets, as well as B-, T-, and I cells. The exact role in these cells was unknown, but was associated with differentiation of megakaryocytes (platelet precursors).
  • alpha-synuclein aggregates according to the present application as highly affinity and indicates that alpha-synuclein antibodies can be usefully used for the diagnosis or detection of such diseases. Furthermore, alpha-synuclein antibodies that specifically recognize alpha-synuclein aggregates according to the present invention inhibit the formation of alpha-synuclein aggregates or degrade aggregates, inhibit the transfer of intercellular aggregates, Particularly for the treatment of Parkinson ' s disease.
  • alpha-synuclein aggregate-associated disease '' is a group of neurodegenerative diseases called sinus clover disease, characterized by the presence of alpha-synuclein aggregates in lesions including neurons and glia, And have characteristics such as degeneration of the dopaminergic system, change in athletic performance, cognitive impairment, and the formation of leucocytes and / or ruminurites (Kim et al. Alzheimer ' s Research & Therapy 2014, 6: 73; McKei th et al. , Neurology (1996) 47: 1113-24).
  • Such diseases include Parkinson's disease, Parkinson's disease dementia, 2019/117684 1 »(: 1 ⁇ ⁇ 1, Alzheimer 2018/015953 every Lewy body disease, Parkinson's disease, multi-system atrophy and Alzheimer's complexity and a number of other neurological diseases, including the axon is not limited to one which in one embodiment according to the present Antibodies are effectively used for the treatment of Parkinson's disease.
  • bispecific antibody An example of the bispecific antibody according to the present invention is as follows.
  • amino acid sequences corresponding to SEQ ID NOS: 1 to 81 listed in the above table are shown in the following table.
  • Antibodies produced in the examples of the present invention specifically bind IGF1R to IGF1R with a binding force optimized for transcytosi s of brain endothelial, and are useful for treating degenerative brain diseases and brain cancer therapeutic antibodies, It can be useful for delivery.
  • the monoclonal antibody disclosed in the present invention does not affect the binding of the ligands IGF-1, IGF-2 and its homolog insulin to IGF1R, and does not inhibit signal transduction through the IGF1R receptor And thus has utility in connection with the passage of blood vessel brain barriers.
  • the antibodies disclosed herein can effectively remove or facilitate degradation of alpha-synuclein aggregates, inhibit intercellular delivery of alpha-synuclein, and are useful for the treatment of diseases associated with aggregation accumulation of alpha-synuclein .
  • FIG. 1 is a graph showing the results of measurement of the concentration of a-syn antibody prepared in the example of the present invention, The results of the dot blot are shown to determine whether or not the ⁇ -synuclein specifically recognizes the 1 ⁇ 1 ⁇ 2018/015953 ⁇ -synuclein.
  • FIG. 2 shows the affinity of the antibody 3-5711 prepared in the example of the present invention as a result of measuring the affinity of the antibody 3-5711 by £ 11.
  • Fig. 3 shows the results of Fig. _ Figure 43 the 3-57 antibody is produced in an example of alpha neunbon invention is the result of analysis to zero the preferential binding specificity to the synuclein aggregates. 41) is a table showing the results of FIG.
  • FIG. 5 and FIG. 5 and FIG. 6 show the results obtained by comparing the expression levels of the Lewis somalia (10 0 and Lewy neuron protrusions (Ne 7 bar muscles) in human brain tissue with specificity in the -7 antibody 3 show 9 and 1 according to an example of the present invention Which is the result of setting each one. Indicating that the antibody according to the present invention binds to the rui soma (arrow) and the lu neurite (lower left thread-like shape).
  • FIG. 6 is a graphical representation of epitope mapping results of -8711 antibody according to an embodiment of the present invention, wherein the antibodies according to the present invention were found to bind mostly at the 0 terminal.
  • FIG. 7 is a graph showing the affinity between the k- 3 > chimeric antibody prepared in an example of the present invention and the human antibody 11.
  • FIG. 8 is a graph showing the relationship between the 3 - 711 chimeric antibody prepared in the example of the present invention and humanized 1 11 2019/117684 1 »(1 ⁇ 1 ⁇ 2018/015953 the antibody alpha-analysis of a preferential binding specificity and affinity for the synuclein aggregates in BIAcore.
  • Figures 9a, 9b and 10 show that the a- synchromic antibody produced in an example of the present invention is an alpha (alpha) antibody that is not an aggregate derived from beta-synuclein, gamma-synuclein or amyloid betal-42 or tau 5 , -
  • alpha alpha
  • Figures 11a- llg are binding data for the IGF1R protein of the anti- IGF1R antibody.
  • Figure 12 is binding data for the IGF1R expressing cell lines of the anti-IGF1R antibody.
  • Figure 14 is data that the anti-IGF1R antibody does not affect IGF1R or IGF1R siRNA ing by insulin.
  • FIG. 15 is data showing no anti-IGF1R antibody and no change in brain IGF1R 15 level after repeated administration.
  • Figure 16 is data that the bispecific antibody of the anti-IGF1R antibody and the therapeutic antibody passes better than the single antibody consisting only of the therapeutic antibody in the BBB system in vitro.
  • Figure 17 is data that the bispecific antibody and the anti-IGF1R antibody of the anti-IGF1R antibody and the therapeutic antibody pass the in vivo BBB better than the single antibody consisting only of the therapeutic antibody.
  • Figure 18 shows the excellent development of a bispecific antibody composed of an anti-IGF1R antibody and a therapeutic antibody 2019/117684 1 »(1 ⁇ 1 ⁇ 2018/015953 reason ( ⁇ 1 661 (a data showing a larger one.
  • Figure 19 is the result of epitope mapping of the anti-antibody.
  • Fig. 2 shows the result of performing the ⁇ 5 ratio show to compare the binding ability of the chimeric antibody and the humanized antibody to each antigen.
  • Figures 213 and 2 show the results of evaluating the efficacy of the bispecific antibody prepared in the example of the present application in a mouse animal model against the single antibody 10 .
  • Antigen euroneun length (140 residue) or (: _-terminal 21 residues are truncated alpha-the Sinus Klee monomer 37 into a 1 ⁇ 611110111 0 was turned on during Chemistry other example aggregated 1050 US for 14 days, 20 to sonication Respectively.
  • the prepared 11 140 ⁇ / concentration and one 119 Each of the alpha-synuclein fibrils of 2019/117684 (1: 1 ⁇ 2018/0195953 residue) was mixed with Escherichia coli and l: Kvol: vol).
  • the spleen of the immunized mouse was removed as described above, and the cells were visualized therefrom.
  • the spleen cells were then suspended in Hybridoma-SFM medium (Thermo Fier Scientific, USA) supplemented with 10% FBS.
  • Hybridoma-SFM medium Thermo Fier Scientific, USA
  • the SP2 (8) -AgM and spleen cells which are the murine myeloid cells, were mixed with Hybr i doma-SFM medium containing no serum, followed by centrifugation to remove the medium.
  • PEG was added to the cell pellet, followed by incubation at 37 ° C for 1 minute to induce cell fusion.
  • Clones of 9B11 (I gGl ka ppa , respectively) were obtained using the full-length (140 residues) alpha-synuclein aggregates as antigens, and alpha-synuclein aggregates with 21 C- terminal residues were used as antigens to generate 3A9 and 11F11 to give the clones (respectively I gG2b kappa, 5 I gG2b kappa ).
  • each hybridoma is cultured in RPMI 1640 medium supplemented with 10% FBS.
  • the culture medium is replaced with serum-free SFM medium and cultured for about 4 days.
  • the cell culture supernatant was separated, centrifuged, and then filtered with a 0.22 ⁇ m filter.
  • the IgG type protein G column and the remaining antibodies were purified with protein A column 10 .
  • variable region and CDR sequences are described in Ahn et al, Mol. Cel ls 2004, 18 (2): 237-241. After culturing the hybridomas are 15 was separated to separate only the cells centrifuged. The RNA was isolated from the isolated hybridomas by the addition of a triazole. The cDNA was synthesized using the template as a template, and the variable region and the CDR sequence were confirmed by sequencing. Thus, antibodies 3A9, 9B11, and 11F11 were obtained.
  • Example 2 Preparation of anti-alpha-synuclein (chimeric) antibodies
  • the prepared vector was maxi-prep (Qiagen) to obtain a large amount of plasmid DNA and then introduced into cells as follows.
  • ExpiCHO TM Gibco, Cat: A29127 cells were plated at 3 x 10E6 to 4 x 10E6 viable cel l / , 37 [deg.] C and 120 [mu] M for 1 day.
  • the survival rate was 95% or higher at 7 x 10E6 to 10 x 10E6 viable cel ls / mL on the day of DNA transfection, and the cells were diluted to 106 viable cel l / mL with fresh medium using a fresh medium.
  • ExpiFectamine TM CH0 & plasmid DNA complexes were prepared using the ExpiFectamine TM CH0 transfection kit (Gibco, Cat: A29129) for transfection into prepared embryonic cells.
  • Each of the cold Opt iPR0 TM SFM® (Gibco, Cat: 12309019) medium was inoculated separately, and DNA and ExpiFectaraine TM CHO reagent prepared at an appropriate concentration were respectively inoculated, mixed and allowed to stand at room temperature for 5 minutes, The post-culture was started. The next day, the enhancer contained in the ExpiFectamine TM CH0 transfection kit After 5 days, feed was added, and the cells were cultured for 10 days at 8% C02, 37 C and 120 rpm. Completed.
  • the culture was transferred to a centrifuge bottle for centrifugation at 4 ° C and 6500 rpm for 30 minutes, and then filtered with a filter having a size of 0.2 ⁇ m to obtain a culture solution except the suspension, .
  • the culture was purified using HiTrap MabSelectSure (GE Heal Thcare, 11-0034-94). Equilibrated with equilibration buffer (50 mM Tris-HCl pH 7.2, 100 mM NaCl), and the recovered culture was loaded onto the column. After loading, the cells were washed with 50 mM sodium citrate pH 5.0 and eluted with 50 mM sodium citrate pH 3.4. The eluate was neutralized to pH 6.0 by adding 1 M Tris-HCl pH 9.0. After this, the eluate was exchanged with PBS (phosphate buffered saline, pH 7.4), concentrated and stored at 4 until use.
  • PBS phosphate buffered saline, pH 7.4
  • the HiLoad 26/600 superdex 200 column is subjected to a second purification step based on the size of the eluted sample by passing the first purification through a buffer of IX PBS.
  • the amino acid sequence of the purified antibody was analyzed by mass spectrometry and confirmed to be consistent with the variable region of mouse monoclonal antibody.
  • variable region of the 3A9, 9B11, and 11F11 antibodies identified by the above method was substituted with the backbone variable region portion of the human IgG1 isotype to generate a chimeric human IgG1 antibody 1 was produced ⁇ 1 ⁇ 2018/015953: 2019/117684 1 »(.
  • the Chllllll antibody comprises a heavy chain variable region sequence (chllll-VH) of SEQ ID NO: 90 as an IgG type antibody and a light chain of the sequence number 109 as a combination of the variable region sequence (chllFll-VL)
  • the Ch3A9 antibody is an IgG type antibody and includes a combination of the heavy chain variable region sequence (chllF11-VH) of SEQ ID NO: 102 and the light chain variable region 5 sequence (chIIIll-VL) of SEQ ID NO: 116.
  • Example 3 Preparation of humanized antibody
  • Competent cel 1 of the library was diluted with 2X YT [ Tryptone (CONDA, 1612.00) 17 g, containing 34 yg / ml chloramphenicol (Sigma, C0857), 2% glucose (Sigma, G5400) and 5 mM MgC12 yeast extract (C0NDA, 1702.00) 10g, NaCl (Sigma, S7653) 5g] after the culture medium inoculation, hanhu to 3 hours incubation at 37 ° C so that the 0D600 value at 15 of 0.5 0.7 and helper phage (hel per phage) the After infection, the cells were cultured in 2X YT medium supplemented with 34 yg / ml of chloramphenicol, 5 mM MgCl 2, 70 ⁇
  • the phages bound to the alpha-synuclein monomers were recovered and bound to the immunostimulating tubes with alpha-synuclein aggregates for 2 hours at room temperature.
  • the non-specifically bound phage was washed 30 times with PBS-T (0.05% Tween 20) solution 5 times, and the remaining antigen-specific phage antibody was recovered using 100 mM triethylamine solution. Recovered .
  • E. coli Escherichia coli was infected at 37 ° C for 1 hour and the infected E. coli was plated on 2X YT agar medium containing carbenicillin and incubated at 37 ° C overnight.
  • E. coli cultured were suspended in 4M 2X YT carbenicillin culture medium, 15% glycerol was added, some were stored at -80 ° C, and the rest were prepared for panning of the next round. This . A total of three rounds of the procedure were repeated 2019/117684 1 »(1 ⁇ 1 ⁇ was amplified 2018/015953 antibodies. As the panning round progressed, the number of washing with PBS-T was increased to amplify and concentrate the antigen-specific phage.
  • the phage was spiked on LB-tetracycline / carbenicillin agar medium and then cultured to obtain a single colony. Then 10 monoclons were inoculated into a 96 deep well plate containing 400 M 2 X YT-tetracycline / carbenicillin medium per well and incubated overnight, after which the culture was replaced with fresh 390 2XYT-tetracycline / carbenicillin And cultured at 37 ° C for 4 hours in a 96-well plate containing the medium. ImM IPTG was added to the above culture and incubated overnight at 30 ° C. The overnight culture was centrifuged and the supernatant was taken.
  • the CDR residues of the clones found in the library are analyzed in silico, resulting in serious problems in binding to the framework, or a clone in which no T-cel 1 epitope, B cell epitope, and MHC II epitope are present in the framework portion except CDR Respectively.
  • Hull Fll is an IgG type antibody, which comprises a combination of the heavy chain variable region sequence (HullFll-VH2) of SEQ ID NO: 92 and the light chain variable region sequence (HullFll_VL4) of SEQ ID NO: 113, (Hull Fll-VH-vl) of SEQ ID NO: 98 and a light chain variable region sequence (Hull Fll_VLv34c) of SEQ ID NO: 115 (Hull Fll-VH-v2) of SEQ ID NO: 99 as an IgG-type antibody, and SEQ ID NO: 115 (Hull Fll-VH-v3) of SEQ ID NO: 10 as an IgG-type antibody and a combination of the light chain variable region sequence of SEQ ID NO:
  • HullFll (ver. 4) was confirmed to be a combination of the heavy chain variable region sequence (HullFll-VH_v4) of SEQ ID NO: 101 and the light chain variable region sequence (HullFll-VLv3 4c) of SEQ ID NO: 115.
  • Example 4 Analysis of antigen binding specificity and binding affinity of alpha-synuclein antibody
  • the membrane was blocked with 5% non-fat dry mi lk of TBST composition for 1 hour at room temperature. Then, the ⁇ -synuclein antibody prepared in Example 1 was added to 1 ml of TBST containing 1% bovine serum albumin And the membrane and the antibody were incubated at room temperature for 1 hour. After washing with TBST 2019/117684 1 » (: 1 ⁇ 1 ⁇ 2018/015953
  • the alpha-synuclein antibodies according to the present invention were found to preferentially bind aggregates only, as compared to alpha-synuclein monomers.
  • 9B11, 3A9 and 11F11 appeared to bind only to aggregates.
  • 274 antibody (Bae et al., J Neurosci. 2012 Se p 26; 32 (39): 13454-13469) is a comparative antibody that binds both monomers and aggregates.
  • ELISA was performed to quantitatively analyze the binding ability of the antibody according to the present invention to the antigen.
  • Embodiment wherein mouse obtained in Example 1.
  • alpha-synuclein antibody for 1 u g / ml was coated on 96 well plates at a concentration of, here 10, 100, 1000, 10,0 00 15 n g / ml concentration
  • streptavidin conjugated with biotin-conjugated secondary antibody and HRP was treated and reacted with the seedlings as a substrate, and the absorbance was measured. The measurement results are shown in Fig.
  • the antibodies according to the present invention were found to bind to aggregates with high affinity.
  • Analysis of antibodies by ELISA showed that aggregation 2019/117684 1 »(1 ⁇ 1 antibody that binds both to the ⁇ 2018/015953 said monomer and aggregates of the more high-_ 0 ° showed the M value.
  • the antibodies according to the invention preferentially bind to the alpha synuclein aggregates with high affinity and are less than or less than the aggregates with respect to the monomers so that the affinity can not be deduced. And that it is possible to effectively remove or inhibit the activity of the causative agent of neurodegenerative disease.
  • the instrument used was T200 (GE Healthcare, S / N: 1565888). Chip was used with Protein A (GE Healthcare, Cat. 29-1275-56), Regeneration buffer was diluted with running buffer and analyte, 10 mM Glycine-HCl pH1.5 (GE Healthcare, Cat. BR-1003-54) HBS-EP was used as the sample dilution buffer.
  • the a-syn antibodies (3A9, 9B11, 11F11) prepared in Example 1 were diluted with IX HBS-EP (GE Healthcare, Cat. BR ⁇ 1006-69)
  • the fibrin protein (3 mg / ml) was diluted in duplicate and analyzed at a total of 6 concentrations (0, 0.39, 1.56, 6.25, 25, 100 nM) including 0 nM.
  • the monomer should have a target RU of 800 (theoretical), a fibril of target RU of 100 (theoretical), a capture phase of contact time of 60 seconds, a flow rate of 30 u 1 / min, 180 seconds.
  • the association time was 120 seconds and the flow rate was 30 u 1 / min.
  • the dissociation phase the dissociation time was 360 seconds and the flow rate was 30 ii 1 / min.
  • the regeneration time was set to 240 seconds (primary) and 60 seconds (secondary) with a flow rate of 30 y 1 / min. 1: 1 binding model, and the evaluation software was BIACore T200 Evaluation software (GE healthcare). The results are based on Figs. 3A and 3B.
  • Figure 3a shows the results of BIAcore analysis of the preferred binding specificities and affinities for alpha-synuclein aggregates of monoclonal antibodies prepared in an example of the invention.
  • the antibodies according to the present invention bind to the aggregates with high affinity . These results indicate that the causative agents of neurodegenerative diseases with an alpha-synuclein pathogen such as Parkinson's disease can be effectively removed or inhibited.
  • FIG. 3b shows the results of FIG. 3a.
  • Example 2 5 sections of patients who died of 10-micrometer-thick paraffin-embedded Parkinson's disease were treated with the chimeric anti-alpha-synuclein antibody obtained in Example 2 to induce the formation of rheisocytes and neurites in tissue sections And stained as follows.
  • the tissue sections were treated with 90% formic acid for 3 minutes to proceed with antigen retrieval, and peroxidase activity was inhibited by using 1% H202 (50% ethanol base). 10% normal horse serum was treated to prevent non-specific binding of tissues.
  • the 3A9, 11F11 and 11F11 antibodies according to the present invention were treated overnight at 4 ° C in an adjacent section.
  • the biotin-conjugated anti-human IgG antibody was treated at 37 ° C for 3 minutes, and the avidin-biot in complex was reacted at room temperature for 30 minutes (Vectastatin El ite kit; Vector Laboratories).
  • the cells were stained with DAB containing 0.005% H202, and the sections were incubated with 0.5% cresyl
  • FIGS. 5A and 5B are graphs showing that the monoclonal antibodies 3A9 and 11F11 according to an example of the present invention can specifically recognize the Lewy body and the Lewy neurites in human brain tissue, respectively Results.
  • the antibody according to the present invention is a &
  • the antibodies according to the present invention were found to be effectively bound (indicated by arrows) to the lozocytes and the lu neuronal projections. This result implies that it is able to bind effectively to alpha-synuclein aggregates, a component of the leucovorin in human brain tissue. Showing that the antibody delivered to the human brain can effectively bind to the alpha-synuclein aggregates effectively. These results indicate that the antibody of the present invention can specifically bind to alpha-synuclein aggregates present in human brain tissue and can be effectively used for the prevention and / or treatment of diseases related to the pathogenesis of alpha-synuclein. .
  • Example 6 Epitope analysis of anti-alpha-synuclein antibodies
  • FIG. 6 shows schematically the result of epitope mapping of an antibody according to an embodiment of the present invention.
  • a sandwich ELISA was performed to quantitatively analyze the binding force of the chimeric antibody (ChllF11) obtained in Example 2 and the humanized antibodies (HullF11) obtained in Example 3, in substantially the same manner as in Example 4-2.
  • each of the antibodies was diluted 1/10 in 0.04 400 nM concentration
  • the humanized antibodies according to the invention in particular the humanized antibodies derived from chimeric B 11F11 (humanized 11F11 antibodies), were found to exhibit equivalent binding capacity to chimeric 11F11 clones.
  • the binding force of the chimeric antibody obtained in Example 2 and the humanized antibody obtained in Example 3 was quantitatively analyzed in substantially the same manner as in Example 4-3 by using this show 0.
  • the results of the analysis are shown in Figs. Are shown in the table.
  • human beta-synuclein (Uniprot: Q16143 ) protein (CUSABIO, Cat:
  • CSB-EP624090HU or a human gamma-synuclein (Uniprot: 076070) protein ((3) SABI0, Cat: C-EP021915HU) was coated on a 96 well plate at a concentration of 100 ng / % BSA for 2 h.
  • Pan-Syn antibody (santacruz, Cat: FL-140, sc-10717, rabbi t) was used as a positive control, which binds to all of the alpha, beta and gamma-synuclein.
  • the chimeric antibody (M9, 9B11, 11F11) diluted 1/10 in 400 to 0.04 nM was treated for 2 hours, washed with PBS, and HRP was added to goat anti i-hFc antibody Absorbance was measured at 450 nm and 650 nm after reaction with TMB as a substrate after the combined detection antibody treatment.
  • HRP-conjugated antibody was used as a goat anti-rabbi t antibody as a detectable antibody in the positive control group.
  • Figures 9a and 9b demonstrate the very low binding capacity of human chimeric antibodies (3A9, 9B11, 11F11) according to one embodiment of the present invention to human beta-synuclein and human gamma-synuclein by ELISA
  • the results are as follows.
  • the positive control pan-Syn antibody has been shown to inhibit beta-and gamma-synuclein 2019/117684 1 ( 1 ⁇ ⁇ 2018/015953) .
  • Figure 9A relates to human beta-synuclein
  • Figure 9B relates to human gamma-synuclein.
  • amyloid beta 142 and tau form agglutinates and are considered to be important diseases for degenerative neurological diseases, especially Alzheimer's disease.
  • the aggregates are known to have oligomer, protopiperyl, fibril, etc. structures similar to aggregates of alpha-synuclein have.
  • the dot blot confirmed that chimeric antibodies 3A9, 9B11, and 11F11 recognized a specific sequence of alpha-synuclein and did not recognize the common structure of aggregates derived from alpha-synuclein, amyloid beta, and tau as aggregates .
  • the antibody nuclease ide sequence containing the signal sequence was inserted into the MCS (Mul t i cloning site) of the pcDNA3.4 (i nv i t r ogen) vector.
  • the double antibody expression vector was a monocystic vector, and a heavy chain expression vector and a light chain expression vector were respectively prepared.
  • the heavy chain variable region encoding the anti -a-syn antibody and the immunoglobulin C terminal to which the human heavy chain constant region is linked are linked to each other by an I GF1R scFv linker.
  • the light chain variable region and the human light chain constant region, which encode the anti- a- syn antibody are linked. 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953
  • the monovalent double antibody is an anti-a-syn immunoglobulin heavy chain in which the anti-IGF1R scFv is conjugated to the C-terminus as a linker, and an anti-a-syn immunoglobulin heavy chain knob in which the scFv is not linked Is conjugated with an antibody light chain.
  • Knob-in-hole technique was used to increase the bonding efficiency of the heavy chain heterodimer. That is, the heavy chain coding sequence of the Hole type was replaced with T366S, L368A, Y406V in the CH3 region, and the heavy chain coding sequence of the knob type was changed from amino acid to CH3 region to T366W.
  • the prepared vector was maxi-prep (Qiagen) to obtain a large amount of plasmid DNA, and then introduced into cells as follows.
  • To produce BsAb heavy chain expression vector DNA and light chain chain expression vector DNA were transfected at a ratio of 1: 1.
  • a hole type heavy chain expression vector DNA, a knob type heavy chain expression vector DNA and a light chain expression vector DNA were transfected at a ratio of 0.5: 0.5: 1.
  • ExpiCHO TM (Gibco, Cat: A29127) cells were seeded at 3 x 10E6 to 4 x 10E6 viable cells / mL in ExpiCHO TM expression medium (Gibco, Cat: A29100-01) And incubated at 37 ° C for 1 day at 120C.
  • survival rate is> 95% 2019/117684 1 »(: 1/10 ⁇ 018/015953 was prepared by dilution of the cells grown in 6 X 106 viable cel ls / mL with fresh medium.
  • ExpiFectamine TM CHO & plasmid DNA complexes were prepared using the Exp i Feet amine TM CHO transfection kit (Gibco, Cat: A29129) for transfection of the prepared parental cells. Cool 0pt iPR0 TM SFM® (Gibco, Cat : 12309019) to dispense the medium, respectively, and then each inoculated with the DNA and CHO ExpiFectamine TM reagent prepared in an appropriate concentration, and to mix for 5 minutes at room temperature, then transfected cells injected was inoculated in The culture was started.
  • the enhancer and feed contained in the ExpiFectamine TM CHO transfection kit were inoculated into the transfected cells. After 5 days, the cells were inoculated with the feed and cultured at 8% C02, 37 ° C and 120 rpm for 10 days .
  • Example 11 Preparation of parent antibody ( 1 )
  • Monoclonal antibodies were prepared using phage display / panning technology.
  • phage display panning for the production of anti-myeloma antibody and other 2019/117684 1 »(1 ⁇ 1 antigen used in the ⁇ 2018/015953 analysis was used for the following protein.
  • a histidine-tag (His tag) was attached to the C-terminus of the amino acid sequence of amino acids 31 to 932 of SEQ ID NO: 99 amino acid residues from which the signal sequence was removed from the extracellular domain (ECD) of human IGF1R Systems, USA, 391-GR).
  • monkey IGF1R National Research Council Canada
  • mouse IGF1R R & D systems, 6630-GR / CF
  • rat IGF1R was used as an antigen.
  • the pellet was suspended in PBS, centrifuged at 12000 rpm for 10 minutes at 20 ° C, and the supernatant containing the library phage 2019/117684 1: 1 (2018/015953) was obtained and placed in a new tube and stored at 4 ° C until used.
  • the phage library used in the present invention is a synthetic human tertiary library, and the phage display panning process and results are shown in Table 11 below.
  • the cells were washed once with PBS-T (phosphate buffered saline-0.05% Tween 20) solution to remove nonspecifically bound phage, and the phage bound to IGF1R was recovered using 100 mM triethylamine solution.
  • PBS-T phosphate buffered saline-0.05% Tween 20
  • E. coli was infected at 37 ° C for 1 hour, the E. coli was plated on LB agar medium containing tetracycline and carbenicillin and incubated overnight at 37 ° C. The next day, E. coli was suspended in 5 ml of superbroth (SB) medium containing tetracycline and carbenicillin, and the same volume of 50% glycerol was added. A portion of the suspension was stored at 80 ° C. - After suspending in tetracycline / carbenicillin medium, 10 12 PFU of VCSM13 helper phage was added and incubated at 37 ° C for 1 hour with gentle stirring. Then, kanamycin was added to the culture medium and cultured at 30 ° C for about 16 hours to allow only E. coli infected with helper phage to be cultured.
  • SB superbroth
  • the phage obtained in the LB -tetracycline / carbenicillin agar medium was cultured to obtain a single colony.
  • the inoculation of the call 10 Ronnie in 96-dee p-well plate were cultured overnight, it was inoculated again in 96-deep-well pi ate the culture medium 10 in the same way to about 4 hours incubation at 37 ° C fair 0D (0.5 0.7) Respectively.
  • 20 MOI helper phage was added to the culture solution, followed by reaction at 37 ° C for 1 hour. Subsequently, kanamycin was added to the culture medium and cultured at 30 ° C overnight.
  • Recombinant IGF1R was added to the ELISA plate in an amount of 100 ng per well and the antigen was coated on the plate by reaction at 4 ° C for about 15 hours.
  • PBS buffer containing 3% BSA 20 was added at a rate of 200 cells / well, followed by incubation at 37 ° C for about 1 hour.
  • Supernatant 2019/117684 1 » (: 1 ⁇ 1 ⁇ 2018/015953 abandoned.
  • Antibodies were optimized by affinity variation on selected clones by assessing ligand binding capacity and BBB passivity. 1 periods also in on the basis of the 1564 scFv was produced NNS hand-mix primer for randomization of CDR3 of the heavy chain CDR2 and the li ght chain, using the PCR technique was amplified 1564 scFv gene containing the randomizat ion Sequence . The amplified gene was inserted into a pComb3x vector , which was then made into a library suitable for phage display, and a number of scFv clones binding to IGF1R could be screened by librarian panning and ELISA screening. The selected clones are sequenced to identify the amino acid sequence of the variable region 2019/117684 1 (: 1 ⁇ ⁇ 2018/015953).
  • the in-silico analysis and peptide mapping of the parental 1564 clone confirmed the actual deamidation.
  • the sample was stored at 4 ° C or 40 ° C for one week, and analysis was performed. It was confirmed that deamidation occurred in LCDR2, LCDR3, and HCDR2.
  • the affinity variants disclosed in Example 12 were also analyzed to confirm the location of the deamidation. 2019/117684 1 »(: 1/10 ⁇ 018/015953
  • the 1564 clone the parental clone, has a net charge of -0.7 in in silico analysis. Usually net char yoga ⁇ 0 or> 5.5 seems to be vulnerable to fast clearance in the body. Therefore, if the deamidation residue is replaced with a positive charge such as H, R, or K, deamidation may be eliminated and the entire charge may be increased to prevent fast clearance. As a result, mutants produced by mutating positions where deamidation occurs are shown in FIG. 18B.
  • Mini-bodies were prepared by linking the entire scFv of the IGF1R-specific monoclonal phage antibody obtained in Examples 11 to 13 to the C-terminal of Fc.
  • a nucleic acid sequence encoding the 5 scFV amino acid sequence set forth in Table 12 was prepared, and this sequence was digested with restriction enzymes and cloned into a pcDNA- based expression vector containing a nucleic acid encoding Fc.
  • Example 11 around the body 10 of the IGF1R scFv specific monoclonal phage antibodies was obtained from 1-13, I gG antibody treatment was to produce a form of bivalent form connect the two to C- terminus, respectively.
  • a nucleic acid sequence encoding the amino acid sequence of scFV disclosed in Table 12 was prepared, and this sequence was digested with restriction enzymes and cloned into a p cDNA- based expression vector containing the nucleic acid encoding the therapeutic antibody.
  • Example 14-1 In the case of the minibody form in which the anti-IGF1R antibody is bound in the form of scFv to each of the C-terminal ends of two heavy chains of the heavy chain, in this embodiment, monovalent forms in which one scFv is bound to only one Fc C- A vector obtained by binding 1564, F06,? 4, VH5, VH16, VH35, VH9, VH2, VH7 and VH32 of the IGF1R specific monoclonal phage antibody obtained in Examples 11 to 13 to only one Fc C_ terminus, A vector without anti-IGF1R antibody was prepared at the C-terminus. In the corresponding Fc, a knob-into-hole mutation was introduced to produce a heteromeric form in antibody production in cells.
  • the vectors prepared in Examples 14-1 to 14-3 were introduced into cells as follows. Specifically, CHO-S cells were cultured in CD-CHO (Gibco, 10743) at a concentration of 1.5 ⁇ 10 6 cel / ml and cultured for 1 day at 8% CO 2 and 37 ° C. DNA transfection injection day 2.5-3 X 10 6 cel ls / ml after Rosa is prepared the cells to 1% DMS0 is also saturable CD-CH0 2.1 X 10 6 cel ls / ml concentration of using a medium which, 8% C0 2 , And cultured at 37 for 3 hr. After centrifugation at 3000 rpm for 15 min, the supernatant was removed and resuspended in RPMI 1640 medium supplemented with 2.5% FBS.
  • the resulting culture was passed through Mab selectures (GE healthcare, 5 mL) equilibrated by passing through equilibration buffer (50 mM Tris-HCl, pH 7.5, 100 mM NaCl) to allow the expressed antibodies to bind to the column. After elution with 50 mM Na-citrate (pH 3.4) and 100 mM NaCl solution, neutralization was performed using 1 M Tris-HCl (pH 9.0) to obtain a final pH of 7.2. The buffer was then exchanged with PBS (phosphate buffered saline, pH 7.4). When the purity was high, it was stored frozen at -20 ° C after the formulation and stored at 4 ° C until further purification was necessary.
  • equilibration buffer 50 mM Tris-HCl, pH 7.5, 100 mM NaCl
  • an anti-IGF1R antibody according to the invention was prepared by linking the heavy chain variable region and the light chain variable region using a linker (SEQ ID NO: 172) , The anti-a-syn antibody (SEQ ID NO: 173) was ligated to the C-terminus of the heavy chain constant region of the complete form of the IGG antibody of SEQ ID NO: 2019/117684.
  • monovalent antibodies and monoclonal antibodies were prepared by linking one scFv form of anti-IGF1R antibody per molecule of complete IGG antibody of anti-a-syn antibody.
  • Bivalent antibodies prepared by linking two scFv-type molecules of an anti-IGF1R antibody were prepared.
  • Exemplary sequences of the a-syn antibodies used for the production of double antibodies in this Example are shown in the following table, and the recombination heavy chain combinations and light chains of double antibodies prepared according to the invention are shown in the following table. Experiments were then carried out on the double antibodies exemplified in the following examples.
  • the heavy and light chain sequences of the 3- < RTI ID 0.0 > 11 < / RTI &
  • Example 15-1 Analysis of Binding Capacity of IGF1R Antibody to IGF1R (ELISA)
  • the minibody form of the 996, 1226, 1564, and MKJP2 clones prepared in Example 14-1 was combined with binding force and concentration-dependent binding to IGF1R ELISA analysis was performed to confirm whether or not it was.
  • human recombinant IGF1R, an antibody-binding target was purchased as an extracel lular domain (ECD) from R. lu systems (6630-GR8: F).
  • Human IGF1R was diluted 1 ⁇ g / ml in PBS buffer (Nunc-Immuno Plates, NUNC, Rochester, NY) in a 96-well ELISA plate and 100 ⁇ l / well was added thereto. After reacting at 4 ° C for 16 hours, The supernatant was removed. PBS buffer containing 3% BSA (bovine serum albumin) was added to 200 ⁇ l of the well and reacted for 2 hours to block non-specific binding.
  • PBS buffer containing 3% BSA (bovine serum albumin) was added to 200 ⁇ l of the well and reacted for 2 hours to block non-specific binding.
  • the minibody antibody of the 996, 1226, 1564, and MKJP2 clones prepared in Example 14-1 was diluted 3-fold with 20 nM of the highest concentration to make 12 points. Each well was transferred to each well at a rate of 100 y 1, After the time treatment, anti-human HRP, which recognizes human Fc present in the mini-body, was diluted 1: 5000 in blocking buf fer and washed with 100 ⁇ l And reacted at room temperature for 1.5 hours. After washing 4 times with 300 ⁇ l of PBS-T (0.05% Tween 20), the cells were developed with TMB (Tetramethylbenzidine, Sigma, T0440). The enzyme reaction was stopped with 0.5 mol / L sulfuric acid and the absorbance was recorded and analyzed at 450 nm using a microplate reader. The results of the above experiment are shown in FIG.
  • minibody 4 clone binds to human IGF1R recombinant protein in a concentration-dependent manner. Specifically, ffiJP2 shows the best binding force, followed by 996 and 1564 with similar binding force, and 1226 shows a slightly lower binding force Respectively. 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953
  • the cross-linkage between the 1564 anti-IGF1R antibody prepared in accordance with the method of Example 14-2 and the anti-IGF1R antibody obtained in Example 11-3 was analyzed by ELISA.
  • human, monkey, mouse, and rat IGF1R antigens were diluted to 1 ug / ml and added to each well at 100 ° C for 15 hours at 4 ° C for coating on the plate bottom. After removing the supernatant, 200 ⁇ l of PBS buffer containing 3% BSA was added to each well to block non-specific binding.
  • the anti-IGF1R antibody was diluted 5-fold in PBSB (BSA 3% in PBS) at the highest concentration of 400, treated in the respective wells, and reacted at 37 ° C for 1 hour.
  • anti-human Fab HRP which recognizes the Fab portion of the bound antibody, was diluted 1: 20000, treated with 100 ⁇ l of each well, and reacted at 37 ° C for 1 hour.
  • the cells were washed 5 times with PBS buffer and developed with TMB (Tetramethylbenzidine, Sigma, T0440) according to the manufacturer's method.
  • TMB Tetramethylbenzidine, Sigma, T0440
  • the enzyme reaction was stopped with 0.5 mol / L sulfuric acid, and absorbance was measured at 450 nm using a microplate reader (Molecular device).
  • the ELISA was carried out, the plate was divided into two portions in the case of a large number of samples, and the experimental results are shown in Table 12 below.
  • the binding affinity of the affinit y variants prepared in Example 12 was analyzed by ELISA for the IGF1R ECD protein and the binding affinity for MCF-7 by FACS.
  • Table 13 shows the results of binding ELISA analysis of IGF1R ECD protein in the double-specific antibody form of the primary selected clones
  • Table 14 shows the results of FACS analysis of binding to MCF-7 cell line. It is a constant.
  • the clones to be subjected to the analysis except for the clones whose productivity and physical properties are significantly lower than those of the second-produced clones were selected as shown in Table 16.
  • Figure 12 shows the binding of the clones to the 007 cell line. Analysis results, and analysis clones The binding force to 1 -7 was lower than that of the clone 1564. The results show that the clones And also shows a decrease in bond strength.
  • the selected antibody clones were egg 6, 004, sas 2, sas 5, sas 7, sas 9, sas 16, sas 32_, and the amino acid sequences for the heavy chain variable region and the light chain variable region for these antibodies are shown in Table 5 and Table 6. 15-4: BIAcore analysis for human IGF1R
  • the degree of binding to human IGF1R was analyzed by SPR analysis of IgG type of 1564 clone.
  • the anti-his antibody to the His tag bound to human IGF1R ECD was diluted to 20 yg / ml in acetate pH 4.0 buffer.
  • the target RU was 10,000 RU Lt; / RTI > During the capture, PBS was used as the running buffer.
  • the flow rate is 30 yL / min. 2019/117684 1 »(1 ⁇ 1 ⁇ 2018/015953 were ⁇ Association / dissociation f low rate while maintaining roneun 40 uL / min, running buffer was used as a PBS.
  • association / dissociation was 5 minutes and 20 minutes, respectively.
  • Example 16 Analysis of binding force of anti-IGF1R antibody to human IGF1R expressing cell line and brain endothelial cell
  • Example 14-1 To confirm whether the minibody forms of the 996, 1226, and 1564 clones prepared in Example 14-1 bind to the endogenous IGF1R on the cell surface, the cell line expressing human IGF1R and the endothelial cells ) was performed by FACS. The degree of binding of Periplasmic extract and MCF-7, which is known to overexpress IGF1R, to breast cancer cell lines was confirmed by FACS.
  • the MFKMean Fluorescence Intensity of the sample was expressed.
  • the affinity variant and the parental clone (1564 clones) of the scFv and bispecific antibody forms in the three minibodies tested were expressed on the surface of the endogenous IGF1R Specific binding.
  • the results show that the clones obtained in the above example can bind to the type of IGF1R actually present in the body and can be used for the intended purpose.
  • Example 16-1 JIMT-1 and BT474 breast cancer
  • the minibody form of the 996, 1226, and 1564 clones produced in Example 14-1 in substantially the same way except that the cell line was used was the endogenous RTI ID 0.0 > IGF1R. ≪ / RTI > The results of the above experiment are shown in Fig.
  • Example 17 Analysis of intra-lular internal izat ion of anti-IGF1R antibody
  • Minibody form of the 996, 1226, 1564, and MKJP2 clones prepared in Example 14-1 was observed in a cell line expressing IGF1R Intracellularly internalized and introduced into cells 2019/117684 1 »(1 ⁇ 1 ⁇ 2018/015953 the antibody without decomposition was to verify that passes the RMT Pathway.
  • the anti-IGF1R antibody In order for the anti-IGF1R antibody to be used as a shuttle that enhances the ability to pass through the BBB, the antibody must precede the internal ize into the brain endothelial cell that constitutes the BBB.
  • the MCF-7 cell line expressing IGF1R was used to analyze whether the antibodies according to the present invention were intracellularly 5 internal ized. Specifically, 30,000 MCF-7 cell lines were plated in an 8-well slider chamber and cultured for 1 day. The minibody antibodies of the 996, 1226, 1564 and MKJP2 clones prepared in Example 14-1 were each treated with 5 yg / ml each at 4 ° C for 2 hours in each well, washed 3 times with cold DMEM medium, and Alexa488- The conjugated anti-i-human Fc antibody was also treated at 4 ° C for 1 hour.
  • the plate was transferred to a CO 2 incubator and incubated at 37 ° C for 30 min. 100% methanol was added to fix the culture, and the reaction was terminated. After fixation, the cells were washed 3 times with PBS. The internal ized level of the antibody was imaged on a fluorescence microscope in a green fluorescence region (Alexa488). At the time of imaging, DAPI was used to stain the intracellular nuclei, and the position of each cell was determined
  • FACS analysis was performed using an MCF-7 cell line expressing IGF1R to analyze the cell surface IGF1R binding of 1564 variants that altered binding to IGF1R.
  • the IGF1R antibody prepared from scFv-type double antibody was treated with MCF7 cells of 2 X 10E5 at a concentration of 10 ug / mL for 30 minutes. After washing with PBS buffer supplemented with 1% BSA, a FITC-conjugated secondary antibody for human antibody detection was treated for 1 hour. After washing with PBS buffer, FACS analysis confirmed the extracellular binding and internal ization of various variants.
  • the bivalent and monovalent forms of the 1564 clones prepared in Examples 14-2 and 14-4 were analyzed for internalization by human brain endothelial cells (primary human microvascular brain endothelial cell (HMBEC)).
  • Therapeutic antibody IgG (11F11) was used as a negative control.
  • HMBEC Cell Systems, cat #: ACBRI 3766
  • HMBEC Human Mollusk Cell Systems, cat #: ACBRI 3766
  • the test antibody was administered on the next day, the cells were fixed with 4% paraformaldehyde, and then rinsed with PBS, followed by blocking and permeabi 1 using a solution containing 3% BSA and TritonX for 50 minutes.
  • an antibody against human Fc Goat ant i-human antibody
  • PBS a secondary antibody against the primary antibody was administered for 1 hour.
  • Hoechst was stained for 10 minutes at a dilution of 1: 1000 for nuclear staining.
  • the bivalent and monovalent forms of the 1564 clone showed increased internal izat ion relative to the negative control antibody (11F11).
  • the antibody does not pass through the tumor marker because it is degraded in the brain endothelial cell.
  • the antibody does not pass through the tumor marker because it is degraded in the brain endothelial cell.
  • the antibody is expected to pass the BBB by receptor-mediated transcytosis exiting the internal ized brain via endothelial cells do.
  • the 1564 bivalent form of the antibody tested in Example 17-2 was treated with HMBEC in the same manner and analyzed with which cel lular component and colocal ize the corresponding antibody in the cell.
  • the following antibodies were injected simultaneously with blocking and permeabi 1 izat ion, followed by goat anti i-human antibody to detect the administered antibody.
  • IGF1R antibody inhibits the binding between IGF1R (IGF1 receptor) and IGF1, which is a ligand thereof, by confirming the cell proliferation effect by IGF1.
  • Minibody antibodies of the 996, 1226, 1564 and MKJP2 clones prepared in Example 14-1 were each diluted by a factor of 400 to 5 times to prepare diluted samples and then treated with 25 u 1 IGF1 at a concentration of 20 ng / Respectively.
  • the MCF-7 cell line expressing IGF1R was cultured, the medium was removed on the day of the experiment, and 20, 000 (corresponding to 50 y 1) per well of a 96-well plate in which IGF1 and test antibody were dispensed, Respectively. 2019/117684 1 * (1 ⁇ 1 ⁇ 2018/015953
  • CCK-8 reagent was treated in 10 yi 1 and incubated for 4-5 hours in a C02 incubator to measure cell growth.
  • the absorbance was measured at 450 nm wavelength of the spectrophotomer.
  • the results of the above experiment are shown in Fig. 14A .
  • the antibody according to the present invention does not inhibit the cell proliferation of MCF-7 by signaling to IGF1R of IGF1.
  • Imclone anti-IGF1R antibody used as a control inhibited cell proliferation of MCF-7 by IGF1 in proportion to the treatment concentration. Therefore, since the antibody of the present invention binds to IGF1R expressed in endothelial cells constituting BBB and has BBB- passing ability but at the same time does not inhibit signaling by IGF1 in the body, It is confirmed that it can be used as.
  • the anti-IGF1R antibody according to the present invention was tested to determine whether IGF1 binding to IGF1R-expressing cells is involved in the signaling receptor and downstream signaling components when signaling is delivered into the cells.
  • the anti-IGF1R antibody was administered to the MCF-7 cell line expressing IGF1R, and the total Akt and phosphorylated Akt amount, which are downstream factors of total IGF1R, phosphorylated IGF1R and IGF1R in the cells, were analyzed.
  • MCF-7 cells were cultured and cultured 20 hours before treatment with anti-IGF1R antibody 2019/117684 1 »(1 ⁇ ⁇ 1 was changed to the serum 2018/015953 is included culture.
  • 100 of the minibody antibodies of the 996, 1226, 1564 and MJP2 clones prepared in Example 4-1 were treated with 200 ng / ml IGF1 after 1 hour treatment with the MCF-7 cell line. After 20 minutes, the cells were washed with PBS and lysed with M-PER supplemented with protease and phosphatase inhibitor cocktail. After measuring the protein concentration using the BCA assay kit, 12.5 ug of protein was loaded on SDS-PAGE gel, electrophoresed, and transferred to PVDF membrane. Blocking
  • the antibody according to the present invention does not affect total Akt and phosphorylated Akt amount, which are downstream factors of total IGF1R, phosphorylated IGF1R in the cells.
  • IGF1R signaling component Immunization
  • the anti-IGF1R antibody according to the present invention inhibits signaling of the signaling receptors and downstream signaling components when signaling is delivered to the brain endothelial cells To determine whether they are involved.
  • BEND3 cell line confirmed to be pre-existing was identified as 11F11-1564, 3A9-1564 (CH11F11 and ch3A9, a_syn alone antibody produced by the method of Example 14-2) And the 1564 clone IgG form prepared by the method of Example 14-3, and the total factor IGF1R, the phosphorylated IGF1R in the cell, the downstream factor of IGF1R, the total Akt, the phosphorylated The amount of Akt was analyzed.
  • bEND3 cells were cultured, and the culture medium was changed to a serum-free culture medium 20 hours before the treatment with the anti-IGF1R antibody.
  • 100 nM of the specific antibody of the 1564 and MJP2 clones of Example 14-2 were treated with 200 ng / ml of IGF1 after 1 hour treatment of the bEND cell line. Twenty minutes later, the cells were washed with PBS and then the protease and phosphatase inhibitor cocktail were added. The protein concentration was measured using a BCA assay kit, and 12.5 iig of the protein was loaded on SDS-PAGE gel, electrophoresed, and transferred to a PVDF membrane.
  • Blocking was performed at room temperature with gentle shaking for 1 h with PBST (0.1% Tween 20) containing 5% BSA, followed by overnight incubation at 4 ° C with primary antibody against IGF1R or Akt Respectively. beta act in antibody was used as a loading control. After washing, the secondary antibody was shaken slowly at room temperature for 1 hour, washed, ECL solution was added, and the signal was checked using Image Quant Las 4000.
  • Example 14-3 In order to confirm whether the anti-IGF1R antibody according to Example 14-3 binds to the surface of IGF1R-expressing cells as an IgG form and affects cell death by IGF1R-dependent binding. In other words, when the anti-IGF1R antibody 1564 clone binds to the IGF1R-expressing cell line, activation of the natural killer cell (NK cell l) results in adverse effects on IGF1R-expressing cells. .
  • Cells expressing IGF1R and MCF-7 cells and low-level expressing SKBR3 cells were cultured. Cells were plated at a rate of 5000 cells / well in a 96-well plate 20 hours before antibody treatment. The cultured cells were exchanged with RPMI / 1640 medium containing 4% low IgG serum and 1564 clone IgG form was diluted 8 times from 133.3 nM to each well. The stabilized ADCC effector cells are added to each well and left for about 10 minutes at the incubation temperature for 6 hours. The luminescence was measured with a PHERAster FS BMG LABTECH instrument after the addition of the previously prepared Bio-Glo luci ferase assay reagent
  • the antibodies according to the present invention bind to MCF-7 cells, an IGF1R overexpressing cell line, and SKBR3 cells, which express low levels 2019/117684 1 » (: 1 ⁇ 1 ⁇ 2018/015953
  • ADCC was not induced by effector cells.
  • IGF1R levels were analyzed by western blotting. After perfusion of mouse brain tissue of each group 3 with PBS loading homogenize the lysate o 'clock, 10 ug on 4-12% Bis-Tris Gel, and the transfer was 15 o' clock running, PVDF membrane. The remaining method was carried out in the same manner as in Example 19-1. The experimental results are shown in Fig. 15B. The 1564 clone double-stranded antibody showed a similar level of IGF1R to the Parkinson's disease-treated antibody alone and the IgG-treated group. This result suggests that 1564 clones do not cause a significant change in IGF1R levels in the brain after repeated administration and thus the antibody is expected to have low side effects when used as a BBB shuttle.
  • the BBB shuttle binds to the receptor on the surface of the brain endothelial cell surface and delivers the therapeutic antibody into the brain, but binding to the receptor on the normal cell surface in the brain should be small. If the BBB shuttle is heavily bound to normal cells expressing antigens in the brain, then the therapeutic antibody bound to the shuttle will be less likely to reach the disease target.
  • the distribution of the anti-IGF1R antibody in the brain of the in vivo experimental animal performed in Example 21-2 was analyzed by immunostaining.
  • SD rats to which the 1564 clone bivalent form was administered were perfused with physiological saline in a transcardiac perfusion fashion.
  • the left hemisphere was fixed in 10% neutral-buffered formalin for 24 hours.
  • the brain was rinsed with 1XPBS and frozen in a solution containing 30% sucrose for 24 hours. Brains were placed in 0CT and frozen and stored at -80 ° C until section.
  • the anti-IGF1R antibody of the present invention is expected to increase the therapeutic effect of the therapeutic antibody, since it does not bind to the normal cells in the brain and increases only the BBB passage ability of the therapeutic antibody.
  • Example 20 In vitro BBB passability assay of anti-IGF1R antibody
  • the signature pept ide in Fc and scFv was analyzed.
  • a double-stranded antibody conjugated with Parkinson's disease antibody alone (11F11) and a scFv form of Hercept in TM biosimilars were used as a negative control.
  • the system is known to not pass the BBB A20. 1 antibody (manufactured by National Research Council) to determine the calibration limit of the system.
  • the Papp values were determined by substituting the results obtained from the mass analysis into the known formulas in the preceding literature, and this value represents the BBB passability in F / fro.
  • Example 20-1 In the same model as in Example 20-1, the ability of the monovalent antibody and bivalent antibody prepared in Example 14-4 to pass through BBB in vitro was analyzed.
  • the 1564 cloned bivalent, monovalent antibody and negative control Parkinson's disease antibody (3A9) were passed through the sv-ARBEC BBB system and analyzed for passage. The results of the analysis are shown in Fig. 16B.
  • the bivalent and monovalent forms of the 1564 clone showed higher in vitro viability than the single antibody, 3A9, 2019/117684 1 »(1 ⁇ ⁇ 1 higher than 2018/015953. This shows that the 1564 clone can enhance the in vitro BBB throughput of therapeutic antibodies linked thereto in various forms.
  • the human stem cell-derived BBB model exhibits a high resistance value (TEER) versus the BBB system derived from rat or mouse cells and expresses various markers identified in the BBB. Therefore, the BBB tightness of the human stem cell-derived model is higher than that of animal cell-derived BBB, and the model reproduces the human BBB well.
  • TEER high resistance value
  • a vector derived from human amniotic fluid (AF-iPSC), or iP / EBNAl episomal vectors encoding 0CT4, S0X2, c-Myc, KLF4, NANOG and LIN28 was introduced and reprogrammed with iPSC.
  • Endothelial cells of pre-di fferentiate were prepared by treatment with K0 DMEM / F12, KOSR, glutamax, NEAA and beta mercaptoethanol. The cells were treated with serum free endothelial differentiation medium and 1% PDS, 20 ng / ml bFGF was treated to differentiate into brain endothelial cells.
  • the test antibodies were a bivalent form of 1564 clones, a monovalent form of 1564 clones, a bivalent form of the F06 clone, and a bivalent form of the C04 clone.
  • 11F11 a Parkinson's disease treatment antibody, was used as a negative control.
  • Antibodies passed through the BBB system were obtained in the same manner as in Examples 20-1 and 20-2 It was analyzed by 1 ⁇ 1 ⁇ 2018/015953 same way: 2019/117684 1 »(.
  • the results of the analysis are shown in Fig. 16c .
  • the test clones showed higher ability to pass through the BBB than the negative control.
  • the F06 bivalent and the C04 bivalent showed up to 15 times higher BBB ability than the single antibody.
  • the results of the present application - shows that IGF1R antibody to efficiently pass to prepare a human-derived antibody alone system B m.
  • Example 21 In vivo BBB passability assay of anti-IGF1R antibody (co-local ization assay)
  • PBS buf fer or 10 mg / kg IgG control and minibody antibodies of 996, 1226 and 1564 clones prepared in Example 14-1 were administered to tail veins of 6-8 week old male BALB / c mice, respectively .
  • the mouse brain was intracardially perfused with a sufficient amount of 0.9% NaCl solution and 4% par a formaldehyde.
  • the fixed brain was harvested and sectioned at 20 ym and co-stained with anti-i-mouse CD31 and anti-i-human Fc antibody, the vascular markers, to identify colocal ization of cerebral blood vessels and IGF1R test.
  • CD31 was imaged under fluorescence microscope using a secondary antibody conjugated with Alexa 488 and a secondary antibody with human Fc conjugated with Alexa 594. 2019/117684 1 Experiment results are shown in Fig. 17A.
  • the ligand-binding non-inhibitory clones according to the present invention have excellent BBB-passing ability, and the degree of co-localization of the antibody with the cerebral blood stream is analyzed by immunostaining As a result of staining brain tissue with a blood vessel marker (ant i_CD31, green) and a human antibody (anti-human Fc, red color) according to the method (Neuron (2016) Yu_ Zuchero et al. Non-inhibitory clones showed higher colocalization levels than IgG control.
  • the 1564 clone-bound bispecific antibody showed higher CSF and brain cross-reactivity than the anti-IGF1R antibody-conjugated therapeutic antibody, and its efficacy was confirmed at both 10 and 30 mg / kg doses.
  • the double-specific antibody showed the ability to pass the brain at a maximum of about 4.5 times higher than the single antibody at 30 mg / kg dose.
  • the amount of antibody in CSF and brain was analyzed. Two types of double-stranded antibodies with 1564 clones showed higher CSF and brain transitivity than single antibodies. In particular, the bivalent form showed a higher ability to pass through the BBB than the monovalent form, which was up to about 5 times that of the brain.
  • FIG. 17B show that when 1564 clones are bound to the therapeutic antibody in various forms, the anti-corpusclear antibody enhances BBB transitivity in the body.
  • the affinity variants of 1564 clones prepared according to Example 2 were expected to increase serum PK relative to parental clones. Therefore, it is expected that the ability to pass through the BBB will be improved by staying in the serum for a long time and maintaining the inflow amount of BBB continuously.
  • Affinity variants prepared in monovalent form according to bivalent form or 4-4 according to Example 14-2 were administered intravenously at 30 mg / kg to SD rats and blood was collected from ocular venules at 0, 24 and 48 hours Respectively. Test antibodies were divided into two experiments according to the backbone of the therapeutic antibody, and the bispecific antibodies of the corresponding variants used in the experiment are shown in Table 18 below.
  • the amount of antibody in the blood was analyzed by ELISA.
  • the 96-well plate was coated with a goat anti-human Fc antibody, and the diluted sample was treated with an anti-human IgG HRP conjugated antibody.
  • the results of the analysis are shown in Fig.
  • CSF was extracted from the rats at 48 hours and analyzed by the same ELISA. The results of the analysis are shown in Fig. 17E.
  • the 1564 monovalent, F06 monovalent, and C04 monovalent forms which showed increased serum PK, showed increased CSF antibody levels compared to the parental 1564 bivalent.
  • the bivalents of VH2, VH5, VH7, VH9, VH16 and VH32 also showed an increase in CSF antibody compared to the parental 1564 bivalent.
  • VH35 showed reduced serum PK and CSF antibody levels compared to parental 1564 bivalent.
  • FIGS. 17d and 17e are significant for the ability of the antibody to pass through the BBB due to the introduction of the BBB of the PK antibody in the serum, the BBB shuttle, 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953
  • the ability of the bispecific antibody to pass through the BBB increases.
  • the F06 monovalent form with the highest amount of CSF antibody showed about 5 times higher CSF passive ability than the parental 1564 bivalent.
  • the 1564 bivalent antibody showed about 3-fold increase in CSF-passing ability compared to the single antibody in CSF, so that the F06 monovalent form showed up to about 15-fold increased BBB activity compared to the single antibody .
  • the deamidation reaction means, for example, attacking the side-by-side thiophene bond of asparagine to produce a succinimide intermediate product of a symmetric structure which is converted to either asparaginic acid or isoasparic acid due to hydrolysis do.
  • Such deamination reaction may affect the continuous activity of the protein, so that the light and heavy chain amino acids are replaced with other amino acids to prevent the depolarization and to secure long-term stability.
  • the clones showed similar binding to native human IGF1R ECD as in Example 15, but not all of the boi led human IGF1R ECDs that destroyed the tertiary structure by heat. This means that the anti-IGF1R antibody of the present invention binds to a non-linear conformational epitope .
  • Conformational e pi tope of 1564 clone was analyzed by field scanning as follows.
  • the ovarian cancer cell line 0VCAR3 cells which were confirmed to have low IGF1R expression, expressed the IGF1R library in which the eGFP ta g fused at the N-terminus and the C-terminal kinase domain was deleted.
  • the IGF1R library contains mutations in which the residues of the IGF1R surface are replaced by alanine.
  • the prepared library was transfected into 0VCAR3 cells. Cells with expression of IGF1R were treated with 1564 antibody and then treated with a secondary antibody labeled with DyLight650 for fluorescent labeling.
  • the labeled cells were classified according to the presence or absence of IGF1R expression, the expression of IGF1R and the presence or absence of 1564, and RNA deep se quencing was performed using the Illumina or HiSeq technique. 2019/117684 1 »(1 ⁇ 1 ⁇ 2018/015953 analyzed the frequency of each alanine mutation. The frequencies were normalized as a result of the cells expressing the wi lde type IGF1R, and the relative frequencies were calculated to select mutants whose number decreased in the 1564-labeled cell group.
  • the effect of the IGF1R antibody on the binding ability of the a-syn antibody when scFv-linked to an a-syn antibody of IgG type was analyzed.
  • the a-syn aggregate was coated on a 96-well plate at a concentration of 1 ug / ml for 18 hours. After washing, each antibody was diluted 5 times at 400 nM to bind. The bound antibody was bound to anti-human Fc-HRP and then TMB solution was added thereto to develop color, thereby confirming the binding degree of the antibody.
  • the binding force to the a-syn aggregate was confirmed to be the same in the single antibody or the double antibody.
  • the double antibody having the IGF1R scFv antibody binds to the antibody in a concentration-dependent manner, but does not bind to the antibody having no IGF1R antibody site.
  • the humanized double antibodies have a binding capacity to a- syn aggregates at a level similar to that of chimeric double antibodies, and monovalent double antibodies having one IGF1R scFv show similar binding affinities to chimeric antibodies.
  • Phagocytosis refers to the action of various receptors of macrophages to remove unnecessary extracellular materials. Variety of protein aggregates are to induce an immune response or 15 inflammatory response there is to give an adverse effect to the human body to be facilitated through interaction with FcrR of the Fc region with the cell surface of the antibody when the particular dosage of the antibody for the removal of a-syn aggregates It is known. For this reason, we compared the activity of the double antibody to the phagocytic action of the single antibody and the IGF1R scFv .
  • mouse - derived BV-2 To compare the phagocytosis of the single antibody and the double antibody, mouse - derived BV-2
  • the a-syn aggregates of the supernatant were removed by centrifugation at 1200 rpm and washed three times with PBS, pH 2.5 buffer to remove aggregates or antibodies bound to the cell surface.
  • Cells were fixed with 4% paraformaldehyde and washed with PBS buffer. The cells were washed with PBS buffer and treated with pan-a-syn antibody for 1 hour. The cells were washed with 0.5% tr i ton X-100 to confirm the presence of phagocytosized aggregates and antibodies.
  • the combined pan-a-syn antibody was treated with anti-ibra t-a lexa-488 antibody for 1 hour, and then FACS analysis was performed to identify aggregates entering the cells by macrophage.
  • a bivalent bispecific antibody of chimeric 11F11 antibody and 1564 clone scFv was prepared according to Example XX and transfected with human alpha-synuclein (mThy- 2019/117684 1 » (: 1 ⁇ 1 ⁇ 2018/015953
  • the animals were anesthetized with chloral hydrate according to humanitarian regulations and then cardiopulmonary with 0.9% saline.
  • the saggital section of the perfused brain was stored in 4% paraformaldehyde (pH 7.4, 4 ° C) in phosphate buffer until analysis and the other half was stored frozen (-70 ° C) .
  • Brain half fixed to paraformaldehyde was cut into sections of 40 ym thickness in a free-floating format using a Vibratome. Sections containing cortex, hippocampus, and striatum were incubated with alpha-sine cline antibody (pl29a-syn antibody, abeam, ab59264, or species alpha-sine cline antibody, Cel l
  • stellate cell astrocyte
  • GFAP stellate cell (astrocyte) GFAP the sections to analyze the activity level of (gl ial fibrillary acidic protein) in order to determine the degree (AB5804, mi11ipore) or brain inflammation (neuroinfla_ation), antibodies to IL-113 (ab9722, abeam), respectively.
  • hippocampus, NeuN Chemicon,
  • Figure 11a shows the ability of the chimeric 11F11 antibody and its chimeric antibody and 1564 clone bivalent bispecific antibody to clear alpha-synuclein aggregates in a mouse animal model (TG) overexpressing human a-Syn, After the administration, p-129 a -Syn antibody was used to stain cortex and hippomcapus in mouse brain tissue. p-129 a-syn is a dark brown dot or aggregate in the stained tissue with a 129-residue phosphorylated form of aggregate marker.
  • the IgG-treated group showed a higher degree of staining of p-129 than the non-tg-treated group (#: one way ANOVA, p ⁇ 0.01).
  • the degree of staining of p-129 a-syn or aggregates was significantly reduced in the group treated with either a single antibody or a bispecific antibody.
  • the degree of reduction of the bispecific antibody group was superior to that of chimeric 11F11 antibody (O: one way ANOVA, p ⁇ 0.05).
  • Figure lib is the same experiment as in Figure 11a, but as a result of staining with total alpha-synuclein antibody as a marker.
  • Total alpha-synuclein detection indicates that the antibody according to the present invention has the ability to clear the alpha-synuclein itself and inhibit cell-to-cell transmission. In another aspect, it can be interpreted that inhibition of the formation of monomers into aggregates, or removal of all of the monomers. / Increased human alpha-synuclein in TG mice is associated with IgG administration by single antibody and bispecific antibody administration 2019/117684 1 » (: 1 ⁇ 1 ⁇ 2018/015953
  • Glycidyl Osis is a non-specific reaction occurs in glial cells (gl ial cel l) in response thereto if there is damage to the central nervous system that is triggered by a material, such as damage to the BBB, TGF- beta or inter ryukan.
  • Representative examples include Astroglossia, and GFAP protein is used as a marker.
  • Fig. 11C is a graph showing the relationship between the chimeric 11F11 antibody or its antibody
  • mice The results are as follows.
  • the mouse brain tissue was stained with GFAP (astroglia) antibody as a marker.
  • the single antibody and the bispecific antibody inhibited astroglia compared to the IgG control, and in particular, the efficacy of the bispecific antibody in the striatum 2019/117684 1 »(: 1 ⁇ 1 ⁇ 2018/015953
  • the lid shows whether the chimeric 11F11 antibody or the antibody and 1564 clones of the bispecific antibody produced in the example of the present invention can reduce the inflammatory cytokine in vivo.
  • the IL-1beta antibody And the brain tissue of the mouse was measured by staining. IL-1 beta induces inflammation leading to the death of various nerve cells and inflammatory responses.
  • IL-1beta was reduced in the group treated with the single antibody and the group treated with the antibody specific to the IgG, and especially the ability to decrease the specific antibody was significantly superior to the antibody alone -way ANOVA, p ⁇ 0.005; *: one way ANOVA, p ⁇ 0.05).
  • the antibody according to the present invention as compared to the control,
  • Example 26 Improvement of half-life through Fc en gineering and enhancement of ability to pass through BBB
  • FcRn is an important receptor of the cell membrane that increases half-life by circulating the antibody 5 into the cell so that it is not dissolved when the antibody circulates in the blood vessel.
  • WT double antibody the concentration in the blood rapidly decreased after 168 hours, whereas the M428L double antibodies having high binding capacity to 15 FcRn retained an improved blood concentration compared to WT.
  • the half - life was increased by 1.5 days in the M428L double antibody compared to the WT duplex.
  • the monovalent M428L double antibody was the best in clearance and the WT duplex showed the fastest clearance (FIG. 22b).

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Immunology (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Engineering & Computer Science (AREA)
  • Public Health (AREA)
  • Animal Behavior & Ethology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Veterinary Medicine (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Molecular Biology (AREA)
  • Neurology (AREA)
  • Neurosurgery (AREA)
  • Biomedical Technology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • General Chemical & Material Sciences (AREA)
  • Epidemiology (AREA)
  • Cell Biology (AREA)
  • Psychology (AREA)
  • Peptides Or Proteins (AREA)
  • Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)

Abstract

본 발명은 알파-시누클레인 및 IGF1R에 특이적으로 결합하는 이중 특이 항체, 및 상기 이중 특이 항체를 이용하여 알파-시누클레인 또는 이의 응집체와 관련된 질병인 시누클레인병의 예방, 치료 및 /또는 진단 용도로 사용하고, a-syn 항체 또 는 이의 항원결합단편을 혈액뇌 장벽을 통과할 수 있게 하여 뇌에서 그 작용을 발휘할 수 있도록 하며, 반감기를 연장하여 약효를 장기간 유지할 수 있도록 한다.

Description

2019/117684 1»（：1^1{2018/015953
【명세세
【발명의 명칭】
크 / 比묘에 대한이중특이 항체 및그용도
【기술분야】
본발명은 알파-시누클레인 및
Figure imgf000003_0001
대한 이중특이 항체， 상가이중특 이 항체를 포함하는 시누클레인병 （（1 - 5 1111（：1 11（ 31；11 3）의 예방 및/또는 치료용 약학적 조성물， 및 상기 이중 특이 항체를 포함하는 알파-시누클레인 응집체 검출 또는시누클레인병 진단을위한정보를제공하는방법에 관한것이다.
【배경기술】
알파-시누클레인（（1-31111（：1^11， （1-3 11）은 뉴론의 전 시냅스 말단에서 주로 발현되며， 정상상태에서는자연적으로 접히지 않은상태의 단량체로존재한다. 알 파-시누클레인은 자발적 및 비자발적 운동의 시작과 정지를 제어하는 중요한 일종 의 신경 전달물질인 도파민의 방출을 규제하는 것을 돕는다. 특히 알파-시누클레 인의 기능은 시냅스 활동의 증가및 나이가듦에 따라서 중요하며, 신경퇴화의 중 요한인자이다.
그러나, 병적인 상태에서 알파-시누클레인은 액적（ 01）161；）， 인지질 이중막 또는지질막등과의 결합 및 상호작용을통해 구조적 변화를 일으켜 접힌 또는 폴 딩된 01-헬리칼 형태의 2차 구조를 형성하여 이량체（ 11161·）, 올리고머（01 0111 ） 및/또는섬유상형태의 분자를포함하는응집체를형성하게 된다.
이러한알파-시누클레인응집체는세포에 독성을유발하는것으로알려져 있 2019/117684 1»（：1^1{2018/015953 으며 파킨슨병 Parkinson's disease, PD) , 파킨슨질환성 치매Parkinson’s disease dementia, PDD), 다계통 위축증 multiple system atrophy, MSA) , 루이소 체 치매 dementia with Lewy bodies, DLB) , 그 외 다양한 질환의 신경세포 내에서 발견되는 비정상적인 단백질 응집체인 루이소체의 주성분이다.또한 알파-시누클레 5 인의 인산화 또는 유비퀴틴화와 같은 번역 후 변형도 알파-시누클 레인의 응집 및 신경독성과 관련이 있는 것으로 알려져 있다.알파-시누클레인은 동물실험 및 세포 실험에서도 도파민 신경세포를 사멸시키고 염증반응을 유발하며 실험동물에서 파 킨슨 병증과 유사한 운동증상을 유발하는 것으로 알려져 있다.또한， 알파-시누클 레인 응집은 파킨슨 병 파킨슨질환성 치매， 루이소체 치매， 다계통위축증 및 기타 10 다수의 신경축삭 질환을 포함하는 시누클레인병 a-synucleinopathies)라고 불리 는 일군의 신경퇴행성 질환의 병인과관련이 있는 것으로 알려져 있다.
알파-시누클레인에 대한 항체 또는 그러한 항체를 유도하기 위한 알파-시누 클레인의 절편은 시누클레인병에 대한 면역 요법의 방법으로 제안되어왔다.그러나 항체의 뇌 침투는 혈액 뇌 장벽 (BBB)에 의해 제한될 수 있다.
15 또한 고도-특이성인 BBB운반체의 결핍은 뇌 종양 및 신경변성 질환을 포함 한 뇌에서 기원하는 질환들을 위한 새로운 치료제 및 진단제의 개발을 지연시키고 있다. BBB의 생리학 및 항상성을 붕괴시키지 않으면서 뇌에 약학적으로 효능있는 투여량으로 치료제 및 진단제 분자를 전달하기 위한 방법에 대한 필요성이 분명하 게 존재한다.
20 【발명의 상세한설명】 2019/117684 1»（：1^1{2018/015953
【기술적 과제】
본 발명의 일 예는 알파-시누클레인 에 대한 항원 결합 부위 및 犯凡요에 대한 항원 결합 부위를 포함하는 단백질 복합체 또는 상기 단백질 복합체의 제조방법을제공한다.
다른 예는 상기 단백질 복합체를 코딩하는 폴리뉴클레오타이드, 이를 포함하는재조합벡터 , 및 이를포함하는재조합세포를제공한다.
또 다른 예는 상기 단백질 복합체로부터 얻어지는 크 !! 및 犯 묘에 대한 이중특이 항체 및 이의 제조방법을제공한다.
또 다른 예는 상기
Figure imgf000005_0001
및 犯 에 대한 이중특이 항체와， 약학적으로 허용가능한부형제를포함하는, 알파-시누클레인병 （（1 -3 1111（：16江1（ 31；］1 3）의 예방 및/또는치료용약학적 조성물을제공한다.
본발명에 따른항체또는항원 결합단편을이용한알파-시누클레인병의 진 단， 치료또는예방에 사용되는약물을뇌로전달하는방법을제공한다.
【과제의 해결수단】
이하, 본발명을더욱자세히 설명하고자한다.
본발명의 일 예는알파-시누클레인 ）에 대한항원 결합부위 및 犯 에 대한 항원 결합 부위를 포함하는 단백질 복합체 및 상기 단백질 복합체로부터 얻어지는 알파-시누클레인（3 ） 및 묘에 대한 이중 특이 항체（이하， 항 3- /항 犯 이중특이 항체）에 관한것이다. 이에， 본발명에 따른 이중특이 항 체는， 알파-시누클레인과犯凡요를모두항원으로인식 및 결합할수있다. 2019/117684 1»（그1^1{2018/015953 본 발명에 따른 항 a_syn/항 IGF1R 이중 특이 항체는， 상기 항 a_syn항체 또는 이의 항원결합단편을포함하며, 알파-시누클레인을특이적으로 인식하고 결합 할수 있으며， 특히 알파-시누클레인의 C-말단부위에 결합할수 있으며， 알파-시 누클레인 또는 이의 응집체와 관련된 질병인 시누클레인병의 예방， 치료 및/또는 진단용도로사용될수있다.
본발명에 따르면， 용어 "시누클레인병”은병리학적 시뉴클레인응집체를특 징으로 하는 모든 신경퇴행성 장애를 포함한다. 파킨슨병, 파킨슨질환성 치매 (Parkinson ' s di sease dement i a, PDD) , 루이소체 치매 (dement i a wi th Lewy bodies , DLB) , 루이소체병， 루이소체를동반한치매， 치매를동반한파킨슨증후군， 다계통 위축증 (mul t iple system atrophy, MSA) , 다발성 신경계 위축 및 뇌 철 침착동반 한신경변성 I형 (NBIA Type I )을 포함하는 몇 가지 신경퇴행성 장애는 시누클레인 병으로서 집합적으로 그룹화된다. 또한， 알파-시누클레인 응집은 이차적으로 알츠 하이머 질환에서도 발견된다 (Kim et al . Alzheimer’s Research & Therapy 2014, 6:73) .
시누클레인병은공통적인 병리학적 특성을공유하는신경퇴행성 장애의 다양 한그룹이다: 신경병리적 실험에서, 특유의 병변은뉴런 (neuron) 및 희소돌기신경 교 (ol igodendrocyte)의 선택된 집단 내에서 알파-시누클레인 단백질의 비정상적 응집을포함하며 감지될 수 있다. 알파-시누클레인 (처음에 PARK1 및 PARK4로판명 됨)은신피질, 해마， 치상회, 후신경구, 선조체, 시상및 소뇌에서 광범위하게 발 현되는 140개 아미노산의 단백질이다. 알파-시누클레인은또한 B-, T-, 및■세포 2019/117684 1»（：1^1{2018/015953 를비롯하여 단백구및 혈소판을포함하는조혈세포에서 높게 발현된다. 이러한세 포 내에서의 정확한 역할은 알려지지 않았으나， 거핵구 (혈소판 전구체 )의 분화와 관련이 있었다.
본 발명에서 "알파-시누클레인 응집체와관련된 질환”은 시누클레인병 라고 5 불리는 일군의 신경퇴행성 질환으로, 뉴런 및 교세포 (gl ia) 집단을포함하는 병소 에서 알파-시누클레인 응집체가발견되며， 도파민성 시스템의 퇴화, 운동능력변화, 인지장애 및 루이소체 및/또는 루이 뉴라이트의 형성과 같은 특징을 가진다 (Kim et al . Alzheimer’s Research & Therapy 2014， 6:73; McKeith et al . , Neurology (1996) 47: 1113-24) . 이러한질환에는파킨슨 질환，파킨슨질환성 치매，루이소체 치 10 매， 알츠하이머 루이소체 질환, 복합성 알츠하이머 및 파킨슨 병, 다계통위축증및 기타다수의 신경축삭질환을포함하나 이로제한하는 것은아니다. 일 구현예에서， 본원에 따른항체는파킨슨병의 치료에 효과적으로사용된다.
또한, 본발명에 따른항 a-syn/항 IGF1R이중특아 항체는, 항- IGF1R항체 또는 이의 항원 결합 단편을 포함하여 , 항 a-syn 항체 또는 이의 항원결합단편을 15 혈액뇌 장벽을통과할수 있게 하여 뇌에서 그 작용을 발휘할수 있도록 하며, 반 감기를연장하여 약효를장기간유지할수있도록한다.
더욱이 , 본 발명에 따른 항 a-syn/항 IGF1R 이중 특이 항체는 세포 표면의 IGF1R에 결합하지만 리간드의 결합에 영향을 주지 않으며， IGF1R을 통한신호전달 경로에는 영향을 미치지 않는 특성을 가지며， 이에 IGF1R와 이의 리간드 결합 및 20 IGF1R를통한신호전달을 억제하지 않으므로 혈액 뇌 장벽을통과하는셔틀수단으 2019/117684 1»（：1^1{2018/015953 로사용될수있다.
특히 본발명에 따른항- IGF1R항체 또는항원결합단편은， IGF1R (Insulin- 1 ike Growth Factor 1 Receptor)을특이적으로 인식하며， IGF1R,특히 인간 IGF1R, 마우스 IGF1R, 랫트 IGF1R, 및 원숭이 IGF1R에 인식 및 결합하며， IGF1R의 리간드 인 IGF-1, IGF-2, 및/또는 인슐린이 IGF1R에 결합하는 것을 방해하지 않고， IGF1R 을통한신호전달을저해하지 않으며， 트랜스사이토시스에 사용될 수 있어 혈액 내 장벽 통과능을 가지며， ADCC (Ant i body-dependent cel 1 -mediated cytotoxicity)를 갖지 않아동물에 반복투여했을경우에도뇌의 IGF1R수준을 감소시키지 않아,독 성을가지지 않는다.
특히， 본발명에 따른항- IGF1R항체는， BBB을구성하는뇌 내피세포 (brain endothelial cell)의 표면에 존재하는 IGF1R에 결합하여 세포 내부로
Internalization이 이루어진다. 예를 들면, IGF1R을 발현하는 세포주 (예, MCF-7 등)을 이용하여 본 발명의 항- IGF1R 항체가 세포내로 internalization 되는 지를 확인할 수 있다. 본 발명의 항- IGF1R 항체， 예를 들면 1564， 48G5, 54H4, 60H6, B11그리고 1564의 affinity variant들인 ⑶ 4, F06, VH2, VH5, VH7, VH9, VH16,
VH32, VH35들은음성 대조군 대비 높은 internal izat ion을나타냈다.해당결과는, 시험한 항- IGF1R항체들의 internalization 정도는 세포 표면의 IGF1R에 특이적임 을시사한다.또한， 본 발명에 따른항- IGF1R항체는 scFv형태로서,다양한 방식 으로치료용항체에 결합하여 제작될수 있다. 예를들면,항- IGF1R항체의 scFv는 치료용항체， 예를들면 a-syn항체의 C-말단에 두개가결합한이중특이항체， 즉 \¥0 2019/117684 1»（：1^1{2018/015953
2가 (bivalent) 형태 이중항체 혹은해당항- IGF1R항체 (scFv형태)가치료용항 체의 C-말단에 한 개가 결합한 이중특이항체, 즉 1가 (monovalent) 형태 이중특이 항체로 제작될 수 있으며, 해당 이중특이항체들은 모두 IGF1R을 발현하는 세포 안 으로 internal ize된다. IGF1R 항체는 세포 표면의 항원에 대한 높은 결합력이 5 internalization효과를높이며， 이는 BBB통과능으로 이어질 수 있다. 다만， 해당 항체가 BBB통과능을 가지면서 IGF1R의 시그널링에 간섭을 줄 경우 부작용을 야기 할 수 있기 때문에， BBB shuttle로서 기능할 수 있는 결합력을 가지면서 동시에 IGF1R시그널에 대한 non-blocking항체인 것이 특징이다.
상기 항- IGF1R항체 또는항원결합단편은우수한개발용이성을가진다. 이 10 와 관련하여 상기 항- IGKLR 항체의 CDR 영역에 발생하여 항체의 안정성과 효능을 감소시키는 post-translat ional modification, 예를 들면 deamidation을 제거하고. 자 하였다. deamidation이 발생하는 아미노산의 치환으로, 항원인 IGF1R의 ECD에 대한결합력에 변화가 없으면서， 항체의 안정성과효능이 parental 대비 증대된다. 항체의 deamidation이 발생하는 부위는 Asn을 하나씩 Q, H, K 을 포함하는 다른 15 residue로의 돌연변이체에 대해， IGF1R에 대한결합력을 ELISA로분석했을때 해당 돌연변이의 결합력은 parental 항- IGF1R항체와유사함을확인하였다.
추가적으로， 본 발명에 따른 항-IGF1R항체는 뇌에서 작용하는 생리활성물질 과 연결되었을 때， 상기 생리활성물질 단독에 비하여 향상된 BBB통과능 및 효능을 유도할수 있다.
20 본 발명의 일례에 따른 항-IGF1R항체는， 다양한 치료용 제2항체를 포함하는 2019/117684 1»（：1^1{2018/015953 이중특이항체로활용될수 있으며 , 인간 IPSC유래 in vitro BBB시스템의 통과실 험에서, 치료 항체로만 구성된 단독항체에 비해 15배 높은 BBB 통과능을 보였다 (도 7a) . 상기 이중 특이 항체에서 상기 제 2항체에 결합된 항- IGF1R 항체가 1가 (monovalent) 혹은 2가 (bivalent) 형태로 결합된 것일 수 있다. 예를 들면, 항- 5 IGF1R항체가 1가또는 2가인 이중특이 항체를정상 랫트에 단회 투여 후혈중항 체량및 CSF에서의 항체량을분석하였을때， 항- IGF1R항체가 1가또는 2가인 이중 특이 항체는, parental 항- IGF1R항체 (1564클론) 대비 최대 5배 증가된 혈중항체 량과 최대 5배 증가된 CSF 항체량을 보였다. Parental 항- IGF1R 항체(1564 클론) 대비 약 3배 증가된 CSF및 약 4.5배 증가된 brain통과량을나타낸다 (도 7c) . 따 10 라서, 상기의 방법으로 개선된 항- IGF1R항체의 이중특이 항체는, 치료용 제 2항체 로만구성되는단독항체 대비 최대 약 15배의 CSF및 약 23배의 Brain통과능을보 일 것으로기대된다.
본발명에 따른항 IGF1R항체는 IGF1R, 특히 인간, 원승이， 랫트， 및 마우 스을 포함하는 포유동물의 IGF1R에 결합하는 것이 확인되어, 약물 개발을 위한스 15 크리닝， 임상시험등에 유용하게사용될수 있다.
본 발명에 따른항- IGF1R항체 또는항원결합단편은， IGF1R (Insulin-like Growth Factor 1 Receptor)을특이적으로 인식하는항체 또는 이의 항원 결합단편 이다.
본 발명에 따른 항 IGF1R 항체 또는 항원결합 단편은 해리 상수 20 (dissociation constant , KD)가 <10-6 의 친화도로 결합할 때， 항원과같은 이의 2019/117684 1»（：1^1{2018/015953 표적에 "특이적으로결합한다’’ 라고 일컬어진다. 항체는 KD가 < lx 10-8 M일 때 혹 은 EC50 (effect ive concentration 50)이 2 nM이하일 때, 높은 친화성으로표적에 특이적으로결합한다. 일 구현예에서， 항체 또는이의 항원 결합단편은 KD < 1X10 8로 IGF1R또는인간 IGF1R에 결합할수 있다. 본발명에 개시된항체는 IGF1R, 특 5 히 인간 IGF1R, 마우스 IGF1R, 랫트 IGF1R, 및 원숭이 IGF1R에 결합하는 것이 확인 되었다.
본 명세서에서， 용어 ”에피토프 (epitope)"는 항원 결정 부위 (antigenic determinant)로서， 항체에 의해 인지되는항원의 일부분을 의미하는 것으로 해석된 다. 일 구체예에 따르면, 본발명에 따른항- IGF1R항체의 결합부위는 IGF1R단백 10 질， 예를 들면 인간 IGF1R단백질 (서열번호 99)의 세포 외 도메인 (extracel lular domain)일 수 있다. 더욱 구체적으로， 본 발명에 따른 항- IGF1R항체， 예를 들면 1564클론항체의 인간 IGF1R단백질에 대한결합부위는， 서열번호 99의 아미노산 서열로 이루어진 단백질에서， 결합부위 1은 Y775, P776, F778, R650, S791, L798 and Glu779을포함하고， 결합부위 2는 L641, H808, E809 and L813을포함하고， 결합 15 부위 3은 V397, D435, W434, Y460 and C488을 포함한다. 이에, 본 발명에 따른
IGF1R항체의 에피토프는 conformat ional epitope로서 상기의 3개 결합부위를모두 혹은일부를포함하는것일수있다.
본 발명에서 ’’항체"라함은， 면역계 내에서 항원의 자극에 의하여 만들어지 는 물질을 의미하는 것으로서, 생체 내에서 생성된 것, 재조합적으로 생성된 것， 20 또는 인공적으로 합성된 것일 수 있으며， 그 종류는특별히 제한되지 않는다. 본 2019/117684 1»（：1^1{2018/015953 발명에서 항체는동물항체, 키메릭 항체， 인간화항체， 및 인간항체를모두포함 한다. 또한본발명에서 항체란항원 결합능을보유한항체의 항원 결합단편도포 함한다.
상기 항체는모노클로날항체 및 폴리클로날항체도포함하며， 상기 모노클 로날항체는 인간항체, 인간화항체， 또는키메라항체인， IGF1R에 특이적으로결 합하는 분리된 항체일 수 있다. 상기 모노클로날 항체는 IgGl, IgG2, IgG3 또는 IgG4형인， IGF1R에 특이적으로결합하는분리된항체이다.
본발명에 따른항체는이중특이적 항체， 미니바디， 도메인항체， 항체 모방 체（또는 합성 항체）， 항체 융합체（또는 항체 접합체）， 및 이의 단편을 포함하나， 이에 국한되지 않는다. 다양한항체의 구조가이하본발명에서 추가로개시된다. 본 명세서에 기재된 "항원 결합단편”은항원에 대한특이적 결합능을 갖는 항체의 일부또는 이를포함하는폴리펩타이드를 의미한다. 예컨대， 항원결합단편 은 항원（예컨대, 에피토프）과 상호작용하여， 항체에 항원에 대한 특이성 및/또는 친화성을 부여하는 아미노산 잔기를 포함하는 항체의 일부 또는 이를 포함하는 폴 리펩타이드일 수 있다. 이러한 항원결합단편은 전형적으로， 하나 이상의 "상보성 결정 부위’’（Complementary Determining Region, or CDR）을포함할수 있으며 , 여기 에 더하여， 하나이상의 ’’프레임워크” 영역을포함할수 있다. CDR은항체의 항원 결합의 특이성과 친화성에 기여하는 아미노산 서열이고， 프레임워크 영역은 이들 CDR의 적절한 형태（conformat ion）를 유지하는데 기여하는 아미노산 서열 부위로， 항원결합영역과항원사이에 결합을촉진할수있다. 2019/117684 1»（：1^1{2018/015953 본 발명에서, "상보성 결정 영역 (Complementar i ty-determining regions , CDR)”라함은， 항체의 가변 영역 중에서 항원과의 결합특이성을 부여하는부위를 의미한다.
상기 항체는 모든 서브타입의 면역글로불린(예컨대， IgA, IgD, IgE, IgG (IgGl, IgG2, IgG3, IgG4) , IgM, 등)에서 선택된 것일 수 있다.상기 IgG 형태의 항체는 IgGl, IgG2, IgG3, 또는 IgG4 서브타입， 예컨대 IgGl 또는 IgG2 서브타입 형태일 수 있다. 상기 IgG형태의 항체는 두 개의 중쇄와 두 개의 경쇄를 포함하 고， 각각의 중쇄 및 경쇄는 다이설파이드 결합을 통하여 결합되어 두 개의 중쇄-경 쇄 구조체(dimer)를 형성하고, 상기 형성된 두 개의 중쇄-경쇄는 중쇄의 Fc 부위에 서 다이설파이드 결합을 통하여 연결된 형태를 갖는다.상기 IgG형태의 항체는 양 쪽 중쇄-경쇄 구조체에 동일한 항원에 대한 항원 결합 부위를 포함하여 하나의 항 원을 표적으로 하는 단일 표적 항체 또는 양쪽 중쇄-경쇄 구조체에 서로 다른 항원 에 대한항원 결합부위를 포함하여 두 개의 항원을 표적으로 하는 이중 특이 항체 일 수 있다.
본 발명에 사용된， 항체 또는 면역글로불린의 사슬 (중쇄 또는 경쇄)의 "항 원 결합 단편’’은 전장 사슬과 비교하여 일부 아미노산이 결여되었지만， 항원에 특 이적으로 결합할 수 있는 항체의 일부를 포함하는 것이다.이러한 항원 결합 단편 은 표적 항원에 특이적으로 결합할 수 있고， 또는 다른 항체 또는 항원 결합 단편 과 특정 에피토프에 결합하기 위해 경쟁할 수 있다는 측면에서 생물학적으로 활성 이 있다고 할 수 있다.구체적으로,상기 항원 결합 단편은 상기 상보성 결정 영역 2019/117684 1»（：1^1{2018/015953 을하나이상포함하는항체 단편， 예컨대， 산 ， （^1^X02， - , , ’ 및 （此'）2로이루어진군에서 선택되는것일 수 있으나, 이에 한정하지 않는다. 이러 한 생물학적 활성 단편은 재조합 0·기술에 의해 생산되거나, 또는 예를들면 온 전한항체를효소적 또는화학적 절단하여 생산될 수 있다. 면역학적으로기능적인 5 면역글로불린단편에는이로제한하는것은아니다.
본발명에서 예를들면 항원 결합단편， 단백질, 또는항체와같은폴리펩타 이드의 "변이체”는다른폴리펩타이드서열과비교하여 하나 이상의 아미노산잔기 에 삽입， 결실， 부가및/또는치환이 발생한폴리펩타이드이며， 융합폴리펩타이드 를포함한다. 예를들면, 항체의 일부는상기 중쇄 또는경쇄, 가변 영역 또는
Figure imgf000014_0001
본발명에서 폴리펩타이드의 ’’유도체"는, 삽입, 결실, 부가또는 치환 변이 체와는 상이한， 다른 화학적 모이어티와의 컨쥬게에션을 통해 화학적으로 변형된 폴리펩타이드를의미한다.
Figure imgf000014_0002
1， 犯 2, 및/또는 인슐린이 犯 묘에 결합하는 것을 방해하지 않는다. 구체적
Figure imgf000014_0003
의 리간드가세포막에 위치하는 상기 에 결합하는 것을 방해하지 않고 묘 를통한신호전달을 억제하지 않으며， 또한세포표면의 발현에도영향을미 20 치지 않는장점이 있다. 이에， 본발명에 따른항 平 항체 또는항원 결합단편 2019/117684 1»（：1^1{2018/015953 은， 트랜스사이토시스를 통해 혈액 뇌 장벽을 통과하는 데 효과적으로 사용될 수 있다.
인간 IGF1R은 인슐린유사성장 인자, IGF-1 및 IGF-2 및 인슐린 (INS)에 의 해 활성화될수 있다. IGF1R을통한신호 전달은 PI3 Kinase/Akt 경로의 활성화에 5 의존적인 IRS어댑터 단백질을통해 세포의 성장과생존을촉진한다. IGF1R은 이의 주요서브스트레이트인 IRS-1, IRS-2, IRS-3및 IRS-4와 She단백질에 신호를 전달 한다. 그 결과 Ras/Raf/MAP 키나아제 및 PI3 키나제 Mkt 신호 전달 경로의 활성화 가초래된다. IGF1R은현재까지 주로사용되는 BBB통과능향상을위한, 뇌의 내피 세포에서 그 발현된다고 알려진 다른 트랜스사이토시스 표적과 비교하여 묘의 10 발현은뇌에 상대적으로높은발현양을보이는것으로나타났다.
본발명에 따른항 IGF1R항체는 IGF1, IGF2및/또는인슐린이 IGF1R에 결합 하는 것을 방해하지 않으며 IGF1R을통한상술한 바와 같은 신호전달 경로를 방해 하지 않는다. 또한본 발명에 따른 일 구현예에서, IGF1R은 치료항체의 BBB통과 능향상용도로현재 개발되고 있는다른표적, 예를들면, transferrin receptor , 15 insul in receptor 등과 비교하였을 때, 정상 뇌 및 peripheral tissue, 예를 들면 간， 폐， 대장등에 상대적으로낮은발현양을보이는것으로나타났다.
IGF1R은혈액 뇌 장벽 (Blood Brain Barrier , BBB)을통과하여 유용한물질을 뇌와내부로 전달할수 있는 RMT( Receptor Mediated Transcytosis)의 표적이 되고 있다. 하지만 혈액 뇌 장벽 통과를 위한 약물 전달 표적으로 사용되기 위해서는, 20 세포표면의 IGF1R에 결합하지만리간드의 결합에 영향을주지 않으며 , IGF1R을통 2019/117684 1»（：1^1{2018/015953 한 신호전달 경로에는 영향을 미치지 않는 특성을 가져야 바람직하다.따라서， 본
Figure imgf000016_0001
및 犯 요를 통한 신호전달을 억제하지 않으므로 혈액 뇌 장벽을 통과하는 셔틀 수 단으로사용될 수 있다.
5 본 발명에 따른 항-犯 항체 또는 그 항원 결합 단편은 트랜스사이토시스
Figure imgf000016_0002
른 항체는 마우스에 혈관 주사한 경우 마우스의 뇌혈관과 동일 자리에 위치한다. 이러한 결과는 본 발명에 따른 항체 또는 항원결합 단편이 혈액 뇌장벽을 통과하는 약물 전달체로서 효과적으로사용될 수 있음을 나타내는 것이다.
Figure imgf000016_0003
작용하는 생리활성물질이 혈액 뇌장벽을 통과할 수 있게 한다.본 발명에서 생물학 적 장벽은 세포， 조직 막또는 생물학적 분자의 효과적인 통과 확산 또는 전달을 막는 세포， 막， 또는 구조를 말한다.이러한 생물학적 장벽은 신경세포/조직， 결합 조직, 근육， 막 또는 상피(예를 들면 점막 또는 혈관)세포를 포함한다.대표적인 15 예로 혈액뇌장벽을들수 있다.
Figure imgf000016_0004
에 존재하는 뇌의 모세혈관 내피세포 막내에 타이트 결합0 :1^ )에 의해 형성된 장벽이다.이러한 장벽은 매우 견고해서 약 6아 분자량의 저분자 물질이 뇌로 통 과하는 것도 제한한다.뇌의 혈액 뇌장벽， 척추의 혈관척수장벽 그리고 망막의 혈
Figure imgf000016_0005
2019/117684 1»（：1^1{2018/015953 본발명에서 "혈액 뇌 장벽 전달체”는이러한혈액 뇌장벽을통과하여， 상기 뇌 작동인자물질을 전달할수 있으며 , 상기 뇌 작동인자물질은 예를 들면, 화합 물, 펩타이드 및 폴리펩타이드를포함하는 단백질， 핵산， 항체, 또는 저분자 화합 물을포함한다.
본 발명에 따른 항체는 하이브리도마 기술을 사용하여， 목적하는 특이성을 갖는항원-특이적 인간 mAb가유전자도입 마우스, 예를 들면， 앞서 기술된 것들로 부터 생성되고선택될 수 있다. 이러한항체는적절한벡터 및 숙주세포를사용하 여 클로닝되고 발현되거나, 또는 상기 항체는 배양된 하이브리도마 세포로부터 수 확될 수 있다. 또한, 상기 항체는 파지-디스플레이 라이브러리 (phage-di spl ay l ibrary)로부터 유래될 수 있다. 파지 디스플레이 기술은 필라멘트 (f i lamentous) 박테리오파지의 표면 상에서 항체 레퍼토리를 디스플레이하여, 이로부터 목적하는 항원에 결합하는 파지를 선별하는 일종의 면역 선택 ( immune select ion)을 모방한 방법이다. 이러한 한 가지 기술은 본 발명의 실시예 또는 PCT 공개공보 W0 99/ 10494호를 참조할수 있다. 일 구현예에서， 본 발명의 인간화 IGF1R항체는 파 지 디스플레이 방법을통해선별된다.
본발명은 IGF1R에 특이적으로결합하는분리된항체 또는그항원결합단편 에 관한것으로서, 상기 항체 또는항원결합단편은중쇄의 상보성 결정부위와경쇄 의 상보성 결정부위를포함하여, IGF1R에 특이적으로결합하는폴리펩타이드, 단백 질또는항체 또는이의 항원결합단편일수 있다. 2019/117684 1»（：1^1{2018/015953 구체적으로， 이하 IGF1R에 특이적으로결합하는항체에 관한기재이다.
본발명에 따른항- IGF1R항체 또는항원결합단편은, IGF1R (Insulin-like Growth Factor 1 Receptor)을특이적으로 인식하며, IGF1R,특히 인간 IGF1R,마우 스 IGF1R, 랫트 IGF1R, 및 원숭이 IGF1R에 인식 및 결합하며， IGF1R의 리간드인 IGF-1, IGF-2, 및/또는 인슐린이 IGF1R에 결합하는 것을 방해하지 않고， IGF1R을 통한신호전달을저해하지 않으며,트랜스사이토시스에 사용될 수 있어 혈액 내 장 벽 통과능을 가지며， ADCC ( Ant i body-dependent cel 1 -mediated cytotoxicity)를 갖 지 않아동물에 반복투여했을경우에도뇌의 IGF1R수준을감소시키지 않아， 독성 을가지지 않는다.
특히,본발명에 따른항- IGF1R항체는, BBB을구성하는뇌 내피세포 (brain endothelial cell)의 표면에 존재하는 IGF1R에 결합하여 세포 내부로
Internal izat ion이 이루어진다. 예를 들면, IGF1R을 발현하는 세포주 (예， MCF-7 등)을 이용하여 본 발명의 항- IGF1R 항체가 세포내로 internalization 되는 지를 확인할 수 있다. 본 발명의 항- IGF1R 항체, 예를 들면 1564， 48G5, 54H4, 60H6, B11그리고 1564의 affinity variant들인 ⑶ 4， F06, VH2, VH5, VH7, VH9, VH16,
VH32, VH35들은음성 대조군 대비 높은 internal izat ion을나타냈다.해당결과는 , 시험한 항- IGF1R항체들의 internalization 정도는 세포 표면의 IGF1R에 특이적임 을시사한다.또한， 본 발명에 따른항- IGF1R항체는 scFv형태로서,다양한 방식 으로치료용항체에 결합하여 제작될수 있다. 예를들면,항- IGF1R항체의 scFv는 치료용항체， 예를들면 a-syn항체의 C-말단에 두개가결합한이중특이항체， 즉 2019/117684 1»（：1/10公018/015953
2가 (bivalent) 형태 이중항체 혹은해당항- IGF1R항체 (scFv형태)가치료용항 체의 C-말단에 한 개가 결합한 이중특이항체, 즉 1가 (monovalent) 형태 이중특이 항체로 제작될 수 있으며， 해당 이중특이항체들은 모두 IGF1R을 발현하는 세포 안 으로 internal ize된다. IGF1R 항체는 세포 표면의 항원에 대한 높은 결합력이 5 internalization효과를높이며, 이는 BBB통과능으로 이어질 수 있다. 다만, 해당 항체가 BBB통과능을 가지면서 IGF1R의 시그널링에 간섭을 줄 경우부작용을 야기 할 수 있기 때문에， BBB shutt le로서 가능할 수 있는 결합력을 가지면서 동시에 IGF1R시그널에 대한 non-blocking항체인 것이 특징이다.
상기 항- IGF1R항체 또는항원결합단편은우수한개발용이성을가진다. 이 10 와 관련하여 상기 항- IGF1R 항체의 CDR 영역에 발생하여 항체의 안정성과 효능을 감소시키는 post-translational modification, 예를 들면 deamidation을 제거하고 자 하였다. deamidation이 발생하는 아미노산의 치환으로， 항원인 IGF1R의 ECD에 대한결합력에 변화가없으면서, 항체의 안정성과효능이 parental 대비 증대된다. 항체의 deamidation이 발생하는 부위는， 항- IGF1R항체의 Fc 영역에서 Asn을 하나 15 씩 Q, H， K을포함하는 다른 residue로의 돌연변이체에 대해, IGF1R에 대한 결합 력을 ELISA로분석했을때 해당돌연변이의 결합력은 parental 항- IGF1R항체와유 사함을확인하였다.
추가적으로, 본발명에 따른항- IGF1R항체는뇌에서 작용하는생리활성물질 과연결되었을때, 상기 생리활성물질 단독에 비하여 향상된 BBB통과능 및 효능을
20 유도할수있다. 2019/117684 1»（：1^1{2018/015953 본발명의 일례에 따른항- IGF1R항체는, 다양한치료용제 2항체를포함하는 이중특이항체로활용될 수 있으며 , 인간 IPSC유래 in vitro BBB시스템의 통과실 험에서, 치료 항체로만 구성된 단독항체에 비해 15배 높은 BBB 통과능을 보였다 （도 7a）. 상기 이중 특이 항체에서 상기 제 2항체에 결합된 항- IGF1R 항체가 1가 5 （monovalent） 혹은 2가 （bivalent） 형태로 결합된 것일 수 있다. 예를 들면, 항_ IGF1R항체가 1가또는 2가인 이중특이 항체를정상 랫트에 단회 투여 후혈중항 체량및 CSF에서의 항체량을분석하였을때， 항- IGF1R항체가 1가또는 2가인 이중 특이 항체는， parental 항- IGF1R항체（1564클론） 대비 최대 5배 증가된 혈중항체 량과 최대 5배 증가된 CSF 항체량을 보였다. Parental 항- IGF1R 항체（1564 클론） 10 대비 약 3배 증가된 CSF 및 약 4.5 배 증가된 brain통과량을 나타낸다（도 7c 및 도 7d）. 따라서， 상기의 방법으로개선된 항- IGF1R항체의 이중특이 항체는, 치료 용 제 2항체로만 구성되는 단독항체 대비 최대 약 15배의 CSF 및 약 23배의 Brain 통과능을보일 것으로기대된다.
본발명에 따른항 IGF1R항체는 IGF1R, 특히 인간, 원숭이， 랫트， 및 마우 15 스을포함하는포유동물의 IGF1R에 결합하는 것이 확인되어， 약물 개발을 위한스 크리닝， 임상시험등에 유용하게사용될수있다.
본발명에 따른항- IGF1R항체 또는항원결합단편은， IGF1R （Insulin-like Growth Factor 1 Receptor）을특이적으로 인식하는항체 또는 이의 항원 결합단편 이다.
20 본 발명에 따른 항 IGF1R 항체 또는 항원결합 단편은 해리 상수 2019/117684 1»（：1^1{2018/015953
(di ssoci at ion constant , KD)가 < 10-6 의 친화도로 결합할때， 항원과같은 이의 표적에 "특이적으로결합한다” 라고 일컬어진다. 항체는 가 < lx 10-8 M일 때 혹 은 EC50 (ef fect ive concentrat ion 50)이 2 nM이하일 때， 높은 친화성으로표적에 특이적으로결합한다. 일 구현예에서， 항체 또는 이의 항원 결합단편은 ¾ < 1x10一 8로 IGF1R또는인간 IGF1R에 결합할수 있다. 본발명에 개시된항체는 IGF1R, 특 히 인간 IGF1R, 마우스 IGF1R, 랫트 IGF1R, 및 원숭이 IGF1R에 결합하는 것이 확인 되었다.
본 명세서에서 , 용어 "에피토프 (epi tope)"는 항원 결정 부위 (ant igeni c determinant)로서， 항체에 의해 인지되는항원의 일부분을의미하는 것으로해석된 다. 일 구체예에 따르면， 본발명에 따른항- IGF1R항체의 결합부위는 IGF1R단백 질， 예를 들면 인간 IGF1R단백질 (서열번호 99)의 세포 외 도메인 (extracel lul ar domain)일 수 있다. 더욱 구체적으로, 본 발명에 따른 항- IGF1R항체, 예를 들면 1564클론 항체의 인간 IGF1R단백질에 대한 결합부위는, 서열번호 174의 아미노 산 서열로 이루어진 단백질에서， 결합부위 1은 Y775, P776, F778, R650, S791, L798 and Glu779을포함하고， 결합부위 2는 L641, H808, E809 and L813을포함하고, 결합부위 3은 V397, D435, W434, Y460 and C488을 포함한다. 이에， 본 발명에 따른 IGF1R항체의 에피토프는 conformat ional epi tope로서 상기의 3개 결합부위를모두 혹은일부를포함하는것일수있다.
본 발명에서 "항체”라함은, 면역계 내에서 항원의 자극에 의하여 만들어지 는 물질을 의미하는 것으로서， 생체 내에서 생성된 것， 재조합적으로 생성된 것， 2019/117684 1»（：1^1{2018/015953 또는 인공적으로 합성된 것일 수 있으며 그종류는 특별히 제한되지 않는다. 본 발명에서 항체는동물항체 키메릭 항체， 인간화항체 및 인간항체를모두포함 한다. 또한본발명에서 항체란항원 결합능을보유한항체의 항원 결합단편도포 함한다.
5 상기 항체는모노클로날항체 및 폴리클로날항체도포함하며 상기 모노클 로날항체는 인간항체， 인간화항체 또는키메라항체인 IGF1R에 특이적으로결 합하는 분리된 항체일 수 있다. 상기 모노클로날 항체는 IgGl, IgG2, IgG3 또는 IgG4형인 IGF1R에 특이적으로결합하는분리된항체이다.
본발명에 따른항체는이중특이적 항체， 미니바디， 도메인항체， 항체 모방 10 체（또는 합성 항체）， 항체 융합체（또는 항체 접합체）， 및 이의 단편을 포함하나， 이에 국한되지 않는다. 다양한항체의 구조가이하본발명에서 추가로개시된다. 본 명세서에 기재된 ’’항원 결합단편”은항원에 대한특이적 결합능을 갖는 항체의 일부또는 이를포함하는폴리펩타이드를 의미한다. 예컨대 항원결합단편 은 항원（예컨대 에피토프）과 상호작용하여， 항체에 항원에 대한 특이성 및/또는 15 친화성을부여하는 아미노산 잔기를 포함하는 항체의 일부 또는 이를 포함하는폴 리펩타이드일 수 있다. 이러한 항원결합단편은 전형적으로， 하나 이상의 "상보성 결정 부위’'（Complementary Determining Region, or CDR）을포함할수 있으며 여기 에 더하여 하나이상의 "프레임워크’ 영역을포함할수 있다. CDR은항체의 항원 결합의 특이성과 친화성에 기여하는 아미노산 서열이고， 프레임워크 영역은 이들 20 CDR의 적절한 형태（conformat ion）를 유지하는데 기여하는 아미노산 서열 부위로 2019/117684 1»（：1^1{2018/015953 항원결합영역과항원사이에 결합을촉진할수있다.
본 발명에서, ”상보성 결정 영역 (Complementar i ty-determining regions , CDR)"라함은 항체의 가변 영역 중에서 항원과의 결합특이성을 부여하는부위를 의미한다.
5 상기 항체는 모든 서브타입의 면역글로불린(예컨대, IgA, IgD, IgE, IgG
(IgGl, IgG2, IgG3, IgG4), IgM, 등)에서 선택된 것일 수 있다: 상기 IgG형태의 항체는 IgGl, IgG2, IgG3, 또는 IgG4 서브타입， 예컨대 IgGl 또는 IgG2서브타입 형태일 수 있다. 상기 IgG형태의 항체는 두 개의 중쇄와 두 개의 경쇄를 포함하 고, 각각의 중쇄 및 경쇄는 다이설파이드 결합을 통하여 결합되어 두 개의 중쇄-경 10 쇄 구조체(dimer)를 형성하고,상기 형성된 두 개의 중쇄-경쇄는 중쇄의 Fc부위에 서 다이설파이드 결합을 통하여 연결된 형태를 갖는다.상기 IgG형태의 항체는 양 쪽 중쇄-경쇄 구조체에 동일한 항원에 대한 항원 결합 부위를 포함하여 하나의 항 원을 표적으로 하는 단일 표적 항체 또는 양쪽 중쇄-경쇄 구조체에 서로 다른 항원 에 대한 항원 결합 부위를 포함하여 두 개의 항원을 표적으로 하는 이중 특이 항체 15 일 수 있다.
본 발명에 사용된， 항체 또는 면역글로불린의 사슬 (중쇄 또는 경쇄)의 "항 원 결합 단편"은 전장 사슬과 비교하여 일부 아미노산이 결여되었지만， 항원에 특 이적으로 결합할 수 있는 항체의 일부를 포함하는 것이다.이러한 항원 결합 단편 은 표적 항원에 특이적으로 결합할 수 있고,또는 다른 항체 또는 항원 결합 단편 20 과 특정 에피토프에 결합하기 위해 경쟁할 수 있다는 측면에서 생물학적으로 활성 2019/117684 1»（：1^1{2018/015953 이 있다고할수 있다. 구체적으로， 상기 항원 결합단편은상기 상보성 결정 영역 을하나이상포함하는항체 단편, 예컨대, scFv, (scFv)2, scFv-Fc, Fab, Fab' 및 F(ab’)2로이루어진군에서 선택되는것일수있으나， 이에 한정하지 않는다. 이러 한 생물학적 활성 단편은 재조합 DNA기술에 의해 생산되거나， 또는 예를 들면 온 전한항체를효소적 또는화학적 절단하여 생산될 수 있다. 면역학적으로 기능적인 면역글로불린단편에는이로제한하는것은아니다.
본발명에서 예를들면항원 결합단편， 단백질, 또는항체와같은폴리펩타 이드의 "변이체"는다른폴리펩타이드서열과비교하여 하나 이상의 아미노산잔기 에 삽입， 결실, 부가및/또는치환이 발생한폴리펩타이드이며， 융합폴리펩타이드 를포함한다. 예를들면, 항체의 일부는상기 중쇄 또는경쇄 , 가변 영역 또는 CDR 서열의 하나이상의 잔기에서 보존적 (conservat ive) 아미노산치환을포함한다. 본발명에서 폴리펩타이드의 "유도체”는， 삽입， 결실， 부가또는 치환 변이 체와는 상이한， 다른 화학적 모이어티와의 컨쥬게에션을 통해 화학적으로 변형된 폴리펩타이드를의미한다. 본 발명에 따른 항- IGF1R 항체 또는 항원결합 단편은, IGF1R의 리간드인 IGF-1, IGF-2, 및/또는 인슐린이 IGF1R에 결합하는 것을 방해하지 않는다. 구체적 으로， 상기 항 IGF1R항체 또는항원결합단편은 IGF1R을발현하는세포에서 IGF1R 의 리간드가세포막에 위치하는 상기 IGF1R에 결합하는 것을 방해하지 않고 IGF1R 를통한신호전달을 억제하지 않으며, 또한세포표면의 IGF1R발현에도 영향을미 0 2019/117684 1»（：1^1{2018/015953 치지 않는장점이 있다. 이에， 본발명에 따른항 IGF1R항체 또는항원 결합단편 은, 트랜스사이토시스를 통해 혈액 뇌 장벽을 통과하는 데 효과적으로 사용될 수 있다.
인간 IGF1R은 인슐린유사성장 인자， IGF-1 및 IGF-2및 인슐린 (INS)에 의 5 해 활성화될수 있다. IGF1R을통한신호 전달은 PI3 Kinase/Akt 경로의 활성화에 의존적인 ms어댑터 단백질을통해 세포의 성장과생존을촉진한다. IGF1R은 이의 주요서브스트레이트인 IRS-1, IRS-2, IRS-3및 IRS-4와 She단백질에 신호를 전달 한다. 그 결과 Ras/Raf/MAP키나아제 및 PI3 키나제/ Akt 신호 전달경로의 활성화 가초래된다. IGF1R은현재까지 주로사용되는 BBB통과능향상을위한， 뇌의 내피 10 세포에서 그 발현된다고 알려진 다른 트랜스사이토시스 표적과 비교하여 IGF1R의 발현은뇌에 상대적으로높은발현양을보이는것으로나타났다.
본발명에 따른항 IGF1R항체는 IGF1, IGF2및/또는인슐린이 IGF1R에 결합 하는 것을 방해하지 않으며 IGF1R을 통한상술한 바와 같은신호전달 경로를 방해 하지 않는다. 또한본 발명에 따른 일 구현예에서， IGF1R은 치료 항체의 BBB통과 15 능향상용도로현재 개발되고 있는다른표적， 예를들면， transferrin receptor , insulin receptor 등과 비교하였을셰 정상 뇌 및 per ipheral tissue, 예를 들면 간， 폐 , 대장등에 상대적으로낮은발현양을보이는것으로나타났다.
IGF1R은혈액 뇌 장벽 (Blood Brain Barrier, BBB)을통과하여 유용한물질을 뇌의 내부로 전달할 수 있는 RMKReceptor Mediated Transcytosis)의 표적이 되고 20 있다. 하지만 혈액 뇌 장벽 통과를 위한 약물 전달 표적으로 사용되기 위해서는， 2019/117684 1»（：1^1{2018/015953 세포표면의 犯 요에 결합하지만리간드의 결합에 영향을주지 않으며， 犯요을통 한신호전달 경로에는 영향을 미치지 않는특성을 가져야 바람직하다. 따라서， 본 발명에 따른항-江 항체 및 이의 항원 결합단편은， 犯 요와 이의 리간드 결합 및 犯凡묘를통한신호전달을 억제하지 않으므로 혈액 뇌 장벽을통과하는셔틀 수 단으로사용될수있다.
본 발명에 따른항-犯 요항체 또는그항원 결합단편은트랜스사이토시스
Figure imgf000026_0001
가능하며， 뇌의 내피세포를 통과할수 있다. 또한본 발명에 따 른 항체는 마우스에 혈관주사한 경우， 마우스의 뇌혈관과 동일 자리에 위치한다. 이러한결과는본발명에 따른항체 또는항원결합단편이 혈액 뇌장벽을통과하는 약물전달체로서 효과적으로사용될수있음을나타내는것이다.
따라서, 본 발명에 따른 항- 凡요항체 또는 그 항원 결합 단편은， 뇌에서 작용하는 생리활성물질이 혈액 뇌장벽을통과할수 있게 한다. 본발명에서 생물학 적 장벽은세포， 조직, 막또는 생물학적 분자의 효과적인통과， 확산또는전달을 막는세포, 막， 또는구조를 말한다. 이러한생물학적 장벽은신경세포/조직， 결합 조직， 근육， 막 또는 상피（예를 들면 점막 또는 혈관）세포를 포함한다. 대표적인 예로혈액뇌장벽을들수있다.
본발명에서 “혈액 뇌 장벽”
Figure imgf000026_0002
및 척추와그주변순환계사이 에 존재하는뇌의 모세혈관내피세포 막내에 타이트 결합 01111（： 011）에 의해 형성된 장벽이다. 이러한 장벽은 매우 견고해서 약 6003분자량의 저분자물질이 뇌로통 과하는 것도 제한한다. 뇌의 혈액 뇌장벽, 척추의 혈관척수장벽 그리고 망막의 혈 2019/117684 1»（：1^1{2018/015953 관망막장벽은중추신경계내의 연속적인모세혈관장벽으로, 통상 BBB로칭한다. 본발명에서 "혈액 뇌 장벽 전달체"는이러한혈액 뇌장벽을통과하여， 상기 뇌 작동인자물질을 전달할수 있으며 , 상기 뇌 작동인자물질은 예를들면， 화합 물， 펩타이드 및 폴리펩타이드를 포함하는 단백질, 핵산， 항체， 또는 저분자 화합 물을포함한다.
본 발명에 따른 항체는 하이브리도마 기술을 사용하여, 목적하는 특이성을 갖는항원-특이적 인간 mAb가유전자도입 마우스， 예를 들면， 앞서 기술된 것들로 부터 생성되고선택될수 있다. 이러한항체는 적절한벡터 및 숙주세포를사용하 여 클로닝되고 발현되거나， 또는 상기 항체는 배양된 하이브리도마 세포로부터 수 확 ¾ 수 있다. 또한, 상기 항체는 파지-디스플레이 라이브러리 (phage-di spl ay l ibrary)로부터 유래될 수 있다. 파지 디스플레이 기술은 필라멘트 (f i lamentous) 박테리오파지의 표면 상에서 항체 레퍼토리를 디스플레이하여, 이로부터 목적하는 항원에 결합하는 파지를 선별하는 일종의 면역 선택 ( immune select ion)을 모방한 방법이다. 이러한 한 가지 기술은 본 발명의 실시예 또는 PCT 공개공보 W0 99/10494호를 참조할수 있다. 일 구현예에서， 본 발명의 인간화 IGF1R항체는 파 지 디스플레이 방법을통해 선별된다. 본발명은 IGF1R에 특이적으로결합하는분리된항체 또는그항원결합단편 에 관한것으로서， 상기 항체 또는항원결합단편은중쇄의 상보성 결정부위와경쇄 의 상보성 결정부위를포함하여, IGF1R에 특이적으로 결합하는폴리펩타이드， 단백 2019/117684 1»（：1^1{2018/015953 질또는항체또는이의 항원 결합단편일수있다.
구체적인 일 예는, 항- 묘항체 및 이의 항원결합단편은,
(0 1] 1， ＜1«2및 }{ 3로 이루어진 군에서 선택된 하나 이상의 중쇄 상보성 결정 영역, 또는상기 하나이상의 중쇄 상보성 결정 영역을포함하는중쇄 5 가변 영역;
( ) 0 1, 1 ： 2및 1게¾3로 이루어진군에서 선택된 하나이상의 경쇄 상보성 결정 영역， 또는상기 하나이상의 경쇄 상보성 결정 영역을포함하는경쇄 가변 영역;
상기 하나 이상의 중쇄 상보성 결정 영역 및 상기 하나 이상의 경쇄 상보성 10 결정 영역의 조합; 또는
상기 중쇄 가변 영역 및상기 경쇄 가변 영역의 조합
을포함하는것일수있다.
추가적으로， 상기 중쇄 가변 영역, 상기 경쇄 가변 영역， 또는상기 중쇄 가 변 영역 및 상기 경쇄 가변 영역의 조합에서， 상기 중쇄 가변 영역은 }1 ， 114^2,
Figure imgf000028_0001
수 있으며， 상기 경쇄 가변영역은 1^1, 1^2, 抑 3, 및 1^ 4로 이루어진 군에 서 선택된하나이상의 경쇄 프레임워크를포함할수 있다.
Figure imgf000028_0002
하기 표 1에 기재된 아미노산서열중에서 선택되거나상기 선택된 아미노산서열과 20 실질적인 서열 동일성을 갖는 하나 이상의 아미노산서열을 포함한다. 또한, (11 ) 2019/117684 1»(：1^1{2018/015953 匕 1， 1 ： 2또는 1게«3의 경쇄 상보성 결정부위는하기 표 2에 기재된 아미노 산서열중에서 선택되거나， 상기 선택된 아미노산서열과실질적인 서열 동일성을 갖는하나이상의 아미노산서열을포함한다.
상기 실질적 동일성이란 본 발명은 서열변이가 존재하는 본 발명에 개시된 효과를 유지하는 것을 의미한다. 일 구현예에서 개시된 중쇄 가변영역과 약 90%, 95%, 또는 99%동일성을가진다. 다른구현예에서 개시된 경쇄 가변영역과 약 90%, 95%, 또는 99%동일성을가진다. 예를들면 본발명에 개시된 항체 또는항원 결합 단편의 서열과 90%, 95%, 또는 99%동일성을나타내는 변이체의 경우， 임의의 변이 보다는가변영역의 골격에서 발생된다.
[표 1] 본발명의 항체클론과중쇄
Figure imgf000029_0001
Figure imgf000029_0002
Figure imgf000030_0001
Figure imgf000031_0001
Figure imgf000032_0001
Figure imgf000033_0001
2019/117684 1»(：1/10公018/015953
Figure imgf000034_0002
Figure imgf000034_0001
Figure imgf000034_0003
Figure imgf000035_0001
Figure imgf000036_0001
Figure imgf000037_0001
2019/117684 1»(그1^112018/015953
Figure imgf000038_0002
Figure imgf000038_0001
하나 이상의 중쇄 프레임워크는 하기 표 3에 기재된 아미노산 서열중에서 선택될 수 있으며, 1^¾1， 1^2, 1^3, 및 1^¾4로 이루어진 군에서 선택된 하나이상의 경쇄 프레임워크는하기 표 4에 기재된아미노산서열중에서 선택될수 있다.
구체적으로， 본발명에 따른항 항체의 중쇄 가변 영역은하기 표 1에 2019/117684 1»（：1^1{2018/015953 기재된 H-CDR1, H-CDR2 및 H-CDR3을포함하거나， 추가로 표 3의 H-FR1, H-FR2, H- FR3, 및 H-FR4의 중쇄 프레임워크를포함할수 있다. 본 발명에 따른항 IGF1R항 체의 경쇄 가변 영역은 하기 표 3에 나타낸 L-CDR1, L-CDR2 및 L-CDR3을포함하거 나, 추가로표 4에 나타낸 L-FR1, L-FR2, L-FR3, 및 L-FR4의 경쇄 프레임워크를포 함할수 있다. 일 예에서, 상기 항- IGF1R항체 또는이의 항원 결합단편은표 1에 기재된 CDR-H1, CDR-H2및 CDR-H3의 아미노산서열로 이루어지는군에서 선택된 각 클론의 CDR-H1, CDR-H2 및 CDR-H3를 포함하는 중쇄 가변 영역 및 표 2에 기재된 CDR-L1, CDR-L2 및 CDR-L3의 아미노산 서열로 이루어지는 군에 선택된 각 클론의 CDR-L1 , CDR-L2및 CDR-L3를포함하는것일수있다.
본발명의 일 예에서， 상기 항 IGF1R항체의 Fc영역에 아미노산변이 , 예를 들면 아미노산의 Deamindat ion 제거로, 항원인 IGF1R의 ECD에 대한 결합력에 변화 가 없으면서 혈중 clearance 감소로 항체의 가 증가되며 , 이에 항체의 반감기를 연장한다. 일 예에서， 항 IGF1R항체에서 deamidat ion이 제거된 아미노산 위치는， 클론 1564에서 경쇄 LCDR2의 N51D, LCDR3의 N95aK, N95aH, N95aR, N95aD, 또는중 쇄의 HCDR2에서 N54D또는 N54Q일수 있다
[표 3] 본발명의 항체 클론과중쇄 가변영역의 프레임워크서열
Figure imgf000039_0001
Figure imgf000040_0001
Figure imgf000041_0001
Figure imgf000042_0001
Figure imgf000043_0001
Figure imgf000044_0001
Figure imgf000045_0001
2019/117684 1»(：1/10公018/015953
Figure imgf000046_0001
［표 4］ 본발명의 항체 클론과경쇄 가변영역의 프레임워크서열
Figure imgf000046_0002
Figure imgf000047_0001
Figure imgf000048_0001
Figure imgf000049_0001
Figure imgf000050_0001
Figure imgf000051_0001
Figure imgf000052_0001
2019/117684 1»（：1^1{2018/015953
Figure imgf000053_0002
본 발명에 따른 항 항체는， 경쇄 가변 영악과 중쇄 가변 영역을 포함 하는 항체일 수 있으며 본 명세서에 개시된 다양한 중쇄 및 경쇄 가변영역은 표
Figure imgf000053_0001
을각각 기재한다
하기 표 5및 표 6에 기재된 상기 중쇄 가변영역과 경쇄 가변영역은 다양한 형태의 항체의 제조를 위해 자유롭게 조합될 수 있다.상기 중쇄 가변영역 및 경쇄 가변영역의 조합 예를 표 5에 나타낸다. 2019/117684 1»(：1/10公018/015953
[표 5] 본발명에 따른항체의 중쇄 가변영역
Figure imgf000054_0001
Figure imgf000055_0001
Figure imgf000056_0001
Figure imgf000057_0001
2019/117684 1»(：1/10公018/015953
Figure imgf000058_0001
[표 6] 본 발명에 파른 항체의 경쇄 가변영역
Figure imgf000058_0002
Figure imgf000059_0001
Figure imgf000060_0001
Figure imgf000061_0001
2019/117684 1»(：1^1{2018/015953
Figure imgf000062_0002
본명세서에 개시된다양한중쇄 및 경쇄 가변영역은표 5및 표 6에 개시된 다. 이러한각각의 가변영역은온전한항체의 각각의 중쇄 및 경쇄를 형성하기 위 해 상기 중쇄 및 경쇄 불변영역에 결합될 수 있다. 본 발명의 일 예에 따른 항_ 平 항체를 구성하는 중쇄 가변 영역과 경쇄 가변 영역의 조합 예는 상기 표 5 미 6에 기재된 동일 클론명에 따라중쇄 가변영역과 경쇄 가변영역을조합한 것일 수있다.
본발명의 구체적인 일예에서， 서열번호 1내지 서열번호 9의 아미노산서열 중에서 하나를포함하는중쇄 0 1어抑 1산），
서열번호 10내지 서열번호 49의 아미노산서열중에서 하나를포함하는중쇄 0 2 01 2），
서열번호 50 내지 서열번호 80의 아미노산 서열중에서 하나를 중쇄
Figure imgf000062_0001
（［卜抑 1?3） :
서열번호 96 내지 서열번호 113의 아미노산 서열중에서 하나를 포함하는 2019/117684 1»（：1^1{2018/015953 경쇄如묘1（1게¾1），
서열번호 114 내지 서열번호 132의 아미노산 서열중에서 하나를 포함하는 경쇄 01¾2（1， ¾2）， 및
서열번호 133 내지 서열번호 161의 아미노산 서열중에서 하나를 포함하는 경쇄 0에3 此 대?3）로 이루어지는 군에서 선택된 적어도 하나를 포함하는， 항
1（ 항체 또는이의 항원 결합단편에 관한것이다.
구체적으로， 본 발명에 따른 항체 또는 그 항원결합 단편은， 서열번호 1 내지 서열번호 9의 아미노산 서열중에서 하나를 포함하는 중쇄 ⑶ 01 -⑶ .）， 서열번호 10내지 서열번호 49의 아미노산서열중에서 하나를 포함하는 중쇄
Figure imgf000063_0001
0 如1?2） , 및서열번호 50 내지 서열번호 80의 아미노산 서열중에서 하나를 중쇄
Figure imgf000063_0002
포함하는중쇄 가변영역과,
서열번호 96 내지 서열번호 113의 아미노산 서열중에서 하나를 포함하는 경쇄 ⑶ 此 -⑶ ）， 서열번호 114 내지 서열번호 132의 아미노산 서열중에서 하나를 포함하는 경쇄
Figure imgf000063_0003
（1-001^2）, 및 서열번호 133 내지 서열번호 161의 아미노산 서열중에서 하나를 포함하는 경쇄 ⑶요크 （1 - 0 3）를 포함하는 경쇄 가변영역을포함할수있다.
상기 항 1대 항체 또는 이의 항원 결합단편은， 서열번호 174의 아미노산 서열을포함하는 단백질에서 ¥775, ?776 , F778, 묘況 0， 3791, 1798, 0^779, 내41, 볘08, £809, 1813, ¥397, 0435, ¥434, ¥460 및 0488로 이루어지는 군에서 선택된 적어도하나이상의 아미노산을특이적으로 인식하여 결합하는 것인 항 ½ 1고항체 2019/117684 1»（：1^1{2018/015953 또는 이의 항원 결합 단편일 수 있다. 구체적으로, 본 발명에 따른항 犯凡묘항체 또는 이의 항원 결합 단편은， 서열번호 174의 아미노산 서열을 포함하는 단백질에서 결합 부위 1 내지 결합 부위 3으로 이루어지는 군에서 선택된 적어도 하나 이상의 결합부위에 결합하는 것이며， 상기 결합부위 1은 ¥775, 776， 778, 1½50, 3791, 98 및 （ 11779로 이루어지는 군에서 선택된 하나 이상의 아미노산을 포함하고， 결합부위 2는 1641, 11808， £809 및 내13로 이루어지는 군에서 선택된 하나 이상의 아미노산을포함하고， 결합부위 3은 ¥397, 0435, «34, ¥460및 0488로 이루어지는군에서 선택된하나이상의 아미노산을포함하는것일수있다.
Figure imgf000064_0001
2019/117684 1»（：1^1{2018/015953
Figure imgf000065_0003
본발명에 따른항체 또는이의 항원 결합단편의 중쇄 가변 영역은， 서열번호 81 내지 84의 아미노산서열중에서 하나를포함하는, II -⑶안의 1 말단쪽에 위치하는중쇄가변영역 프레임워크 1어 1¾1) ,
서열번호 85내지 86의 아미노산서열중에서 하나를포함하는, !1 1供1과 1-1 -
Figure imgf000065_0001
말단에 위치하는중쇄가변영역 프레임워크 (}«¾4)를포함하는것일수있다.
본발명에 따른항체 또는이의 항원 결합단편의 경쇄 가변 영역은， 서열번호 162 내지 164의 아미노산 서열중에서 하나를 포함하는， 1 1\ 11의 1말단쪽에 위치하는경쇄가변영역 프레임워크 1 ( 꾸犯)，
서열번호 165의 아미노산 서열을 포함하는， 1^¾1과 1^1¾2 사이에 위치하는경쇄가변영역 프레임워크 (1^¾2)
Figure imgf000065_0002
2019/117684 1»(：1^1{2018/015953
Figure imgf000066_0001
말단에 위치하는경쇄가변영역 프레임워크 （ᄂ子1산）를포함하는것일수있디-.
상기 표 5및 표 6에 개시된 중쇄 가변영역 및 경쇄 각가변영역은각각별 도의 도메인 항체로사용되거나 서로자유롭게 조합되어 다양한항체를 형성할수
Figure imgf000066_0002
본 발명에서 도메인 항체’’는중쇄의 가변 영역 또는 경쇄의 가변 영역만을 포함하는 면역학적으로 기능적인 면역글로불린 단편이다. 일 구현예에서는 2개 이 상의 영역이 펩타이드 링커에 의한공유결합으로 연결되어， 2가比 ）의 도 메인 항체를형성한다. 이러한 2가도메인 항체의 2개의 영역은동일 또는상이 한항원을표적으로할수있다.
본발명에 따른항 正 항체의 항원 결합단편은 상보성 결정 영역을하 나이상포함하는항체 단편, 예컨대， 3산 ， （3산 ）2， 3신 -1；（：,
Figure imgf000066_0003
’ , '） 미니바디 및 디아바디 로이루어진군에서 선택될수있다.
상기 항원 결합단편 중에서 는 경쇄 가변영역 및 중쇄 가변영역과경쇄 의 불변 영역 및 중쇄의 첫 번째 불변 영역（대1）을가지는구조로 1개의 항원 결합
Figure imgf000066_0004
테인 잔기를 포함하는 힌지 영역 0 1 6 011）을 가진다. ’）2 항체는 2개의 가 此 힌지 영역의 시스테인잔기가디설파이드결합을이루면서 생성된다.
Figure imgf000066_0005
로 단쇄 Fv (single-chain variable fragment , scFv) 및 이중쇄 Fv(two-chain 2019/117684 1»（：1^1{2018/015953 var i able fragment）을 포함한다. 이중쇄 Fv는 비공유 결합으로 중쇄 가변 영역과 경쇄 가변 영역이 연결될 수 있다. 단쇄 는， 중쇄 가변영역과 경쇄 가변 영역이 직접 또는 펩타이드 링커를 통하여 공유 결합으로 연결되거나또는（:-말단에서 바
Figure imgf000067_0001
연결된 항원 결합영역의 단일 폴리펩타이드사슬로서, 중쇄 가변영역과경쇄 가변
Figure imgf000067_0002
어진군에서 선택된 1종이상일수있다.
상기 펩타이드 링커는 앞서 설명한 바와 같을 수 있으며， 예컨대， 1 내지
100개, 예컨대 2내지 50개 또는 5내지 25개 아미노산길이의 것일 수 있으며, 상 기 펩타이드링커는항체의 기능에 영향을미치지 않는한도내에서, 그길이를다 양하게 결정할 수 있다. 상기 펩타이드 링커에 포함된 아미노산 종류는 예컨대， 이 ， 아 밍 1 11으로 이루어지는 군에서 선택된 1종 이상의 아미노산으로 구성될
Figure imgf000067_0003
比 ）로구성될수 있다. 구체적 일 예에서， 상기 펩타이드 링커는 ½43）11일수 있 으며, 상기 은 ½4幻의 반복수로서 1내지 10의 정수, 예컨대 2내지 5, 특히 3또 는 4의 정수로 표현되는 것일 수 있다. 상기 펩타이드 링커의 일 예는, 서열번호 172또는 173의 아미노산으로이루어지는펩타이드일수 있다.
서열번호 172: 000030（^50（^30（^5 2019/117684 1»（：1^1{2018/015953
Figure imgf000068_0001
하는 0 사이에 펩타이드 링커를 코딩하는 를 융합함으로써 제조될 수 있다. 제조된 폴리펩타이드는 접힘에 의해 항원-결합 단량체를 형성하거나, 또는 2개의 5 가변 도메인 사이에 유연성 링커의 길이에 따라， 다량체（예를 들면， 이량체， 삼량 체 또는사량체）를형성할수 있다. 상이한 과 을포함하는폴리펩타이드를조 합함으로써， 상이한에피토프에 결합하는다량체성 를형성할수있다.
상기 항원 결합단편은단백질 가수분해 효소를이용해서 얻을수 있고（예를
Figure imgf000068_0002
10 면 '）2단편을얻을수있다）， 유전자재조합기술을통하여 제작할수있다.
본발명에 개시된 단쇄 항체는중쇄 및 경쇄 가변 영역의 도메인 조합을포
Figure imgf000068_0003
이로제한되는것은아니다.
또한, 항 요항체 및 이의 항원결합단편은, 상기 중쇄 가변영역을포함하 15 는 중쇄 및 상기 경쇄 가변영역을 포함하는 경쇄를 포함할 수 있다. 구체적으로, 상기 중쇄 가변영역 및 경쇄 가변영역은중쇄 불변영역및 경쇄 불변영역에 결합될 수 있으며， 상기 중쇄 및 경쇄 서열은또한온전한항체 구조를 형성하기 위해 조 합될수 있다.
본발명에 따른가변 영역과조합될 수 있는 이러한불변 영역 서열은 예시 20 적이며， 상기 불변영역은 면역글로불린 （예컨대， 인간 면역글로불린）의 중쇄 불변 2019/117684 1»（：1^1{2018/015953 영역 및 경쇄 불변영역에서 적절히 선택될 수 있다.예컨대， 중쇄 불변영역은1용야
Figure imgf000069_0001
변영역은 카파 불변영역 또는 람다 경쇄 불변영역일 수 있으나 이에 제한되는 것 은 아니다.
일 예로서， 본 발명에 따른 상기 가변 영역은 불변 영역에 결합되어 하기 기재된 중쇄 및 경쇄 서열을 형성할 수 있다.상기 중쇄 및 경쇄의 조합 예를 표 9 에 나타낸다.또한 예시적인 온전한 항체 항체를 표 10에 기재하였다.상기 불변 영역은 면역글로불린 （예컨대 인간 면역글로불린）의 중쇄 불변영역 및 경쇄 불변 영역에서 적절히 선택될 수 있다.
10 [표 9] 1將항체
Figure imgf000070_0001
68
¾¾§x| (^¾| i|91^) ISA/KR 2019/117684 1»（：1/10公018/015953
Figure imgf000071_0002
Figure imgf000071_0001
이상의 가변 영역을 포함하는 이중특이적 항체 및 이중기능성 항체를포함한다 이 중특이적 또는 이중기능성 항체는서로 관련성이 있거나 또는 없는두 종류의 상이 정정용지（규칙제 91조） ISA/KR 2019/117684 1»（：1^1{2018/015953 한 표적을 인식하는 인공 하이브리드 항체이다.이중특이적 항체는 하이브리도마의 융합또는 北’ 단편의 연결과 같은 다양한 방법을 이용하여 제조될 수 있다.
본 발명에서 ’다중 특이 항원 결합 단백질"또는 ’다중 특이 항체’는 두 개 이상의 항원 또는 에피토프를 표적으로 하는 것으로 두 개 이상의 항원 결합 부위 5 를 포함한다.본 발명에서 "이중 특이"또는 "이중 특이적 항원 결합 단백질 또는 항체는 2개의 상이한 항원 결합 부위를 갖는 하이브리드 항원 결합 단백질 또는 항 체이다.이러한 이중 특이적 항체는 다중 특이적 항원 결합 단백질 또는 다중 특이 적 항체의 일종으로， 공지된 다양한 방법 예를 들면 하이브리도마의 융합 또는 '단편의 연결에 의해 생산될 수 있다.
10 상기 다중 특이 항체 예를 들면 이중 특이 항체를 제조할 수 있는， 항 항체 및 이의 항원결합단편은， 상술한 항 묘 항체 및 이의 항원 결합 단 편을 모두 포함할 수 있으며 예를 들면 완전한항체일 수 있고 상기 항원결합 단
Figure imgf000072_0001
서 선택되는 것일 수 있다.
15 상기 항 犯 항체의 항원결합단편는， 링커 예컨대， 펩타이드 링커를 통하 거나통하지 않고 연결될 수 있다.또한 항원 결합 단편 내의 중쇄 부불과 경쇄 부
Figure imgf000072_0002
통하거나 통하지 않고 연결될 수 있다.상기 펩타이드 링커는 앞서 설명한 바와 같 을수 있다.
20 상기 이중 특이 항체에서 항 犯 묘 항체 및 이의 항원결합단편은 결합된 2019/117684 1»（：1^1{2018/015953 상이한 항원 또는 에피토프를 표적으로 하는 제 2 항체 또는 이의 항원결합단편을 혈액 뇌 장벽을통과시켜 뇌로 전달시키는기능을수행할수 있다. 상기 제 2항체는 뇌에서 효능을발휘하는항체일수 있으나특별히 한정되는것은아니다.
본발명에 항 IGF1R항체또는이의 항원 결합단편은상이한제 2항체와특 정 영역 또는서열을공유할수 있다. 예를들면 항 IGF1R항체는 제 2항체의 항체 또는항원결합단편의 불변영역을공유하거나， Fc영악을공유할수 있다.
또한, 본발명에서 이중특이적 항체의 구조는， 완전한면역글로불린의 2개 중쇄의 Fc영역， 예를 들면 중쇄의 말단에 직접 또는 링커를 매개로 각 Fc에 항 IGF1R항체의 scFv가연결된 형태인 bivalent form이중항체와， 완전한면역글로불 린의 2개 중쇄중에서 1개 중쇄의 말단에만직접 또는 링커를 매개로항 IGF1R항체 의 scFv가연결된 형태인 monovalent 이중항체를모두포함하나, monovalent 이중 항체가바람직하다.
구체적으로, 본발명의 일예에서 monovalent form의 클론이 bivalent form의 클론보다반감기가향상되는 경우가 있으며， 이 때 monovalent form클론의 구조는 온전한면역글로불린의 형태에서 1개의 중쇄 말단에만링커로 IGF1R에 결합하는도 메인항체 (scFv)가 연결된 형태이다. 온전한면역글로불린 형태에서 1개의 중쇄에는 C말단에 링커가포함된 IGF1R항원에 결합하는도메인항체가연결되어 있으며， 나 머지 1개의 중쇄에는불변영역 C말단뒤에 어떠한것도 연결되어 있지 않은두가 지 서로다른중쇄를포함한 Knob- In-hole기법이 적용된 이종이량체의 형태이다. 상기 이중특이 항체에 있어서， 항 IGF1R항체 또는 이의 항원 결합단편에 2019/117684 1»（：1^1{2018/015953 결합하는 상기 제 2항체는 인간 항체 인간화 항체， 키메라 항체， 또는 IGF1R 에 특이적으로 결합하는 분리된 항체일 수 있다. 상기 제 2항체는 완전한 항체， 이중특이적 항체， 미니바디， 도메인 항체， 항체 모방체（또는 합성 항체）， 항체 융합체（또는항체 접합체） 및 이의 단편을포함하나 이에 국한되지 않는다. 이하 본발명에 따른항- syn항체 및 이의 항원결합단편에 관한것이다. 본 명세서에서 제공되는 항체가항원으로 인식하는 알파-시누클레인은 인간 알파-시누클레인， 원숭이 알파-시누클레인 （예컨대， Rhesus 알파-시누클레인）, 마우스 알파-시누클레인， 래트 알파-시누클레인 등의 포유동물 알파-시누클레인 들 중에서 선택된 것일 수 있으며， 예컨대 인간 알파-시누클레인은 알파-시누클레인 （NCBI ID： NP_000336） 일 수 있으나 이에 제한되는 것은 아니다. 본 명세서에 다르게 언급되지 않는 한 알파-시누클레인은 인간 알파-시누클레인을 지칭하는 것일 수 있고 본명세서에서 제공되는항체 또는 이의 항원결합단편은 인간알파 시누클레인 뿐만 아니라 원숭이（예컨대, Rhesus）, 래트， 및/또는 마우스 알파_ 시누클레인에도특이적인결합능을갖는것일수있다.
상기 항체 또는 이의 항원결합단편이 결합하는 알파-시누클레인의 C-말단 부위에 결합하며， 구체적으로 인간 알파-시누클레인 단백질은 서열번호 126의 아미노산 서열에서， C-말단 영역 예를 들면 110번 잔기 내지 120번 잔기 또는 111번 잔기 내지 122번 잔기를 포함하는 연속하는 적어도 11개 또는 12개 아미노산으로구성된 펩타이드를포함하는 C-말단 영역일 수 있다. 본발명에 따른 2019/117684 1»（：1^1{2018/015953 항체 또는 이의 항원결합단편은 , 상기 항원인식부위를 인식하여 알파-시누클레인 응집체에 대한높은친화도로결합하는것이 확인되었다.
본 명세서에서 "친화성 또는 친화도 (af f ini ty)”는 항체 또는 이의 항원 결합단편과 항원 사이의 상호작용의 강도이며， 항체 또는 항원결합 단편의 CDR 서열， 및/또는 항체 또는 항원결합 단편의 물리화학적 특성 (친수성/소수성， 정전기적 특성 등)， 항원의 크기, 모양, 및/또는 전하와 같은 항원의 특징 등에 의해 결정될 수 있다. 이러한친화도를 결정하는방법은당업계에 공지되어 있으며, 통상적으로 해리 상수 (di ssociat ion constant , KD)로 나타낼 수 있으나, 이에 제한되는것은아니다.
본 명세서에서， "알파-시누클레인 단백질 또는 알파-시누클레인 응집체에 특이적 결합한다"함은 알파-시누클레인단백질 또는 알파-시누클레인응집체에 대한 친화도가 다른 항원과 비교하여 상대적으로 높은 것을 의미하는 것으로， 예컨대, 알파-시누클레인 응집체， 구체적으로, 아밀로이드 피브릴 (amyloid f ibr i l s) , 프로토피브릴 (protof ibr i I s) 및 올리고머 (ol igomers)， 특히 아밀로이드 피브릴에 대해 친화도가 Octet 및 SPR분석에서 각각 0.1 x 10_1° M내지 2 x 10 10 M, 또는 0.05 x 10_1° M내지 0.3xl0_9 이나, 이에 제한되는것은아니다.
본 발명의 일예에 따른 경쇄 및 중쇄를 포함하는 인간화 알파-시누클레인 항체, 예를 들면 HullFll_(ver . l) , HullFlKver .2) , 및 HullFll_ABL2-4의 경우， 키메릭 알파-시누클레인항체에 비하여 높은 식세포 작용 촉진 활성을 나타낸다. HullFlKver .1) , HullFlKver .2) , HullFlKver .3) , HullFlKver .4) , ABL2-4와경우, 2019/117684 1»（：1^1{2018/015953 키메릭 알파-시누클레인 항체에 비하여 피브릴의 신경세포막 결합에 대한 높은 억제능을 보이며， HullFlKver.2), HullFlKver .4) , ABL2-4의 경우, 키메릭 알파- 시누클레인 항체 대비, 알파-시누클레인 과발현 세포로부터 분비된 알파- 시누클레인의 다른 신경세포로의 전파에 대한 높은 억제능을 나타낸다. 알파_ 시누클레인응집체에 대한 결합력, 예를 들면 cell-based assay에서는 측정한 결합력은 키메릭 알파-시누클레인 항체와유사하거나우수한 활성을 갖는다.
본 발명에 따른 알파-시누클레인 항체는 적용 대상(subject)의 신경계에서 신경세포 밖으로 분비된 알파-시누클레인 응집체가 세포 외 공간(extracellular space)에서 다른 정상 세포로 이동하여 해당 신경세포를 일종의 감염시키는 작용을 억제하며 ( inhibit cel 1-to-cel 1 transmission of aggregates) , 또한， 미세교세포가 세포 외 공간에 위치하는 알파-시누클레인 응집체에 대한 식세포 작용 촉진능을 가진다. 알파-시누클레인 응집체는 프리온처럼 한 세포에서 다른 세포로 전파되면서 해당 정상 세포 내에도 알파-시누클레인,특히 알파-시누클레인 응집체가 뇌 전반으로 퍼져나가면서 시누클레인병을 초래한다. 따라서, 알파_ 시누클레인 응집체는 뇌 신경세포에 독성이 있으며， 뇌 신경세포 사멸
(neurodegenerat ion) , 뇌염증 반응 (neuroinfla_ation)을 일으키는 것으로 잘 알려져있다. 따라서 알파-시누클레인 응집체가 뇌의 여러 부위에 퍼져나가면서 뇌세포 사멸과 뇌염증 반응이 증가할 것이며, 이로 인하여 시누클레인병, 예를 들면 파킨슨 병이 진행되면서 확인되는 뇌세포 사멸 및 이로 인한 행동， 인지 기능의 장애가나타난다. 2019/117684 1»（：1^1{2018/015953 이에， 본 발명의 알파-시누클레인 항체는 알파-시누클레인 또는 알파- 시누클레인 응집체의 신경세포간 이동을 억제하여 알파-시누클레인 응집체가 뇌의 다양한 영역으로퍼져나가는 현상을방지할수 있으며, 또한， 미세교세포의 식세포 작용을 촉진하여, 대상 신경계에서 신경세포 외부에 존재하는 알파-시누클레인 5 응집체 자체의 감소 또는 제거를 통해 시누클레인병의 중요한 원인인 알파- 시누클레인 응집체의 수준을 감소시켜, 뇌 신경세포 사멸 및 뇌 염증 반응을 줄이고 나아가서 시누클레인병, 예컨대 파킨슨 병의 증상 및 병의 진행을 개선， 경감또는예방하는효과를기대할수 있다.
또한， 본 발명에 따른 알파-시누클레인 항체는 0） 알파-시누클레인 또는 10 알파-시누클레인 응집체의 신경세포간 이동을 억제, 및 （11） 미세교세포의 식세포 작용을 촉진을 통한 뇌 신경계의 알파-시누클레인 응집체의 수준 감소와 관련하여 두 가지 기능을 모두 수행할 수 있는 점에서 우수한 활성을 가진다 （본원 061 1 -
Figure imgf000077_0001
알파-시누클레인 항체들은상기 （0 및 01） 활성 중에서 한가지 활성을가지므로， 15 이는 본원의 알파-시누클레인 항체는 알려진 알파-시누클레인 항체에 비해 우수한 시누클레인병의 예방 또는 치료에 장점이 있음을 나타낸다. 따라서， 본원 발명에 따른 알파-시누클레인 항체는 알파-시누클레인 응집체의 제거 및 감소와, 병인으로서의 작용을 억제하는 효능이 더욱 우수하고， 따라서 시누클레인병 또는 이와관련한증상적 질병 （예， 인지 장애 등）에 더욱효과적이다.
20 알파-시누클레인 응집체에 대한높은 친화도를 갖는본원에 따른항체 또는 2019/117684 1»（：1^1{2018/015953 항원 결합 단편은 알파-시누클레인 응집체 형성을 감소시킬 수 있어 뇌의 응집체의 농도를 낮출 수 있다.또한 알파시누클레인 응집체에 대한 높은 친화도를 갖는 본원에 따른 항체 또는 항원 결합 단편은 중추신경계 바깥에서의 알파시누클레인 응집체 형성을 감소시킬 수 있어， 결국 뇌혈관장벽을 경계로한 알파시누클레인 5 형태들 간의 평형상태를 변경시켜 중추신경계 내의 응집체의 농도를 낮추는 효과를가져올수 있다.
이는 항체를， 예를 들면 이로 제한하는 것은 아니나 보다 간편한 피하주사와 같은 방식으로 투여해도 충분한 효능을 얻을 수 있기 때문에 임상에서 큰 장점이 있다. 나아가 알파시누클레인 응집체에 대한 높은 친화도를 갖는
10 본원에 따른 항체 또는 항원 결합 단편은 알파시누클레인 응집체 형성 및/또는 축적 및/또는 세포가 전달을 억제 및/또는 감소시킬 수 있어 뇌에서 응집체의 농도를 낮출 수 있다.또한 알파시누클레인 응집체에 대한 높은 친화도를 갖는 본원에 따른 항체 또는 항원 결합 단편은 중추신경계 바깥에서의 알파시누클레인 응집체 형성을 감소시킬 수 있어 결국 뇌혈관장벽을 경계로 한 알파시누클레인 15 형태들 간의 평형상태를 변경시켜 중추신경계 내의 응집체의 농도를 낮추는 효과를 가져올 수 있다.또한 본 이론으로 한정하는 것은 아니나， 본원에 따른 항체 또는 항원 결합단편은 단량체의 제거를 통한 응집체 형성 억제， 또는 단량체와응집체를모두 제거할수 있다.
본 명세서에서 제공되는 알파-시누클레인 단백질 또는 알파시누클레인 20 응집체에 특이적으로 결합하는 항체 또는 이의 항원결합단편은 자연적으로 생산된 2019/117684 1»（그1^1{2018/015953 것이 아닐 수 있다 （11011-11 710 31 1 00!1 1^11요; 예컨대， 화학적 합성 또는 재조합적으로생산된 것일 수 있다）. 상기와같은재조합기술은당해 기술분야에 널리 공지되어 있다.
본 명세서에서 ’’항체"는 임의의 아이소타입의 온전한 면역글로불린, 또는 표적 항원에의 결합을 위해 완전한 항체와 경쟁을 할 수 있는 항원 결합 단편을 의미한다. 예를 들면, 키메라, 인간화, 완전 인간 또는 이중특이적 항체 또는 이들의 항원 결합 단편을 포함한다. 항체는 그 자체로 항원 결합 단백질의 일종이기도하다. 완전한항체는 일반적으로 적어도 2개의 전장중쇄와 2개의 전장 경쇄를포함하지만， 일부경우에 항체가단지 중쇄만을포함할수도있다.
항체 또는 이의 항원 결합단편은오직 단일 원（ 근）으로부터 유래될 수 있거나， 또는 키메라일 수 있다, 키메라 항체는 2 종류의 상이한 항체로부터 유래된 부분을포함하며， 아래 보다상세하게 기술된다. 항체 또는미의 항원 결합 단편은 하이브리도마， 재조합 · 기술 또는 온전한 항체의 효소적 또는 화학적 절단에 의해 생산될 수 있다. 다른 언급이 없다면, 본원에서 용어 항체는 2개의 전장 중쇄와 2개의 전장 경쇄를 포함하는 항체는 물론， 이들의 유도체, 변이체， 단편, 및돌연변이체를포함하고, 이들의 예는아래 기술된 바바와같다.
일 구현예에서， 항체는 모노클로날 항체, 이중특이적 항체， 미니바디， 도메인 항체， 항체 모방체 （또는 합성 항체）， 키메라 항체， 인간화 항체， 인간 항체 , 항체 융합체（또는 항체 접합체） , 및 이의 단편을 포함하나， 이에 국한되지 않으며 본원에 개시된 다양한 형태의 항체를 포함한다. 일 구현예에서， 본원에 2019/117684 1»（：1^1{2018/015953
Figure imgf000080_0001
단편 （ ）， 디아바디 또는 중쇄 가변영역과 경쇄 가변영역이 스페이서를 통해 연결된단일 쇄의 단쇄 항체 분자일수있다.
본원에서 "경쇄"는 항원 또는 에피토프에 대한 결합 특이성을 제공하기에 5 충분한가변영역 서열을 갖는 전장의 경쇄 및 이의 단편을 포함한다. 전장경쇄는 가변영역 도메인 1， 및 불변영역 도메인 比 을 포함한다. 경쇄의 가변영역 도메인은 경쇄 폴리펩타이드의 아미노 말단에 존재한다. 경쇄의 종류에는 카파 및 람다사슬이 포함된다.
본원에서 "중쇄”는 항원 또는 에피토프에 대한 결합 특이성을 제공하기에 10 충분한 가변영역 서열을 갖는 전장 중쇄 및 이의 단편을 포함한다. 전장 중쇄는 가변영역 도메인 쌔 및 3개의 불변영역 도메인 대1, 抑 2 및 抑 3을 포함한다. 도메인은 중쇄 폴리펩타이드의 아미노 말단에 존재하고， （ 도메인은 카복시 말단에 존재하며， 抑 3가 카복시 말단에 가장 가깝게 위치한다. 중쇄는 ^6 （1용아， 1^2, ^3 및 64서브타입 포함）， 1쇼 （1쇼1 및 1쇼2서브타입 포함）， ^ 및 15 £：의 아이소타입을포함한다.
본 명세서에 기재된 "항원 결합단편”은항원에 대한특이적 결합능을 갖는 항체의 일부 또는 이를 포함하는 폴리펩타이드를 의미한다. 예컨대 항원결합단편은 항원（예컨대， 에피토프）과 상호작용하여 항체에 항원에 대한 특이성 및/또는 친화성을 부여하는 아미노산 잔기를 포함하는 항체의 일부 또는 2019/117684 1»（：1^1{2018/015953 이를 포함하는 폴리펩타이드일 수 있다. 이러한 항원결합단편은 전형적으로, 하나 이상의 "상보성 결정 부위" (Complementary Determining Region, or CDR)을 포함할 수 있으며， 여기에 더하여， 하나 이상의 "프레임워크” 영역을 포함할 수 있다. CDR 은 항체의 항원 결합의 특이성과 친화성에 기여하는 아미노산 서열이고， 프레임워크 영역은 이들 CDR의 적절한형태 (conformat ion)를유지하는데 기여하는 아미노산서열부위로, 항원결합영역과항원사이에 결합을촉진할수있다.
본원에 사용된, 항체 또는 면역글로불린의 사슬 (중쇄 또는 경쇄)의 "항원 결합 단편”은 전장 사슬과 비교하여 일부 아미노산이 결여되었지만, 항원에 특이적으로 결합할 수 있는 항체의 일부를 포함하는 것이다. 이러한 단편은 표적 항원에 특이적으로 결합할수 있고, 또는 다른 항체 또는 항원 결합 단편과 특정 에피토프에 결합하기 위해 경쟁할수 있다는측면에서 생물학적으로 활성이 있다고 할 수 있다. 한 양태에서, 이러한 단편은 전장 경쇄 또는 중쇄 내에 존재하는 적어도 하나의 CDR을포함하고， 일부 구현예에서， 단쇄 중쇄 및/또는 경쇄， 또는 이의 일부를 포함한다. 이러한 생물학적 활성 단편은 재조합 DNA 기술에 의해 생산되거나， 또는 예를 들면 온전한 항체를 효소적 또는 화학적 절단하여 생산될 수 있다. 면역학적으로 기능적인 면역글로불린 단편에는 이로 제한하는 것은 아니나, Fab, Fab , F(ab' )2, Fv, 도메인 항체 및 단쇄 항체 (예컨대， scFv, scFv- Fc 등)를 포함한다. 또한 이로 제한하는 것은 아니나， 인간, 마우스， 랫트， 카멜리드또는토끼를포함하는 임의의 포유동물에서 유래될 수 있다. 본 명세서에 개시된하나이상의 CDR과같은항체의 기능적인부분은제 2의 단백질또는저분자 2019/117684 1»（：1^1{2018/015953 화합물과 공유결합으로 연결되어 특정 표적에 대한 표적 치료제로서 사용될 수 있다.
본원에서 '下此 단편”은 1개의 경쇄와 抑 1 및 가변영역만을 포함하는 1개
Figure imgf000082_0001
5 수없다.
본원에서 " " 영역은항체의 （¾2및（ 3도메인을포함하는중쇄 단편을두 분자 포함한다. 이들 2개의 중쇄 단편은 2개 이상의 디설파이드 결합 및 （¾3 도메인의 소수성 상호작용에 의해서로결합되어 있다.
Figure imgf000082_0002
사슬간다이설파이드결합이 형성되어， 1’）2분자를형성할수 있다.
본원에서 ’’ '）2 단편'은 앞서 기술한 바와 같이， 2개의 경쇄 및 가변영역， 抑1과 （ 1과 抑 2 도메인 사이에 불변영역의 일부를 포함하는 중쇄 2 분자를 포함하여 2분자의 중쇄 사이에서 사슬간 다이설파이드 결합이 형성된다.
Figure imgf000082_0003
이들간의 다이설파이드결합에 의해 서로회합되어 있다.
Figure imgf000082_0004
포함하지 않는항체이다. 본원에서 ”단쇄 항체”는 중쇄 및 경쇄 가변영역이 유연한 링커에 의해 20 연결된 항원 결합 영역의 단일 폴리펩타이드사슬이다. 예컨대， 상기 단쇄 항체는 2019/117684 1»（：1^1{2018/015953
Figure imgf000083_0001
선택된 1종 이상일 수 있다. 단쇄 항체는 예를 들면 미국 특허 제 5,260,203호를 참조할수있다.
5 본원에서 "2가의 항원 결합 단백질' 또는 "2가 항체’’는 2개의 항원 결합 부위를포함한다. 이러한 2가항체에 포함된 2개의 항원 결합부위는 동일한 항원 특이성을 갖거나， 또는 각각상이한항원에 결합하는 이중특이적 항체일 수 있다. 본원에서 "다중 특이적 항원 결합 단백질" 또는 "다중 특이적 항체"는 두 개 이상의 항원또는에피토프를표적으로하는것이다.
10 본원에서 "이특이적，” "이중 특이적" 항원 결합 단백질 또는 항체는 2개의 상이한 항원 결합 부위를 갖는 하이브리드 항원 결합 단백질 또는 항체이다. 이러한 이특이적 항체는 다중 특이적 항원 결합 단백질 또는 다중 특이적 항체의 일종으로, 공지된 다양한 방법 예를 들면 하이브리도마의 융합 또는 此 단편의 연결에 의해 생산될수있다.
15 본원에서 "이특이적，” "이중 특이적" 항원 결합 단백질 또는 항체는 2개의 상이한 항원 결합 부위를 갖는 하이브리드 항원 결합 단백질 또는 항체이다. 이러한 이특이적 항체는 다중 특이적 항원 결합 단백질 또는 다중 특이적 항체의 일종으로， 공지된 다양한 방법 예를 들면 하이브리도마의 융합 또는 此' 단편
Figure imgf000083_0002
2019/117684 1»（：1^1{2018/015953
Lachmann, Clin. Exp. Immunol . 1990, 79：315-321； Kostelny et al. J. Immunol . 1992, 148:1547-1553 등을 참조할 수 있다. 이특이적 항원 결합 단백질 또는 항체의 2개의 항원 결합 부위가 결합하는 2개의 서로 상이한 에피토프는 동일 또는 상이한 단백질 표적에 위치할 수 있다. 본원에 따른 일구현예에서 본원에 따른 5 항체는 혈관뇌장벽을 통과하여 전달되기 위해 전달체에 대한 결합을 추가로 포함하는 이중특이적 항체의 형태를 취할 수 있다. 혈관뇌장벽을 통하여 약물을 전달하기 위한 한 가지 방법은 세포에 내재된 글루코스 및 아미노산 전달체， 인슐린 또는 트랜스페린의 수용체 매개 트랜스사이토시스와 같은 전달 시스템의 사용을포함한다.
10 본원에서 ’’컨쥬게이트"는 본원에 개시된 항체 또는 그 항원결합단편과 다른 분자， 특히 후술하는 혈관뇌장벽 전달체 또는 치료제와의 키메라 분자를 일컫는 것이다.컨쥬게이트에서 본원에 따른 항체 또는 그 항원결합 단편은 다른 분자와 예를 들면 공유결합 또는 반데스발스 또는 소수성상호작용에 의한 물리적 힘， 캡슐화 매립화embedding) 또는 상기 조합을 포함하는 방법에 의해 물리적으로 15 결합된다.일 구현예에 따른 컨쥬게이트에서 본원에 따른 항체 또는 그 항원결합 단편은 펩타이드 링커를통해 연결될 수 있다.
본원은 또한 본원에 개시된 하나 이상의 아미노산 서열과 실질적인 서열 동일성을 갖는 하나 이상의 아미노산 서열을 포함한다.실질적 동일성이란 본원은 서열변이가 존재하는 본원에 개시된 효과를 유지하는 것을 의미한다. 일 20 구현예에서 개시된 중쇄 가변영역과 약 90%, 95%, 또는 99%동일성을 가진다.다른 2019/117684 1»（：1^1{2018/015953 구현예에서 개시된 경쇄 가변영역과 약 90%, 95%, 또는 99%동일성을가진다. 예를 들면 본원에 개시된 항체 또는 항원 결합단편의 서열과 90%, 95%, 또는 99% 동일성을나타내는 변이체의 경우， 임의의 변이는
Figure imgf000085_0001
보다는가변영역의 골격에서 발생된다.
5 본 발명에 따른 알파-시누클레인 또는 이의 응집체에 특이적으로 결합하는 항체 또는 그 항원 결합 단편은， 00^1, 00^2 및 00애3의 상보성 결정부위를 포함하는중쇄 가변영역 ; 및 001^1, 001^2및 0이 3의 상보성 결정부위를포함하는 경쇄 가변영역을포함할수 있다.
일 구체예에서， 상기 항- 알파-시누클레인 항체 또는 이의 항원결합단편은 10 서열을포함할수있다:
서열번호 1 및 서열번호 6의 아미노산 서열중에서 하나를 포함하는 중쇄
Figure imgf000085_0002
서열번호 2 내지 4 및 서열번호 7 내지 8의 아미노산 서열중에서 하나를 포함하는중쇄 0 2（玉 예2）,
서열번호 5 및 서열번호 9의 아미노산 서열중에서 하나를 중쇄 00묘3 -
0예3）,
서열번호 10 및 서열번호 13의 아미노산서열중에서 하나를 포함하는 경쇄 0예1（ 抑財），
서열번호 11 및 서열번호 14의 아미노산서열중에서 하나를 포함하는 경쇄 20 0 2（玉 예2）， 및 2019/117684 1»（：1^1{2018/015953 서열번호 12및 서열번호 15의 아미노산 서열중에서 하나를 포함하는 경쇄 ◦예30^： 3).
상기 중쇄 0에1 내지 0예3의 아미노산 서열과 경쇄 0 1 내지 0 3의 아미노산서열을표 1및 표 2에 정리하였다:
[표 1]중쇄 0예1내지 0 3의 아미노산서열
Figure imgf000086_0001
2019/117684 1»（：1/10公018/015953
Figure imgf000087_0001
［표 2］ 경쇄 0 1내지 0예3의 아미노산서열
Figure imgf000087_0002
2019/117684 1»（：1^1{2018/015953
Figure imgf000088_0001
일 구체예에서 상기 항- 알파시누클레인 항체 또는 이의 항원결합단편은， 서열번호 1의 아미노산서열을포함하는중쇄 0에1 0 1¾1）， 서열번호 2내지 4의 아미노산 서열중에서 하나를 포함하는 중쇄 0예2 01 에2）， 및 서열번호 5의 아미노산 서열을 포함하는 중쇄 0예3 어 예3）을 포함하는 중쇄 가변 영역; 및 서열번호 10의 아미노산 서열을 포함하는 경쇄 。대 （1게）1?1）， 서열번호 11의 아미노산서열을포함하는경쇄 0대?2 （!거：예2）， 및 서열번호 12의 아미노산서열을 포함하는경쇄 0 3（1거：에3）을포함하는경쇄 가변 영역을포함할수있다.
또한 상기 항 알파-시누클레인 항체 또는 이의 항원결합단편은， 서열번호 6의 아미노산서열을포함하는중쇄 001^1 （ 예1）， 서열번호 7내지 8의 아미노산 서열중에서 하나를 포함하는 중쇄 0예2 어 2） 및 서열번호 9의 아미노산 서열을 포함하는 중쇄 抑묘3 01 에3）을 포함하는 중쇄 가변 영역; 및 서열번호 13의 아미노산 서열을 포함하는 경쇄 00묘1 （1게«1）， 서열번호 14의 아미노산 서열을포함하는경쇄 0 2（1거： 2） 및 서열번호 15의 아미노산서열을포함하는 경쇄 0예3 0 ： 3）을포함하는경쇄 가변 영역을포함할수있다.
다른구체예에서 상기 항-알파시누클레인항체 또는이의 항원결합단편은， 1 볘1의 말단쪽에 위치하는 중쇄가변영역 프레임워크 어 ）로서 서열번호 16 내지 17 및 서열번호 35 내지 4◦의 아미노산 서열중에서 하나를 포함하는폴리펩타이드단편을포함， 2019/117684 1»（：1^1{2018/015953
Figure imgf000089_0001
서열번호 18 내지 19 및 서열번호 41 내지 44의 아미노산 서열중에서 하나를 포함하는폴리펩타이드단편을포함，
예2와 1 3 사이에 위치하는 중쇄가변영역 프레임워크 (1«¾3)로서， 5 서열번호 20 내지 31 및 서열번호 45 내지 50의 아미노산 서열중에서 하나를 포함하는폴리펩타이드단편을포함，
Figure imgf000089_0002
서열번호 32 내지 34 및 서열번호 51 내지 52의 아미노산 서열중에서 하나를 포함하는폴리펩타이드단편을포함
10 1거： 1의 말단쪽에 위치하는 중쇄가변영역 프레임워크 此 )로서， 서열번호 53 내지 58 및 서열번호 71 내지 77의 아미노산 서열중에서 하나를 포함하는폴리펩타이드단편을포함，
1^：예1과 1거： 2 사이에 위치하는 중쇄가변영역 프레임워크 (1 ¾2)로서， 서열번호 59 내지 61 및 서열번호 78 내지 81의 아미노산 서열중에서 하나를
15 포함하는폴리펩타이드단편을포함
1＞ 예2와 1 3 사이에 위치하는 중쇄가변영역 프레임워크 (1^¾3)로서， 서열번호 62 내지 67 및 서열번호 82 내지 88의 아미노산 서열중에서 하나를 포함하는폴리펩타이드단편을포함， 및/또는 2019/117684 1»（：1^1{2018/015953
［ 예3의 0 말단에 위치하는 중쇄가변영역 프레임워크 0^¾4）로서， 서열번호 68 내지 70 및 서열번호 89의 아미노산 서열중에서 하나를 포함하는 폴리펩타이드단편을포함하는것일수있다.
본 명세서에서 프레임워크로사용 가능한 아미노산서열로서 , 중쇄가변영역 프레임워크 서열을 표 3 및 표 4에, 경쇄가변영역 프레임워크 및 표 5 및 표 6에 예시하였다.
［표 3］ 중쇄 프레임워크 1내지 2의 아미노산서열
Figure imgf000090_0001
2019/117684 1»(：1/10公018/015953
Figure imgf000091_0001
［표 4］ 중쇄 프레임워크 3내지 4의 아미노산서열
Figure imgf000091_0002
2019/117684 1»(：1/10公018/015953
Figure imgf000092_0001
［표 5］ 경쇄프레임워크 1내지 2의 아미노산서열
Figure imgf000092_0002
2019/117684 1»(：1/10公018/015953
Figure imgf000093_0001
［표 6］ 경쇄 프레임워크 3내지 4의 아미노산서열
Figure imgf000093_0002
2019/117684 1»（：1^1{2018/015953
Figure imgf000094_0002
다른구체예에서， 상기 항-알파-시누클레인항체 또는이의 항원결합단편은， 서열번호 1 및 서열번호 6의 아미노산서열중에서 하나를포함하는 중쇄 0요1 어- 00^）, 서열번호 2 내지 4 및 서열번호 7 내지 8의 아미노산 서열중에서 하나를
Figure imgf000094_0001
하나를중쇄 0예3대 3）포함하는중쇄 가변 영역을포함할수 있으며，
상기 중쇄가변영역은 서열번호 16 내지 17 및 서열번호 35 내지 40의 아미노산서열중에서 하나를포함하는 중쇄가변영역 프레임워크 어 ）， 서열번호 20 내지 31 및 서열번호 45 내지 50의 아미노산 서열중에서 하나를 포함하는 중쇄가변영역 프레임워크 어 요2）， 서열번호 20내지 31및 서열번호 45내지 50의 아미노산 서열중에서 하나를 포함하는 중쇄가변영역 프레임워크 내 1?3）, 및 서열번호 32 내지 34 및 서열번호 51 내지 52의 아미노산 서열중에서 하나를 포함하는 중쇄가변영역 프레임워크 어 1?4）를 포함할 수 있다. 더욱 자세하게는， 상기 중쇄 가변 영역은서열번호 17의 아미노산서열을 포함하는 서열번호 2019/117684 1»（：1^1{2018/015953
18의 아미노산 서열을 포함하는 서열번호 29 내지 31의 아미노산 서열중에서 하나를 포함하는 묘 1?3， 및 서열번호 34의 아미노산 서열을 포함하는 }{斗묘4을포함할수있다.
또한， 상기 항- 알파-시누클레인 항체 또는 이의 항원결합단편은, 서열번호 10 및 서열번호 13의 아미노산 서열중에서 하나를 포함하는 경쇄 0볘1 （1^1供1）， 서열번호 11및 서열번호 14의 아미노산서열중에서 하나를포함하는경쇄 0 2 （I - 0예2）， 및 서열번호 12 및 서열번호 15의 아미노산 서열중에서 하나를 포함하는 경쇄 0예3 （I - 0예3）을포함하는경쇄 가변 영역을포함할수 있으며 ,
상기 경쇄가변영역은추가로서열번호 53내지 58및 서열번호 71내지 77의 아미노산서열중에서 하나를포함하는 경쇄가변영역 프레임워크
Figure imgf000095_0001
서열번호
59 내지 61 및 서열번호 78 내지 81의 아미노산 서열중에서 하나를 포함하는 경쇄가변영역 프레임워크 （1^2） , 서열번호 62내지 67및 서열번호 82내지 88의 아미노산 서열중에서 하나를 포함하는 경쇄가변영역 프레임워크 此 1?3）, 및 서열번호 68 내지 70 및 서열번호 89의 아미노산 서열중에서 하나를 포함하는 경쇄가변영역 프레임워크 此 1?4）를 포함할 수 있다. 더욱 자세하게는, 상기 경쇄 가변 영역은 서열번호 58의 아미노산 서열을 포함하는 1^ 1， 서열번호 59의 아미노산서열을포함하는 1^2 , 서열번호 67의 아미노산서열을포함하는 1 ¾3, 및서열번호 34의 아미노산을포함하는
Figure imgf000095_0002
포함할수 있다.
다만, 본발명에 따른항-알파-시누클레인 항체 또는이의 항원결합단편은， 서열번호 1， 2및 5의 아미노산서열로 이루어지는중쇄 0예1 - 0 3와서열번호 10, 2019/117684 1＞（그1'/표1¾2018/015953
11， 및 12의 아미노산서열로 이루어지는경쇄 0예1 - 0 3를포함하고， 서열번호 16, 18， 20 및 32의 아미노산서열로 이루어지는중쇄 FR1-FR4와서열번호 53, 59, 62
Figure imgf000096_0001
키메릭 항체 또는 이의 항원결합단편을 포함하지 않는다. 또한, 본 발명에 따른 항- 알파-시누클레인 항체 또는 이의 항원결합단편은， 서열번호 6， 7 및 9의 아미노산서열로 이루어지는중쇄 0예1 - 0예3와서열번호 13, 14, 및 15의 아미노산 서열로 이루어지는 경쇄 0에1 - 0 3를 포함하고, 서열번호 35, 41, 45 및 51의
Figure imgf000096_0002
아미노산서열로 이루어지는 경쇄 ?1시¾4와를 갖는마우스항체 또는 키메릭 항체 또는 이의 항원결합단편을포함하지 않는다. 구체적인 예로서, 서열번호 90의 중쇄 가변영역 서열（（±1 11 - \¾）과 서열번호 109의 경쇄 가변영역 서열 （（土1 11 - 1）을 포함하는 항체 또는 서열번호 102의 중쇄 가변영역 서열（此1내11 - ）과 서열번호 116의 경쇄 가변영역 서열 （此1내11 - 1）을포함하는（¾3쇼9 항체는 본 발명에 따른 항알파-시누클레인항체에 포함되지 않는다. 본 발명의 구체적인 일예에 따른 항- 알파-시누클레인 항체 또는 이의 항원결합단편은, 서열번호 1의 아미노산 서열을 포함하는 중쇄 00111 （^00^）,
Figure imgf000096_0003
및 서열번호 5의 아미노산 서열을 포함하는 중쇄 0에3 어 에3）을 포함하는 중쇄 가변 영역; 및 서열번호 10의 아미노산 서열을 포함하는 경쇄 2019/117684 1»（：1^1{2018/015953 서열번호 11의 아미노산 서열을 포함하는 경쇄 0예2 （1 ：에2） , 및 서열번호 12의 아미노산 서열을 포함하는 경쇄 0^3 （ 에3）을 포함하는 경쇄 가변 영역을 포함할수있으며 ,
상기 중쇄가변영역은 서열번호 16 내지 17의 아미노산 서열중에서 하나를 포함하는 중쇄가변영역 프레임워크 어 ）, 서열번호 18 내지 19의 아미노산 서열중에서 하나를 포함하는 중쇄가변영역 프레임워크 어 묘2）, 서열번호 20 내지 31의 아미노산서열중에서 하나를 포함하는 중쇄가변영역 프레임워크 어 요3）， 및 서열번호 32 내지 34의 아미노산 서열중에서 하나를 포함하는 중쇄가변영역 프레임워크어 1?4）를포함하고，
상기 경쇄가변영역은 서열번호 53 내지 58의 아미노산 서열중에서 하나를 포함하는 경쇄가변영역 프레임워크 （ ）, 서열번호 59 내지 61의 아미노산 서열중에서 하나를 포함하는 경쇄가변영역 프레임워크
Figure imgf000097_0001
서열번호 62 내지
67의 아미노산서열중에서 하나를 포함하는 경쇄가변영역 프레임워크 （1^3）, 및 서열번호 68 내지 70의 아미노산 서열중에서 하나를 포함하는 경쇄가변영역 프레임워크（1 ¾4）를포함할수있다.
바람직하게는， 본 발명의 구체적인 일예에 따른 항- 알파-시누클레인 항체 또는 이의 항원결합단편은 서열번호 1， 서열번호 2 및 서열번호 5의 아미노산 서열을포함하는 중쇄 001^1 내지 0대?3을포함하는 중쇄 가변영역과， 서열번호 10, 서열번호 11 및 서열번호 12의 아미노산 서열을 포함하는 경쇄 0에1 내지 0예3을 포함하는 경쇄 가변영역을 포함하며， 상기 중쇄 가변 영역은 서열번호 17의 2019/117684 1»（：1^1{2018/015953
Figure imgf000098_0001
서열번호 29 내지 31의 아미노산서열중에서 하나를 포함하는묘寸묘3， 및 서열번호
Figure imgf000098_0002
서열번호 58의 아미노산서열을 포함하는 1^¾1， 서열번호 59의 아미노산 서열을 포함하는 1^2, 서열번호 67의 아미노산서열을포함하는 1 ¾3, 및서열번호 34의 아미노산서열을포함하는느 요4을포함할수있다.
본 발명의 구체적인 일예에 따른 항- 알파-시누클레인 항체 또는 이의 항원결합단편은， 서열번호 6의 아미노산 서열을 포함하는 중쇄 0 1 어 대산）, 서열번호 7 내지 8의 아미노산 서열중에서 하나를 포함하는 중쇄 ◦ 요 01 0요2）， 및 서열번호 9의 아미노산 서열을 포함하는 중쇄 0예3 어 에3）을 포함하는 중쇄 가변 영역; 및 서열번호 13의 아미노산 서열을 포함하는 경쇄 0예1 （1게¾1）, 서열번호 14의 아미노산 서열을 포함하는 경쇄 0에2 （1^1¾2）， 및 서열번호 15의 아미노산 서열을 포함하는 경쇄 。대 （1 3）을 포함하는 경쇄 가변 영역을 포함할수있으며 ,
상기 중쇄가변영역은 서열번호 35 내지 40의 아미노산 서열중에서 하나를
Figure imgf000098_0003
서열중에서 하나를 포함하는 중쇄가변영역 프레임워크 어 묘2）, 서열번호 45 내지 50의 아미노산서열중에서 하나를 포함하는 중쇄가변영역 프레임워크 대 1?3）, 및 서열번호 51 내지 53의 아미노산 서열중에서 하나를 포함하는 중쇄가변영역
Figure imgf000098_0004
2019/117684 1»（：1^1{2018/015953 상기 경쇄가변영역은 서열번호 71 내지 77의 아미노산 서열중에서 하나를 포함하는 경쇄가변영역 프레임워크 (L-FR1), 서열번호 78 내지 81의 아미노산 서열중에서 하나를 포함하는 경쇄가변영역 프레임워크 L-FR2) , 서열번호 82 내지 88의 아미노산 서열중에서 하나를 포함하는 경쇄가변영역 프레임워크 (L-FR3), 및 5 서열번호 89의 아미노산 서열을 포함하는 경쇄가변영역 프레임워크 (L-FR4)를 포함할수 있다.
전장의 경쇄 및 중쇄에서, 가변영역 및불변영역은약 12개 이상의 아미노산 길이인 "J" 영역에 의해 결합되고, 중쇄는 또한 약 10개 이상의 아미노산의 "D” 영역을포함한다. 예를들면， Fundamental Immunology, 2nd ed. , Ch. 7 (Paul , ff. , 10 ed. ) 1989, New York： Raven Press 를 참조할 수 있다. 전형적으로 항체의 경쇄/중쇄 쌍의 가변영역이 항원 결합부위를형성한다.
면역글로불린 사슬의 가변영역은 일반적으로 전체적 구조가 동일하며， ”상보적 결정부위 또는 영역 또는 도메인’’ 또는 CDR 로 지칭되는 3 개의 초가변영역에 의해 이어지는 비교적 보존된 프레임워크 영역 (FR)을 포함한다. 15 중쇄/경쇄 쌍을구성하는각사슬유래의 가변영역의 CDR은전형적으로프레임워크 영역에 의해 정렬되어 표적 단백질 (알파-시누클레인)의 특정 에피토프와 특이적으로결합하는구조를 형성한다. 자연 발생 경쇄 및 중쇄 가변영역의 이러한 요소는 N-말단으로부터 C-말단까지 전형적으로 다음 순서로 포함된다: FR1, CDR1, FR2, CDR2, FR3, CDR3 및 FR4. 가변영역에서 이들 각각에 해당하는 아미노산 20 서열의 위치는 Rabat 넘버링 시스템 (Kabat Sequences of Proteins of 2019/117684 1»（：1^1{2018/015953
Immunologi cal Interest (1987 and 1991， NIH, Bethesda, MD) , 또는 Chothi a & Lesk, 1987, J . Mol . Biol . 196:901-917; Chothi a et al . , 1989, Nature
342: 878-883에 기재된 것을따른다. 본 명세서에 개시된 다양한 중쇄 및 경쇄 가변영역은 표 7 및 표 8에 개시된다. 이러한 각각의 가변영역은 온전한 항체의 각각의 중쇄 및 경쇄를 형성하기 위해 상기 중쇄 및 경쇄 불변영역에 결합될 수 있다. 또한, 이렇게 생성된 각각의 중쇄 및 경쇄 서열은 또한 완전한 항체 구조를 형성하기 위해 조합될 수 있다. 예를 들면， 본 발명에 따른항- 알파-시누클레인 항체 또는 이의 항원결합단편은， 서열번호 90 내지 101 또는 서열번호 102 내지 108의 아미노산 서열중에서 하나의 중쇄 가변 영역과， 서열번호 109 내지 115 또는 서열번호 116 내지 123의 아미노산 서열중에서 하나의 경쇄 가변 영역을 포함하며， 더욱 자세하게는서열번호 90내지 101의 아미노산서열중에서 하나의 중쇄 가변 영역과 서열번호 109 내지 115의 아미노산 서열중에서 하나의 경쇄 가변 영역을 포함하거나， 서열번호 102 내지 108의 아미노산 서열중에서 하나의 중쇄 가변 영역과 서열번호 116 내지 123의 아미노산 서열중에서 하나의 경쇄 가변 영역을 포함할수있다. 본 발명의 구체적인 일예에서, 항- 알파-시누클레인 항체 또는 이의 항원결합단편은 서열번호 98 내지 101의 아미노산 서열중에서 하나의 중쇄 가변영역과， 서열번호 115의 아미노산 서열의 경쇄 가변영역을 포함할 수 2019/117684 1»(：1^1{2018/015953 있거나（예， 1孔1111 711_（ 61· .1）， ¾111711_（ 61 .2）， ¾111711_（¥라 .3） , ¾111711_（¥ .4） , 등） 또는 서열번호 92의 아미노산 서열을 갖는 중쇄 가변영역과 서열번호 113의 아미노산 서열을 갖는 경쇄 가변영역을 포함할 수 있다（예, 如11?11_（새12-4） 항체）. 다만, 상기 항- 알파-시누클레인 항체 또는 이의 항원결합단편은， 서열번호
90의 중쇄 가변영역 및 서열번호 109의 경쇄가변영역으로 이루어지는 것 및 서열번호 102의 중쇄 가변영역 및 서열번호 116의 경쇄가변영역으로 이루어지는 것은제외된다. 일 구현예에 따른 항체 또는 항원 결합 단편의 중쇄 가변영역 및 경쇄 가변영역의 아미노산서열을표 7및 표 8에 예시하였다.
[표 7] 중쇄 가변영역
Figure imgf000101_0001
Figure imgf000102_0001
2019/117684 1»（：1/10公018/015953
[표 8] 경쇄 가변영역
Figure imgf000103_0001
2019/117684 1»(：1/10公018/015953
Figure imgf000104_0001
또한， 일 구현예에 따른 항체 또는 항원 결합 단편의 중쇄 가변영역 및 경쇄 가변영역의 조합과불변영역욜포함하는， 예시적인 항체를표 9에 기재하였다.
[표 9]
Figure imgf000104_0002
Figure imgf000105_0001
2019/117684 1»(：1^1{2018/015953
Figure imgf000106_0002
본 명세서에 개시된 중쇄 가변영역 및 경쇄 가변영역은온전한항체의 중쇄 및 경쇄를 형성하기 위하여 , 각각 중쇄 불변영역 및 경쇄 불변영역에 결합될 수 있다. 이와 같이 생성된 각각의 중쇄 및 경쇄는 적절하게 짝지워져 중쇄-경쇄 조합을 이룰 수 있고， 상기 중쇄-경쇄 조합은 다합체를 형성 （예컨대，
Figure imgf000106_0001
타입 항체의 경우이합체를형성）하여 온전한항체 구조를이룰수 있다.
상기 불변영역은 면역글로불린 （예컨대， 인간 면역글로불린）의 중쇄 불변영역 및 경쇄 불변영역에서 적절히 선택될 수 있다. 예컨대， 중쇄 2019/117684 1»（：1^1{2018/015953
불변영역은 1成1중쇄 불변영역, 1成3 중쇄 불변영역， 또는 1成4중쇄 불변영역일 수 있고， 경쇄 불변영역은 카파불변영역 또는 람다 경쇄 불변영역일 수 있으나， 이에 제한되는 것은 아니고， 항체 안정성, 제조 가능성, 항원 친화성, 및/또는 기타 목적하는 특징 등을 위하여 다른 유형의 불변영역 또는 변형된 불변영역을 5 적절하게 선택하여 사용할 수 있으며, 이는 당업자가 명확하게 알 수 있는 사항이다. 다른 구현예에서 상기 표 7 및 표 8에 개시된 중쇄 가변영역 및 경쇄 각 가변영역은 서로 자유롭게 조합되어 다양한 항체를 형성할 수 있고, 단일사슬
Figure imgf000107_0001
10 본명세서에 개시된항체는본명세서에 개시된다른항체와특정 영역 또는 서열을 공유한다. 일 구현예에서는 항체 또는 항원결합단편의 불변영역을 공유할 수있다. 다른구현예에서는 영역을공유할수 있다. 일 예에서, 본 명세서에서 제공되는 항-알파-시누클레인 항체는 모노클로날 항체 또는 폴리클로날 항체일 수 있다. 다른 예에서， 상기 항-알파-시누클레인 15 항체는 인간 항체， 인간화 항체， 키메라 항체， 또는 동물유래 항체일 수 있다. 다른 예에서， 상기 항-알파-시누클레인 항체는 재조합적 또는 화학적으로 합성된 것일수있다. 일 구현예에서, 본 명세서에 개시된 항체의 항원결합단편 또는항체 단편은
Figure imgf000107_0002
20 단쇄 항체분자들로이루어진군에서 선택된 1종이상일수있다. 2019/117684 1»（：1^1{2018/015953 다른 구현예에서， 본원에 제공된 항체는 인간 항체 또는 인간화 항체이고 다양한 이소타입 （예를 들면， 1^1, 1成2， 103, 1804, 民 또는 1요1））일 수 있으며， 특히 1成1-， 1^2- 1與3_또는 1成4-유형， 예컨대， 1成1_또는 1^2- 유형일 수 있다.
5 또 다른 구현예에서 항-알파-시누클레인 항체는 상기 기재된 경쇄 또는 ᅳ 중쇄만으로 이루어진 것일 수 있다.다른 구현예에서， 항-알파-시누클레인 항체는 경쇄 가변영역 또는중쇄 가변영역만으로 이루어진 것일 수 있다.
Figure imgf000108_0001
사용되지 않으며， 예를 들면 항체는 일반적으로 두 개의 00^2 영역을 포함하여 제조되지 않는 다는 것을 당업자라면 알 것이다. 일 구현예에서 상기 항체는 모노클로날 항체 또는 다클론항체일 수 있다.
15 본 명세서에 개시된 항체는 알파-시누클레인에 결합하는 모노클로날 항체를 포함한다.모노클로날 항체는 당해 기술 분야에 공지된 임의의 기술을 사용하여 제조될 수 있다. 예를 들면， 면역화된 형질전환 동물로부터 수확된 비장 세포를 불멸화시킴으로써 생산될 수 있다.하이브리도마 세포주에 의해 분비된 모노클로날 항체는 당해 기술분야에 공지된 기술을사용하여 정제할수 있다. 2019/117684 1»（：1^1{2018/015953
다른 구체예에서， 상기 항체는 동물유래 항체 （예컨대, 마우스 항체 등）， 키메릭 항체 （예컨대， 마우스-인간 키메릭 항체） , 인간화 항체 , 또는인간항체일 수 있다. 항체는 또한 다양한 목적을 위해 다양한 방식으로 변형될 수 있다. 키메라및 인간화항체가또한제공된다. 키메라항체는상이한항체로부터 유래된 폴리펩타이드 단편들이 공유결합으로 연결되어 면역학적으로 기능적인 경쇄， 중쇄 또는그단편을형성하는항체이다. 이러한 모노클로날 항체에서， 전형적으로 항체의 비-항원 인식 부분을 구성하는 특정 아미노산 잔기가 인간 항체의 상응하는 아이소타입의 상응하는 잔기와 상동성이 되도록 변형된다. 인간화는, 예를 들면， 공지된 다양한 방법을 이용하여， 설치류 가변영역의 적어도 일부를 인간 항체의 상응하는 영역으로 치환함으로써 수행될 수 있다（미국 특허 제 5 ,585 ,089호 및 제 5 ,693, 762호; Jones et al .， 1986, Nature 321:522-525； Ri echmann et al . , 1988, Nature 332 : 323-27； Verhoeyen et al . , 1988, Science 239 : 1534-1536） . 완전 인간항체는내인성 면역글로불린 생성이 결핍되어 인간항체를생성할 수 있는 형질전환 동물（통상적으로， 마우스）을 면역화시킴으로써 생성될 수 있다. 완전 인간항체는또한파지-디스플레이 ·라이브러리（phage-di spl ay l ibrary）로부터 유래될 수 있다. 완전 인간 항체를 사용하면, 마우스 또는 마우스-유래된 mAb 를 인간에 투여함으로써 유발될 수 있는 면역원성 반응 및 알레르기 반응을 최소화할 수있다. 일 구현예에서, 본원의 인간 알파-시누클레인 항체는 파지 디스플레이 방법을 통해 선별된다. 파아지 스크리닝을 통해 선별한 알파-시누클레인 특이적인 2019/117684 1»（：1^1{2018/015953 단일클론 파이지 항체를 전체 IgG (full IgG) 형태로 변환하기 위해 재조합 방법을 이용하였다.항-알파-시누클레인 항체의 재조합 제조을 위해 각 단일클론 파아지 항체의 서열을 확보한다. 확보한 서열에서 중쇄 가변영역 서열은 중쇄 불변영역서열에， 경쇄 가변영역 서열은 경쇄 불변영역 서열에 이식한 후 5 코돈최적화 (codon optimization) 방법을 통해 아미노산 서열을 핵산 서열로 변경한다.확보한 핵산 서열을 동물 세포 배양용 벡터에 클로닝 한 후, CH0세포 등의 단백질 생산용 숙주 세포에 상기 벡터를 이용해 형질전환 하여,배양한다. 상기 배양액에 포함된 항체를 정제하기 위해 친화도 크로마토그래피등의 정제 기술을 이용하여 재조합항체를분리 정제한다.
10 다른 구체예에서， 상기 항체는 자연에서 발견되는 항체의 전형적인 구조를 갖거나 변형된 구조를 갖는항체일 수 있다.
상기 전형적인 구조를 갖는 항체는 서로 다른 두 개의 폴리펩타이드 사슬 (즉， 중쇄 및 경쇄)을 포함하는 구조적 단위체를 포함하는 다합체 구조를 가질 수 있다. 상기 서로 다른 두 개의 폴리펩타이드 사슬은 전장 경쇄 (약 25kDa) 및 15 전장 중쇄 (약 50 내지 70kDa)를 포함할 수 있다. 각 사슬은， 특징적인 접힘 패턴을 나타내며,약 90내지 110개 아미노산으로 이루어진， 수 개의 면역글로불린 도메인으로 구성되어 있다.이러한 도메인은 항체 폴리펩타이드를 구성하고 있는 기본 단위체이다. 각 사슬의 아미노-말단 부분은 전형적으로 항원을 인식하는 부분인 가변영역 또는 V영역으로 지칭되는 부분을 포함한다.카복시-말단 부분은 20 아미노-말단 보다 진화적으로 보다 보존되었으며 불변영역 또는 C 영역으로 지칭되는 부분을 포함한다. 인간 경쇄는 일반적으로 카파(K) 및 람다(X) 2019/117684 1»（：1^1{2018/015953 경쇄로서 분류되고， 이들각각은하나의 가변영역 및 하나의 불변영역을포함한다 . 중쇄는 일반적으로뮤 (나)， 델타 (5)， 감마 (Y), 알파 (a)또는 엡실론 (£ ) 쇄로서 분류되고， 이들은각각 IgM, IgD, IgG, IgA및 IgE이소타입으로정의된다. IgG는 IgGl, IgG2, IgG3 및 IgG4를 포함하나， 이에 제한되지 않는 다수의 서브타입을 갖는다. 중쇄 불변영역은 전형적으로 효과기 기능을 나타내는 하나 이상의 도메인을 포함한다. 중쇄 불변영역 도메인의 수는 이소타입에 따라 달라진다. IgG 중쇄는， 예를 들면， 각각 CHI, CH2 및 CH3으로 공지된 3개의 C 영역 도메인을 포함한다. 본 명세서에 개시된 항체는 이러한 이소타입 및 서브타입 중의 임의의 하나일 수 있다. 일 구현예에서,상기 항-알파-시누클레인 항체는 IgG이소타입， 예컨대， IgGl, IgG2또는 IgG4서브타입일수있다. 본발명에 따르면， 용어 "시누클레인병”은병리학적 시뉴클레인응집체를특 징으로 하는 모든 신경퇴행성 장애를 포함한다. 파킨슨병, 파킨슨질환성 치매 (Parkinson's disease dementia, PDD) , 루이소체 치매 (dementia with Lewy bodies , DLB),루이소체병,루이소체를동반한치매， 치매를동반한파킨슨증후군, 다계통 위축증 (multiple system atrophy, MSA) , 다발성 신경계 위축 및 뇌 철 침착동반 한신경변성 I형 (NBIA Type I )을포함하는 몇 가지 신경퇴행성 장애는 시누클레인 병으로서 집합적으로 그룹화된다. 또한， 알파-시누클레인 응집은 이차적으로 알츠 하이머 질환에서도 발견된다 (Kim et al . Alzheimer’s Research & Therapy 2014， 6:73).
시누클레인병은공통적인 병리학적 특성을공유하는신경퇴행성 장애의 다양 2019/117684 1»（：1^1{2018/015953 한그룹이다: 신경병리적 실험에서, 특유의 병변은뉴런 (neuron) 및 희소돌기신경 교 (ol igodendrocyte)의 선택된 집단 내에서 알파-시누클레인 단백질의 비정상적 응집을포함하며 감지될 수 있다. 알파-시누클레인 (처음에 PARK1 및 PARK4로판명 됨)은신피질, 해마， 치상회， 후신경구， 선조체, 시상및 소뇌에서 광범위하게 발 현되는 140개 아미노산의 단백질이다. 알파-시누클레인은또한 B-, T-, 및■세포 를비롯하여 단백구및 혈소판을포함하는조혈세포에서 높게 발현된다. 이러한세 포 내에서의 정확한 역할은 알려지지 않았으나， 거핵구 (혈소판 전구체)의 분화와 관련이 있었다.
본원에 따른알파-시누클레인응집체를높은친화도로특이적으로 인식하며， 알파-시누클레인 항체가 이러한 질환의 진단， 또는 검출에 유용하게 사용될 수 있 음을나타낸다. 나아가본원에 따른 알파-시누클레인응집체를특이적으로 인식하는 알파-시누클레인 항체는 알파-시누클레인 응집체의 형성을 억제하거나또는응집체 를 분해하고, 세포간응집체의 전달을 억제하여， 시누클레인병， 특히 파킨슨 병의 치료에 효과적으로사용될수있음을나타낸다.
본원에서 ’’알파-시누클레인 응집체와 관련된 질환’’은 시누클레인병 라고 불 리는 일군의 신경퇴행성 질환으로, 뉴런 및 교세포 (gl i a) 집단을포함하는 병소에 서 알파-시누클레인 응집체가 발견되며， 도파민성 시스템의 퇴화, 운동능력변화， 인지장애 및 루이소체 및/또는 루이 뉴라이트의 형성과 같은 특징을 가진다 (Kim et al . Alzheimer’s Research & Therapy 2014, 6 :73; McKei th et al . , Neurology (1996) 47: 1113-24) . 이러한 질환에는파킨슨 질환，파킨슨질환성 치매，루이소체 치 2019/117684 1»(：1^1{2018/015953 매 알츠하이머 루이소체 질환 복합성 알츠하이머 및 파킨슨 병 다계통위축증 및 기타 다수의 신경축삭 질환을 포함하나 이로 제한하는 것은 아니다.일 구현예에서 본원에 따른항체는 파킨슨 병의 치료에 효과적으로사용된다.
본 발명에 따른 이중 특이 항체의 일예는 하기와 같다.
Figure imgf000113_0001
Figure imgf000114_0001
Figure imgf000115_0001
Figure imgf000116_0001
Figure imgf000117_0001
Figure imgf000118_0001
2019/117684 1»(：1/10公018/015953
Figure imgf000119_0001
상기 표에 기재된서열 1내지 81에 해당하는아미노산서열을하기 표에 표 시한다.
Figure imgf000119_0002
Figure imgf000120_0001
Figure imgf000121_0001
Figure imgf000122_0001
Figure imgf000123_0001
Figure imgf000124_0001
Figure imgf000125_0001
Figure imgf000126_0001
Figure imgf000127_0001
Figure imgf000128_0001
Figure imgf000129_0001
Figure imgf000130_0001
Figure imgf000131_0001
Figure imgf000132_0001
Figure imgf000133_0001
Figure imgf000134_0001
Figure imgf000135_0001
Figure imgf000136_0001
Figure imgf000137_0001
Figure imgf000138_0001
Figure imgf000139_0001
Figure imgf000140_0001
Figure imgf000141_0001
Figure imgf000142_0001
Figure imgf000143_0001
Figure imgf000144_0001
Figure imgf000145_0001
Figure imgf000146_0001
Figure imgf000147_0001
Figure imgf000148_0001
Figure imgf000149_0001
2019/117684 1»(：1/10公018/015953
Figure imgf000150_0001
【발명의 효과】
본 발명의 일예에서 제조된 항체는 IGF1R에 brain endothel i al의 transcytosi s에 최적화된 결합력으로 IGF1R특이적으로 결합하며， 낮은 혈관뇌장벽 통과능으로 치료 효능이 제한적이었던 퇴행성 뇌질환 및 뇌암 치료항체의 전달에 유용하게 사용될수 있다. 특히 본발명에 개시된 단일클론항체는 리간드인 IGF-1, IGF-2및 그 homolog인 insul in이 IGF1R에 결합하는 것에는 영향을미치지 않으며， IGF1R 수용체를 통한 신호전달을 억제하지 않는 등의 효과를 나타내므로， 혈관뇌장벽 통과와관련하여 유용성을지닌다.
본원에 개시된 항체는 알파-시누클레인 응집체를 효과적으로 제거하거나 분해를 촉할 수 있고， 알파-시누클레인의 세포간 전달을 억제할 수 있어， 알파- 시누클레인의 응집체 축적과관련된 질환의 치료에 유용하게사용될수있다. 【도면의 간단한설명】
도 1은 본 발명의 일예에서 제조된 a-syn 항체가 응집된 형태의 nat ive 2019/117684 1»（그1^1{2018/015953 알파-시누클레인을특이적으로인식하는지 여부를측정한닷블롯결과를나타낸다. 도 2는 본 발명의 일예에서 제조된 3-5711항체의 친화도를 £11쇼로 측정한 결과이다.
도 33는본발명의 일예에서 제조된 -571항체가알파-시누클레인 응집체에 대한 선호적 결합 특이성 및 친화도를 이쇼 ） 로 분석한 결과이다. 도 는 도 3크의 결과를표로나타낸것이다. _ 도 43는본발명의 일예에서 제조된 3-57 항체가알파-시누클레인응집체에 선호적 결합 특이성을 0 으로 분석한 결과이다. 도 41）는 도 4의 결과를 표로 나타낸것이다.
도 5 및 도加는 각각본 발명의 일예에 따른 - 7 항체 3쇼9 및 1내11가 인간 뇌조직에서 루이소체 （［ 1 0（¾0 및 루이 신경돌기 （느 7 바 근크）를 특이적으로 인식할 수 있는 지를 각각 즉정한 결과이다. 본원에 따른 항체가 루이소체（화살표） 및 루이 신경돌기（왼쪽 아래 실 같은 모양）에 결합하는 것을 나타낸다.
도 6은 본 발명의 일예에 따른 -8711 항체의 에피토프 맵핑 결과를 도식적으로 나타낸 것으로， 본원에 따른 항체들은 대부분 0말단부위에 결합하는 것으로나타났다.
도 7은 본 발명의 일예에서 제조된 크-3＞ 키메릭 항체와 인간화 11凡1 항체의 친화도를此比쇼로측정한결과이다.
도 8는 본 발명의 일예에서 제조된 3- 711 키메릭 항체와 인간화 1 11 2019/117684 1»（：1^1{2018/015953 항체가알파-시누클레인 응집체에 대한선호적 결합특이성 및 친화도를 BIAcore로 분석한결과이다.
도 9a， 9b 및 10은본 발명의 일예에서 제조된 a-syn 키메릭 항체가 베타- 시누클레인， 감마-시누클레인, 혹은 아밀로이드 베타 (amyloid betal-42) , 타우 5 (tau) 유래 응집체가 아닌 알파-시누클레인, 특히 알파-시누클레인 응집체에 특이적으로결합하는특이성을 ELISA및 닷블롯으로분석한결과이다.
도 11a 내지 도 llg는 항- IGF1R 항체의 IGF1R 단백질에 대한 결합 데이터이다.
도 12는항- IGF1R항체의 IGF1R발현세포주들에 대한결합데이터이다.
10 도 13은항- IGF1R항체의 IGF1R발현세포주들로의 internalization및 cell 안에서의 fate관련 데이터이다
도 14는항- IGF1R항체가 IGF1혹은 insulin에 의한 IGF1R signal ing에 영향 을주지 않는다는데이터이다.
도 15는 항- IGF1R항체가 가 없으며 , 반복 투여 이후에도 뇌 내 IGF1R 15 레벨에 변화를주지 않는다는데이터이다.
도 16은항- IGF1R항체와치료항체의 이중특이항체가 in vitro BBB시스템 에서 치료항체로만구성된단독항체보다 BBB를더 잘통과한다는데이터이다.
도 17은항- IGF1R항체와치료 항체의 이중특이항체 및 항- IGF1R항체가 in vivo BBB를치료항체로만구성된단독항체 대비 더 잘통과한다는데이터이다.
20 도 18은 항- IGF1R항체와 치료항체로 구성된 이중특이항체의 우수한 개발용 2019/117684 1»（：1^1{2018/015953 이성（＜16 61（ 크 1 을보여주는데이터이다.
도 19는항- 항체의 에피토프맵핑 결과이다.
도 2 및 도 2아3는본원와일예에서 제조된 이중특이항체의 각항원에 대한 결합력을측정하기 위해 比요를수행한결과이다.
5 도 2 는키메릭 항체와인간화한항체의 각항원에 대한결합력을비교하기 위해 ^五比쇼를수행한결과이다.
도 20（1는 본원의 일예에서 제조된 이중특이항체에 대하여 1 ＜：10용1 의 식세포작용에 대한활성을평가한결과이다.
도 213내지 2 는본원의 일예에서 제조된 이중특이항체에 대하여 단독항체 10 대비 마우스동물모델에서의 효능을평가한결과이다.
Figure imgf000153_0001
수행하여 반감기 증대 및 666통과향상을확인한결과이다.
【발명을실시하기 위한구체적인내용】
15
실시예 1.마우스 알파-시누클레인 항체의 제조
1-1: 면역화 및 하이브리도마 생산
항원으로는전장（140잔기）또는（：_말단 21개 잔기가절단된 알파-시누클레 인 단량체를 37도 1±611110111 0에 넣고 14일 동안 1050대미으로른들어 응집화시 20 켰으며 소니케이션 하여 사용하였다. 상기 제조된 1 1收/ 농도의 140개 및 119개 2019/117684 1»（：1^1{2018/015953 잔기의 알파-시누클레인 피브릴 각각을 아주번트와 l：Kvol : vol )로 혼합하여 잘 섞어 주었다.
Homo sapiens alpha-synuclein의 Amino acid sequence (SEQ ID NO : 126)
MDVFMKGLSKAKEGWAAAEKTKQGVAEMGKTKEGVLYVGSKTKEGWHGVATVAEKTKEQVTNVGGAW TGVTAVAQKTVEGAGS I AAATGFVKKDQLGKNEEGAPQEG I LEDMPVDPDNEAYEMPSEEGYQDYEPEA
이어， 상기 준비한혼합물 200 u L를 5~7주령 BALB/c 암컷 마우스의 피하에 주사하였고, 2주후에 동일한방법으로 제조한혼합물 200 y L를 추가로 피하주사 하여 부스팅시켰다. 부스팅 1주일 후에 혈액을채취하여 투여항원을붙인 ELISA방 법을사용하여 면역화 적정 ( immuni zat ion t i terat ion)을 수행하였다. 이어 3차부 스팅은항원만을괴하주사하였다.
이어 상기와같이 면역이 완료된 마우스의 비장을 제거하여, 이로부터 세포 를 화보하였다 . 이어 비장 세포를 10% FBS가 첨가된 Hybr i doma-SFM 배지 (Thermo Fi sher Scient i f i c , USA)에 현탁시켰다. 하이브리도마를 제조하기 위해 뮤린 골수 종 세포인 SP2八)- AgM와 비장세포를 혈청이 포함되지 않은 Hybr i doma-SFM배지에 서 혼합한후원심분리를하여 배지를 제거하였다. 이어 세포 펠렛에 PEG를 첨가한 후 37°C에서 1분간배양하여 세포융합을유도하였다.
1-2： 단세포클로닝 및 항체 정제
융합 2주 후에， 세포 배양 배지를 이용하여 마우스에 투여한 항원을 붙인 ELISA방법을사용하여 항체를 생산하는마우스 B세포와의 융합을확인하였다. 이 2019/117684 1»（：1^1{2018/015953 어 하이브리도마를 이용하여 단세포 클로닝을 수행하여 단클론항체를 생산하는 하 이브리도마를총 16개 선별하였다. 전장（140잔기） 알파-시누클레인 응집체를항원 으로 이용하여 9B11 （각각 IgGl kappa） 클론을수득하였고， C-말단 21개 잔기가절 단된 알파-시누클레인 응집체를항원으로 이용하여 3A9및 11F11 （각각 IgG2b kappa, 5 IgG2b kappa）의 클론을수득하였다.
상기 항체의 정제를위해서， 10% FBS가포함된 RPMI1640배지에서 각하이브 리도마를배양하다항체 생산을위해 serum이 없는 SFM배지로 배양배지를교체한 후 4일 정도배양한다. 세포배양상층액을분리하여 원심분리한후 0.22 um필터 로 거른후 IgGl타입은 protein G column으로 나머지 항체들은 protein A column 10 으로정제하였다.
1-3： 가변영역 서열 결정
가변영역 및 CDR서열은 Ahn et al , Mol . Cel ls 2004, 18（2）:237-241논문을 참조하여 결정하였다. 하이브리도마를 배양한 후 원심분리하여 세포만을 분리하였 15 다. 분리된 하이브리도마에 트라이졸을 넣어 RNA를 분리하였으며 이를 템플릿으로 하여 cDNA를합성한후 염기서열 분석을통해 가변영역 및 CDR서열을확인하였다. 따라서， 항체 3A9, 9B11, 11F11을얻었다. 실시예 2.항알파-시누클레인 （키메릭）항체의 제조
20 2-1： 항체클로닝 및 발현 2019/117684 1»（：1^1{2018/015953 인간화를 진행 후 확보한중쇄가변영역 및 경쇄가변영역의 항체 nucleot ide 서열을 이용하여， 짧은 단편의 nucleot ide인 gblock(m. biotech)을 합성하였고， 이 를 이용하여 동물세포 배양용 벡터 (pcDNA3.4)에 클로닝하였다. 가변영역 앞뒤에 중첩된 nucleot ide를 약 20 bp 정도 포함하여 gblock을 합성하였고， pcDNA3.4 vector의 가변영역을 제외한부분을 로 증폭 후 준비하여， Gibson assembly방 법으로클로닝하였다.
상기 클로닝된항체를 Transfect ion및 발현을하기 위해서, 상기 제조된 벡 터를 maxi-prep(Qiagen) 하여 , 다량의 plasmid DNA를확보후， 다음과같이 세포에 도입하였다. 형질주입 전날, ExpiCHO™ (Gibco, Cat： A29127)세포를 ExpiCHO™ expression medium (Gibco, Cat : A29100-01) 배지에 3 x 10E6 ~ 4 x 10E6 viable cel ls/mL농도를 맞춘후， 8% C02, 37 °C , 120대미에서 1일 동안배양하였다. DNA 형질주입 당일 7 x 10E6 ~ 10 x 10E6 viable cel ls/mL, 생존율은 95%이상으로자 란세포를신선한배지를 이용하여 6 父 106 viable cel ls/mL로 희석하여 준비하였 다.
준비된 모세포에 형질주입을 위해 ExpiFectamine™ CH0 transfect ion kit (Gibco, Cat : A29129)를 사용하여, ExpiFectamine™ CH0 & plasmid DNA복합체 를준비하였다. 차가운 Opt iPR0™SFM® (Gibco, Cat： 12309019) 배지를각각분주하 여, 적정농도로준비한 DNA및 ExpiFectaraine™CH0시약을각각 접종후， mix하여 상온에서 5분간 정치하고， 모세포에 접종하여 형질주입 후 배양을 시작하였다. 형 질주입 다음날에는 ExpiFectamine™ CH0 transfect ion kit에 포함된 enhancer 및 2019/117684 1»（：1^1{2018/015953 feed를 형질주입 세포에 접종하였고, 5일 후에는 feed를 추가 접종 후， 8% C02, 37 C， 120 rpm조건에서 10일간배양하여 생산을완료하였다.
생산이 완료된배양액의 수득을위해 원심분리용 병에 배양액을옮기고 4 °C , 6500 rpm에서 30분간원심분리 후, 0.2 u m의 크기인 필터로필터링을진행하여， 부유물을제외한배양액을확보하여 이후정제과정을진행하였다.
2-2： 항체의 정제 및서열확인
HiTrap MabSelectSure (GE Heal thcare, 11-0034-94)을사용하여 배양액을정 제하였다. 평형화버퍼 (50 mM Tr i s-HCl pH7.2, 100 mM NaCl )을사용하여 평형화시 킨 후， 회수된 배양액을 컬럼에 로딩하였다. 로딩이 완료되면 50 mM Sodium Ci trate pH 5.0으로중간세척 후, 50 mM Sodium Ci trate pH 3.4를 이용하여 용출을 하였다. 용출액에 1M Tr i s-HCl pH 9.0을 첨가하여 pH 6.0이 되도록중화하였다. 이 후용출액을 PBS (phosphate buf fered sal ine, pH 7.4)로버퍼교환및 농축하여 사 용시까지 4 에 보관하였다.
추가정제가필요할경우， HiLoad 26/600 superdex 200컬럼에 IX PBS를 버 퍼로 1차정제분을통과시켜 용출시료의 크기를바탕으로 2차정제를수행하였다. 상기 정제된 항체의 아미노산서열을 질량분석방법으로 분석하였으며， mouse 유래 단일클론항체의 가변영역과일치함을확인하였다.
상기 방법으로 확인된 3A9, 9B11, 11F11항체들의 가변영역을 인간 IgGl아 이소타입의 backbone 가변영역 부분에 치환하여 키메릭 형태의 인간 IgGl 항체를 2019/117684 1»（：1^1{2018/015953 제작하였다. 상기 얻어진 키메릭 항체 중에서, 특히 ChllFll항체는 IgG형태의 항 체로서 서열번호 90의 중쇄 가변영역 서열 (chllFll-VH)과서열번호 109의 경쇄 가 변영역 서열 (chllFll-VL)의 조합을포함하며， Ch 3A9항체는 IgG형태의 항체로서， 서열번호 102의 중쇄 가변영역 서열 (chllFll-VH)과 서열번호 116의 경쇄 가변영역 5 서열 (chllFll-VL)의 조합을포함한다. 실시예 3： 인간화항체의 제조
Figure imgf000158_0001
키메릭 항체의 CDR1, CDR2, CDR3 residue에 human framework을결합시키면서 10 각 CDR residue에 mouse혹은 인간유래 sequence가도입된 mini 라이브러리를 제 작하였다. 해당 라이브러리의 competent cel l을 클로람페니콜 (Sigma, C0857) 34 y g/ml , 2%글루코스 (Sigma, G5400) 및 5 mM MgC12 (Sigma,M2393)이 포함된 2X YT [Tryptone (CONDA, 1612.00) 17g, 이스트 추출물 (C0NDA， 1702.00) 10g, NaCl (Sigma, S7653) 5g] 배지에 접종 후, 37°C에서 3시간 정도 배양하여 0D600 값이 15 0.5에서 0.7이 되도록 한후， 헬퍼 파아지 (helper phage)를 감염시킨 후, 클로람페 니콜 34 y g/ml , 5 mM MgC12, 카나마이신 (Sigma, K1876) 70 u g/ml , 1 mM IPTG (ELPISBI0, IPTG025)를 첨가한 2X YT배지에서 30 °C , 16시간동안배양하여 파아지 패킹을유도하였다. 이어 배양액을 4500 rpm, 4°C 조건에서 15분 동안 원심분리한 후, 상등액에 4% PEG 6000 (Fluka, 81253)과 3% NaCl (Sigma, S7653)을 첨가하여 20 잘녹인 후， 얼음에서 1시간동안 반응시켰다. 이를 다시 4°C 조건에서 8000 rpm, 2019/117684 1»（그1^1{2018/015953
20분간원심분리한후, 펠렛을 PBS로현탁한후, 다시 4°C 조건에서 12000 rpm , 10 분간 원심분리 하여 라이브러리 파아지를 포함하는 상등액을 수득하여 새 튜브에 넣어 사용시까지 4°C에서 보관하였다. 3-2： 파아지 디스플레이 패닝 (panning)
구체적으로 면역시험관 ( immunotube , maxi sorp 444202)께 10//g/m£ 농도의 재 조합 알파-시누클레인 응집체를 PBS에 첨가하여 4°C에서 밤새 시험관 표면에 단백 질을흡착시킨 후 우혈청 알부민 (BSA, Bovine serum albumin) 3%용액을 시험관에 첨가하여 알파-시누클레인 응집체가 흡착되지 않은 표면을 보호하였다. 시험관을 비운후 BSA 3%용액에 분산된 1012CFU의 항체 파지 라이브러리를 알파-시누클레인 단량체 단백질이 흡착되어 있는면역시험관에 넣고상온에서 1시간반응시켰다 (네 거티브선별) . 알파-시누클레인 단량체에 비결합된 파지들을 회수하여 알파-시누클 레인 응집체가부착된 면역시험관에 상온에서 2시간 결합시켰다. 이어 비특이적으 로결합한파지를 PBS-T(0.05% Tween 20)용액으로 5회 30회 씻어낸후남아있는항 원 특이적 파지항체를 100mM트리에틸아민 용액을 이용하여 회수하였다. 회수된 파 지를. 1M트리스버퍼 (pH 7.4)로중화시킨 후 ER2537대장균에 37°C에서 1시간감염 시키고감염된 대장균을카베니실린을함유하는 2X YT한천배지에 도말하여 37°C에 서 밤새 배양하였다. 다음날배양된 대장균을 4M의 2X YT카베니실린 배양액에 현 탁하고 15%글리세롤을 첨가하여 일부는 -80°C에 보관하고나머지는다음라운드의 패닝을 위해 파아지를 제조하였다. 이러.한 과정을 총 3라운드 반복하여 항원 특이 2019/117684 1»（：1^1{2018/015953 적인 항체를증폭시켰다. 패닝 라운드가진행될수록 PBS-T를 이용한세척회수를증 가시켜 항원특이적 파지를증폭및농축하였다.
3-3: 단일클론파아지 항체 선별 (single clone screening)
5 상기 패닝을통해 수득한파아지 풀 (phage pool)로부터 알파-시누클레인 응 집체에 특이적으로결합하는단일클론항체를선별하기 위해 다음과 같은실험을수 행하였다.
농축된 풀로부터 단일클론을 분리하기 위해, LB-테트라사이클린/카베니실린 한천배지에 상기 파아지 풀을도말한후배양하여 단일 콜로니를 확보하였다. 이어 10 단일 클론을 웰당 400M의 2 X YT-테트라사이클린/카베니실린 배지가들어간 96깊 은 웰 플레이트에 접종하여 밤새 키운후， 배양액 10 를 새로운 390 의 2 X YT- 테트라사이클린/카베니실린 배지가포함된 96깊은 웰플레이트에 넣어 37°C에서 4 시간배양했다. 상기 배양액에 ImM IPTG되게 넣어 주고 30°C에서 밤새 배양했다. 밤새 배양한배양액을원심분리하여 상등액을취하였다.
15 이어 다음과 같이 ELISA방법을사용하여 알파-시누클레인 응집체와 결합하 는 단일클론 가용성 scFv를 발현하는 클론을 선택하였다 (Steinberger . Rader and Barbas III . 2000. Phage display vectors. In： Phage Di splay Laboratory Manual . lsted. ColdSpr ing Harbor Laboratory Press . NY. USA. pp .11.9-11.12) . 구체적으 로 96 웰 플레이트에 실시예 1-1에서 선별된 7B7항체를 넣고， 4°C에서 밤새 코팅 20 하였다. 3% BSA를각웰당 20(hi L씩 넣어 37°C에서 2시간블록킹하였다. 이어 알파 2019/117684 1»（：1^1{2018/015953
-시누클레인 응집체와 단량체를 100ng/well의 농도로 각각 로딩 한후 37°C에서 2 시간반응시켰다.이어 PBS-T 300 로 5회 세척하였다.상기 준비된 단일 클론상 등액은 3% BSA와 l:l(vol:vol)로 섞은 후 이를 상기 응집체 및 단량체와 결합시킨 플레이트에 100 씩 로딩한 뒤 37°C에서 2시간 반응시켰다. 이어 PBS-T 300 로 5회 세척한후,항- HA HRP결합항체를 넣고 37°C에서 1시간반응시킨 후， PBS-T로
5회 세척하였다. TMB(Tetramethylbenzidine, Sigma, T0440) 100yL를 넣어 발색한 후, IN H2S0450uL를 넣어 반응을정지한후, 450nm에서 흡광도를측정하였다.흡 광도가 0.5이상인 클론들을결합에 의한 양성반응으로간주하였으며 BSA비특이적 으로결합하는클론들은배제시켰다.
라이브러리에서 발견된 클론의 CDR residue들은 in silico 방식으로 분석을 병행하여 framework과의 결합에 심각한 문제가 생기거나 CDR을 제외한 framework 부분에 T-cel 1 epitope, B cell epitope및 MHCII epitope이 존재하지 않는클론을 선별하였다.
이후 다음과 같은 중쇄, 경쇄의 가변영역의 조합으로 만들어진 5개 항체에 대해서, 의 인간화 항체의 가변영역을 인간 IgGl 아이소타입의 backbone 가변영역 부분에 치환하여 5개의 IgGl backbone의 인간화 항체를 제작하였다. 구체적으로, HullFll_(ABL2-4)는 IgG 형태의 항체로서， 서열번호 92의 중쇄 가변영역 서열 (HullFll-VH2)과서열번호 113의 경쇄 가변영역 서열 (HullFll_VL4)의 조합을포함 하며， HullFll_(ver.l)는 IgG형태의 항체로서,서열번호 98의 중쇄 가변영역 서열 (HullFll-VH-vl)와서열번호 115의 경쇄 가변영역 서열 (HullFll_VLv34c)의 조합 2019/117684 1»（：1^1{2018/015953 을 포함하며， HullFll_(ver .2)은 IgG 형태의 항체로서 서열번호 99의 중쇄 가변영 역 서열 (HullFll-VH-v2) 와 서열번호 115의 경쇄 가변영역 서열 (HullFll-VLv3 4c)의 조합을 포함하며, HullFll_(ver .3)는 IgG 형태의 항체로서 서열번호 10◦의 중쇄 가변영역 서열 (HullFll-VH-v3)와 서열번호 115의 경쇄 가변영역 서열 (HullFll-VLv3 4c)의 조합을포함한다.
HullFll(ver .4)은 서열번호 101의 중쇄 가변영역 서열 (HullFll-VH_v4)와서 열번호 115의 경쇄 가변영역 서열 (HullFll-VLv3 4c)의 조합임을확인하였다. 실시예 4. 알파-시누클레인항체의 항원결합특이성 및결합력 분석
4-1： 항-알파-시누클레인항체를이용한닷블롯분석
본원에 따른항체가네이티브상태에서의 단량체 또는응집체에 결합하는지 를 분석하기 위해 닷블롯 실험을 수행하였다. 이를 위해 항원으로서 50 ng 혹은 100 의 알파-시누클레인 모노머 또는피브릴 단백질 (서울대학교 이승재 교수 lab 에서 제조함; Bae et al .， J . Neurosci 32: 13454， 2012)을 Dot blot apparatus(BioRad)를 이용하여 나이트로셀룰로스 멤브레인에 스팟로딩하였다. 2배 씩 희석한모노머 또는피브릴 단백질은멤브레인의 오른쪽에서부터 왼쪽으로순차 적으로 로딩하였다 (12.5， 25, 50, 100 ng) . 멤브레인을 TBST조성의 5% non-fat dry mi lk로 1시간동안상온에서 블로킹한뒤 , 실시예 1에서 제조한알파-시누클레 인 항체를 1 mg/ml의 농도로 1% bovine serum albumin함유 TBST에 넣고 멤브레인 과 해당 항체를 1시간 동안 상온에서 인큐베이션하였다. 이어 TBST로 세척한 뒤 2019/117684 1»（：1^1{2018/015953
HRP(horse radish peroxidase)가 결합된 2차 항체 및 기질로서 chemi luminscence substrate (NEN)를 제조자의 방법대로 사용하여 신호를 분석하였다. 결과는 LAS- 3000 Luminescent Image Analysis System (FUJIFILM Life Science)을 이용하여 이 미징하였다. 결과는도 1에 기재되어 있다.
5 도 1에 나타난바와 같이 본원에 따른 알파-시누클레인 항체는 알파-시누클 레인 모노머와 비교하여, 응집체에만 선호적으로 결합하는 것으로 나타났다. 특히 9B11, 3A9 및 11F11은 응집체에만 결합하는 것으로 나타났다. 274 항체 (Bae et al . , J Neurosci . 2012 Sep 26； 32(39)： 13454-13469)는 단량체 및 응집체에 모두 결합하는비교항체이다.
10
4-2： 항-알파-시누클레인항체를이용한 ELISA분석
본원에 따른항체의 항원에 대한결합력을 정량적으로분석하기 위해 ELISA 를수행하였다. 이를 위해 실시예 1에서 얻어진 마우스항-알파-시누클레인 항체를 1 ug/ml의 농도로 96웰 플레이트에 코팅한 후, 여기에 10, 100, 1000, 10,000 15 ng/ml 농도의 알파-시누클레인 피브릴 응집체를 처리한후， PBS로 세척하고， 이어 바이오틴아결합된 2차항체 및 HRP가 결합된 스트렙타비딘을 처리한후 기질로서 묘와반응한후흡광도를측정하였고, 그측정 결과를도 2에 나타냈다.
도 2에 나타난바와같이 본원에 따른항체는응집체에 높은결합력으로선 호적으로 결합하는 것으로 나타났다. ELISA 결과를 통해 항체를 분석해 보면 응집
Figure imgf000163_0001
2019/117684 1»（：1^1{2018/015953 며 단량체 및 응집체에 모두 결합하는 항체는 이보다 높은 - 0 _° M값을 보였다. 본 발명에 따른 항체는 알파시누클레인 응집체에 높은 친화도로 선호적으로 결합 하며 단일체에 대해서는 응집체보다 낮거나 또는 결합하지 않기 때문에， 친화도를 도출할 수 없었다.이러한 결과는 파킨슨병과 같은 알파 시큐클레인 병인을 갖는 신경퇴행성 질환의 원인물질을 효과적으로 제거할 수 있거나 활동을 억제할 수 있 음을나타내는 것이다.
4-3： 항-알파-시누클레인항체를이용한 BIAcore분석
실시예 1에서 제조된 알파-시누클레인항체의 단량체 및 응집체 항원 결합에 대한정량적 분석을 BIAcore를사용하여 수행하였다.
기기는 T200 (GEHealthcare, S/N： 1565888)을사용하였다. Chip은 Protein A 를사용하였으며 (GE Healthcare, Cat . 29-1275-56)， Regeneration buffer는 10 mM Glycine-HCl pH1.5 (GE Healthcare, Cat . BR- 1003-54) , Running buffer와 analyte 희석， 샘플 희석 완충액으로는 HBS-EP를 사용하였다. 실시예 1에서 제조된 a-syn 항체 (3A9， 9B11, 11F11)는 IX HBS-EP (GE Healthcare, Cat. BRᅳ 1006-69)로 희석하 였으며, a-syn단량체 (1 mg/ml) 또는 피브릴 단백질 (3 mg/ml) (analyte)은 2배 씩 순차적으로 희석하여， 0 nM 포함 총 6개 농도 (0， 0.39， 1.56， 6.25， 25, 100nM)에서 분석하였다. 캡처의 경우 단량체는 표적 RU를 800 (theoretical)으로, 피브릴은표적 RU를 100 (theoret ical )으로하고， 캡처 phase를 contact time을 60 초, flow rate을 30 u 1/min으로， stabilization period를 180초로 진행하였다. 2019/117684 1»（：1^1{2018/015953 assocation phase에서는 association time을 120초로, flow rate를 30 u 1/min으로 하였으며， dissociation phase에서는 dissociation time을 360초로， flow rate를 30 ii 1/min으로 하였다. Regeneration phase에서는， flow rate을 30 y 1/min으로 하여 regeneration time을 240초 (1차), 60초 (2차), 두 번에 걸쳐 진행하였다. 1:1 binding model을사용하여 fitting하였으며, evaluation software는 BIACore T200 Evaluation software를사용하였다 (GE healthcare) . 결과는도 3a 및 도 3b에 기 재되어 있다.
도 3a는본 발명의 일예에서 제조된 단일클론항체가 알파-시누클레인 응집 체에 대한선호적 결합특이성 및 친화도를 BIAcore로분석한결과이다.본원에 따 른항체가높은친화도로응집체에 결합하는 것을나타낸다. 이러한결과는파킨슨 병과같은 알파-시누클레인 병인을 갖는신경퇴행성 질환의 원인물질을효과적으로 제거할수 있거나활동을 억제할수 있음을 나타내는 것이다.도 3b는도 3a의 결 과를표로나타낸것이다.
도 3a및 도 3b의 결과에 나타낸 바와같이， 분석한 4개의 알파-시누클레인 항체 중상술한다른방법에서 응집체에 선호적으로결합하는항체들인， 3A9, 9B11, 및 11F11이 BIAcore에서도응집체에만결합하는 것으로나타났으며, 약 1~3 x 10-9 의 높은친화도를갖는것으로나타났다.
4-4.항-알파시누클레인항체를이용한 Octet분석
실시예 1에서 제조된 마우스 알파-시누클레인 항체 (3A9， 9B11, 11F11)의 단 2019/117684 1»（：1^1{2018/015953 량체 및응집체 항원결합에 대한정량적 분석을 Octet를사용하여 수행하였다. 구체적으로 running buffer는 IX KB buffer (cat. 18-1092) 혹은 IX PBS buffer를 1000대미에서 사용하였으며， immobilization buffer는 sodium acetate, pH 5 (lOmM, Cat . 18-1068)을 사용하였다. a-syn 모노머는 a -syn 항원을 immobilization 시켰으며, 피브릴의 경우 테스트 항체를 immobilization 시켰다. target concent rat ion은모노머의 경우 20 yg/ml,피브릴의 경우 0.4 yg/ml로하 였으며, kinetics concent rat ion은 모노머의 경우 50 nM부터， 피브릴의 경우 100 부터 2배씩 차례로 희석하여 총 7개의 포인트를 설정하였다.
Assoc i at i on/Di ssoc i at i on시간은모노머의 경우 5분/ 20분， 피브릴은 5분/ 25분이었 으며, Biosensor는 ARG2를, fitting은 1:1 fitting을 사용하였다. 결과는 도 4에 기재되어 있다.도 4는본발명의 일예에서 제조된 단일클론항체가 a -Syn응집체 에 선호적 결합특이성을 Octet으로분석한결과이다.
도 4a에 나타난바와같이， 3A9, 9B11및 11F11의 경우단량체에는거의 결 합하지 않으며 (붉은 점선 박스) ,응집체에는잘결합하는 것으로나타났다 (붉은점 선 박스 내의 그래프가올라감). 이러한 결과는 Dot blot, Octet, ELISA에서의 결 과들과유사혹은 일치하는 결과로, 테스트한 4개의 a -syn항체 중상기 다른 방 법들에서 응집체에 선호적으로 결합하는 항체들인, 3A9, 9B11및 11F11이 Octet에 서도응집체에만 결합하는 것으로 나타났다.도 4b는도 4a의 결과를 표로 나타낸 것이다. 도 4a및 도 4b의 결과는 알파-시누클레인 응집체에 선호적으로결합하는 것을 나타내며, 도 1의 결과와 일치하는 것이다. 비교군으로 사용된 #274항체의 2019/117684 1»（：1^1{2018/015953
경우단량체 및응집체에 모두잘결합하는것으로나타났다 . 실시예 5. 항-알파-시누클레인항체의 인간뇌 조직에서 루이소체 검출분석
10마이크로미터 두께의 파라핀포매된 파킨슨질환으로사망한환자의 뇌조 5 직절편을 실시예 2에서 얻어진 키메릭 항-알파-시누클레인 항체를 이용하여 조직 절편내 루이소체와루이 신경돌기 (neurite)를다음과같이 염색하였다. 90%포름산 으로조직 절편을 3분간처리하여 ant igen retrieval을진행한다음， 1% H202 (50% ethanol base)를 이용하여 조직 자체의 peroxidase 활성을 억제하였다. 조직의 non-specific binding을 막기 위하여 10% normal horse serum을 처리하였다. 이어 10 인산완충액으로 세척한 후 본원에 따른 3A9, 11F11 및 11F11 항체를 adjacent section에 4°C에서 밤새 처리하였다. 인산완충액으로 세척 후， 바이오틴이 결합된 anti-인간 IgG항체를 37°C에서 3◦분간 처리한 뒤, avidin-biot in complex를 상온 에서 30분간반응시켰다 (Vectastatin El ite kit ; Vector Laboratories) .
이어 0.005% H202를포함한 DAB로 발색하였고， 해당 sect ion을 0.5% cresyl
15 violet으로카운터 염색하여 각세포를구분하였다. 결과는도 도도 5a 및 도加 에 개시되어 있다.
도 5a및 도 5b도도는각각본발명의 일예에 따른단일클론항체 3A9및 11F11가 인간뇌조직에서 루이소체 (Lewy body) 및 루이 신경돌기 (Lewy neurites)를 특이적으로 인식할수 있는 지를 각각측정한 결과이다. 본원에 따른항체가루이
20 소체 (화살표) 및 루이 신경돌기 (왼쪽 아래 실 같은 모양)에 결합하는 것을 나타낸 2019/117684 1»（：1^1{2018/015953 다·
도 5a및 도 5b도에 나타난바와같이 본원에 따른항체는루이소체 및 루 이 신경돌기에 효과적으로 결합 (화살표로표시)하는 것으로나타났다. 이러한 결과 는 인간 뇌조직에 있는 루이소체의 구성 성분인 알파-시누클레인 응집체에 효과적 으로 결합할수 있음을 의미하는 것이다. 인간뇌로 전달된 항체가효과적으로 알 파-시누클레인 응집체에 특이적으로 결합할수 있음을보여주는 것이다. 이러한결 과는 본원의 항체가실제 인간 뇌조직에 존재하는 알파-시누클레인 응집체와 특이 적으로결합할수 있음을나타내는 것으로， 알파-시누클레인 병인과관련된 질환의 예방및/또는치료에 효과적으로사용될수 있음을나타낸다. 실시예 6. 항-알파-시누클레인항체의 에피토프분석
실시예 2에서 얻어진 키메릭 항-알파-시누클레인 항체인 3A9 및 11F11항체 에 대한에피토프 맵핑은 PEPSCAN (The Nether l ands)에 펩타이드어래이 분석을의 뢰하여 수행되었다. 결과는도도 6에 개시되어 있다. 도 6도는본발명의 일예에 따른항체의 에피토프맵핑 결과를도식적으로나타낸 것이다.
도 6도에 나타난바와같이 본원에 따른항체는 C-말단을 인식하는 것으로 나타났다. 본원에 따른항체들은대부분 C-말단부위에 결합하는 것으로나타났다. N-말단을 인식하는 알파-시누클레인 항체들은 알파-시누클레인 관련 질환을통징하 는시누클레인병에 속하는다계통위축증와같은다른 질병의 응집체는 인식하지 못 하는반면， C-말단부위를 인식하는 알파-시누클레인 항체들은파킨슨 병뿐아니라 2019/117684 1»（：1^1{2018/015953 기타 다양한 시누클레인병의 응집체도 인식한다는 장점을 가진다.특히 앞서 설명 한 바와 같이 110번째 잔기 내지 122번째 잔기로 이루어진 펩타이드를 인식하는 경 우응집체 선호적인 결합을나타냈다.
5 실시예 7. 항-알파-시누클레인항체의 ELISA분석시험
실시예 4-2와 실질적으로 동일한 방법으로， 실시예 2에서 얻어진 키메릭 항체 (ChllFll) 및 실시예 3에서 얻어진 인간화 항체들 (HullFll)의 결합력을 정량적으로분석하기 위하여 sandwich ELISA를수행하였다.
구체적으로, 각각 항체들을 0.04 400 nM의 농도로 1/10씩 희석하여 96웰
10 플레이트에 코팅한 뒤， 여기에 2000 ng/ml의 응집체를 각 웰에 처리하였다.
1XPBS로 세척 후 이어 바이오틴이 결합된 capture 항체 및 HRP가 결합된 스트렙타빈을 처리한 뒤 기질로서 TMB와 반응시킨 뒤 그 흡광도를 측정하였다. 결과는도도 7에 기재되어 있다.
도도 7에 나타낸 것과같이， 본발명에 따른인간화된항체들, 특히 키메릭 B 11F11에서 유래된 인간화 항체 (인간화 11F11 항체)들은 키메릭 11F11 클론과 동등한 결합력을 보이는 것으로 확인되었다. 인간화 항체들, 특히 11F11 유래 variant들인， hullFlKver .1) , 즉 HullFll-VH-vl 와 HullFll_VLv3 4c의 조합， hullFll(ver.2) , 즉 HullFll-VH_v2 와 HullFll-VLv3 4c의 조합, hullFlKver .3) , 즉 HullFll-VH-v3 와 HullFll-YLv3 4c의 조합, hullFlKver .4) , 즉 HullFll-VH-v4 20 와 HullFll-VLv3 4c 은 키메릭 11F11 클론과 유사한 결합력을 보이는 것으로 2019/117684 1»（：1^1{2018/015953 확인되었으며, 그防50는 11.5 15.1이로， 키메릭 1 11항체의 敗5◦인 12.5油와 유사한값을보였다. 실시예 8： 항알파-시누클레인항체를이용한 쇼«^분석
실시예 4-3과 실질적으로 동일한 방법으로， 실시예 2에서 얻어진 키메릭 항체 및 실시예 3에서 얻어진 인간화 항체들의 결합력을 이쇼0 를 사용하여 정량적으로분석하였다.상기 분석 결과를도도 8및 하기 표에 나타낸다.
[표 10]
Figure imgf000170_0001
그 결과， 본원에 기재된 인간화 항체들， 특히 11고11의 variant들， 즉,
1111111711(八라.2)01111 11 - - ¥2 와 ［ 111711ᅳ ¥1方3 4：의 조합)， 如1 11 6 3)(¾1111711-쌔13 와 此1 11 - 13 4：의 조합)， 血111?11(>61.4)011111?'11-\¾14 와 恥11 1 - ¥切3 4:) 은 키메릭 1 11 클론과 유사한 1出 값을 보이는 것으로 확인되었으며, 그 결합 정도로는 인간화 클론들이 0.02-0.06 X 10-91\1의 0), 키메릭 1 11 클론이 0.02 X 10_91\1의 낮은 I江) 값， 즉 응집체에 대한높은결합력을보였다. 2019/117684 1»（：1^1{2018/015953
실시예 9. 키메릭 항체의 알파-시누클레인특이적 결합평가
9-1： 베타-시누클레인 및 감마-시누클레인과의 ELISA분석
실시예 2에 따른 키메릭 항체 3A9, 9B11, 11F11 3종을 생산 후 해당 항체들의 알파-시누클레인의 결합 특이성을 그 호몰로그인 베타-시누클레인 및 감마-시누클레인과의 ELISA과비교하였다.
이를 위해 인간 베타-시누클레인 (Uniprot : Q16143) 단백질 (CUSABIO, Cat：
CSB-EP624090HU) , 혹은 인간감마-시누클레인 (Uniprot : 076070) 단백질 (⑶ SABI0, Cat： C況- EP021915HU)을 각각 100 ng/ml의 농도로 96웰 플레이트에 코팅한 후, wash 한 다음에 5% BSA로 2시간동안 blocking하였다. 이 때 알파， 베타, 감마- 시누클레인에 모두 결합하는 pan-Syn 항체 (santacruz， Cat : FL-140 , sc-10717, rabbi t)를 양성 대조군으로사용하였다. Wash후， 여기에 400이에서 0.04 nM까지 1/10씩 희석된 키메릭 항체 (M9, 9B11, 11F11)를 2시간 동안 처리한 후, PBS로 세척하고， 이어 goat ant i-hFc항체에 HRP가 결합된 detect ion 항체를 처리한 후 기질로서 TMB와 반응한후 450nm, 650nm에서 흡광도를 측정하였고, 양성 대조군의 경우 detect ion항체로 goat ant i-rabbi t항체에 HRP가결합된항체를사용하였다. 실험결과를도도도 9a및 9b에 나타내었으며， 이는본발명의 일예에 따른 키메릭 항체들 (3A9, 9B11, 11F11)의 인간 베타-시누클레인 및 인간 감마- 시누클레인에 대한 매우 낮은 결합력을 ELISA로 분석한 결과를 나타낸 것이다. 이와 반대로 양성 대조군인 pan-Syn 항체는 베타- 및 감마-시누클레인에 대하여 2019/117684 1»（：1^1{2018/015953 높은 결합력을 나타냈다. 도 9a는 인간 베타-시누클레인에 관한 것이고, 도 9b는 인간감마-시누클레인에 관한것이다.
9-2： 아밀로이드베타및 타우응집체에 대한닷블롯분석
실시예 2에 따른 키메릭 항체 3A9, 9B11, 11F11 3종을 아밀로이드 베타
(Uniprot : P05067； CAS number : 107761-42-2) 및 타우 (Uniport : P10636-8) 단백질로 만들어진 응집체와 닷블롯으로 반응시켜 해당 항체들의 알파-시누클레인 응집체에 대한특이적인결합력을분석하였다. 그이유는다음과같다.
아밀로이드 베타 142 및 타우는 응집체를 형성하여 퇴행성 신경질환， 특히 알츠하이머병에 중요한 병인으로 생각되며， 해당 응집체는 알파-시누클레인의 응집체와유사하게 올리고머 , 프로토피브릴, 피브릴 등의 구조를 가진다고 알려져 있다. 따라서 해당닷블롯은 키메릭 항체 3A9, 9B11, 11F11들이 알파-시누클레인의 특이적인 시퀀스를 인식하고 알파-시누클레인， 아밀로이드 베타， 타우 유래 응집체가 응집체로서 가지는 공통적인 구조를 인식하지 않는 것을 확인하기 위한 것이다.
본실시예의 닷블롯방법은상기 실시예 4-3과실질적으로동일한방법으로 , 수행되었으며, recombinant 아밀로이드 베타 犯 및 타우 단백질 및 이에 대한 응집체는서울대학교 이승재 교수 lab에서 제조되었다. Syn-1, 6E10, Tau5는 각각 알파-시누클레인, 아밀로이드 베타 H2 , 타우 단백질에 결합하는 것으로 알려진 항체들이다. 분석 결과는도도 9c에 기재되었다. 2019/117684 1»（：1^1{2018/015953 실험결과를 도 9c도 에 나타내었으며 이는 본원의 키메릭 항체들인 3A9, 9B11, 11F11이 알파-시누클레인 유래 응집체에만 특이적으로 결합하며 아밀로이드 베타- 및 타우유래 응집체에는 결합하지 않음을 보여준 결과이다.이와상이하게 아밀로이드 베타H 및 타우에 각각 결합하는 것으로 알려진 6E10 및 Tau5항체는 닷블롯상에서 해당응집체에 결합함을보여주었다.
상기의 결과에 따라 해당 키메릭 항체들이 알파시누클레인의 호몰로그 및 상이한 단백질 유래 응집체에 결합하지 않음은， 해당 항체들이 타겟 단백질에만 효율적으로 결합하여 호몰로그 및 상이한 단백질 유래 응집체에 결합하는 항체 혹은 약물 대비 그 효능이 뛰어날수 있음을 시사한다. 실시예 10: 이중특이 항체의 제조
10-1 : Bivalent 이중항체 클로닝
Bivalent 이중항체 발현 벡터를 제작하기 위해, pcDNA3.4 ( i nv i t r ogen ) 벡터의 MCS(Mul t i cloning s i te) 내에 signal sequence를 포함한 항체 nuc leot ide _서열을 삽입하였다. 이중항체 발현벡터는 모노시스트로닉 벡터로써, 중쇄 발현 벡터 및 경쇄 발현 벡터를각각제작하였다.
중쇄 발현 벡터에 삽입된 중쇄 서열의 경우 항 a-syn항체를 코딩하는 중쇄 가변 영역 및 인간 중쇄 불변 영역이 연결된 이뮤노글로불린 C 말단에 항 IGF1R scFv가 링커로 연결된 형태이다.경쇄 발현 벡터에 삽입된 경쇄 서열의 경우 항 a- syn항체를코딩하는 경쇄가변영역 및 인간 경쇄불변영역이 연결된 형태이다. 2019/117684 1»（：1^1{2018/015953
10-2: Monovalent 이중항체 클로닝
Monovalent 이중항체는항 IGF1R scFv가 C terminal에 링커로접합되어 있는 항 a-syn 이뮤노글로불린 중쇄 (hole)와 scFv가 연결되어 있지 않은 항 a-syn 이뮤노글로불린중쇄 (knob)가결합한이종이량체에 항체 경쇄가접합된 형태이다. 중쇄 이종이량체의 접합 효율을 높이기 위해， Knob-in-hole 기법이 이용되었다. 즉, Hole type의 중쇄 coding 서열은 CH3 부분에서 T366S, L368A, Y406V 로 치환하였고， knob type의 중쇄 coding 서열은 CH3 부분에서 T366W로 amino acid로치환하였다.
10~3： Transient expression
상기 제조된 벡터를 maxi-prep(Qiagen) 하여， 다량의 plasmid DNA를확보후， 다음과 같이 세포에 도입하였다. BsAb를 생산하기 위해서 중쇄 발현 벡터 DNA 및 경쇄 발현벡터 DNA를 1:1의 비율로 형질도입 하였다. monovalent BsAb를 생산하기 위해서는 hole type 중쇄 발현 벡터 DNA, knob type 중쇄 발현 벡터 DNA 및 경쇄 발현 벡터 DNA를 0.5 : 0.5 : 1의 비율로형질도입 하였다.
형질주입 전날， ExpiCHO™ (Gibco, Cat： A29127)세포를 ExpiCHO™ expression medium (Gibco, Cat: A29100-01) 배지에 3 x 10E6 ~ 4 x 10E6 viable cells/mL농도를 맞춘후， 8% C02, 37 °C , 120대미에서 1일 동안배양하였다. DNA 형질주입 당일 7 x 10E6 ~ 10 x 10E6 viable cells/mL, 생존율은 95% 이상으로 2019/117684 1»（：1/10公018/015953 자란 세포를 신선한 배지를 이용하여 6 X 106 viable cel ls/mL로 희석하여 준비하였다.
준비된 모세포에 형질주입을 위해 Exp i Feet amine™ CHO transfect ion kit (Gibco, Cat : A29129)를 사용하여， ExpiFectamine™ CHO & plasmid DNA 복합체를 준비하였다. 차가운 0pt iPR0™SFM® (Gibco, Cat： 12309019) 배지를 각각 분주하여, 적정농도로 준비한 DNA 및 ExpiFectamine™CHO 시약을 각각 접종 후, mix 하여 상온에서 5분간 정치하고， 모세포에 접종하여 형질주입 후 배양을 시작하였다. 형질주입 다음날에는 ExpiFectamine™ CHO transfection kit에 포함된 enhancer 및 feed를 형질주입 세포에 접종하였고, 5일 후에는 feed를 주가 접종 후， 8% C02, 37 °C , 120 rpm조건에서 10일간배양하여 생산을완료하였다.
10-4： Medium harvest
생산이 완료된 배양액의 수득을위해 원심분리용병에 배양액을옮기고 4 C， 6500 rpm에서 30분간원심분리 후， 0.2 y m의 크기인 필터로필터링을진행하여， 부유물을제의한배양액을확보하여 이후정제과정을진행하였다. 실시예 11. « 祖항체 제조 ( 1 )
11-1： 犯比요항체 (% )의 제조
파아지 디스플레이/패닝 기술을 이용하여 단일클론항체를 제조하였다.
구체적으로， 항 묘항체 제조를 위한 파지 디스플레이 패닝 수행 및 기타 2019/117684 1»（：1^1{2018/015953 분석에 사용되는 항원을 다음과 같은 단백질을 사용하였다. 인간 IGF1R의 세포외 도메인 (ECD)에서 신호서열이 제거된 서열번호 99 아미노산 잔기의 31번에서 932번 의 아미노산 서열의 C-말단에 히스티딘-태그 (His tag)가 결합된 것을 사용하였다 (R湖 Systems, USA, 391-GR) . 또한종간교차반응성을확인하기 위해 C말단에 His 5 tag 이 융합된 원숭이 IGF1R (Nat ional Research Counci l Canada) , 마우스 IGF1R (R&D systems , 6630-GR/ CF ) , 및 래트 IGF1R (National Research Counci l Canada)의 단백질을항원으로사용하였다.
다양성을가진 인간유래 ScFv (Single-chain variable fragment) 라이브러 리 세포 (OPAL l ibrary, 이화여대 심현보 교수 제작) 1 X 10w개를 클로람페니콜 10 (Sigma, ⑶ 857) 34 ug/ m 1 , 2% 글루코스 (Sigma, G5400 ) 및 5 mM MgC12 (Sigma,M2393)이 포함된 2X YT [Tryptone (CONDA, 1612.00) 17 g, 이스트 추출물 (CONDA, 1702.00) 10 g, NaCl (Sigma, S7653) 5 g] 배지에 접종후， 37°C에서 3시 간 정도 배양하여 OD600 값이 0.5에서 0.7이 되도록 한 후， 헬퍼 파아지 (helper phage)를 감염시킨 후, 클로람페니콜 34 ug/ml， 5 mM MgC12, 카나마이신 (Sigma, 15 K1876) 70 ug/ml , 1 mM IPTG (ELPISBI0, IPTG025)를 첨가한 2X YT배지에서 30 °C ,
16시간동안 배양하여 파아지 패킹을유도하였다. 이어 배양액을 4500 rpm , 4°C조 건에서 15분동안원심분리한후， 상등액에 4% PEG 6000 (Fluka, 81253)과 3% NaCl (Sigma, S7653)을 첨가하여 잘녹인 후， 얼음에서 1시간동안반응시켰다. 이를다 시 4°C조건에서 8000 rpm, 20분간 원심분리한 후， 펠렛을 PBS로 현탁한후， 다시 20 4°C조건에서 12000 rpm, 10분간원심분리 하여 라이브러리 파아지를포함하는상등 2019/117684 1»(：1^1{2018/015953 액을수득하여 새 튜브에 넣어 사용시까지 4(：에서 보관하였다.
11-2： 파아지 디스플레이 패닝( 3111 11요)
인간犯 항체를스크리닝 하기 위해 다음과같은방법으로총 3회 패닝을 수행하였다. 본 발명에 사용된 파지 라이브러리는 합성 사람 3산 라이브러리이며 파아지 디스플레이 패닝 과정 및 결과는다음표 11과같다.
[표 11]
Figure imgf000177_0001
구체적으로 면역 시험관 (immunotube, maxisorp 444202)에 5 ug/ml 농도의 재조합 인간 IGF1R단백질 (R&D Systems, USA, 391-GR혹은 Sino Biological Life Technologies, USA, 10164-H08H-50R)을 1ml 첨가하여 4°C에서 16시간 동안 시험관 표면에 코팅한 후， 상등액을 제거하고 BSA (Bovine serum albumin) 3%가 포함된 PBS용액을 4 ml 첨가하여 37°C에서 1시간 반응시켜 IGF1R가흡착되지 않은 표면에 BSA를 결합시킴으로써 비특이적인 결합을 차단하였다. 이어 상등액을 제거한 후， 실시예 11-1에서 준비한파지 라이브러리를 BSA 1.5%용액과섞어 상기 면역시험관 2019/117684 1»（：1^1{2018/015953 에 37°C에서 1시간동안 반응시켜 IGF1R특이적인 파지가항원에 결합하도록 하였 다. 이어 PBS-T (phosphate buf fered sal ine-0.05% Tween 20) 용액으로 1회 씻어내 어, 비특이적으로결합된 파지를제거한후, 100 mM트리에틸아민 용액을 이용하여 IGF1R에 결합한파지를회수하였다.
회수된 파지를 1M Tr i s 완충액 (pH 7.4)으로 중화시킨 후, E . Col i K12
ER2738대장균에 37°C에서 1시간감염시킨후， 상기 대장균을테트라사이클린과카 베니실린을 함유하는 LB 한천 배지에 도말하여 37°C에서 밤새 배양하였다. 다음날 배양된 대장균을 테트라사이클린과카베니실린을함유한 5 ml의 SB(superbroth) 배 지에 현탁하고동일 부피의 50%글리세롤을 첨가하여 일부는 80°C에 보관하고 나머 지 중 50 ul를 40 ml의 況-테트라사이클린/카베니실린 배지에 현탁한후 1012PFU의 VCSM13 헬퍼파지 (helper phage)를 넣고 천천히 교반하며 37°C에서 1시간 배양하였 다. 이후배양액에 카나마이신을 첨가후， 30°C에서 약 16시간동안배양하여 헬퍼 파지가감염된대장균만이 배양되도록하였다.
다음날배양액을원심분리한후， 상등액을 취하여 4% PEG8000, 3%염화나트 륨 (NaCl )을포함하는 버퍼를 첨가하여 4°C에서 약 1시간동안 반응시켜 파지를 침 전시키고원심분리하였다. 이어 상등액을제거하고 침전된 파이지를 1% BSA가포함 된 PBS버퍼로 재현탁하여 이를다음라운드의 패닝에 사용하였다. 위와같은과정 을 4번 반복하고， 패닝 라운드가 진행될수록 PBS-T를 이용한 세척회수를 증가시켜 항원특이적 파지를증폭및 농축하였다. 2019/117684 1»（：1^1{2018/015953
11~3： 단일클론 파0 ]지 항체 선별 0101½ 50^611111^)
인간 IGF1R의 ECD(extracel lular domain)에 대한 결합력 (protein binding) 뿐 아니라 IGF1R발현 세포주인 MCF-7에 대한 결합력을 보이는 (cel l binding) 클 론을선별하였다.
5 구체적으로, 실시예 11-2을통해 수득한파아지 풀 (Phage pool )로부터 IGF1R 에 특이적으로 결합하는 단일클론 항체를 선별하기 위해 다음과 같은실험을 수행 하였다.
농축된 풀로부터 단일클론을 분리하기 위해， LB-테트라사이클린/카베니실린 한천배지에 수득한 파아지 풀을도말， 배양하여 단일 콜로니를 확보하였다. 이 콜 10 로니들을 96-deep웰 plate에 접종하여 밤새 배양한후, 배양액 10 를 같은방법 으로 96-deep 웰 pi ate에 재접종하여 37°C에서 약 4시간 배양하여 적정 0D (0.5 0.7)가되도록 하였다. 상기 배양액에 20 MOI helper phage를 넣은후， 37 °C 에서 1시간반응시켰다. 이후， 배양액에 카나마이신을 넣어주고， 30°C에서 밤새 배 양하였다. 다음날배양액을원심분리하여 상등액을취하여 IGF1R특이적 파지를선 15 별하기위한 ELISA를 수행하였다 (Steinberger . Rader and Barbas III . 2000. Phage display vectors . In : Phage Display Laboratory Manual . 1 sted.
Co 1 dSpr i ngHar borLabor at oryPr ess . NY. USA. pp.11.9-11.12) .
ELISA plate에 재조합 IGF1R를각웰당 100 ng넣고， 4°C에서 약 15시간반 응시켜 항원을 plate상에 코팅하였다. 비특이적 결합을방지하기 위해 3% BSA가포 20 함된 PBS버퍼를 웰당 200 씩 첨가한후， 37°C에서 약 1시간반응시켰다. 상등액 2019/117684 1»（：1^1{2018/015953 을버렸다.
상기 준비한단일클론파지가포함된 100 ul의 용액을각웰에 넣어 37°C에 서 1시간 반응 시킨 후, PBS-T 300 ul로 3회 세척하였다. IGF1R항원에 결합이 된 phage를 검출하기 위해 3% BSA가포함된 PBS 버퍼에 항- HA HRP를 1:5000으로 희석 한후， 37°C에서 1시간반응시켰다. PBS-T 300 를 이용한세척과정을 3회 수행한 후， TMB (Tetramethylbenzidine, Sigma, T0440) 100 ul를 넣어 발색 시킨 후， 1N ¾S04 50 ul를 넣어 반응을종료하였다. 이를 450 nm에서 흡광도를 측정하여， 대조 군인 BSA대비 흡광도가높은클론을항원특이적 항체 클론으로선별하였다.
2번의 스크리닝에 걸쳐 총 7종의 1564, 48G5, 49G11, 54H4, 60A11, 60H6, B11클론을선별하였다. 실시예 12. IGF1R항체의 변이체(affinity variant)의 제조
리간드 결합력 및 BBB 통과능을 평가하여 선별된 클론에 대하여 affinity variation을수행하여 항체를최적화하였다. 1차시도에서는 1564 scFv를 기반으로 하여 heavy chain의 CDR2와 l ight chain의 CDR3를 randomization하기 위한 NNS hand-mix primer를 제작하였으며， PCR기법을 이용하여 randomizat ion서열이 포함 된 1564 scFv유전자를 증폭시켰다. 증폭된 유전자는 pComb3x vector 에 삽입함으 로써 phage display에 적합한 라이브러리 형태로 만들었으며， l ibrary panning 및 ELISA screening을통해 IGF1R에 결합하는다수의 scFv클론들을선별해 낼수 있 었다. 선별된 클론들은 유전자 시퀀싱을 통해 가변부위의 아미노산서열을 확인하 2019/117684 1»（：1^1{2018/015953 였다.
두번째 시도에서는 CDR1, CDR2, CDR3에 각각 germline backmutation을도입 한 heavy, light chain에 대한 2개의 mini library를제작하였다. 96개의 콜로니를 분석하여 그 중 31개의 VL클론과 39개의 VH클론이 unique한시퀀스를 가짐을 확 인하였다. 해당 클론들의 생산성 및 항원 결합력을 바탕으로 변이체(affinity variant)를선별하여 최종적으로표7의 클론을확보하였다 실시예 13. Deamidation residue변이 항체 제조
13-1 :Deamidat ion residue확인
CDR에 deamidation이 발생하면 항체가 분해되면서 항원에의 결합이 약해져 효능 저하 및 sample heterogenity가 유발될 수 있으며， Sample heterogeneity는 향후 임상 승인 등에서 그 identification 때문에 복잡성을 유발한다. 따라서 in silico분석 및 peptide mapping을 통하여 deamidation이 발생하는 위치를 확인하 고자하였다.
도 8a에 나타낸 바와 같이, parental인 1564 클론의 in silico 분석과 peptide mapping으로실제 deamidation이 일어나는 것을 확인하였다. 이 때 시료를 4 °C 혹은 40 °C에 1주일 보관한 이후 분석을수행하였으며, LCDR2, LCDR3, HCDR2 에서 deamidation이 발생함을 확인하였다. 실시예 12에 개시된 affinity variant들 에 대해서도분석을수행하여 deamidation발생 위치를확인하였다. 2019/117684 1»（：1/10公018/015953
13-2： 변이 항체 제조
Parental clone인 1564클론은 in silico분석에서 net charge가 -0.7이다. 보통 net char요가 <0 이나 >5.5 인 경우 체내에서 fast clearance에 취약한 것으 로 생각된다. 따라서 deamidation residue를 positive charge인 H, R, K등으로치 환한다면 deamidation도 없애고 전체 charge를 올려서 fast clearance를 막을 수 있을 것으로 생각하였다. 따라서 deamidation이 발생하는위치를도 18b와같이 치 환한 mutant를생산하였다.
Deamidation residue 없애는 작업- 아래의 residue로 치환한 mutant 생산하 였다.
1）아미노산서열에서 Asn을 Asn과유사한 D혹은 Q로바꾸었다. 결합력에 변 화가없는것으로확인되면해당 residue들은모두 Q로치환한다.
2）사용된 parental 클론의 net charge는 -0.7. fast clearance 가유발되는 net charge는 <0혹은 >5.5라서 Charge가 positive로바궐수록유리하다. 따라서 LCDR3의 deamidation발생 residue인 N95a는 positive charge를 띠는 H, R, K로치 환하였다.
총 7개 mutant들은 parental 1564클론과비교했을때, IGF1R ECD에 대한결 합력에 큰 변화가없으면서 Peptide mapping에서 deamidation0] 사라졌다. 이는도 18c에 명시되어 있다. 아울러， H,R,K로바꾼 mutant는 net charge의 상승으로 체 내에서 clearance의 감소로인한 PK증대 효능이 예상된다. 2019/117684 1»（：1^1{2018/015953 실시예 14. 다양한형태의 항- IGF1R항체의 제조
14-1: 항- IGF1R minibody형태의 항체 제조
실시예 11내지 13에서 확보한 IGF1R특이적 단일클론 파지 항체의 scFv전 체를 Fc의 C-말단에 연결하여 미니바디를 제조하였다. 이를 위해 표 12에 개시된 5 scFV의 아미노산서열을 암호화하는 핵산서열을 제조하고, 이 서열을 제한효소로 절단하여, Fc를코딩하는핵산을포함하는 pcDNA기반의 발현벡터에 클로닝 하였다.
14-2： 항- IGF1R bivalent 형태의 항체 제조
실시예 11내지 13에서 확보한 IGF1R특이적 단일클론 파지 항체의 scFv전 10 체를, 치료항체 IgG형태의 C-말단각각에 두개를 연결한 bivalent 형태를제작하 였다. 이를위해 표 12에 개시된 scFV의 아미노산서열을 암호화하는핵산서열을 제조하고， 이 서열을제한효소로절단하여， 치료항체를코딩하는핵산을포함하는 pcDNA기반의 발현벡터에 클로닝 하였다.
15 14-3： 항- IGF1R IgG (Full-IgG) 형태의 항체 제조
실시예 11 및 12에서 확보한 IGF1R특이적 단일클론파지 항체 중에서 1564 항체 및 F06 항체의 서열을 전체 IgGl (Full IgG) 형태로 변환하기 위해， 중쇄와 경쇄 영역의 유전자서열을합성하였다 (제노텍). 합성한중쇄 및 경쇄 유전자는발 현벡터에 클로닝하였다. 항- IGF1R scFv 1개가연결된 중쇄 하나, 그렇지 않은중쇄 20 하나， 그리고 공통된 경쇄로 구성된 구조를 갖는 monovalent 형태가 들어가 있어 2019/117684 1»（：1^1{2018/015953 monovalent 형태의 항체를제조하였다.
14-4： 항-IGF1R scFv monovalent형태의 항체 제조
실시예 14-1이 중쇄 두개의 Fc의 C-말단각각에 항- IGF1R항체가 scFv형태 로 결합한 minibody 형태라면 , 당 실시예에서는 중쇄 중 한 곳의 Fc C-말단에만 scFv 한 개가 결합한 monovalent 형태로 항체를 실시예 11 내지 13에서 확보한 IGF1R특이적 단일클론파지 항체 중 1564, F06, ⑶ 4, VH5, VH16, VH35, VH9, VH2, VH7, VH32을 Fc C_말단중한곳에만결합시킨 벡터 , C-말단에 항- IGF1R항체가결 합되지 않은 벡터를 제작하였다. 해당 Fc들 안에는 knob-into-hole mutat ion을 도 입하여 세포에서 항체 생산시 heteromeric형태가제작되도록하였다.
14-5： 다양한항- IGF1R항체의 발현 및 정제
실시예 14-1내지 14-3에서 제조된 벡터를 다음과 같이 세포에 도입하였다. 구체적으로， CH0-S 세포를 CD-CHO (Gibco, 10743) 배지에 1.5 X 106 cel ls/ml로농도를맞춘후， 8% C02 , 37°C에서 1일 동안배양하였다. DNA형질주입 당일 2.5-3 X 106 cel ls/ml로자란세포를 1% DMS0가포함되어 있는 CD-CH0배지를 이용하여 2.1 X 106 cel l s/ml의 농도로준비한후, 8% C02 , 37 에서 3 hr 배양하 였다. 3000 rpm에서 15 min원심분리 후, 상등액을제거한후， 2.5% FBS가포함된 RPMI 1640배지에 재현탁하였다.
이어서， 벡터의 조합을 배지 ml당 l//g씩 Opt i -MEM 배지에 희석하고， PEI 2019/117684 1»（：1^1{2018/015953
(Polysciences , 23966 , stock농도 : 1 mg/ml)는배양배지 ml당 8 jig희석하였다. DNA 및 PEI 혼합물을섞어 상온에서 10 min동안정치한후 세포가포함된 플라스 크에 넣은후, 5% C02 , 37°C, 100 rpm으로 4 hr 배양한후,배양볼륨의 동일한볼 륨의 CD-CH0배지를넣어준후， 8% C02 , 37 °C, 110 rpm에서 4일동안배양하였다. 상기 얻어진 배양액을， 평형화완충액 (50 mM Tris-HCl, pH7.5, 100 mM NaCl) 을통과시켜 평형화한 Mab selectsure (GE healthcare, 5mL)에 통과시켜 발현된 항 체가 컬럼에 결합하도록 하였다. 이 후, 50mM Na-citrate (pH 3.4), 100 mM NaCl 용액으로 용출시킨 후， 1M Tris-HCl (pH 9.0)을 이용하여 중화시켜 최종 pH가 7.2 가되게 하였다. 이후 완충액을 PBS (phosphate buffered saline, pH 7.4)로 교환 하여 순도가높은 경우 제형 후 -20 °C에 냉동보관하였으며,추가 정제가필요한 경우추가정제 시까지 4°C에 보관하였다. 추가 정제가 필요한 경우， Hi load superdex 200 (GE Healthcare, Cat . No. 28-9893-36)을 사용하여 정제했으며， 다양한 다른 size exclusion chromatography 를사용하여 정제할수 있다.평형화 버퍼 (lx Phosphate buffered saline pH 7.4, Gibco, Cat. No. 10010-023)을사용하여 평형화시킨 후， 1차 정제가완료된 시료 를컬럼에 로딩하였다.정제 완료된시료는제형 후 -20 °C에 냉동보관하였다.
14-6： 항 a-syn (알파-시누클레인)과의 이중항체 제조 본발명에 따른항 IGF1R항체를 링커 (서열번호 172)를사용하여 중쇄가변영 역과경쇄가변영역을 연결하여 scFV로 제조하고， 하기 표에 기재된 항 a-syn항체 2019/117684 1»（：1^1{2018/015953 의 완전한형태의 IGG항체의 중쇄 불변영역의 C말단에 링커（서열번호 173）를통 해 연결하여 이중 항테를 제조하였다. 본 실시예에서는 항 a-syn항체의 완전한 형태의 IGG항체 1분자당， 항 IGF1R항체의 scFv형태 한개 분자를 연결하여 제 조한 monoval ent 항체와. 항 IGF1R항체의 scFv형태 2개 분자를 연결하여 제조 한 bival ent항체를각각제조하였다. 본실시예에서 이중항체 제조를위해사용 한항 a-syn항체의 예시적 서열을하기 표에 나타내고, 이건발명에 따라제조한 이중항체의 재조합중쇄 사슬의 조합및 경쇄를하기 표에 기재하였다. 이후실 시예에서 하기 예시된 이중항체에 대한실험을수행하였다. 이중항체 맺에 사용된 3- 11항체의 중쇄 및 경쇄서열
Figure imgf000186_0001
Figure imgf000187_0001
Figure imgf000188_0001
¥() 2019/117684 1»(：1/10公018/015953
Figure imgf000189_0002
이중항체의 조합설명
Figure imgf000189_0001
2019/117684 1»(：1^1{2018/015953
Figure imgf000190_0001
실시예 15. 항- IGF1R항체의 IGF1R특이적 결합력 분석
15-1： Minibody형태 항- IGF1R항체의 IGF1R에 대한결합력 분석 (ELISA) 실시예 14-1에서 제작한 996, 1226, 1564, MKJP2클론의 minibody형태가재 조합 IGF1R에 대한 결합력 및 농도 의존적으로 결합하는지 여부를 확인하고자 ELISA분석을수행하였다. 2019/117684 （그1/10公018/015953 구체적으로， 항체 결합 대상인 인간 재조합 IGF1R은 extracel lular domain(ECD)로서， R湖 systems에서 구매하였다 (6630-GR八: F) . 96 -웰 ELISA plate에 (Nunc-Immuno Pl ates , NUNC, Rochester , NY) 인간 IGF1R을 PBS버퍼에 1 ug/ml로희 석하여 웰당 100 ul 넣은뒤， 4°C에서 16시간동안반응하여 코팅 후, 상등액을제 거하였다. 3% BSA (bovine serum albumin)가포함된 PBS버퍼를 웰당 200 ul 넣고 로 2시간동안반응시켜 비 특이적인결합을차단시켰다.
실시예 14-1에서 제조한 996， 1226， 1564, MKJP2클론의 minibody항체를최 고농도 20 nM을기준으로 3배씩 희석하여 12포인트를 만든 뒤， 각 웰에 100 y 1 씩 옮긴 후， 상온에서 1시간처리 후에， Tween20이 0.05%함유된 PBS버퍼를 이용 하여 4회 세척하고 , mini body에 존재하는 human Fc를 인지하는 항- human HRP를 블 로킹 buf fer에 1:5000으로희석하여 각웰에 100 ul씩 옮겨 1.5시간동안상온에서 반응시켰다. 다시 PBS-T(Tween20 0.05%) 300 ul를 이용하여 4회 세척한 이후， TMB (Tetramethylbenzidine, Sigma, T0440)를 사용하여 발색 시켰다. 효소반응을 0.5 mol/L의 황산에 의해서 중지시키고， 마이크로 플레이트 리더기 (molecular devi ce) 를이용하여 450nm에서 흡광도를기록 및 분석하였다. 상기 실험결과를도 la에 나 타냈다.
minibody 4종클론이 인간 IGF1R재조합단백질에 농도의존적으로결합하고， 구체적으로， ffiJP2가가장우수한 결합력을， 그 다음에 996과 1564가 비슷한 결합 력을 보임을 확인하였으며， 1226은 그보다 약간 떨어지는 결합력을 보임을 확인하 였다. 2019/117684 1»（：1^1{2018/015953
15-2： : IGF1R항체의 종간교차반응성의 ELISA분석
실시예 14-2의 방법에 따라 제작한 1564항-IGF1R항체와 실시예 11-3에서 확보한 항-IGF1R항체들의 종간교차 결합 여부를 ELISA기법을 통해 분석하였다. 이를위해， 우선， 인간， 원숭이， 마우스 및 렛트 IGF1R항원을 1 ug/ml로희석하여 각웰에 100 씩 넣고, 4 °C에서 15시간반응하여 플레이트바닥에 코팅되게 하였 다. 상등액을제거한후, 3% BSA가포함된 PBS버퍼 200 ul를각웰에 처리하여 비 특이적인 결합을 차단하였다. 항-IGF1R 항체를 최고 농도 400 이로 하여， PBSB (BSA 3% in PBS)에 5배씩 희석하여 상기 각웰에 처리한후， 37 °C에서 1시간반응 하였다. 이어 PBS버퍼를 이용하여 5회 세척한후， 결합된 항체의 Fab부분을 인지 하는항-인간 Fab HRP를 1:20000으로희석하여 각 웰에 100 ul처리한후 37 °C에서 1시간 반응시켰다， 이어 PBS 버퍼로 5회 세척하여 TMB (Tetramethylbenzidine, Sigma, T0440)를사용하여 제조자의 방법대로 발색시켰다. 효소반응을 0.5 mol/L의 황산에 의해서 중지시키고, 마이크로플레이트 리더기 (Molecular device)를 이용하 여 450nm에서 흡광도를측정하였다. ELISA수행 시 샘플이 많은 경우는플레이트 를 2개로나누어 진행하였으며， 실험결과는다음표 12에 나타냈다.
구체적으로， 표 12에서 인간 IGF1R에 대한 이중특이항체들의 ELISA 결과， 1564 IgG와이중특이항체들의 인간 IGF1R에 대한 ELISA결과， 마우스 IGF1R에 대한 이중특이항체들의 ELISA 결과, 래트 IGF1R에 대한 이중특이항체들의 ELISA 결과， 원숭이 IGFm에 대한이중특이항체들의 ELISA결과를하기 표 12에 정리하였다. 2019/117684 1»(：1^1{2018/015953 아래 실험결과는 다양한 종의 동물모델을 이용하여 효능을 평가할 수 있는 장점을보여주는 것으로， 본원발명에 따른항체를 이용하여 다양한종의 질환모델 을통한치료제를효능평가가가능함을알수 있다.
[표 12] 다양한종의 比요에 대한항체 결합력의 此比쇼분석결과
Figure imgf000193_0001
2019/117684 1»(：1^1{2018/015953
Figure imgf000194_0001
* : not avai lable
**201: scFv form of Hercept in biosimilar
15-3： Affinity variant의 IGF1R에 대한 결합력 분석 (FACS)
실시예 12에서 제작된 affinity variant들의 결합력을 IGF1R ECD단백질에 대 한 ELISA수행 및 MCF-7에 대한결합력을 FACS로분석하였다.
1차클론들에 대한분석으로, 표 13은 1차선별된 해당클론들의 이중특이항 체 형태에서의 IGF1R ECD단백질에 대한결합 ELISA분석 결과이며， 표 14는 MCF-7 세포주에 결합을 FACS로분석한결과이다.
[표 13] 1차선별된해당클론들의 이중특이항체 형태에서의 IGF1R ECD단백 질에 대한결합此 쇼
Figure imgf000194_0002
2019/117684 1»(：1/10公018/015953
Figure imgf000195_0002
Figure imgf000195_0001
Figure imgf000195_0003
그 결과， 1^06이 가장 parental 클론 (1564 클론) 대비 세포 결합에서 가장 높은 결합력을 가진 클론으로 선정되었고 (affinity matured) , C04는 parental (1564 클론) 보다 세포 결합력이 가장 떨어지는 클론으로 선정되었다 (affinity reduced) .
2차클론들에 대한분석으로， 표 15는 2차 제작 방법에서 만들어진 클론들의 2019/117684 1»(：1^1{2018/015953 이중특이항체 형태에서의 犯 ECJ）단백질에 대한결합此比쇼이다.
［표 15］ 2차선별클론의 比!? 0단백질에 대한此比쇼결과
Figure imgf000196_0001
2차 제작된 클론들 중 생산성 및 물성이 현저히 떨어지는 클론들을 제외한 분석을수행할클론들을표 16과같이 선정하였다.
［표 16］ FACS분석을수행할클론들
Figure imgf000196_0002
2019/117684 1»（：1^1{2018/015953
Figure imgf000197_0004
도 12（：는해당클론들의 ¾0 7세포주에의 결합을
Figure imgf000197_0001
분석한 결과이며， 분석 클론들
Figure imgf000197_0002
클론인 1564대비 1 -7에 대한결합력이 떨어졌다.해 당 결과는, 此比쇼에서 결합력 저하를 보인 클론들이
Figure imgf000197_0003
에서도 결합력 저하를 보 임을보여준다.
선별된 항체 클론은卵6, 004, 쌔2, 쌔5, 쌔7, 쌔9, 쌔16， 쌔32_이며 , 이들 항체에 대한 중쇄 가변영역 및 경쇄 가변영역에 대한 아미노산 서열은 상기 표 5 및표 6에 나타냈다. 15-4： Human IGF1R에 대한 BIAcore분석
본발명에 따른항체와인간 IGF1R간의 결합력을분석하고자하였다.
1564클론의 IgG형태에 대해서 SPR분석으로인간 IGF1R에 대한결합정도 를 분석하였다. 항원인 인간 IGF1R ECD에 결합된 His tag에 대한 항- his 항체를 acetate pH4.0 buffer에 20 y g/ml 로 희석한 뒤， CM4 chip에 amine coupl ing방법 으로 reference/ analytic channel에 target RU를 10,000 RU로 immobilize하였다. Capture 동안， running buffer로는 PBS를 사용하였다. Flow rate은 30 yL/min을 2019/117684 1»（：1^1{2018/015953 유지하였다· Association/dissociation 동안 f low rate는 40 uL/min， running buffer로는 PBS를 사용하였다. association/disssociat ion은 각각 5분, 20분 이었 다. 분석은， basel ine 1， act ivation (EDC+NHS) , 인간 IGF1R loading, quenching (1 M Ethanol amine) , basel ine 2, associat ion, dissociation순으로 이루어졌다. Evaluation은 bivalent 모델을 사용하였으며， Biacore T200 Evaluation software
(version 1.0， S/N： 04Y15X11-0149)를사용하여 분석하였다.
분석 결과， 1564 IgG항체의 는 2.5305 X 10-9 이으로, F06 IgG 항체는 4.7802 X 10-7 nM으로확인되어， 모두인간 IGF1R에 높은결합력을보임을확인하였 다. 분석의 결과는도 lib이다. 특히 1564클론을 IgG형태로제작하였을때 인간 IGF1R에 2.5305 X 10-9 nM의 해리 상수를보임을 확인하여， 1564는그 형태에 따라 결합력에 큰변함이 없음을확인하였다
실시예 16. 항- IGF1R항체의 인간 IGF1R를발현하는세포주및 뇌 내피세포 (brain endothelial cell)에 대한결합력 분석
16-1： MCF-7에 대한 FACS분석
실시예 14-1에서 제조한 996， 1226, 및 1564클론의 minibody형태가， 세포 표면의 endogenous 한 IGF1R에 결합하는지 확인하기 위하여, 인간 IGF1R를 발현하 는 세포주 및 뇌내피세포 (brain endothel ial cel l)에 대한 결합력 분석을 FACS로 수행하였다. Periplasmic extract와 IGF1R이 과발현한다고 알려진 MCF-7, 유방암 세포주와의 결합정도를 FACS로확인하였다.
구체적으로， 샘플 당 0.43 x 10E6의 MCF-7세포주에， 상기 3종의 minibody 2019/117684 1»（그1^1{2018/015953 를각각 20 ug/ml로 희석 후， 처리하여 4°C에서 1시간반응시켰다. PBS버퍼를 이 용하여 2회 세척 후, 항- human FITC를 1:500으로 희석하여 처리, 4°C에서 1시간반 응시켰다. 다시 PBS버퍼를 이용해 2회 세척 후， FACSCal ibur 기기를 이용하여 항_ IGF1R minibody가 결합된 정도를 측정하였다. 대조군으로 secondary antibody 만 처리한 MCF-7세포를사용하였다. 상기 실험결과를도 12a에 나타냈다.
실시예 12 및 실시예 14-2로 제작된 A02, A06, A07, B01, B02, B09, B10, ⑶ 4， D03, E06, F06, H04(Gly) , H04(Val ) , VH2, VH5, VH7, VH9, VH16, VH32, VH35 를상기와동일한 방법으로 MCF-7에 대한 결합력을 분석하였다. 1564클론을 실시 예 14-2 방법으로 제작하고 parental 클론으로 비교하였으며， secondary ant ibody 만처리한 MCF-7세포를대조군으로사용하였다. 분석 결과는표 14및도 12c에 나 타냈다.
상기 실험 결과에 따라， 해당 샘플의 MFKMean Fluorescence Intensity)로 나타냈고， 테스트한 3종의 minibody 내의 scFv 및 이중특이항체 형태의 aff inity variant 및 parental 클론 (1564클론)이 세포 표면에 발현되는 endogenous IGF1R 에 특이적으로결합함을확인하였다. 해당결과는상기 예에서 확보된 클론들이 체 내에 실제로 존재하는 형태의 IGF1R에 결합하여 의도한목적으로사용될 수 있음 을보여주는결과이다.
16-2： JIMT-1및 BT474에 대한 FACS분석
실시예 16-1에서 사용한 MCF-7세포주를 대신하여 , JIMT-1 및 BT474유방암 2019/117684 1»（：1^1{2018/015953 세포주를사용한것을제외하고는실질적으로동일한방법으로실시예 14-1에서 제 조한 996， 1226, 및 1564 클론의 minibody 형태가， 세포 표면의 endogenous 한 IGF1R에 결합하는지 확인하였다. 상기 실험결과를도 12a에 나타냈다.
상기 실험 결과에 따라, 해당 샘플의 MFKMean Fluorescence Intensi ty)로 나타냈고， 테스트한 3종의 minibody내의 scFv가 IGF1R발현 다양한세포주표면의 endogenous IGF1R에 특이적으로결합함을확인하였다.
16-3： 마우스뇌 내피세포에 대한 FACS분석
실시예 14-2방법으로제작한 1564클론의 이중특이항체 형태와실시예 14- 3방법으로제작한 1564클론의 IgG형태가마우스의 뇌 내피세포인 bEND.3에 결합 하는지를분석하였다. 이 때 secondary항체만처리 그룹및 치료항체 단독 IgG (CH11F11) 처리 그룹을 음성대조군으로 사용하였다. FACS 분석법은 실시예 16-1 및 16-2와동일하게수행하였다. 분석 결과는도 12b에 나타냈다.
시험한 테스트클론모두음성 대조군을 제외하고 bEND.3에 결합력을 나타 냈다. 해당결과를통해 다양한형태의 1564클론이 뇌 내피세포표면에 발현하는 IGF1R에 특이적으로결합함을확인하였다.
실시예 17. 항- IGF1R항체의 intracel lular internal izat ion분석
17-1: MCF-7 internal i zat ion assay - 1564, 996, 1226, MKJP2 (minibody) 실시예 14-1에서 제조한 996, 1226, 1564및 MKJP2클론의 minibody형태가， IGF1R를 발현하는세포주에서 intracel lul ar internal i zat i on되며, 세포내로 도입 2019/117684 1»（：1^1{2018/015953 된 항체는 분해되지 않고 RMT Pathway을 거치는지를 확인하고자 하였다. 항- IGF1R 항체가 BBB통과능을 향상시키는셔틀로사용되기 위해서는 해당 항체가 BBB를 구 성하는 brain endothel ial cel l 내로 internal ize됨이 선행되어야한다.
IGF1R을발현하는 MCF-7세포주를 이용하여 발명에 따른항체들이 세포내로 5 internal ize 되는지를 분석하였다. 구체적으로， 8 - wel l sl ide chamber 내에 30, 000개의 MCF-7세포주를 plating한뒤， 1일간배양하였다. 실시예 14-1에서 제 조한 996, 1226, 1564및 MKJP2클론의 minibody항체를 각각 5 y g/ml씩 4°C에서 각 wel l에 2시간동안 처리하고 차가운 DMEM배양액으로 3번 세척하고， Alexa488- conjugated ant i -human Fc항체를역시 4°C에서 1시간처리하였다.
10 항체 complex의 internal izat ion을 테스트하기 위하여 해당 plate를 CO2 incubator로옮겨 37°C에서 30분간 incubat ion하였다. 100%메탄올을 넣어 culture 를 고정함과동시에 반응을 종료하였다. 고정 후에는 PBS로 3번 세척하였다. 형광 현미경 상에서 항체의 internal ized정도를 green fi lter 영역 (Alexa488)에서 이미 징하였다. 이미징 시에， DAPI를 이용하여 세포내 핵을 염색하여 각세포의 위치를
15 확인하였다. 상기 실험결과를도 13a에 나타냈다.
상기 실험 결과로부터， MCF-7세포주를 이용한실험에서도 테스트한 4종항 체 모두 internal izat ion이 잘 일어남을 볼 수 있었으며， 특히 MKJP2와 1564의 internal izat ion이 다른클론에 비해 많이 일어나는것을알수 있었다.
20 17~2： MCF-7 internalization assay - C04, F06 , VH5, VH16 , VH35, VH9, VH2, 2019/117684 1»（：1^1{2018/015953
VH7, VH32
IGF1R에 대한결합력을변화시킨 1564 variant 들의 세포표면 IGF1R결합을 분석하기 위해 IGF1R을 발현하는 MCF-7 세포주를 이용하여 FACS 분석을 하였다. scFv형태의 이중항체로 제작된 IGF1R항체를 10 ug/mL농도로 2 X 10E5의 MCF7 세포에 30분간 처리하였다. 1% BSA가 첨가된 PBS 버퍼로 세척한 후 인간 항체를 detection하는 FITC가결합된 2차항체를 1시간동안처리하였다. PBS버퍼로세 척한 후 FACS 분석을 통해 결합력이 변화 다양한 variant 들의 세포외 결합 및 internal ization을확인하였다.
표 17의 결과 처럼 1564 IGF1R 항체가 포함된 이중항체는 냉장 조건보다 37 °C 조건에서 internal ization 이 증가하여 intensity가증가됨을 확인하였으며 세포결합정도가높았던 F06클론또한 internal izat ion이 증가함을확인하였다. 이러한결과는 1564 variant 들이 세포에 잘결합하여 결합의존적으로세포내로 internal ization됨을시사하는것이다. [표 17]
Figure imgf000202_0001
2019/117684 1»(：1^1{2018/015953
Figure imgf000203_0001
17-3: 인간 brain endothelial cell에 대한 internalization분석
실시예 14-2및 14-4에서 제작한 1564클론의 bivalent 및 monovalent 형태 가 인간 유래 brain endothelial 세포 (primary human microvascular brain endothelial cell (HMBEC))로 internalize 되는지 분석하였다. 치료 항체 IgG (11F11)를음성대조군으로사용하였다.
HMBEC (Cell Systems, cat#： ACBRI376)을 12 웰플레이트에 90% confluency 로 플레이팅한 뒤 테스트 항체를 투여하였다. 그 다음 날 4% 파라포름알데히드로 고정 후 PBS 린스 후에 3% BSA와 TritonX가 포함된 solution을 50분간 사용하여 blocking및 permeabi 1 i 근하였다. PBS로 린스후 인간 Fc에 대한항체 (Goat ant i- human 항체)를 2시간 30분간 투여하고 PBS 린스 후， 해당 primary 항체에 대한 secondary항체를 1시간동안투여하였다. PBS 린스후， 핵 염색을 위하여 1:1000 으로 희석된 농도로 Hoechst를 10분간 staining하였다. 결과물은 LSM 780 NLO EC Plan-Neofluar 100X / 1.3 Oil 조건으로공초점 현미경으로분석하였다. 상기 실험 결과를도 1¾에 나타냈다. 2019/117684 1»（：1^1{2018/015953
1564 클론의 bivalent 및 monovalent 형태는 음성대조군인 치료 항체 (11F11) 대비 증가된 internal izat ion을보여주었다. 이 결과는, 상기에 기술된 항 -IGF1R항체가치료항체와연결된 다양한형태의 이중특이항체로서， BBB를구성하 는 brain endothel ial cel l 안으로 해당치료항체를효과적으로 internal ize시킬 수 있음을, 따라서 궁극적으로 해당 치료 항체의 BBB통과능을 증대시킴을 시사한 다.
17-4： 인간 brain endothel ial cel l 내에서 cel lular fate의 분석
만일, 해당 항체가 internal ize 된 후 세포 내의 리소좀 관련 마커와 colocal ize한다면 해당항체는 brain endothel ial cel l 내에서 분해되어 버리기 때 문에 요표묘를 통과하지 못한다. 이와 반대로, exocytosis 와관련된 early endosome 혹은 BBB 통과와 관련되었다고 알려진 마커와 colocal ize 한다면, 해당 항체는 brain endothel ial cel l로 internal ize된 투 뇌 쪽으로 빠져나가는 receptor- mediated transcytosis에 의해 BBB를통과할것으로 예상된다. 실시예 17-2에서 테스트된 항체 중 1564 bivalent형태를 동일한 방식으로 HMBEC에 처리한 뒤 세포 내에서 해당 항체들이 어느 cel lular component와 colocal ize하는지 분석하였다. 다만， blocking 및 permeabi 1 izat ion후 투여 항체 를 detect ion하는 Goat ant i -human항체와 함께 , 다음의 항체들을 각각동시에 투 여하였다.
- Ant i -Cat heps in D: 리소좀마커 2019/117684 1»（：1^1{2018/015953
- Ant i-Caveol in-1： caveol in-medi ated transcytosi s 마커 （BBB통과의 주 요메커니즘으로생각됨）
- Ant i-EEAl : ear ly endosome마커
나머지 방법들은실시예 17-2와동일하되， 상기의 마커에 대한 secondary항체들을 각각처리하였다.
분석 결과는 도 13c에 나타냈다. 1564 클론은 이중특이항체 형태에서 모두 Cathepsin D와 colocal i ze하지 않았으며 , 대신 caveol in-1 및 EEA1과세포막및 세 포 내부에서 colocal i ze하였다. 이 결과는, 1564 클론이 internal i ze 된 후 세포 내의 분해 메커니즘을거치지 않고 RMT를통해 BBB를통과할수 있음을나타낸다. 실시예 18. 항- IGF1R항체의 IGF1R신호전달에 미치는영향분석
18-1: MCF-7세포주의 IGF1R에 의한 prol i ferat ion assay
본 발명에 따른 항- IGF1R항체가 IGF1R （IGF1 수용체）와 그 리간드인 IGF1 간의 결합을방해하는지 여부를， IGF1에 의한세포증식 효능을 이용하여 확인하였 다.
실시예 14-1에서 제조한 996, 1226, 1564 및 MKJP2클론의 minibody항체를 각각 400 부터 5배씩 희석하여 희석 샘플을 제작 후， 20 ng/ml 농도의 25 y 1 IGF1에 각 25 u 1 씩 처리하였다. IGF1R을 발현하는 MCF-7세포주를 배양하고， 실 험 당일 배지를 제거하고 계대하고， IGF1과 테스트 항체가분주되어 있는 96 wel l plate의 각 wel l 당 20, 000개씩（50 y 1에 해당） 처리하였다. 2019/117684 1*（그1^1{2018/015953
3일간적절한온도및 습도에서 배양하다가세포생장정도를측정하기 위하 여 CCK-8 reagent를 10 y 1씩 처리하고 C02 incubator에서 4-5 시간 incubation하 였다. 그뒤 꺼내어 spectrophotomer의 450 nm파장에서 흡광도를측정하였다. 상기 실험결과를도 14a에 나타냈다.
상기 실험 결과로부터， 본 발명에 따른 항체는， IGF1의 IGF1R에 대한 signal ing에 의한 MCF-7의 세포 증식을 저해하지 않는 것으로 확인되었다. 대조군 으로사용한 Imclone사의 항- IGF1R항체는 IGF1에 의한 MCF-7의 세포 증식을 처리 농도에 비례하여 저해하였다. 따라서， 본 발명의 항체는 BBB를 구성하는 endothel ial cel l에 발현하는 IGF1R에 결합하여 BBB통과능을가지나， 동시에 체내 IGF1에 의한 signal ing을 저해하지 않는 항체이므로， 본 발명에 따른 항체는 BBB 셔틀로사용될수있음을확인하였다.
18-2: MCF-7세포주의 IGF1R에 의한 signal ing component의 저해 분석
본 발명에 따른 항- IGF1R 항체가, IGF1R 발현 세포와 결합하는 IGF1이 signal ing을 세포 내로 전달할 때 그 signal ing의 receptor 및 downstream signal ing component에 관여하는지 여부를 확인하고자실험하였다. 즉， IGF1R을발 현하는 MCF-7 세포주에 항- IGF1R 항체를 투여하고， 이에 의한 세포 내의 전체 IGF1R, 인산화된 IGF1R, IGF1R의 downstream factor인 전체 Akt , 인산화된 Akt 양 을분석하였다.
MCF-7 cel l을 배양하다가, 항- IGF1R 항체를 처리 20시간 전에 그 배양액을 2019/117684 1»（：1^1{2018/015953 serum이 불포함된 배양액으로 변경하였다. 실시예 4-1에서 제조한 996， 1226， 1564 및 MJP2클론의 minibody항체를각각 100이를상기 MCF-7세포주에 처리 후 1시 간뒤에 200 ng/ml의 IGF1을처리하였다. 20분뒤， PBS로세포를씻은뒤 protease 와 phosphatase inhibitor cocktai l이 첨가된 M-PER로 세포를 용해하였다. BCA assay kit를사용하여 단백질 농도를측정한뒤 12.5 u g의 단백질을 SDS-PAGE gel 에 로딩하여 electrophoresis 시킨 뒤， PVDF membrane에 transfer하였다. 블로킹은
5%의 BSA가 포함된 PBST (0.1% Tween 20)와 함께 1시간 동안 gent le shaking으로 상온에서 수행하였으며, 그뒤에 IGF1R혹은 Akt에 대한 primary ant ibody를 4°C에 서 천천히 흔들면서 하룻밤 동안 처리하였다. beta act in ant ibody는 loading control로사용되었다. 세척한후에 secondary ant i body를 1시간동안상온에서 천 천히 흔들면서 처리한 뒤 세척하고, ECL solut ion 을 첨가하고, Image Quant Las 4000를이용하여 시그널을확인하였다. 상기 실험결과를도 14b에 나타냈다.
상기 실험 결과로부터， 본 발명에 따른항체는세포 내의 전체 IGF1R, 인산 화된 IGF1R, 의 downstream factor인 전체 Akt , 인산화된 Akt 양에 영향을주 지 않는것을확인하였다.
18 3： p]-T-r±i뇌니]피乂 으! IGF1R에 의 ¾： signal ing component ᄌ극해普석 본 발명에 따른 항- IGF1R 항체가， 마우스 유래 brain endothel ial 세포에 IGF!이 signal ing을 세포 내로 전달할 때 그 signal ing의 receptor 및 downstream signal ing component에 관여하는지 여부를 확인하고자실험하였다. 즉, IGF1R을발 2019/117684 1»（：1^1{2018/015953 현하는 것으로 확인된 bEND3 세포주에 실시예 14-2의 방법으로 제작된 11F11-1564, 3A9-1564 (CH11F11 와 ch3A9, a_syn 단독항체로서 대한민국 공개특허 2018-0081465 에 기재된 것) 및 실시예 14-3의 방법으로 제작된 1564 클론의 IgG 형태를 투여하 고， 이에 의한 세포 내의 전체 IGF1R, 인산화된 IGF1R, IGF1R의 downstream factor 인 전체 Akt, 인산화된 Akt 양을 분석하였다.
bEND3 cell을 배양하다가, 항- IGF1R 항체를 처리 20시간 전에 그 배양액을 serum이 불포함된 배양액으로 변경하였다. 실시예 14-2의 1564 및 MJP2 클론의 이 중특이항체를 각각 100 nM을 상기 bEND 세포주에 처리 후 1시간 뒤에 200 ng/ml의 IGF1을 처리하였다. 20분 뒤， PBS로 세포를 씻은 뒤 protease와 phosphatase inhibitor cocktail이 첨가된 구묘요로 세포를 용해하였다. BCA assay kit를 사용하 여 단백질 농도를 측정한 뒤 12.5 iig의 단백질을 SDS-PAGE gel에 로딩하여 electrophoresis 시킨 뒤, PVDF membrane에 transfer하였다. 블로킹은 5%의 BSA가 포함된 PBST (0.1% Tween 20)와 함께 1시간 동안 gentle shaking으로 상온에서 수 행하였으며, 그 뒤에 IGF1R 혹은 Akt에 대한 primary antibody를 4°C에서 천천히 흔들면서 하룻밤 동안 처리하였다. beta act in antibody는 loading control로 사용 되었다. 세척한 후에 secondary antibody를 1시간 동안 상온에서 천천히 흔들면서 처리한 뒤 세척하고， ECL solution을 첨가하고， Image Quant Las 4000를 이용하여 시그널을 확인하였다.
상기 실험결과를도 14c에 나타냈다.
상기 실험 결과로부터, 본 발명에 따른 항체는 세포 내의 전체 IGF1R, 인산 2019/117684 1»（：1^1{2018/015953 화된 IGF1R, IGF1R의 downstream factor인 전체 Akt , 인산화된 Akt 양에 영향을주 지 않는것을확인하였다. 실시예 19. 항- IGF1R항체의 무독성 분석
19-1： IgG형태 IGF1R항체의 ADCC분석
실시예 14-3에 따른항- IGF1R항체가 IgG형태로서， IGF1R발현세포의 표면 에 결합하여 IGF1R 의존적인 결합에 의해 세포 사멸에 영향을 주는지 확인하고자 실험하였다. 즉 IGF1R발현 세포주에 항- IGF1R항체인 1564클론이 결합했을때 자 연살해세포 (Natural ki l ler cel l , NK cel l )를 활성화시켜 IGF1R발현 세포에 악영 향을주는지를 ADCC reporter bi oassay ki t을사용하여 분석하였다.
IGF1R을과발현하는 MCF-7세포와낮은수준으로 발현하는 SKBR3세포를 배 양한후항체 처리 20시간전에 96웰플레이트에 wel l 당 5000개의 세포를분주하 였다. 배양한 세포는 4% low IgG serum 이 포함된 RPMI/1640 배지로 교환한 후 1564클론의 IgG형태를 133.3 nM부터 8배씩 희석하여 각 wel l에 첨가하였다. 안 정화시킨 ADCC ef fector세포를각 wel l에 첨가한후 6시간동안배양한투상온에 서 약 10분간방치한다. 미리 준비한 Bio-Glo luci ferase assay reagent를각 wel l 에 첨가한 후 PHERAster FS BMG LABTECH 장비로 luminescence 정도를 측정하여
ADCC유도정도를분석하였다. 상기 실험결과를도 15a에 나타냈다.
상기 실험 결과로부터， 본발명에 따른항체， 특히 1564클론은 IGF1R과발 현 세포주인 MCF-7 세포와 낮은 수준으로 발현하는 SKBR3 세포에 결합하나 2019/117684 1»（：1^1{2018/015953
effector세포에 의한 ADCC를유도하지 않음을확인하였다.
19-2： 항- IGF1R항체의 반복투여 후뇌 내 IGF1R레벨분석 BBB셔틀로사용되는 항체는 brain endothel ial cel l의 타겟 receptor에 결 5 합하여 치료항체의 통과능을높여주는 역할을하되, 해당 receptor 레벨에 변화를 주지 않아야한다. 타겟 receptor의 down regulation은해당타겟의 뇌에서의 역할 에 영향을주어 부작용을야기할수있다. 본원의 항- IGF1R항체가반복투여 후에도뇌 내의 IGF1R레벨에 영향을 미 치는지를분석하였다. 실시예 14-2에 따라 파킨슨 병 치료 항체와 1564클론이 연 10 결된 bivalent 형태의 이중특이항체와 파킨슨 병 치료 항체 단독， 그리고 음성 대 조군으로 IgG를 파킨슨모델 마우스에 3개월간 매주 반복투여한 뒤 그 뇌조직에서
*
의 IGF1R레벨을 western blotting으로분석하였다. 각그룹당 3마리의 마우스뇌 조직을 PBS로 perfusion후 homogenize한뒤 10 ug의 lysate를 4-12% Bis-Tris Gel에 로딩하고 running한뒤, PVDF membrane에 15 transfer하였다. 나머지 방법은실시예 19-1과동일하게수행하였다. 실험결과는도 15b에 나타냈다. 1564클론으로 구성된 이중특이항체는 파킨 슨병 치료항체 단독 및 IgG투여군과유사한레벨의 IGF1R을보여주었다. 이 결과 는， 1564클론이 반복투여 후에도뇌 내 IGF1R레벨에 심각한변화를야기하지 않 으며 따라서 해당항체는 BBB셔틀로사용될경우부작용이 낮을것으로예상된다.
20 2019/117684 1»（：1^1{2018/015953
19-3： 항- IGF1R항체의 투여 후뇌 내 분포분석
BBB셔틀은 brain endothel ial cel l 표면의 receptor에 결합하여 치료 항체 를뇌 내로전달하지만， 뇌 내의 정상세포표면의 receptor에의 결합은적어야한 다. 만일 BBB셔틀이 뇌 안에서 항원을발현하는정상세포에 다량결합한다면, 그 만큼해당셔틀에 결합된치료항체는질환타겟에 적게도달하게 될 것이다.
본원의 항- IGF1R 항체의 뇌 내 분포를 분석하기 위하여 실시예 21-2에서 수행한 in vivo실험 동물의 뇌에서 항- IGF1R항체의 분포를 면역염색법으로 분석 하였다. 1564클론의 bivalent 형태가투여된 SD rat을 transcardiac perfusion방 식으로 생리식염수를 이용하여 perfusion하였다. 좌반구를 10% neutral-buffered formal in에 24시간 동안 넣어 고정하였다. 뇌를 1XPBS로 린스하고 30% sucrose가 포함된 용액에 24시간동안 냉동시켰다. 뇌를 0CT에 넣은 뒤 얼리고 sect ion까지 -80 °C에서 보관하였다. Sect ion은 coronal 방향으로 25 // m두께로수행하였으며， 24 웰 페트리 디쉬에 0.1% sodium azide를 포함한 IX PBS에 모았다. 해당 조직을 free f loat ing방식으로 0.3 % Tween-20 이 포함된 Dako serum free protein block (X0909, DAKO) 과 1시간 동안상온에서 incubat ion하여 blocking 및 permeabi 1 ize 하였다. Primary 항체로는 1 :50 비율의 biot inylated 인간 Fc 항체 (BA3080, Vector Labs)를 처리 후 4 ¾에서 overnight incubat ion 하였다. TBS로 3번 wash 후 endothel ial cel l 에 대한항체인 RECA-1 (ab9774, AbCam)를 1 :2000 비율혹은 뉴런에 대한항체인 NeuN (MAB377, Mi l l ipore)을 1:250의 비율로 2시간동안 처리 하였다. Wash후， Alexa488 이 결합되고 각 항체에 대한 secondary항체를 45분간 2019/117684 1»（：1^1{2018/015953 처리하였다. wash 이투 sect ion을 유리 sl ide에 올린 뒤 Dapi가 포함된 ProLong Gold 혹은 Hoechst 33258이 포함된 Dako f luorescent mount ing medi a을 첨가하여 핵을 염색하였다. 공초점 현미경에서 대뇌피질 및 해마를 알맞은 형광파장을 이용 하여 분석하였다. 분석 결과는도 15c에 나타냈다.
해당결과는 1564클론이 결합된 이중특이항체는정상뉴런에 결합하지 않 으며, 대신 brain endothel i al cel l에 특이적으로 결합함을보여주었다. 따라서 본 원의 항- IGF1R항체는뇌 내의 정상세포에 결합하지 않고치료항체의 BBB통과능 만을증대시켜 부작용이 거의 없으며 치료항체의 치료효능의 향상을가져올 것으 로예상된다. 실시예 20. 항- IGF1R항체의 in vitro BBB통과능분석
20-1. sv-ARBEC유래 BBB모델에서 bivalent항체의 BBB통과능분석
실시예 11 및 12 유래 항체를 실시예 14-2로 제작한 이중특이항체의 in vi tro BBB 통과능을 Sv-ARBEC 으로 구성된 BBB 모델에서 평가하였다. Sv_AR別: C을 permeable membrane 위에 단일층으로 플레이팅하고 해당 BBB 시스템의 저항값 (TEER) 및 sucrose통과 정도를 바탕으로 해당 시스템의 integr i ty를 미리 평가하 였다. 이 때 sv-AI犯 EC은해당시스템의 integr i ty에 도움을주는 것으로확인된 래 트 astrocyte배양 medium (RAS-CM)을처리하였다. 테스트항체인 1564， 48G5, 54H4, 60H6, B11의 bivalent 이중특이항체를 membrane 위에 처리한 뒤 90분 후 bottom chamber에서의 항체량을 질량 분석으로 분석하였다. 질량 분석을 위해서 각 항체 2019/117684 1＞（그1'/1012018/015953
Fc및 scFv에서의 signature pept ide가분석된투사용되었다. 이 때 파킨슨 병 치 료항체 단독 ( 11F11) 및 해당항체에 Hercept in™의 바이오시밀러의 scFv형태를결 합시킨 이중특이항체를 음성대조군으로 사용하였다. 해당 시스템에는 BBB를 통과 하지 않는 것으로 알려진 A20. 1 항체 (nat ional research counci l 제작)를 통과시 켜 해당시스템의 검량한계선을 정하였다. 질량분석에서 도출된 결과값을선행문헌 에서 알려진 공식에 대입하여 Papp 값을 결정하였으며, 이 값은 in F/ fro에서의 BBB통과능장도를나타낸다.
분석 결과는 도 16a에 나타냈다. B11을 제외한 테스트항체들은 음성대조군 대비 높은 in vi tro BBB통과능을보였다. 특히 1564클론은 다른클론 대비 높은 BBB통과능을보였다. 이는 1564 , 48G5 , 54H4, 60H6클론들 및 클론들을연결한이 중특이항체의 in vivo BBB통과능이 단독항체 대비 높을수 있음을보여준다.
20-2. sv-ARBEC유래 BBB모델에서 monovalent항체의 BBB통과능분석
20-1과동일한모델에서， 실시예 14-4를바탕으로제작한 monovalent 항체와 bivalent 항체의 in vi tro BBB 통과능을 분석하였다. 1564 클론으로 제작한 bivalent , monovalent 항체 및 음성대조군인 파킨슨 병 치료 항체 (3A9)를 sv- ARBEC BBB시스템에 통과시킨 뒤 통과량을분석하였다. 분석 결과는도 16b에 나타 냈다.
1564 클론의 bivalent , monovalent 형태는 단독항체인 3A9 대비 모두 높은 in vi tro BBB통과능을보였으며， 특히 bivalent 형태의 통과능이 monovalent 형태 2019/117684 1»（：1^1{2018/015953 보다 높았다. 이는 1564 클론은 다양한 형태로 그것에 연결된 치료 항체의 in vitro BBB통과능을향상시킬수있음을보여준다.
20-3. 인간 IPSC유래 BBB모델에서 항- IGF1R항체의 BBB통과능분석
인간 stem cel l 유래 BBB모델은래트혹은마우스세포유래 BBB시스템 대 비 높은 저항값 (TEER)을보이며 BBB에서 확인된 다양한 마커들을모두 발현한다. 따라서 인간 stem cel l 유래 모델의 BBB tightness는동물 세포유래 BBB 대비 높 으며， 해당모델은인간 BBB를잘재현하고 있다.
인간의 양수에서 유래한 세포 (AF-iPSC)에 or iP/EBNAl episomal vectors encoding 0CT4, S0X2, c-Myc, KLF4, NANOG and LIN28등의 벡터를도입하여 iPSC로 reprogram하였다. 생성된 콜로니에 K0 DMEM/F12, KOSR, glutamax, NEAA, beta mercaptoethanol을 처리하여 pre-di fferentiat ion상태의 endothel ial cel l을 만든 뒤 serum free endothel ial differentiat ion medium 및 1% PDS, 20 ng/ml bFGF를 처리하여 brain endothel ial cel l로 분화시켰다. 양수세포의 획득 및 해당 세포를 이용한 BBB 시스템의 확립은 National Research Counci l에서 수행되었다. 저항값 및 sucrose 통과값으로 시스템의 integrity를 확인한 뒤， 항- IGF1R항체가 파킨슨 병 치료 항체와 scFv 형태로 결합된 이중특이항체 형태로 통과능을 분석하였다. 테스트 항체들은 1564 클론의 bivalent 형태， 1564 클론의 monovalent 형태, F06 클론의 bivalent 형태， C04 클론의 bivalent 형태였다. 파킨슨 병 치료 항체인 11F11은음성대조군으로사용되었다. BBB시스템을통과된 항체들은실시예 20-1과 2019/117684 1»（：1^1{2018/015953 동일한방법으로분석하였다.
분석 결과는 도 16c에 나타냈다. 테스트 클론들은 음성 대조군 대비 모두 높은 BBB통과능을 나타냈으며， 특히 F06 bivalent 및 C04 bivalent 는 단독항체 대비 최대 15배의 높은 BBB 통과능을 보였다. 해당 결과는 본원의 항- IGF1R 항체들이 인간유래 Bm시스템을 단독항체 대비 효율적으로통과함을보여준다. 실시예 21. 항- IGF1R 항체의 in vivo BBB 통과능 분석 (co-local ization assay)
21 1. minibody의 brain vessel과의 colocal izat ion
본발명의 항- IGF1R항체들이 in vivo에서 brain vasculature를따라분포하 는지를여부를확인하기 위하여 다음과같은실험을진행하였다.
구체적으로， 6-8주령 BALB/c mouse수컷의 꼬리 정맥에 PBS buf fer 혹은 10 mg/kg의 IgG control 및 실시예 14-1에서 제조한 996 , 1226 및 1564 클론의 minibody 항체를 각각 단회 투여하였다. 4시간 뒤 mouse brain을 충분한 양의 0.9 % NaCl 용액 및 4% par a formaldehyde로 intracardial ly perfuse하였다. 고정된 brain은 적출하여 20 y m으로 sect ion 후, 뇌 혈관과 IGF1R 테스트의 colocal izat ion을확인하기 위하여 혈관마커인 ant i-mouse CD31및 ant i -human Fc ant ibody로 co-staining 하였다. CD31은 Alexa 488이 conjugate된 secondary ant ibody로， human Fc는 Alexa 594가 conjugate된 secondary ant ibody를 이용하여， 형광현미경 하에서 이미징하였다. 2019/117684 1»（：1^1{2018/015953 상기 실험결과는도 17a에 나타냈다.
상기 실험 결과로부터， 본 발명에 따른 리간드 결합 비저해 클론 (non- blocking ant ibodies)들은 우수한 BBB통과능을 가짐을 확인하였으며, 항체가 뇌혈 관과 co local i zat ion하는 정도를 면역염색으로 분석하는 방법 (Neuron (2016) Yu_ Zuchero et al . )에 따라， 뇌조직을 혈관 마커 (ant i_CD31， 초록색)과 인간항체 (anti -human Fc, 붉은색)로 염색한 결과， 본원의 일예에 따른 리간드 결합 비저해 클론들은 IgG대조군에 비해 높은 colocal i zat ion정도를보였다.
21-2. 이중특이항체의 in vivo BBB통과능분석
본원 항- IGF1R항체의 in vivo BBB통과능을 normal rat에서 확인하려 하였 다. SD rat에 10 mg/kg혹은 30 mg/kg 의 파킨슨 병 치료 단독항체 (11F11) 혹은
1564 클론이 bivalent 형태로 결합된 이중특이항체 (11F11-1564)를 미정맥에 단회 투여 후 24시간째에 그 CSF 및 brain에서의 항체량을 질량 분석으로 분석하였다. 질량분석 방법은실시예 20-1에서의 방법과동일하였다.
1564클론이 결합된 이중특이항체는항 IGF1R항체가결합하지 않은치료항 체 대비 높은 CSF, brain통과능을보였으며 해당효능을 10, 30 mg/kg dose모두 에서 확인되었다. 이중특이항체는 30 mg/kg dose에서 단독항체 대비 최대 약 4.5배 이상의 brain으로의 통과능을보였다.
1564클론을실시예 14-2및 14-4에 따라 bivalent 및 monovalent 형태로제 작한뒤 상기와동일한방식으로 30 mg/kg혹은 60 mg/kg으로투여 후 24시간째에 2019/117684 1»(：1^1{2018/015953
CSF와 brain에서의 항체량을분석하였다. 1564클론이 결합된 두가지 형태의 이중 특이항체는 단독항체 대비 높은 CSF, brain통과능을보였다. 특히 bivalent 형태 는 monovalent 형태 대비 높은 BBB통과능을보였으며 , 이는 최대 약 5배의 brain 통과능증대였다.
도 17b의 결과는, 1564클론이 다양한형태로 치료항체에 결합되었을 때에 도해당치료항체의 체내 BBB통과능을향상시킴을나타낸다.
실시예 2에 따라제작된 1564클론의 affinity variant들은 parental 클론 대비 serum PK의 증대가 예상되었다. 따라서 serum내에 장기간잔존하여 계속적으 로 BBB유입량을유지함으로써 그 BBB통과능이 향상될 것으로기대되었다. 실시예 14-2에 따라 bivalent 형태 혹은 4-4에 따라 monovalent 형태로 제작된 affinity variant들을 SD rat에 30 mg/kg으로미정맥 투여한뒤 0， 24, 48시간째에 혈액을 안구정맥총에서 채취하였다. 테스트 항체들은 치료 항체의 backbone에 따라두 가 지 실험으로나뉘었으며, 실험에 사용된 해당 variant들의 이중특이항체는하기 표 18과같다.
[표 18]
Figure imgf000217_0001
2019/117684 1»(：1^1{2018/015953
Figure imgf000218_0001
혈액 내 항체량은 ELISA로 분석하였다. 96 웰 플레이트에 goat ant i -human Fc 항체를 코팅한 뒤, 적당량 희석된 시료를 처리 후 ant i -human Fab HRP conjugated항체로 detect ion하였다. 분석 결과는도 17d에 나타냈다.
그 결과， 1차 시험군에서는 1 4의 monovalent , F06의 monovalent , C04의 monovalent가 parental 1564클론의 bivalent 대비 길어진 serum PK를보였다. 2차 시험군에서는 VH35 bivalent 군을 제외하고 VH2 , VH5, VH7, VH9, VH16 , VH32 의 bivalent 형태들이 parental 1564 bivalent 대비 증대된 serum PK를보였다.
해당 그룹들의 BBB통과능을 분석하기 위하여 48 시간 째에 해당 래트에서 CSF를추출하여 동일한 ELISA로분석하였다. 분석 결과는도 17e에 나타냈다.
1차 시험군에서는 증대된 serum PK를 보였던 1564 monovalent , F06 monovalent , C04 monovalent 형태가 parental 1564 bivalent 대비 증대된 CSF항체 량을보였다. 2차시험군에서도 역시 증대된 serum 를보인 VH2, VH5, VH7, VH9 , VH16 , VH32 의 bivalent 들이 parental 1564 bivalent 대비 증대된 CSF 항체량을 보였다. VH35는 parental 1564 bivalent 대비 짧아진 serum PK및 CSF항체량을보 였다.
도 17d및 도 17e의 결과는 serum에서의 PK가지속적인 항체의 BBB유입으 로 인하여 항체의 BBB 통과능에 있어 중요한 요소이며, BBB 셔틀을 가지며 serum 2019/117684 1»（：1^1{2018/015953
PK가증대된 이중특이항체의 BBB통과능이 증가함을 보여준다. 특히 CSF항체량이 가장높은 F06 monovalent 형태의 경우, parental 1564 bivalent 대비 약 5배 정도 높은 CSF통과능을보였다. 실시예 18-2 및 18-3에서 1564 bivalent 항체가 CSF에 서 단독항체 대비 약 3배 증가된 CSF 통과능을 보이므로， F06 monovalent 형태는 단독항체 대비 최대 약 15배 증가된 BBB통과능을보일것으로예상된다. 실시예 22. IGF1R항체의 탈아미드화
탈아미드화 반응은 예를 들어 아스파라긴의 곁사이 팹티드 결합을 공격하여 대칭구조의 석시니마이드 중간산물을 만드는 것을 의미하며 이 중간산물은 가수분해로 인해 아스파라진산 혹은 이소아스파라진산 중 하나로 변하게 된다. 이러한 탈아민화 반응은 단백질의 지속적인 활성에 영향을 줄 수 있어 경쇄 및 중쇄 아미노산을 다른 아미노산으로 치환하여 탈아민화를 방지하는 동시에 장기간의 안정성을확보하고자하였다.
In si l i co 를 통해 확인한 탈아민화 부위를 확인하기 위해 40°C에서 1564 IGF1R항체를방치한후 Mass분석을통해 탈아민화정도를확인한결과도 18a처 럼 경쇄 CDR2와 CDR3 그리고 중쇄 CDR2 부위에서 4.6 47.3%의 탈아민화 반응이 일어남을 확인하였다. 탈아민화를 방지하기 위해 도 18b 처럼 각부위별로 아미노 산을치환하였으며 각아미노산치환에 따른 IGF1R단백질과의 결합력 변화를 확인 하였다. WT 1564와동일한 결합력을 보이는 돌연변이체를 선별하였으며 3개 또는 4개의 돌연변이를 적용한돌연변이체가 IGF1R결합력에 있어 WT 1564 와동일함을 2019/117684 1»（：1^1{2018/015953 확인하였다. 이러한돌연변이체의 도입은 제형버퍼 저장조건에서 결합력을유지하 며 장기적으로 안정한 형태를 유지할수 있음을 의미하는 것이다.-분석 결과는표 19에 나타냈다.
[표 19]
Figure imgf000220_0001
실시예 23. 항- IGF1R항체의 에피토프맵핑
23-1. 항- IGF1R항체와 boi led, nat ive IGF1R단백질의 ELISA
항- IGF1R항체가선형 혹은 conformat ional epi tope을 인식하는지 확인하고 자 하였다. 1的 4， 48G5, 54H4, 60H6, B11의 bivalent 이중특이항체과 nat ive 인간 IGF1R ECD 단백질 혹은 해당 단백질에 열을 가한 단백질 （boi led IGF1R）과 대한 ELISA를 수행하였다. ELISA 방법은 실시예 15에 나타난 방법과 동일하였다. 분석 결과는표 20에 나타냈다.
[표 20]
Figure imgf000220_0002
2019/117684 1»(：1^1{2018/015953
Figure imgf000221_0001
상기 클론들은 native 인간 IGF1R ECD에 실시예 15에서의 결과와유사한결 합력을보인 반면， 열을 가해서 3차구조를 파괴한 boi led 인간 IGF1R ECD에는모 두 결합하지 않았다. 이는 본원의 항- IGF1R 항체가 선형이 아닌 conformational epi tope에 결합함을의미한다.
23-2. 항- IGF1R항체의 에피토프맵핑
1564 클론의 Conformational epi tope을 분석하기 위하여 다음과 같이 alanine scanning을수행하였다. IGF1R발현도가낮은 것으로 확인된 난소암세포주 인 0VCAR3세포에 N-말단에는 eGFP tag이 융합되고 C-말단 kinase domain은 제거된 IGF1R 라이브러리를 발현시켰다. IGF1R 라이브러리는 IGF1R 표면의 잔기들이 alanine으로 치환된 돌연변이들을 포함한다. 준비된 라이브러리를 0VCAR3 세포에 transfect ion하였다. IGF1R의 발현이 확인된 세포들에 대해서 1564 항체를 처리하 였으며 이후 DyLight650가표지된 이차항체를처리하여 형광표지하였다. 표지된 세 포들을 IGF1R발현유무와 IGF1R의 발현과 1564결합유무에 따라분류한후 이들에 대해 일루미나 HiSeq기법으로 RNA deep sequencing을 수행하여 해당 세포군에서의 2019/117684 1»（：1^1{2018/015953 각 alanine돌연변이의 빈도를 분석하였다. 해당 빈도수는 wi lde type IGF1R을 발 현한세포에 대한결과로 정규화 한후 상대 빈도를 계산하여 1564가표지된 세포 군에서 그숫자가 감소한돌연변이들을 선별해 내었다. 이러한 관찰을토대로， 이 러한 관찰을 토대로, 1564의 에피토프는 FN2 도메인에 위치함을 알아냈으며 이에 5 속하는잔기는 Y775, P776, F778, R的 0， S791, L798임을알아내었다. 해당결과및 1564클론이 인식하는시퀀스는도 9에 나타냈다. 이 잔기들은선행 문헌에 따르면 IGF1의 결합에 관여하지 않으므로해당결과는실시예 23-1에서 1564가보이는성 질을충실하게 설명하고있다
2019/117684 1»（：1^1{2018/015953
실시예 24. 단독항체및 이중항체의 항원결합력 비교등
24-1： a-syn항원에 대한단독항체 및 이중항체의 결합력
IGF1R항체가 scFv 형태로 IgG 형태의 a-syn 항체와 연결시켰을 때 a-syn 항체의 결합력에 대한영향을분석하였다.
1 ug/ml 농도로 96웰 플레이드에 18시간 동안 a-syn aggregate를 coating 하였으며 세척 후 각 항체는 400 nM 에서 5배씩 희석하여 결합시켰다. 결합된 항체는 항-인간 Fc-HRP를 결합시킨 후 TMB용액을 첨가하여 발색시켜 항체의 결합 정도를확인하였다.
도 10a 처럼 a-syn aggregate 에 대한 결합력은 단독항체나 이중항체에서 동일함을확인하였다.
24-2： IGF1R항원에 대한단독항체 및 이중항체의 결합력
IGF1R항원에 대한 a-syn단독항체와 이중항체의 결합정도를 비교하기 위해 실시예 22와동일한방법으로실험을수행하였다.
도 10b의 결과처럼 IGF1R scFv항체를갖고 있는 이중항체는농도의존적으로 잘결합하였으나 IGF1R항체 부위가없는단독항체는결합하지 않음을확인하였다.
24 3： a~syn인간화항체들의 결합력 분석
실시예 24-1과 동일한 방법으로 실험을 수행하여 키메릭 이중항체와 인간화 2019/117684 1»（：1^1{2018/015953 이중항체간의 결합력 차이를 분석하였다.
도 10c의 결과처럼 인간화 이중항체들은 키메릭 이중항체와 유사한 수준으로 a-syn 응집체와의 결합력을 보유하고 있으며 IGF1R scFv가 하나인 monovalent 이중항체도 키메릭 항체와유사한결합력을보임을 확인하였다.
5 실시예 24-2와 동일한 방법으로 실험을 수행하여 키메릭 이중항체와 인간화 이중항간의 IGF1R 결합력을 분석한 결과 도 10d 처럼 모든 이중항체가 동일한 결합력을보였으며 IGF1R scFv가 없는 단독항체는 결합하지 않음을 확인하였다. 이러한 결과는 인체내에서 면역원으로 작용할 수 있는 마우스항체 부위를 교체하기 위해 인간화 하였을 때 a-syn응집체 및 IGF1R에 대한 결합력에 변화가 10 없었음을시사하는 것으로동일한활성을보유하고 있음을 의미하는 것이다.
24-4： 단독항체와 이중항체의 식세포작용 비교
식세포작용은 대식세포의 다양한 수용체들이 관여하여 세포외 불필요한 물질들을 제거하는 작용을 의미한다. 다양한 단백질 응집체들은 면역반응이나 15 염증반응을 유도하여 인체에 악영향을 주게 되는데 특히 a-syn 응집체의 제거를 위해 항체를 투여하였을 때 항체의 Fc 부위와 세포 표면의 FcrR 와의 상호작용을 통해 촉진되는 것으로 알려져 있다. 이러한 이유로 단독항체와 IGF1R scFv가 연결된 이중항체의 식세포작용에 대한활성을 비교하였다.
단독항체와 이중항체의 식세포작용을 비교하기 위해 마우스에서 유래한 BV-2
20 미세아교세포를 이용하였다. ^-2 세포는 1¾¾11640 배지로 배양하였으며 2 X 1예6 2019/117684 1»（：1^1{2018/015953 cel l s/ml로 준비하여 U-bottom 96wel 1 pl ate에 100 씩 분주하였다. 10 세의 a-syn 응집체와 25 ug/ml 항체는 RPM 11640 배지로 희석하여 섞어준 후 상온에서 2◦분간 방치하였다. a-syn응집체와항체 혼합물을 BV-2 세포에 처리한후 15분간 방치하였다. 1200 rpm 으로 원심분리하여 상층액의 a-syn 응집체를 제거하였으며 세포표면에 결합된 응집체 또는 항체를 제거하기 위해 PBS， pH2.5 버퍼로 3회 세척하였다. 세포는 4% paraformaldehyde로 고정시킨 후 PBS 버퍼로 세척하였다. 세포내로 phagocytos i s된 응집체와 항체를 확인하기 위해 0.5% tr i ton X-100 을 첨하여 세포막을느슨하게 만들었으며 PBS버퍼로세척 후 pan-a-syn항체를 1시간 동안 처리하였다. 결합된 pan-a-syn 항체는 ant i -rabbi t -a lexa-488 항체를 1시간 처리한 후 FACS 분석을 통해 대식작용에 의해 세포내로 들어간 응집체를 확인하였다.
도 10d 결과 처럼 norma l human IgG는 대식작용에 영향을주지 않았으며 a_ syn항체를처리하였을때 a-syn응집체의 대식작용이 증가함을확인할수 있었다. 단독항체와 이중항체를 비교하였을 때 유사한 수준으로 대식작용이 일어남을 확인하여 IgG C-말단 부위에 결합된 scFv 형태의 IGF1R 항체가 a-syn 항체의 작용에 영향을주지 않음을확인하였다. 실시예 25. 이중특이항체의 효능평가
실시예 XX에 따라 키메릭 11F11 항체와 1564 클론 scFv의 bivalent 이중특이항체를 제작하고 인간 알파-시누클레인을 과발현하는 형질전환 생쥐 (mThy- 2019/117684 1»（：1^1{2018/015953
1 human a -synuclein, UC San Diego)에서 이중특이항체와알파-시누클레인 항체의 인비보에서 효과를 비교， 분석하였다. 2.5 mg/kg의 단독 항체 또는 인간 IgG또는 동일 몰수의 bivalent 이중특이항체를 3개월 동안매주복강투여하였다. 그룹당 5마리의 생쥐를 사용하였으며， 비형질전환 생쥐 (non-transgenic l ittermate)를 대조군으로사용하였다. 이어 관류를다음과같이 수행하였다.
마지막 투여가 완료된 후 뇌 내의 병리 분석을 위하여, 인도적 규정에 의하여 해당 동물들은 chloral hydrate로 마취된 뒤， 0.9 %의 생리식염수로 심장 관류되었다. 이어 관류된 뇌의 반쪽(saggital section)은 인산완충액 중의 4% 파라포름알데하이드 (pH7.4， 4°C)에 분석 시점까지 보관하였으며， 다른 반쪽은 바로 냉동상태로보관하였다 (-70°C).
병리학적 분석은 다음과 같이 이루어졌다.파라포름알데하이드에 고정된 뇌 반쪽은 Vibratome을 이용하여 free-f loat ing방식으로 40 y m두께의 연속절편으로 잘라내었다.각 투여군의 뇌 내 알파-시누클레인 의 발현 정도를 확인하기 위해， cortex, hippocampus , striatum을포함한 절편을 알파-시누클레인 항체 (응집체의 마커인 pl29 a -syn 항체 , abeam, ab59264또는 종 알파-시누클레인 항체 , Cel l
Signal ing Technology, #2642)와 4°C에서 밤새 배양하였다. 또는 성상세포 (astrocyte)의 활성 정도를 분석하기 위하여 상기 절편을 GFAP(gl ial fibrillary acidic protein)(AB5804, mi11ipore) 혹은 뇌염증(neuroinfla_ation) 정도를 확인하기 위해， IL-113에 대한 항체 (ab9722， abeam)를 각각 처리하였다. 또는 hippocampus의 신경세포 사멸 정도를 분석하기 위하여 NeuN (Chemicon,
#MAB377)에 대한 항체를 처리하였다. 1차 항체와의 배양 후에 바이오틴이 결합된 goat ant i -rabbit IgG (1: 100, Vector Laboratories) 및 Avidin D-horseradish 2019/117684 1»（：1^1{2018/015953
peroxidase (1:200， ABC El i te, Vector Laborator ies)를 처리하고 DAB(diaminobenzidine)로 검출하였다. 면역염색된 각 절편은 명시야 현미경으로 관찰하여 광학밀도를측정하였다. 결과는도 Ha내지 도 lie에 개시되어 있다. 25-1. 키메릭 항체와이중특이항체의 알파-시누클레인감소능분석
도 11a는 키메릭 11F11 항체 및 해당 키메릭 항체와 1564클론의 bivalent 이중특이항체가 인간 a -Syn을 과발현하는 마우스 동물모델 (TG)에서 알파- 시누클레인 응집체를 제거할 수 있는 지를, 마우스에 항체 투여 후 p-129 a -Syn 항체를 이용하여 마우스 뇌 조직 중 cortex, hippomcapus를 염색하여 즉정한 결과이다. p-129 a -syn은 129번째 잔기가 인산화된 형태의 응집체의 마커로 염색된조직에서 짙은갈색 점 혹은응집체 형태로나타난다.
도 11a에 따르면 IgG 처리군은 non-tg 대조군 대비 높은 p-129 의 염색정도를 보여주었다 (#: one way ANOVA, p < 0.01) . 이와 반대로, 단독항체 혹은 이중특이항체를 처리한 그룹에서는 p-129 a -syn혹은 응집체의 염색 정도가 현저히 감소하였다. 특히 hippocampus에서는 이중특이항체 처리군의 감소 정도가 키메릭 11F11 항체 대비 뛰어났다 O : one way ANOVA, p < 0.05) . 도 lib는 도 11a와 동일한 실험이나， 마커로서， 총 알파-시누클레인 항체로 염색한 결과이다. 총 알파-시누클레인 검출은 본원에 따른 항체가 알파-시누클레인 자체의 제거능 (clear ing) 및 항체의 세포 간 전달 (cel l to cel l transmi ssion) 억제능이 있음을 나타내는 것이다. 또한 다른 측면에서 단량체의 응집체로의 형성의 억제, 또는 단량체를 모두 제거할 수 있는 것으로 해석될 수 있다/TG mouse에서 증가한 인간 알파-시누클레인은 단독항체 및 이중특이항체 투여에 의해 IgG 투여군 대비 2019/117684 1»（：1^1{2018/015953
감소하였으며, 특히 hippocampus에서는 이중특이항체의 단독항체 대비 효능이 더 뛰어났다.
해당 결과는 키메릭 11F11 항체 및 이중특이항체가 2.5 mg/kg의 낮은 용량으로도 파킨슨 질환 동물 모델에서 효과적으로 알파-시누클레인 및 그 응집체 5 레벨을 감소시킴을 나타낸다. 특히 이중특이항체가 단독항체 대비 효능이 뛰어났는데, 이는 이중특이항체가 향상된 BBB 통과능을 바탕으로 단독항체 대비 뇌에 더 많이 도달하여 질환을효과적으로치료할수 있음을시사한다.
25-2. 키메릭 항체와이중특이항체의 astroglosis 및 inf lammatory cytokine 10 레벨감소능분석
글리오시스 (gl iosis)는 BBB의 손상， TGF-베타또는 인터류칸과 같은 물질에 의해 촉발되는, 중추신경계에 손상이 있는 경우 이에 대한 반응으로 교세포 (gl ial cel l )에서 일어나는 비특이적 반응이다. 대표적인 것으로， Astrogl iosis를 포함하며 GFAP 단백질이 마커로 사용된다 . 이에 키메릭 11F11 항체 및 키메릭 15 항체와 1564클론의 이중특이항체를마우스에 투여하여 Astrogl iosis 감소및 이를 촉발하는 염증성 사이토카인 방출 감소에 미치는 영향을 분석하였다. 분석 결과는 도 11c및 lid에 개시되어 있다.
도 11c는 본 발명의 일예에서 제조된 키메릭 11F11 항체 혹은 해당 항체와
1564 클론의 이중특이항체가 in vivo에서 astrogl iosis를 감소시킬 수 있는지를，
20 마우스에 항체 투여 후 마커로서 GFAP (astrogl iosis) 항체를 이용하여 마우스의 뇌 조직을 염색으로 측정한 결과이다. 단독항체 및 이중특이항체는 IgG 대조군 대비 astrogl iosis를 억제하였으며 , 특히 striatum에서는 이중특이항체의 효능이 2019/117684 1»（：1^1{2018/015953
단독항체 대비 뛰어남을확인할수 있었다.
도 lid는 본 발명의 일예에서 제조된 키메릭 11F11 항체 혹은 해당항체와 1564 클론의 이중특이항체가 in vivo에서 염증성 사이토카인을 감소시킬 수 있는지를, 마우스에 항체 투여 후마커로서 IL-1베타항체를 이용하여 마우스의 뇌 조직을 염색으로 측정한 결과이다. IL-1 베타는 염증을 유발하여 다양한 신경세포의 사멸 및 염증 반응을유도하게 된다. 본원에 따른 항체를 투여한 쥐의 hippocampus에서 IgG 대조군 대비 단독항체 및 이중특이항체 투여군에서 IL-1 베타가 감소하였으며， 특히 이중특이항체의 감소능이 단독항체 대비 유의미하게 뛰어났다 (## .· One-way ANOVA, p < 0.005； * : one way ANOVA, p < 0.05) .
상기 도면에 나타난 바와 같이 본원에 따른 항체는 대조군과 비교하여，
Astrogl iosi s를 감소시키며, 이를촉발하는 염증성 사이토카인 IL-lbeta의 방출을 감소시키는것으로나타났다.
25-3. 굿 1메릭 ¾체斗 01著록 01 ¾~체외 neurodegenerat ion
Figure imgf000229_0001
능是석
알파 시누클레인의 신경 독성 및 염증 반응으로 인하여 뇌세포의 사멸이 발생함을 선행문헌에서 확인되어 왔다. 본원의 단독항체 및 이중특이항체가 알파- 시누클레인으로인한 in vivo에서의 뇌세포사멸을억제할수있는지 분석하였다. cortex및 hippocampus에서 뉴런의 마커인 으로 염색한결과， 단독항체 및 이중특이항체 모두 IgG 대조군 대비 뇌세포 사멸 정도가 감소하는 것으로 나타났다. 특히 cortex에서는 이중특이항체의 뇌세포사멸 억제능이 단독항체 대비 뛰어난것으로확인되었다. 해당결과는도 lie에 나타냈다. 2019/117684 1»（：1^1{2018/015953
실시예 26. Fc engineering을 통한 반감기 증대 및 이를 통한 BBB 통과능 향상
FcRn은 혈관내에서 항체가 순환할 때 용해되지 않도록 세포 안으로 항체를 5 끌어들여 순환시킴으로 해서 반감기를 증가시키는 세포막의 중요한 수용체이다.
BBB 통과능은 트렌스사이토시스 항체의 활성도 중요하지만 혈관내에서의 농도에 의존하여 BBB를 통과한다는 것은 잘 알려진 사실이다. 이러한 이유로 이중항체의 반감기를 증가시키고자 Fc 부위의 428번째 아미노산을 메사이오닌 (Met)을 류신 (Leu) 으로 변화시켜 FcRn과의 결합력을 증대시킨 이중항체를 제작하였다. Human 10 FcRn을 발현하는 tg mouse 에 10 mg/kg 농도로 WT 이중항체와 M428L 이중항체를 투여하여 비교한 결과도 12처럼 약 50%정도의 반감기 증대 효과를확인하였다. 반감기 증가를 재확인하기 위해 원숭이에 WT 이중항체, Bivalent M428L 이중항체, monovalent M428L 이중항체를 투여하여 PK prof i le을 분석하였다. 도 22a 처럼 WT 이중항체의 경우 168시간 이후부터 급격하게 혈액내 농도가 낮아지는 반면 15 FcRn과의 결합력이 높은 M428L 이중항체들은 WT 대비 향상된 혈액내 농도를 유지하였다. 반감기는 WT 이중항체에 비해 M428L 이중항체에서 1.5일 정도 증가하는 결과를 확인하였다. 특히 clearance 즉면에서는 monovalent M428L 이중항체가 가장 우수하였으며 WT 이중항체가 가장 빠른 clearance를 보였다 (도 22b) .
20 반감기 증가효과에 의한 BBB통과 향상을 검증하기 위해 항체 투여 24시간 0 2019/117684 1»（：1^1{2018/015953 후에 CSF를 추출하여 CSF 내의 항체량을 분석하였다. 100 ng/ml 의 IGF1R 을 18시간 동안 냉장상태로 coat ing 한 후 CSF를 첨가하여 IGF1R 과 결합한 항체를 detection하였다. 도 22c에서 확인되는바와같이, 혈액내 항체량이 많았던 M428L 이중항체의 BBB 통과량이 많음을 확인하였으며 monovalent M428L 이중항체는 5 우수한 BBB 통과능과 결합되어 bivalent M428L 이중항체보다 향상된 통과능을 보였다.

Claims

2019/117684 1»（：1^1{2018/015953
【청구범위】
【청구항 1】
항 3-5711항체 또는 이의 항원 결합단편; 및 항 항체 또는 이의 항원 결합단편을포함하는, 항 3 /항 묘의 이중특이 항체로서，
상기 항 止항체는중쇄가변영역 및 경쇄가변영역을포함하며,
상기 중쇄가변영역은， 서열번호 1 내지 서열번호 9의 아미노산 서열중에서 하나를 포함하는 중쇄 0）1¾1 （11-0）1¾1） , 서열번호 10 내지 서열번호 49의 아미노산 서열중에서 하나를 포함하는 중쇄 0예2 （또 예2）， 및서열번호 50 내지 서열번호 80의 아미노산서열중에서 하나를중쇄 001« 0너 1¾）룰포함하며，
상기 경쇄가변영역은, 서열번호 96 내지 서열번호 113의 아미노산 서열중에서 하나를 포함하는 경쇄 江恨1 （ 抑 1¾1）, 서열번호 114 내지 서열번호 132의 아미노산서열중에서 하나를포함하는경쇄 。대씽 （1:^期\ 12）， 및 서열번호 133 내지 서열번호 161의 아미노산서열중에서 하나를 포함하는 경쇄 抑묘3 此 1¾3）를 포함하는것인， 이중특이 항체.
【청구항 2]
제 1항에 있어서， 상기 항크 !!항체 또는 이의 항원 결합단편은인간알파- 시누클레인단백질의 （:-말단영역에 특이적으로결합하는것인 이중특이 항체.
【청구항 3】
제 1항에 있어서， 상기 항크 항체 또는 이의 항원 결합단편은， 서열번호 126의 아미노산 서열에서， 말단부터 110번 잔기 내지 120번 잔기를 포함하는 2019/117684 1»（：1^1{2018/015953 연속하는 적어도 11개의 아미노산을 포함하는 펩타이드， 또는 111번 잔기 내지 122번 잔기를 포함하는 연속하는 적어도 12개 아미노산을 포함하는 펩타이드에 특이적으로 결합하는 것인 이중 특이 항체.
【청구항 4]
제 1항에 있어서 , 상기 항 3-8711항체 또는이의 항원 결합단편은， 서열번호 1 및 서열번호 6의 아미노산 서열중에서 하나를 포함하는 중쇄 0 1 （ ＜1）1산）， 서열번호 2 내지 4 및 서열번호 7 내지 8의 아미노산 서열중에서 하나를 포함하는 중쇄 0 ｛2 0 묘2）， 서열번호 5 및 서열번호 9의 아미노산
Figure imgf000233_0001
아미노산서열중에서 하나를포함하는경쇄 0 2此 대?2）， 및
서열번호 12 및 서열번호 15의 아미노산서열중에서 하나를 포함하는 경쇄 0예3（ 에3）을포함하는것인, 이중특이 항체.
【청구항 5】
Figure imgf000233_0002
1의 아미노산서열을포함하는중쇄 0이?1 0너 묘1）， 서열번호 2내지 4의 아미노산 서열중에서 하나를포함하는중쇄 00묘2（1! 예2）， 및서열번호 5의 아미노산 서열을포함하는중쇄 0 3어 예3）을포함하는중쇄 가변 영역; 및
Figure imgf000233_0003
11의 아미노산서열을포함하는경쇄 0 2（1거：0요2）， 및서열번호 12와아미노산 2019/117684 1»（：1^1{2018/015953 서열을포함하는경쇄 0 3此 3）을포함하는경쇄 가변 영역을포함하는것인 이중특이 항체 .
【청구항 6】
제 4항에 있어서， 상기
Figure imgf000234_0001
단편은,
서열번호 6의 아미노산 서열을 포함하는 중쇄 0飛1 0 ： 1）， 서열번호 7 내지 8의 아미노산서열중에서 하나를 포함하는 중쇄 0대?2
Figure imgf000234_0002
및 서열번호
9의 아미노산서열을포함하는중쇄 0예3어 에3）을포함하는중쇄 가변 영역;및 서열번호 13의 아미노산 서열을 포함하는 경쇄 0班?1 （1거 요1）, 서열번호 14의 아미노산 서열을 포함하는 경쇄 。대썽 （1거 1?2）， 및 서열번호 15의 아미노산 서열을포함하는 경쇄 0 3（ 예3）을 포함하는 경쇄 가변 영역을 포함하는 것인 이중특이 항체 .
【청구항 7]
제 1항에 있어서， 상기 항 3-8711항체의 중쇄 가변 영역은,
서열번호 16내지 17및 서열번호 35내지 40의 아미노산서열중에서 하나를 포함하는， 11 예1의 ^말단쪽에 위치하는중쇄가변영역 프레임워크 1어 ）,
서열번호 18내지 19및서열번호 41내지 44의 아미노산서열중에서 하나를 포함하는, 11 예1과 11 2사이에 위치하는중쇄가변영역 프레임워크어 묘2）
서열번호 20내지 31및 서열번호 45내지 50의 아미노산서열중에서 하나를 포함하는，
Figure imgf000234_0003
사이에 위치하는중쇄가변영역 프레임워크（11내1?3） 및 서열번호 32내지 34및 서열번호 51내지 52의 아미노산서열중에서 하나를 2019/117684 1»（：1^1{2018/015953
Figure imgf000235_0004
5 서열번호 53내지 58및서열번호 71내지 77의 아미노산서열중에서 하나를
Figure imgf000235_0001
서열번호 59내지 61및 서열번호 78내지 81의 아미노산서열중에서 하나를
Figure imgf000235_0002
서열번호 62내지 67및서열번호 82내지 88의 아미노산서열중에서 하나를
Figure imgf000235_0003
서열번호 68 내지 70 및 서열번호 89의 아미노산 서열중에서 하나를 포함하는 느 3의 0 말단에 위치하는 경쇄가변영역 프레임워크 0 4)를 포함하는것인 이중특이 항체.
【청구항 9]
15 제 5항에 있어서 상기 항 3-8711항체의 중쇄 가변 영역은
서열번호 16내지 의 아미노산서열중에서 하나를포함하는 0 1의 말단쪽에 위치하는중쇄가변영역 프레임워크 1내斗財)，
서열번호 18내지 19의 아미노산서열중에서 하나를포함하는， 묘 대산과 11- 0 2사이에 위치하는중쇄가변영역 프레임워크어- 2)
20 서열번호 20내지 31의 아미노산서열중에서 하나를포함하는，묘 2와 1 2019/117684 1»（：1^1{2018/015953
Figure imgf000236_0001
말단에 위치하는중쇄가변영역 프레임워크（1«¾4）를포함하는것이며，
상기 항 3 ＞1항체의 경쇄 가변 영역은,
서열번호 53내지 58의 아미노산서열중에서 하나를포함하는, ＜1«1의 _ 말단쪽에 위치하는경쇄가변영역 프레임워크 1（ -1¾1）,
서열번호 59내지 61의 아미노산서열중에서 하나를포함하는，느 1과 1- 0 2사이에 위치하는경쇄가변영역 프레임워크此寸1씽）
서열번호 62내지 67의 아미노산서열중에서 하나를포함하는， 느 대 와 1/~
Figure imgf000236_0002
서열번호 68내지 70의 아미노산서열중에서 하나를포함하는느 이?3의 0 말단에 위치하는경쇄가변영역 프레임워크 0^¾4）를포함하는것인 이중특이 항체 .
【청구항 10】
제 6항에 있어서， 상기 항 3-5711항체의 중쇄 가변 영역은，
서열번호 35내지 40의 아미노산서열중에서 하나를포함하는， 11 1의 말단쪽에 위치하는중쇄가변영역 프레임워크 1어 ），
서열번호 41내지 44의 아미노산서열중에서 하나를포함하는， 11 1과 11- 0 2사이에 위치하는중쇄가변영역 프레임워크（｝«¾2）
서열번호 45내지 50의 아미노산서열중에서 하나를포함하는， ^1 2와 2019/117684 1»（：1^1{2018/015953
0예3사이에 위치하는중쇄가변영역 프레임워크어 1¾) 및
서열번호 51내지 52의 아미노산서열중에서 하나를포함하는 11 대«의 0 말단에 위치하는중쇄가변영역 프레임워크 (}«¾4)를포함하는것이며，
상기 항 3-5711항체의 경쇄 가변 영역은，
서열번호 71내지 77의 아미노산서열중에서 하나를포함하는，丄- 0이?1의 말단쪽에 위치하는경쇄가변영역 프레임워크 1此 요1)，
서열번호 78내지 81의 아미노산서열중에서 하나를포함하는,느 예1과 1 0^2사이에 위치하는경쇄가변영역 프레임워크 (1^ 2)
서열번호 82내지 88의 아미노산서열중에서 하나를포함하는,세 2와 사이에 위치하는경쇄가변영역 프레임워크 (1^¾3) 및
서열번호 89의 아미노산서열중에서 하나를포함하는 1^ 예3의 0말단에 위치하는경쇄가변영역 프레임워크此斗1?4)를포함하는것인 이중특이 항체.
【청구항 11】
제 4항에 있어서， 상기
Figure imgf000237_0001
항체의 중쇄 가변영역은，
서열번호 90내지 101또는서열번호 102내지 108로부터 선택되는아미노산 서열;
서열번호 90내지 101또는서열번호 102내지 108로부터 선택되는아미노산 서열과적어도 90%이상의 상동성을갖는서열; 또는
서열번호 90내지 101또는서열번호 102내지 108로부터 선택되는아미노산 서열과적어도 95%이상의 상동성을갖는서열을포함하는것인， 이중특이 항체. 2019/117684 1»（：1^1{2018/015953
【청구항 12】
제 4항에 있어서， 상기 항 3-5711항체의 경쇄 가변영역은，
서열번호 109내지 115또는서열번호 116내지 123로부터 선택되는 아미노산서열;
서열번호 109내지 115또는서열번호 116내지 123로부터 선택되는 아미노산서열과적어도 90%이상; 또는
서열번호 109내지 115또는서열번호 116내지 123로부터 선택되는 아미노산서열과적어도 95%이상의 상동성을갖는서열을포함하는것인, 이중 특이 항체 .
【청구항 13】
Figure imgf000238_0001
90내지 101의 아미노산서열중에서 하나의 중쇄 가변 영역과서열번호 109내지 115의 아미노산서열중에서 하나의 경쇄 가변 영역을포함하는것인， 이중특이 항체 .
【청구항 14】
제 4항에 있어서, 상기 항크 항체또는그항원결합단편은서열번호 102내지 108의 아미노산서열중에서 하나의 중쇄 가변 영역과서열번호 116내지 123의 아미노산서열중에서 하나의 경쇄 가변 영역을포함하는것인, 이중특이 항체 .
【청구항 15】 2019/117684 1»（：1^1{2018/015953
Figure imgf000239_0001
서열번호 127의 중쇄 가변영역과 서열번호 128의 경쇄 가변영역을 포함， 서열번호 129의 중쇄 가변영역과서열번호 130의 경쇄 가변영역을 포함 서열번호 131의 중쇄 가변영역과 서열번호 132의 경쇄 가변영역을 포함 서열번호 133의 5 중쇄 가변영역과 서열번호 134의 경쇄 가변영역을 포함， 서열번호 135의 중쇄 가변영역과 서열번호 136의 경쇄 가변영역을 포함 또는 서열번호 137의 중쇄 가변영역과서열번호 138의 경쇄 가변영역을포함하는것인 것인 이중특이 항체.
【청구항 16】
제 1항에 있어서 상기 항 1（平 항체 또는그항원결합단편은， 서열번호
Figure imgf000239_0002
（卜抑묘2）， 및서열번호 50 내지 서열번호 80의 아미노산 서열중에서 하나를 중쇄 01）1¾3（1ᅡ 0예3）를포함하는중쇄 가변영역과
서열번호 96 내지 서열번호 113의 아미노산 서열중에서 하나를 포함하는
Figure imgf000239_0003
하나를 포함하는 경쇄 0¾2 （1-（^2） 및 서열번호 138 내지 서열번호 161의 아미노산 서열중에서 하나를 포함하는 경쇄 0）묘3 （ -0狀3）를 포함하는 경쇄 가변영역을포함하는이중특이 힘체.
【청구항 17】
20 제 16항에 있어서， 상기 항 항체 또는 이의 힝-원 결합 단편은， 2019/117684 1»（：1^1{2018/015953 서열번호 174의 아미노산 서열을 포함하는 단백질에서 ¥775, ?776, 778, 1½50, 3791, 1798, 0^779, 1641, }½08， 묘809, 1813, V397, 0435, 1434, ¥460 및 0488로 이루어지는 군에서 선택된 적어도 하나 이상의 아미노산을 특이적으로 인식하여 결합하는것인 이중특이 항체
【청구항 18】 제 17항에 있어서, 상기 항 犯!7^ 항체 또는 이의 항원 결합 단편은， 서열번호 174의 아미노산서열을포함하는단백질에서 결합부위 1내지 결합부위 3으로 이루어지는군에서 선택된 적어도하나 이상의 결합부위에 결합하는 것이며, 상기 결합부위 1은 ¥775, 776, ?778， 요650， 3791, 98 및 이11779로 이루어지는 군에서 선택된 하나 이상의 아미노산을 포함하고， 결합부위 2는 1641, ᄈ08， 묘809 및 1 13로 이루어지는 군에서 선택된 하나 이상의 아미노산을 포함하고， 결합부위 3은 ¥397, 0435, 1434, ¥460 및 0488로 이루어지는 군에서 선택된 하나 이상의 아미노산을포함하는것인 이중특이 항체.
【청구항 19]
제 17항에 있어서， 상기 중쇄 가변 영역은,
서열번호 81내지 84의 아미노산서열중에서 하나를포함하는，
Figure imgf000240_0001
射- 말단쪽에 위치하는중쇄가변영역 프레임워크 1 (11^1),
서열번호 85내지 86의 아미노산서열중에서 하나를 포함하는，
Figure imgf000240_0002
0¾2사이에 위치하는중쇄가변영역 프레임워크 (!1-1¾2)
서열번호 87내지 91의 아미노산서열중에서 하나를포함하는, 11-抑요2와 11- \¥0 2019/117684 1»（：1^1{2018/015953
◦113시-이에 위치하는중쇄가변영역 프레임워크 （11-?1?3） 및
서열번호 92 내지 95의 아미노산 서열중에서 하나를 포함하는 11 예3의 0 말단에 위치하는 중쇄가변영역 프레임워크 （] 4¾4）를 포함하는 것인 이중 특이 항체 .
【청구항 20】
제 17항에 있어서, 상기 경쇄 가변 영역은,
서열번호 162 내지 164와 아미노산 서열중에서 하나를 포함하는， 1 抑 ¾의 말단쪽에 위치하는경쇄가변영역 프레임워크 1比 犯）,
Figure imgf000241_0001
위치하는경쇄가변영역 프레임워크此4¾2）
서열번호 166 내지 168의 아미노산 서열중에서 하나를 포함하는， 1^1¾2와 1게）1¾사이에 위치하는경쇄가변영역 프레임워크 （1.시¾3） 및
서열번호 169내지 1기의 아미노산서열중에서 하나를포함하는 1^03의 0 말단에 위치하는 경쇄가변영역 프레임워크 0거 4）를 포함하는 것인 이중 특이 항체 .
【청구항 21] 제 16항에 있어서, 상기 항 1（伊 항체의 항원 결합 단편은 %1 ， （^1今）2,
Figure imgf000241_0002
【청구항 22]
제 1항에 있어서， 상기 항 항체는 완전한 항체이고， 항 항체는 2019/117684 1»（：1^1{2018/015953 항체의 Fv-단편인， 이중특이 항체 .
【청구항 23】
제 1항에 있어서， 상기 항 a-Syn 항체는 완전한 항체는 IgGl , IgG2, IgG3 또는 IgG4형태인 이중특이 항체
【청구항 24]
제1항에 있어서, 항 IGFR항체의 항원 결합 단편은, scFv, (scFv)2, scFv-Fc, Fab, Fab' 및 F(ab’)2로 이루어진 군에서 선택되는 것인 이중 특이 항체.
【청구항 25】
제 1 항 내지 제 24항 중 어느 한 항에 따른 이중 특이항체를 포함하는， a -synucleinopathy의 예방또는치료용약학조성물.
【청구항 26】
제 25 항에 있어서, 상기 a _3>¾11<:1 11매31;}17는 파킨슨 질환 (Parkinson’ s disease, PD) , 파킨슨질환성 치매 (Parkinson’ s disease dement i a, PDD) , 루이소체 치매 (dement i a with Lewy bodies , DLB) , 알츠하이머 루이소체 질환 (Lewy body variant of Alzheimer ' s disease (LBV) ) , 복합성 알츠하이머 및 파킨슨 병 (Combined Alzheimer ' s and Parkinson disease) , 또는 다겨)통위죽증 (mul t iple system atrophy, MSA)를포함하는것인, 조성물.
【청구항 27】
제 1항내지 제 24항중어느한항에 따른 이중특이항체를 제공하는단 계， 및 상기 이중 항체를포함하는, (1 -350111(： 1 11(¾)31:1 의 예방또는 치료용 약학 2019/117684 1»（：1^1{2018/015953 조성물.
【청구항 28】
제 1항내지 제 24항중 어느 한항에 따른 이중 특이항체를 약학적으로 유효한 양으로 (I -3 11(：16111(피31：117의 치료 및/또는 01 - 응집체의 농도 조절이 필요한대상체에게투여하는단계를포함하는， 0· -3 1111(：1 11( 31：117의 치료방법. 【청구항 29] 제 1항 내지 제 24항 중 어느 한 항에 따른 이중 특이항체를 이중 특이항 체를 약학적으로 유효한 양으로 X-3 11：1 11¾31；1 의 치료 및/또는 1- 응집체 의 농도 조절이 필요한 대상체에게 투여하는 단계를 포함하는， 1-3 응집체의 형 성 저해 또는 1_3 응집체의 농도를 감소시키는 방법 .
PCT/KR2018/015953 2017-12-14 2018-12-14 a-syn/IGF1R에 대한 이중 특이 항체 및 그 용도 WO2019117684A1 (ko)

Priority Applications (16)

Application Number Priority Date Filing Date Title
CN202310369584.9A CN116731173A (zh) 2017-12-14 2018-12-14 抗a-syn/igf1r的双特异性抗体及其用途
EP24170761.1A EP4403218A2 (en) 2017-12-14 2018-12-14 Bispecific antibody to a-syn/igf1r and use thereof
EP18889608.8A EP3725806A4 (en) 2017-12-14 2018-12-14 BISPECIFIC ANTIBODIES AGAINST A-SYN/IGF1R AND ASSOCIATED USE
JP2020531764A JP7212391B2 (ja) 2017-12-14 2018-12-14 ａ－ｓｙｎ／ＩＧＦ１Ｒに対する二重特異抗体およびその用途
KR1020207009513A KR102263812B1 (ko) 2017-12-14 2018-12-14 a-syn/IGF1R에 대한 이중 특이 항체 및 그 용도
CA3085572A CA3085572A1 (en) 2017-12-14 2018-12-14 Bispecific antibody to a-syn/igf1r and use thereof
EA202091183A EA202091183A1 (ru) 2018-09-21 2018-12-14 БИСПЕЦИФИЧНОЕ АНТИТЕЛО К -syn/IGF1R И ЕГО ПРИМЕНЕНИЕ
AU2018385230A AU2018385230B2 (en) 2017-12-14 2018-12-14 Bispecific antibody to a-syn/IGF1R and use thereof
CN201880089354.4A CN111886251A (zh) 2017-12-14 2018-12-14 抗a-syn/igf1r的双特异性抗体及其用途
US16/770,728 US12071483B1 (en) 2017-12-14 2018-12-14 Bispecific antibody to alpha-synuclein/insulin-like growth factor 1 receptor and use thereof
BR112020011875-3A BR112020011875A2 (pt) 2017-12-14 2018-12-14 anticorpo biespecífico ao a-syn/igf1r e uso do mesmo
JP2022059697A JP7513651B2 (ja) 2017-12-14 2022-03-31 ａ－ｓｙｎ／ＩＧＦ１Ｒに対する二重特異抗体およびその用途
AU2022241522A AU2022241522A1 (en) 2017-12-14 2022-09-28 Bispecific antibody to a-syn/igf1r and use thereof
JP2023000428A JP2023052217A (ja) 2017-12-14 2023-01-05 ａ－ｓｙｎ／ＩＧＦ１Ｒに対する二重特異抗体およびその用途
US18/480,071 US20240101687A1 (en) 2017-12-14 2023-10-03 Bispecific Antibody to A-Syn/IGF1R and Use Thereof
JP2024061429A JP2024096805A (ja) 2017-12-14 2024-04-05 ａ－ｓｙｎ／ＩＧＦ１Ｒに対する二重特異抗体およびその用途

Applications Claiming Priority (8)

Application Number Priority Date Filing Date Title
KR10-2017-0172205 2017-12-14
KR20170172205 2017-12-14
US201862693474P 2018-07-03 2018-07-03
US62/693,474 2018-07-03
US201862734391P 2018-09-21 2018-09-21
US201862734388P 2018-09-21 2018-09-21
US62/734,388 2018-09-21
US62/734,391 2018-09-21

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US16/770,728 A-371-Of-International US12071483B1 (en) 2017-12-14 2018-12-14 Bispecific antibody to alpha-synuclein/insulin-like growth factor 1 receptor and use thereof
US18/480,071 Division US20240101687A1 (en) 2017-12-14 2023-10-03 Bispecific Antibody to A-Syn/IGF1R and Use Thereof

Publications (1)

Publication Number Publication Date
WO2019117684A1 true WO2019117684A1 (ko) 2019-06-20

Family

ID=66819361

Family Applications (2)

Application Number Title Priority Date Filing Date
PCT/KR2018/015953 WO2019117684A1 (ko) 2017-12-14 2018-12-14 a-syn/IGF1R에 대한 이중 특이 항체 및 그 용도
PCT/KR2018/015954 WO2019117685A2 (ko) 2017-12-14 2018-12-14 항-igf1r 항체 및 그 용도

Family Applications After (1)

Application Number Title Priority Date Filing Date
PCT/KR2018/015954 WO2019117685A2 (ko) 2017-12-14 2018-12-14 항-igf1r 항체 및 그 용도

Country Status (9)

Country Link
US (2) US12071483B1 (ko)
EP (2) EP3725806A4 (ko)
JP (4) JP7212391B2 (ko)
KR (1) KR102263812B1 (ko)
CN (2) CN116731173A (ko)
AU (2) AU2018385230B2 (ko)
BR (1) BR112020011875A2 (ko)
CA (1) CA3085572A1 (ko)
WO (2) WO2019117684A1 (ko)

Cited By (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110494445A (zh) * 2017-01-06 2019-11-22 Abl生物公司 抗α-SYN抗体及其用途
EP3567054A4 (en) * 2017-01-06 2021-03-10 ABL Bio Inc. ANTI-ALPHA SYN ANTIBODIES AND USES THEREOF
WO2021130717A1 (ko) 2019-12-26 2021-07-01 에이비엘바이오 주식회사 단백질 a 친화성 크로마토그래피를 이용한 생리활성 펩티드의 정제 방법
US11142570B2 (en) 2017-02-17 2021-10-12 Bristol-Myers Squibb Company Antibodies to alpha-synuclein and uses thereof
CN113966346A (zh) * 2019-06-14 2022-01-21 Abl生物公司 抗a-syn/igf1r的双特异性抗体及其用途
US12071483B1 (en) 2017-12-14 2024-08-27 Abl Bio Inc. Bispecific antibody to alpha-synuclein/insulin-like growth factor 1 receptor and use thereof

Families Citing this family (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023215697A1 (en) * 2022-05-05 2023-11-09 Eli Lilly And Company Multispecific binding molecules and methods of use thereof

Citations (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
WO1999010494A2 (en) 1997-08-25 1999-03-04 Genentech, Inc. Agonist antibodies to the thrombopoietin receptor, and their therapeutic uses
US20110014117A1 (en) * 2007-06-28 2011-01-20 Schering Corporation Anti-igf1r
KR20120047274A (ko) * 2009-07-29 2012-05-11 아보트 러보러터리즈 이원 가변 도메인 면역글로불린 및 이의 용도
KR20140125409A (ko) * 2012-01-27 2014-10-28 네오토프 바이오사이언시즈 리미티드 알파-시누클레인을 인식하는 인간화된 항체
KR20150063447A (ko) * 2012-10-08 2015-06-09 프로테나 바이오사이언시즈 리미티드 알파-시누클레인을 인식하는 항체
US9534044B2 (en) * 2013-02-28 2017-01-03 United Arab Emirates University Alpha-synuclein antibodies and uses thereof
KR20180081465A (ko) 2017-01-06 2018-07-16 에이비엘바이오 주식회사 항 α-syn 항체 및 그 용도

Family Cites Families (71)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US3773919A (en) 1969-10-23 1973-11-20 Du Pont Polylactide-drug mixtures
IE52535B1 (en) 1981-02-16 1987-12-09 Ici Plc Continuous release pharmaceutical compositions
EP0088046B1 (de) 1982-02-17 1987-12-09 Ciba-Geigy Ag Lipide in wässriger Phase
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
HUT35524A (en) 1983-08-02 1985-07-29 Hoechst Ag Process for preparing pharmaceutical compositions containing regulatory /regulative/ peptides providing for the retarded release of the active substance
US4615885A (en) 1983-11-01 1986-10-07 Terumo Kabushiki Kaisha Pharmaceutical composition containing urokinase
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US5011912A (en) 1986-12-19 1991-04-30 Immunex Corporation Hybridoma and monoclonal antibody for use in an immunoaffinity purification system
US4965195A (en) 1987-10-26 1990-10-23 Immunex Corp. Interleukin-7
US4968607A (en) 1987-11-25 1990-11-06 Immunex Corporation Interleukin-1 receptors
GB8823869D0 (en) 1988-10-12 1988-11-16 Medical Res Council Production of antibodies
AU643427B2 (en) 1988-10-31 1993-11-18 Immunex Corporation Interleukin-4 receptors
JP3068180B2 (ja) 1990-01-12 2000-07-24 アブジェニックス インコーポレイテッド 異種抗体の生成
US6713610B1 (en) 1990-01-12 2004-03-30 Raju Kucherlapati Human antibodies derived from immunized xenomice
US6673986B1 (en) 1990-01-12 2004-01-06 Abgenix, Inc. Generation of xenogeneic antibodies
WO1991018982A1 (en) 1990-06-05 1991-12-12 Immunex Corporation Type ii interleukin-1 receptors
US6300129B1 (en) 1990-08-29 2001-10-09 Genpharm International Transgenic non-human animals for producing heterologous antibodies
US5545806A (en) 1990-08-29 1996-08-13 Genpharm International, Inc. Ransgenic non-human animals for producing heterologous antibodies
US6255458B1 (en) 1990-08-29 2001-07-03 Genpharm International High affinity human antibodies and human antibodies against digoxin
US5874299A (en) 1990-08-29 1999-02-23 Genpharm International, Inc. Transgenic non-human animals capable of producing heterologous antibodies
ATE158021T1 (de) 1990-08-29 1997-09-15 Genpharm Int Produktion und nützung nicht-menschliche transgentiere zur produktion heterologe antikörper
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
US6565841B1 (en) 1991-03-15 2003-05-20 Amgen, Inc. Pulmonary administration of granulocyte colony stimulating factor
US5262522A (en) 1991-11-22 1993-11-16 Immunex Corporation Receptor for oncostatin M and leukemia inhibitory factor
WO1993015722A1 (en) 1992-02-07 1993-08-19 Syntex (Usa) Inc. Controlled delivery of pharmaceuticals from preformed porous microparticles
ES2301158T3 (es) 1992-07-24 2008-06-16 Amgen Fremont Inc. Produccion de anticuerpos xenogenicos.
US5457035A (en) 1993-07-23 1995-10-10 Immunex Corporation Cytokine which is a ligand for OX40
DE69637481T2 (de) 1995-04-27 2009-04-09 Amgen Fremont Inc. Aus immunisierten Xenomäusen stammende menschliche Antikörper gegen IL-8
CA2196496A1 (en) 1997-01-31 1998-07-31 Stephen William Watson Michnick Protein fragment complementation assay for the detection of protein-protein interactions
PL228041B1 (pl) 2001-01-05 2018-02-28 Amgen Fremont Inc Przeciwciało przeciwko receptorowi insulinopodobnego czynnika wzrostu I, zawierajaca go kompozycja farmaceutyczna, sposób jego wytwarzania, zastosowania, linia komórkowa, wyizolowana czasteczka kwasu nukleinowego, wektor, komórka gospodarza oraz zwierze transgeniczne.
US20050026823A1 (en) 2003-06-20 2005-02-03 Biomarin Pharmaceutical Inc. Use of the chaperone receptor-associated protein (RAP) for the delivery of therapeutic compounds to the brain and other tissues
MXPA06001634A (es) 2003-08-13 2006-04-28 Pfizer Prod Inc Anticuerpos humanos modificados igf-1r.
FR2873699B1 (fr) 2004-07-29 2009-08-21 Pierre Fabre Medicament Sa Nouveaux anticorps anti igf ir rt leurs utilisations
EA013752B1 (ru) 2004-08-09 2010-06-30 Элан Фармасьютикалз, Инк. Предупреждение и лечение синуклеинопатических и амилоидогенных заболеваний
CN101287761A (zh) * 2005-06-15 2008-10-15 先灵公司 抗-igf1r抗体制剂
ES2452115T3 (es) 2005-06-17 2014-03-31 Imclone Llc Un anticuerpo anti-PDGFRalfa para su uso en el tratamiento de cáncer de huesos metastásico
CA2624781A1 (en) 2005-10-11 2007-04-19 Ablynx N.V. Nanobodies tm and polypeptides against egfr and igf-ir
EP1945671A2 (en) * 2005-10-12 2008-07-23 MorphoSys AG Generation and profiling of fully human hucal gold-derived therapeutic antibodies specific for human cd38
GB0624500D0 (en) 2006-12-07 2007-01-17 Istituto Superiore Di Sanito A novel passive vaccine for candida infections
US20090068110A1 (en) 2006-12-22 2009-03-12 Genentech, Inc. Antibodies to insulin-like growth factor receptor
CN102164960A (zh) * 2008-09-26 2011-08-24 罗氏格黎卡特股份公司 双特异性抗-egfr/抗-igf-1r抗体
UY32317A (es) 2008-12-12 2010-07-30 Boehringer Ingelheim Int Anticuerpos anti-igf
CN102317316B (zh) 2008-12-19 2014-08-13 帕尼玛制药股份公司 人抗α突触核蛋白自身抗体
US20110257281A1 (en) 2008-12-23 2011-10-20 John Christopher Thomas Amorphous microporous organosilicate compositions
EP2539366B1 (en) 2010-02-26 2017-11-08 BioArtic Neuroscience AB Protofibril-binding antibodies and their use in therapeutic and diagnostic methods for parkinson's disease, dementia with lewy bodies and other alpha-synucleinopathies
EP2366714A1 (en) 2010-03-03 2011-09-21 Dr. Rentschler Holding GmbH & Co. KG Naturally occuring autoantibodies against alpha-synuclein that inhibit the aggregation and cytotoxicity of alpha-synuclein
PT2646470T (pt) 2010-11-30 2017-05-03 Hoffmann La Roche Anticorpos anti-recetor da transferrina de baixa afinidade e a sua utilização na transferência de scfv terapêuticos através da barreira hematoencefálica
BR112013033258B1 (pt) 2011-06-23 2022-09-20 University Of Zurich Anticorpo isolado ou fragmento de ligação ao antígeno do mesmo que se liga a alfasinucleína, composição e seus usos
PL2771031T3 (pl) * 2011-10-28 2018-09-28 Prothena Biosciences Limited Co. Humanizowane przeciwciała rozpoznające alfa-synukleinę
CN104040342A (zh) 2011-11-02 2014-09-10 生物国际强制戒毒协会国际神经系统科学公司 抗α-共核蛋白抗体诊断脑中的α-共核蛋白的升高水平的用途
TR201909156T4 (tr) * 2012-08-29 2019-07-22 Hoffmann La Roche Kan beyin bariyeri mekiği.
EP2906596B1 (en) 2012-10-12 2023-12-27 Arizona Board of Regents on behalf of Arizona State University Antibody based reagents that specifically recognize toxic oligomeric forms of tau
KR20140138533A (ko) * 2013-05-24 2014-12-04 한화케미칼 주식회사 항 igf-1r 단일클론 항체 및 이를 포함하는 암치료용 조성물
US20150093399A1 (en) 2013-08-28 2015-04-02 Bioasis Technologies, Inc. Cns-targeted conjugates having modified fc regions and methods of use thereof
JP2017501848A (ja) * 2013-11-19 2017-01-19 プロセナ バイオサイエンシーズ リミテッド 便秘症状からのレビー小体病の免疫療法のモニター
EP3071597B1 (en) 2013-11-21 2020-07-29 F.Hoffmann-La Roche Ag Anti-alpha-synuclein antibodies and methods of use
US9629801B2 (en) 2014-01-10 2017-04-25 Wisconsin Alumni Research Foundation Blood-brain barrier targeting antibodies
WO2015130115A1 (en) * 2014-02-28 2015-09-03 Scripps Korea Antibody Institute Novel antibody specific for tspan8 and uses thereof
KR102355310B1 (ko) * 2014-03-06 2022-01-24 내셔날 리서치 카운실 오브 캐나다 인슐린-유사 성장 인자 1 수용체-특이적 항체 및 그의 용도
UA120048C2 (uk) 2014-03-06 2019-09-25 Нешнл Рісеч Каунсіл Оф Канада Антигензв'язуючий фрагмент антитіла, який специфічно зв'язується з рецептором інсуліноподібного фактора росту 1 (igf1r)
CN106536555B (zh) * 2014-03-06 2019-10-18 加拿大国家研究委员会 胰岛素样生长因子1受体特异性抗体及其用途
CN107074938A (zh) * 2014-10-16 2017-08-18 豪夫迈·罗氏有限公司 抗‑α‑突触核蛋白抗体和使用方法
CA2874083C (en) 2014-12-05 2024-01-02 Universite Laval Tdp-43-binding polypeptides useful for the treatment of neurodegenerative diseases
GB201512203D0 (en) 2015-07-13 2015-08-19 Lundbeck & Co As H Agents,uses and methods
WO2018128454A1 (ko) 2017-01-06 2018-07-12 에이비엘바이오 주식회사 항 α-SYN 항체 및 그 용도
US11359014B2 (en) 2017-05-16 2022-06-14 Alector Llc Anti-siglec-5 antibodies and methods of use thereof
CN111225923B (zh) 2017-08-02 2024-09-24 思瑞麦科生物科技公司 结合活性α突触核蛋白的抗体
CA3082559A1 (en) 2017-11-17 2019-05-23 Abl Bio Inc. Antibodies to .alpha.-synuclein and uses thereof
US12071483B1 (en) 2017-12-14 2024-08-27 Abl Bio Inc. Bispecific antibody to alpha-synuclein/insulin-like growth factor 1 receptor and use thereof
EP3985022A4 (en) 2019-06-14 2023-08-02 ABL Bio, Inc. BISPECIFIC ANTIBODIES AGAINST A-SYN/IGF1R AND ITS USE
CA3219659A1 (en) 2021-05-12 2022-11-17 Abl Bio Incorporated Antibodies for treating alpha-synucleinopathies

Patent Citations (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
US5585089A (en) 1988-12-28 1996-12-17 Protein Design Labs, Inc. Humanized immunoglobulins
US5693762A (en) 1988-12-28 1997-12-02 Protein Design Labs, Inc. Humanized immunoglobulins
WO1999010494A2 (en) 1997-08-25 1999-03-04 Genentech, Inc. Agonist antibodies to the thrombopoietin receptor, and their therapeutic uses
US20110014117A1 (en) * 2007-06-28 2011-01-20 Schering Corporation Anti-igf1r
KR20120047274A (ko) * 2009-07-29 2012-05-11 아보트 러보러터리즈 이원 가변 도메인 면역글로불린 및 이의 용도
KR20140125409A (ko) * 2012-01-27 2014-10-28 네오토프 바이오사이언시즈 리미티드 알파-시누클레인을 인식하는 인간화된 항체
KR20150063447A (ko) * 2012-10-08 2015-06-09 프로테나 바이오사이언시즈 리미티드 알파-시누클레인을 인식하는 항체
US9534044B2 (en) * 2013-02-28 2017-01-03 United Arab Emirates University Alpha-synuclein antibodies and uses thereof
KR20180081465A (ko) 2017-01-06 2018-07-16 에이비엘바이오 주식회사 항 α-syn 항체 및 그 용도

Non-Patent Citations (13)

* Cited by examiner, † Cited by third party
Title
AHN, MOL. CELLS, vol. 18, no. 2, 2004, pages 237 - 241
BAE ET AL., J NEUROSCI., vol. 32, no. 39, 26 September 2012 (2012-09-26), pages 13454 - 13469
BAE ET AL., J. NEUROSCI, vol. 32, 2012, pages 13454
CHOTHIA ET AL., NATURE, vol. 342, 1989, pages 878 - 883
CHOTHIALESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917
JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525
KIM ET AL., ALZHEIMER'S RESEARCH & THERAPY, vol. 6, 2014, pages 73
KOSTELNY ET AL., J. IMMUNOL., vol. 148, 1992, pages 1547 - 1553
MCKEITH ET AL., NEUROLOGY, vol. 47, 1996, pages 1113 - 24
RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 27
SONGSIVILAILACHMANN, CLIN. EXP. IMMUNOL., vol. 79, 1990, pages 315 - 321
STEINBERGER.RADERBARBAS III: "Phage Display Laboratory Manual", 2000, COLD SPRING HARBOR LABORATORY PRESS, article "Phage display vectors"
VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN110494445A (zh) * 2017-01-06 2019-11-22 Abl生物公司 抗α-SYN抗体及其用途
EP3567054A4 (en) * 2017-01-06 2021-03-10 ABL Bio Inc. ANTI-ALPHA SYN ANTIBODIES AND USES THEREOF
CN110494445B (zh) * 2017-01-06 2023-10-20 Abl生物公司 抗α-SYN抗体及其用途
US12049493B2 (en) 2017-01-06 2024-07-30 Abl Bio Inc. Anti-alpha-synuclein antibodies and uses thereof
US11142570B2 (en) 2017-02-17 2021-10-12 Bristol-Myers Squibb Company Antibodies to alpha-synuclein and uses thereof
US11827695B2 (en) 2017-02-17 2023-11-28 Bristol-Myers Squibb Company Antibodies to alpha-synuclein and uses thereof
US12071483B1 (en) 2017-12-14 2024-08-27 Abl Bio Inc. Bispecific antibody to alpha-synuclein/insulin-like growth factor 1 receptor and use thereof
CN113966346A (zh) * 2019-06-14 2022-01-21 Abl生物公司 抗a-syn/igf1r的双特异性抗体及其用途
WO2021130717A1 (ko) 2019-12-26 2021-07-01 에이비엘바이오 주식회사 단백질 a 친화성 크로마토그래피를 이용한 생리활성 펩티드의 정제 방법

Also Published As

Publication number Publication date
AU2018385230A1 (en) 2020-07-02
KR20200067838A (ko) 2020-06-12
EP4403218A2 (en) 2024-07-24
WO2019117685A2 (ko) 2019-06-20
JP2022104966A (ja) 2022-07-12
EP3725806A4 (en) 2022-03-30
AU2018385230B2 (en) 2022-10-13
AU2022241522A1 (en) 2022-12-22
US12071483B1 (en) 2024-08-27
JP7212391B2 (ja) 2023-01-25
JP2024096805A (ja) 2024-07-17
CN111886251A (zh) 2020-11-03
JP2023052217A (ja) 2023-04-11
CN116731173A (zh) 2023-09-12
BR112020011875A2 (pt) 2020-11-24
JP2021506770A (ja) 2021-02-22
KR102263812B1 (ko) 2021-06-14
US20240101687A1 (en) 2024-03-28
WO2019117685A3 (ko) 2019-08-01
EP3725806A1 (en) 2020-10-21
CA3085572A1 (en) 2019-06-20
JP7513651B2 (ja) 2024-07-09

Similar Documents

Publication Publication Date Title
KR102263812B1 (ko) a-syn/IGF1R에 대한 이중 특이 항체 및 그 용도
AU2018370279B2 (en) Antibodies to a-synuclein and uses thereof
KR102444797B1 (ko) α-SYN/IGF1R에 대한 이중 특이 항체 및 그 용도
EA047717B1 (ru) БИСПЕЦИФИЧНОЕ АНТИТЕЛО К α-SYN/IGF1R И ЕГО ПРИМЕНЕНИЕ
EA045348B1 (ru) БИСПЕЦИФИЧНОЕ АНТИТЕЛО К α-SYN/IGF1R И ЕГО ПРИМЕНЕНИЕ

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 18889608

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 2020531764

Country of ref document: JP

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 3085572

Country of ref document: CA

WWE Wipo information: entry into national phase

Ref document number: 122023007118

Country of ref document: BR

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2018385230

Country of ref document: AU

Date of ref document: 20181214

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2018889608

Country of ref document: EP

Effective date: 20200714

REG Reference to national code

Ref country code: BR

Ref legal event code: B01A

Ref document number: 112020011875

Country of ref document: BR

ENP Entry into the national phase

Ref document number: 112020011875

Country of ref document: BR

Kind code of ref document: A2

Effective date: 20200612