WO2017201325A1 - Combinations of mrnas encoding immune modulating polypeptides and uses thereof - Google Patents

Combinations of mrnas encoding immune modulating polypeptides and uses thereof Download PDF

Info

Publication number
WO2017201325A1
WO2017201325A1 PCT/US2017/033395 US2017033395W WO2017201325A1 WO 2017201325 A1 WO2017201325 A1 WO 2017201325A1 US 2017033395 W US2017033395 W US 2017033395W WO 2017201325 A1 WO2017201325 A1 WO 2017201325A1
Authority
WO
WIPO (PCT)
Prior art keywords
polypeptide
composition
polynucleotide encoding
seq
encoding
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2017/033395
Other languages
English (en)
French (fr)
Other versions
WO2017201325A8 (en
Inventor
Joshua Frederick
Susannah HEWITT
Ailin Bai
Stephen Hoge
Vladimir PRESNYAK
Lain Mcfadyen
Kerry BANENATO
Ellalahewage Sathyajith Kumarasinghe
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
ModernaTx Inc
Original Assignee
ModernaTx Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to SI201731226T priority Critical patent/SI3458474T1/sl
Priority to PL17727999.9T priority patent/PL3458474T3/pl
Priority to CN202310702910.3A priority patent/CN116726203A/zh
Priority to EP17727999.9A priority patent/EP3458474B1/en
Priority to LTEPPCT/US2017/033395T priority patent/LT3458474T/lt
Priority to CN201780044529.5A priority patent/CN109476718B/zh
Priority to EP22181855.2A priority patent/EP4137509A1/en
Priority to DK17727999.9T priority patent/DK3458474T3/da
Priority to ES17727999T priority patent/ES2932516T3/es
Priority to SM20230003T priority patent/SMT202300003T1/it
Priority to AU2017266929A priority patent/AU2017266929B2/en
Priority to JP2018560868A priority patent/JP7194594B2/ja
Priority to KR1020187036733A priority patent/KR102482867B1/ko
Priority to HRP20221135TT priority patent/HRP20221135T8/hr
Priority to RS20220929A priority patent/RS63625B1/sr
Priority to CA3024917A priority patent/CA3024917A1/en
Priority to KR1020227045735A priority patent/KR20230008243A/ko
Application filed by ModernaTx Inc filed Critical ModernaTx Inc
Priority to MA45035A priority patent/MA45035B1/fr
Publication of WO2017201325A1 publication Critical patent/WO2017201325A1/en
Priority to US15/995,889 priority patent/US10172808B2/en
Publication of WO2017201325A8 publication Critical patent/WO2017201325A8/en
Priority to US16/184,282 priority patent/US10322090B2/en
Anticipated expiration legal-status Critical
Priority to US16/219,418 priority patent/US10322091B2/en
Priority to US16/222,155 priority patent/US10406113B2/en
Priority to US16/227,810 priority patent/US10285950B2/en
Priority to US16/543,102 priority patent/US11185510B2/en
Priority to US17/071,685 priority patent/US11071716B2/en
Priority to US17/352,904 priority patent/US11344504B1/en
Priority to US17/826,387 priority patent/US20230041964A1/en
Priority to US17/930,369 priority patent/US11596609B2/en
Priority to JP2022197763A priority patent/JP7586883B2/ja
Priority to AU2023210606A priority patent/AU2023210606A1/en
Ceased legal-status Critical Current

Links

Classifications

    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/48Preparations in capsules, e.g. of gelatin, of chocolate
    • A61K9/50Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
    • A61K9/51Nanocapsules; Nanoparticles
    • A61K9/5107Excipients; Inactive ingredients
    • A61K9/5123Organic compounds, e.g. fats, sugars
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K31/00Medicinal preparations containing organic active ingredients
    • A61K31/70Carbohydrates; Sugars; Derivatives thereof
    • A61K31/7088Compounds having three or more nucleosides or nucleotides
    • A61K31/7115Nucleic acids or oligonucleotides having modified bases, i.e. other than adenine, guanine, cytosine, uracil or thymine
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/177Receptors; Cell surface antigens; Cell surface determinants
    • A61K38/1774Immunoglobulin superfamily (e.g. CD2, CD4, CD8, ICAM molecules, B7 molecules, Fc-receptors, MHC-molecules)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • A61K38/2006IL-1
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • A61K38/208IL-12
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • A61K38/2086IL-13 to IL-16
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/39Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/3955Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K45/00Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
    • A61K45/06Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/16Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
    • A61K47/18Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/24Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing atoms other than carbon, hydrogen, oxygen, halogen, nitrogen or sulfur, e.g. cyclomethicone or phospholipids
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K47/00Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
    • A61K47/06Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
    • A61K47/28Steroids, e.g. cholesterol, bile acids or glycyrrhetinic acid
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
    • A61K48/005Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy characterised by an aspect of the 'active' part of the composition delivered, i.e. the nucleic acid delivered
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/0012Galenical forms characterised by the site of application
    • A61K9/0019Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/10Dispersions; Emulsions
    • A61K9/127Synthetic bilayered vehicles, e.g. liposomes or liposomes with cholesterol as the only non-phosphatidyl surfactant
    • A61K9/1271Non-conventional liposomes, e.g. PEGylated liposomes or liposomes coated or grafted with polymers
    • A61K9/1272Non-conventional liposomes, e.g. PEGylated liposomes or liposomes coated or grafted with polymers comprising non-phosphatidyl surfactants as bilayer-forming substances, e.g. cationic lipids or non-phosphatidyl liposomes coated or grafted with polymers
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K9/00Medicinal preparations characterised by special physical form
    • A61K9/48Preparations in capsules, e.g. of gelatin, of chocolate
    • A61K9/50Microcapsules having a gas, liquid or semi-solid filling; Solid microparticles or pellets surrounded by a distinct coating layer, e.g. coated microspheres, coated drug crystals
    • A61K9/51Nanocapsules; Nanoparticles
    • A61K9/5107Excipients; Inactive ingredients
    • A61K9/513Organic macromolecular compounds; Dendrimers
    • A61K9/5146Organic macromolecular compounds; Dendrimers obtained otherwise than by reactions only involving carbon-to-carbon unsaturated bonds, e.g. polyethylene glycol, polyamines, polyanhydrides
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5434IL-12
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5443IL-15
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/5446IL-16
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52Cytokines; Lymphokines; Interferons
    • C07K14/54Interleukins [IL]
    • C07K14/545IL-1
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70575NGF/TNF-superfamily, e.g. CD70, CD95L, CD153, CD154
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2818Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against CD28 or CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2803Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
    • C07K16/2827Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against B7 molecules, e.g. CD80, CD86
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/53DNA (RNA) vaccination
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/54Medicinal preparations containing antigens or antibodies characterised by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/545Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/58Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation
    • A61K2039/585Medicinal preparations containing antigens or antibodies raising an immune response against a target which is not the antigen used for immunisation wherein the target is cancer
    • BPERFORMING OPERATIONS; TRANSPORTING
    • B82NANOTECHNOLOGY
    • B82YSPECIFIC USES OR APPLICATIONS OF NANOSTRUCTURES; MEASUREMENT OR ANALYSIS OF NANOSTRUCTURES; MANUFACTURE OR TREATMENT OF NANOSTRUCTURES
    • B82Y5/00Nanobiotechnology or nanomedicine, e.g. protein engineering or drug delivery
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N15/00Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
    • C12N15/09Recombinant DNA-technology
    • C12N15/87Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation
    • C12N15/88Introduction of foreign genetic material using processes not otherwise provided for, e.g. co-transformation using microencapsulation, e.g. using amphiphile liposome vesicle

Definitions

  • Cancer is a disease characterized by uncontrolled cell division and growth within the body. In the United States, roughly a third of all women and half of all men will experience cancer in their lifetime. With the host of undesired consequences brought about by standard treatments such as chemotherapy and radiotherapy used today, genetic therapy for the manipulation of disease-related peptides and their functions provides a more targeted approach to disease diagnosis, treatment and management. However, gene therapy poses multiple challenges including undesirable immune response and safety concern due to the incorporation of the gene at random locations within the genome. Therefore, there is a need for an improved therapeutic approach to treat tumors. BRIEF SUMMARY
  • the present disclosure provides mRNA therapeutics for the treatment of cancer.
  • the mRNA therapeutics of the disclosure are particularly well-suited for the treatment of cancer as the technology provides for the intracellular delivery of mRNA encoding immune modulating polypeptides (for example, oncology-related polypeptides, including immune response stimulators, co-stimulatory factors, checkpoint inhibitors, and the like, useful in immuno-oncology ("10")), followed by de novo synthesis of functional proteins within target cells, e.g., within target cells in tumors.
  • immune modulating polypeptides for example, oncology-related polypeptides, including immune response stimulators, co-stimulatory factors, checkpoint inhibitors, and the like, useful in immuno-oncology (“10")
  • target cells e.g., within target cells in tumors.
  • the disclosure features therapeutic mRNAs having modified nucleotides to (1) minimize unwanted immune activation (e.g., the innate immune response associated with in vivo introduction of foreign nucleic acids) and (2) optimize the translation efficiency of mRNA to protein.
  • therapeutic mRNAs having a combination of nucleotide e.g., the innate immune response associated with in vivo introduction of foreign nucleic acids
  • the mRNA therapeutic technology of the disclosure features delivery of mRNA(s) encoding immune modulating (e.g., oncology-related) polypeptides via a lipid nanoparticle (LNP) delivery system.
  • the mRNA therapeutic technology of the disclosure features delivery of mRNA(s) encoding immune modulating polypeptides into tumors via a lipid nanoparticle (LNP) delivery system.
  • the disclosure also features novel ionizable lipid-based LNPs which have improved properties when combined with mRNA(s) encoding immune modulating (e.g., oncology-related) polypeptides and administered in vivo, for example, cellular uptake, intracellular transport and/or endosomal release or endosomal escape.
  • immune modulating e.g., oncology-related
  • formulations of the disclosure also demonstrate reduced immunogenicity associated with the in vivo administration of LNPs.
  • the present disclosure features methods and compositions for treating cancer, in particular, immunotherapeutic methods and compositions.
  • the disclosure features methods and compositions for treating cancer using a combination therapy that features two or more immune modulating (e.g., oncology-related) polynucleotides (e.g., mRNAs) encoding a first immune response primer polypeptide and a second, different, immune response primer polypeptide, and, optionally, a polynucleotide encoding an immune response co-stimulatory signal polypeptide and, optionally, a polynucleotide encoding a checkpoint inhibitor polypeptide or a polypeptide comprising a checkpoint inhibitor polypeptide.
  • immune modulating e.g., oncology-related polynucleotides
  • mRNAs e.g., mRNAs
  • the disclosure provides an immunomodulatory composition comprising a polynucleotide encoding an Interleukin-23 (IL-23) polypeptide, a polynucleotide encoding an Interleukin-36 gamma (IL-36 gamma) polypeptide and, optionally, a polynucleotide encoding an OX40L polypeptide.
  • the disclosure provides an immunomodulatory composition comprising a polynucleotide encoding an IL-23 polypeptide, a polynucleotide encoding an Interleukin 18 (IL-18) polypeptide and, optionally, a polynucleotide encoding an OX40L polypeptide.
  • aspects of the disclosure feature treatment with a polynucleotide mRNA encoding an IL-23 polypeptide in combination with mRNA encoding an IL-36 polypeptide.
  • Other aspects of the disclosure feature treatment with mRNA encoding an IL-23 polypeptide in combination with mRNA encoding an IL-18 polypeptide.
  • Yet other aspects of the disclosure feature treatment with mRNA encoding immune response primer polypeptides in combination with additional therapeutic agents, such as a checkpoint inhibitor polypeptide (e.g., anti-PD-1 antibody, anti-PDL-1 antibody, anti-CTLA4, or a combination thereof).
  • exemplary aspects feature treatment with lipid nanoparticle- (LNP-) encapsulated mRNAs.
  • Exemplary aspects feature intratumoral administration of mRNAs in ionizable amino lipid-based LNPs.
  • the present disclosure provides methods of reducing or decreasing the size of a tumor or inhibiting tumor growth in a subject in need thereof by administering at least two polynucleotides, wherein the at least two polynucleotides are selected from a first polynucleotide encoding a first immune response primer polypeptide (e.g., an IL-23 polypeptide) and a second polynucleotide encoding a second immune response primer polypeptide (different from the first) e.g., an IL-36 gamma polypeptide or an IL-18 polypeptide and, optionally, a third polynucleotide encoding an immune response co-stimulatory signal polypeptide (e.g., an OX40L polypeptide).
  • a first immune response primer polypeptide e.g., an IL-23 polypeptide
  • a second polynucleotide encoding a second immune response primer polypeptide (different from the first) e.g
  • the first polynucleotide comprises an mRNA encoding the first polypeptide
  • the second polynucleotide comprises an mRNA encoding the second polypeptide
  • the third polynucleotide comprises an mRNA encoding the third polypeptide.
  • the first polynucleotide, the second polynucleotide, and/or the third polynucleotide comprise at least one chemically modified nucleoside.
  • the at least one chemically modified nucleoside is selected from the group consisting of pseudouridine, Nl- methylpseudouridine, 5-methylcytosine, 5-methoxyuridine, and a combination thereof.
  • the disclosure provides a composition, e.g., an immunomodulatory composition, comprising at least two polynucleotides (e.g., at least two mRNAs), wherein the at least two polynucleotides are selected from the group consisting of:
  • the composition further comprises at least one polynucleotide encoding a checkpoint inhibitor polypeptide.
  • the composition is administered to subjects in need thereof in combination with another cancer therapy, such as a polypeptide comprising a checkpoint inhibitor polypeptide (e.g., an anti-PD-1 antibody, an anti-PDL-1 antibody, an anti-CTLA4 antibody, or a combination thereof).
  • a checkpoint inhibitor polypeptide e.g., an anti-PD-1 antibody, an anti-PDL-1 antibody, an anti-CTLA4 antibody, or a combination thereof.
  • the composition comprises at least one polynucleotide (e.g., an mRNA) encoding a first immune response primer polypeptide and at least one polynucleotide (e.g., an mRNA) encoding a second immune response primer polypeptide (different from the first immune response primer polypeptide), wherein the first and second immune response primer polypeptides have one or more activities selected from the group consisting of:
  • the immune response primer polypeptide is an IL-12 family member.
  • the IL-12 family member is a polypeptide selected from the group consisting of IL-12, IL-23, IL-12p40 subunit, IL-23pl9 subunit, IL-27, IL-35, and combinations thereof.
  • the immune response primer polypeptide is IL-23.
  • the IL-23 polypeptide comprises the amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 5 or SEQ ID NO: 140.
  • the IL-23 polypeptide is encoded by a nucleotide sequence comprising the nucleotide sequence shown in SEQ ID NO: 141 or 142.
  • the immune response primer polypeptide is an IL-1 family member.
  • the IL-1 family member is a polypeptide selected from the group consisting of IL-1 a, IL- ⁇ , IL-IRa, IL-18, IL-33, IL-36Ra, IL-36cc, IL-36 , IL-36y, IL-37, IL-38, and
  • the immune response primer polypeptide is an IL-36- gamma polypeptide or an IL-18 polypeptide. In one embodiment, the immune response primer polypeptide is IL-36-gamma polypeptide. In one embodiment, the IL-36-gamma polypeptide comprises the amino acid sequence shown in SEQ ID NO: 16. In one embodiment, the IL-36- gamma polypeptide is encoded by a nucleotide sequence comprising the nucleotide sequence shown in SEQ ID NO: 143 or 144. In one embodiment, the immune response primer polypeptide is IL-18. In one embodiment, the IL-18 polypeptide comprises the amino acid sequence shown in SEQ ID NO: 147, 149, 151 or 153. In one embodiment, the IL-18 polypeptide is encoded by a nucleotide sequence selected from SEQ ID NO: 148 and 155-162.
  • the disclosure provides a composition (e.g., an immune modulatory composition) comprising at least two polynucleotides (e.g., two mRNAs) encoding a first immune response primer polypeptide and a second immune response primer polypeptide, wherein the first immune response primer polypeptide is an IL-12 family member and the second immune response primer polypeptide is an IL- 1 family member.
  • the first immune response primer polypeptide is an IL-23 polypeptide and the second immune response primer polypeptide is an IL- 36-gamma polypeptide.
  • the first immune response primer polypeptide is an IL- 23 polypeptide and the second immune response primer polypeptide is an IL-18 polypeptide.
  • the disclosure provides a composition (e.g., an immune modulatory composition) comprising at least three polynucleotides (e.g., three mRNAs) encoding at least one polynucleotide encoding a first immune response primer polypeptide, at least one polynucleotide encoding a second immune response primer polypeptide (different from the first), and at least one polynucleotide encoding an immune response co-stimulatory signal polypeptide.
  • the immune response co- stimulatory signal polypeptide has at least one activity selected from the group consisting of:
  • the immune response co-stimulatory signal polypeptide has at least one activity selected from the group consisting of:
  • the immune response co- stimulatory signal polypeptide is selected from the group consisting of OX40L, CD80, IL-15, and combinations thereof. In one embodiment, the immune response co-stimulatory signal polypeptide is selected from the group consisting of OX40L, CD80, IL-15, and combinations thereof. In one embodiment, the immune response co- stimulatory signal polypeptide is OX40L. In one embodiment, the OX40L polypeptide comprises the amino acid sequence shown in SEQ ID NO: 21. In one embodiment, the OX40L polypeptide is encoded by a nucleotide sequence comprising the nucleotide sequence shown in SEQ ID NO: 145 or 146.
  • the disclosure provides a composition (e.g., an immune modulatory composition) comprising at least three polynucleotides (e.g., three mRNAs) encoding a first immune response primer polypeptide, a second immune response primer polypeptide and an immune response co- stimulatory signal polypeptide, wherein the first immune response primer polypeptide is an IL-23 polypeptide, the second immune response primer polypeptide is an IL-18 polypeptide, and the immune response co- stimulatory signal polypeptide is OX-40L.
  • a composition e.g., an immune modulatory composition
  • at least three polynucleotides e.g., three mRNAs
  • the first immune response primer polypeptide is an IL-23 polypeptide
  • the second immune response primer polypeptide is an IL-18 polypeptide
  • the immune response co- stimulatory signal polypeptide is OX-40L.
  • the disclosure provides a composition (e.g., an immunomodulatory composition) comprising at least three polynucleotides (e.g., three mRNAs) encoding a first immune response primer polypeptide, a second immune response primer polypeptide and an immune response co-stimulatory signal polypeptide, wherein the first immune response primer polypeptide is IL-23 polypeptide, the second immune response primer polypeptide is IL-36-gamma polypeptide, and the immune response co- stimulatory signal polypeptide is OX-40L.
  • the composition further comprises a polynucleotide (e.g., mRNA) encoding a checkpoint inhibitor polypeptide.
  • the disclosure provides a composition for reducing the size of a tumor or inhibiting growth of a tumor, the composition comprising at least two polynucleotides (e.g., two mRNAs) encoding at least a first and a second polypeptide, wherein the at least two polynucleotides are selected from the group consisting of:
  • the at least two polynucleotides are selected from the group consisting of:
  • the at least two polynucleotides are selected from the group consisting of:
  • the at least two polynucleotides are selected from the group consisting of: (i) a polynucleotide encoding an IL23 polypeptide and a polynucleotide encoding an
  • the disclosure provides a composition for reducing the size of a tumor or inhibiting growth of a tumor, the composition comprising at least three polynucleotides (e.g., three mRNAs) encoding at least a first, second and third polypeptides, wherein the at least three polynucleotides are selected from the group consisting of:
  • polynucleotide encoding an IL-23 polypeptide comprises: (i) an
  • the polynucleotide encoding an IL-23 polypeptide comprises an IL-12p40 polypeptide, an IL-23pl9 polypeptide and a linker operatively positioned between the IL- 12p40 polypeptide and the IL-23pl9 polypeptide.
  • the linker is a Gly/Ser linker (e.g., G4S), having an amino acid sequence as shown in any of SEQ ID NOs: 136-139).
  • the polynucleotide encoding an IL-23 polypeptide comprises the amino acid sequence shown in SEQ ID NO: 140. In other aspects, the polynucleotide encoding an IL-23 polypeptide comprises the nucleotide sequence shown in SEQ ID NO: 141. [25] In some aspects, the polynucleotide encoding an IL-18 polypeptide comprises a heterologous signal sequence. In one aspect, the polynucleotide encoding an IL-18 polypeptide comprises the amino acid sequence shown in SEQ ID NO: 147, 149, 151 or 153. In one aspect, the polynucleotide encoding an IL-18 polypeptide comprises the nucleotide sequence selected from SEQ ID NO: 148 and 155-162.
  • the polynucleotide encoding an IL-36gamma polypeptide comprises a heterologous signal sequence. In one aspect, the polynucleotide encoding an IL36-gamma polypeptide comprises the amino acid sequence shown in SEQ ID NO: 16. In one aspect, the polynucleotide encoding an IL-36gamma polypeptide comprises the nucleotide sequence shown in SEQ ID NO: 143.
  • the polynucleotide encoding an OX40L polypeptide comprises the amino acid sequence shown in SEQ ID NO: 21. In one embodiment, the polynucleotide encoding an OX40L polypeptide comprises the nucleotide sequence shown in SEQ ID NO: 145.
  • the disclosure provides a composition e.g., for reducing the size of a tumor or inhibiting growth of a tumor, the composition comprising at least three polynucleotides (e.g., three mRNAs) encoding at least a first, second and third polypeptides, wherein the at least three polynucleotides comprise a first polynucleotide encoding OX40L, a second polynucleotide encoding an IL-23 polypeptide, and a third polynucleotide encoding IL-36gamma, wherein the first, second and third polynucleotides are present in the composition at a mass ratio of approximately 1: 1:2, respectively.
  • polynucleotides e.g., three mRNAs
  • the at least three polynucleotides comprise a first polynucleotide encoding OX40L, a second polynucleotide encoding an IL-23 polypeptid
  • the first and second polynucleotides, encoding OX40L and IL-23 respectively, are present in the composition in approximately equal mass amounts and the third polynucleotide, encoding IL-36gamma, is present in the composition at a higher mass amount than the first and third polynucleotides. Additional mass ratios for the composition are disclosed herein.
  • lipid nanoparticle comprising any of the foregoing or related compositions.
  • the lipid nanoparticle is formulated with a pharmaceutically acceptable carrier or excipient.
  • the lipid nanoparticle is formulated for intratumoral administration (iTu).
  • the disclosure provides a lipid nanoparticle comprising: [31] a polynucleotide encoding a human OX40L polypeptide, wherein the polynucleotide comprises an ORF encoding a human OX40L polypeptide; a polynucleotide encoding a human IL23 polypeptide, wherein the polynucleotide comprises an ORF encoding a human IL-12p40 polypeptide operably linked to a human IL-23pl9 polypeptide; and a polynucleotide encoding a human IL-36 gamma polypeptide, wherein the polynucleotide comprises an ORF encoding a human IL-36 gamma polypeptide.
  • the human IL-12p40 polypeptide is operably linked to the human IL-
  • the IL-12p40 polypeptide is located at the 5' terminus of the IL-23pl9 polypeptide or the linker (e.g., peptide linker). In other aspects, the IL- 12p40 polypeptide is located at the 5' terminus of the IL-23pl9 polypeptide or the linker (e.g., peptide linker). In some aspects, the linker is a peptide linker, for example, a Gly/Ser linker (e.g., G6S).
  • Gly/Ser linker comprises (GnS)m, wherein n is 1, 2 3, 4, 5, 6, 7, 8, 9, 10, 15, or 20 and m is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, or 20. In some aspects, the Gly/Ser linker comprises (GnS)m, and wherein n is 6 and m is 1 (i.e., G6S).
  • a polynucleotide comprising an ORF encoding a human IL23 polypeptide or a polynucleotide comprising an ORF encoding a human IL-36 gamma polypeptide further comprises a signal peptide.
  • the signal peptide is a heterologous signal peptide, for example a signal peptide derived from human immunoglobulin kappa light chain variable region, MGVK4.
  • the human OX40L polypeptide comprises an amino acid sequence set forth in SEQ ID NO: 21.
  • the human IL-12p40 polypeptide comprises an amino acid sequence set forth in SEQ ID NO: 1.
  • the human IL-23pl9 polypeptide comprises an amino acid sequence set forth in SEQ ID NO: 5.
  • the human IL-36 gamma polypeptide comprises an amino acid sequence set forth in SEQ ID NO: 16.
  • the disclosure provides any of the foregoing or related
  • the miRNA binding site is a miR-122 binding site (e.g., a miR-122-3p binding site, a miR- 122-5p binding site or both). In some embodiments, the miR binding site is at least one miR-122-5p binding site. In some embodiments the polynucleotide comprises a 3' UTR comprising at least one miR-122-5p binding site. In some aspects, the miR-122-5p binding site comprises the nucleotide sequence shown in SEQ ID NO: 26.
  • the polynucleotide comprises a 3' UTR comprising the nucleotide sequence shown in SEQ ID NO: 120. In one aspect, the polynucleotide comprises a 5' UTR comprising the nucleotide sequence shown in SEQ ID NO: 27.
  • the disclosure provides use of any of the foregoing or preceding compositions or lipid nanoparticles as described herein in the manufacture of a medicament for treating or delaying progression of cancer in an individual, wherein the medicament comprises the composition or lipid nanoparticle and an optional pharmaceutically acceptable carrier, and wherein the treatment comprises administration of the medicament in combination with a composition comprising a checkpoint inhibitor polypeptide (e.g., an anti-PD-1 antibody, an anti-PDL-1 antibody, an anti-CTLA4 antibody, or a combination thereof), and an optional pharmaceutically acceptable carrier.
  • a checkpoint inhibitor polypeptide e.g., an anti-PD-1 antibody, an anti-PDL-1 antibody, an anti-CTLA4 antibody, or a combination thereof
  • the disclosure provides a kit comprising a container comprising a polynucleotide (e.g., an mRNA) composition or a lipid nanoparticle comprising polynucleotides as (e.g., mRNAs) as disclosed herein, and an optional pharmaceutically acceptable carrier, and a package insert comprising instructions for administration of the lipid nanoparticle or pharmaceutical composition for treating or delaying progression of cancer in an individual.
  • the package insert further comprises instructions for administration of the pharmaceutical composition in combination with a composition comprising a checkpoint inhibitor polypeptide and an optional pharmaceutically acceptable carrier for treating or delaying progression of cancer in an individual.
  • the disclosure provides a kit comprising a medicament comprising any of the foregoing or preceding compositions or lipid nanoparticles as described herein and an optional pharmaceutically acceptable carrier, and a package insert comprising instructions for administration of the medicament alone or in combination with a composition comprising a checkpoint inhibitor polypeptide (e.g., an anti-PD-1 antibody, an anti-PDL-1 antibody, an anti- CTLA4 antibody, or a combination thereof), and an optional pharmaceutically acceptable carrier for treating or delaying progression of cancer in an individual.
  • the kit further comprises a package insert comprising instructions for administration of the first medicament and the second medicament for treating or delaying progression of cancer in an individual.
  • compositions comprising any of the foregoing or preceding lipid nanoparticles as described herein and an optional pharmaceutically acceptable carrier for use in treating or delaying progression of cancer in an individual, wherein the treatment comprises administration of the lipid nanoparticle in combination with a second composition, wherein the second composition comprises a checkpoint inhibitor polypeptide (e.g., an anti-PD-1 antibody, an anti-PDL-1 antibody, an anti-CTLA4 antibody, or a combination thereof), and an optional pharmaceutically acceptable carrier.
  • a checkpoint inhibitor polypeptide e.g., an anti-PD-1 antibody, an anti-PDL-1 antibody, an anti-CTLA4 antibody, or a combination thereof
  • the checkpoint inhibitor polypeptide inhibits PD1, PD-L1, CTLA4, or a combination thereof.
  • the checkpoint inhibitor polypeptide is an antibody or a polynucleotide encoding the antibody.
  • the antibody is an anti-CTLA4 antibody or antigen-binding fragment thereof that specifically binds CTLA4, an anti-PDl antibody or antigen-binding fragment thereof that specifically binds PD1, an anti-PD-Ll antibody or antigen- binding fragment thereof that specifically binds PD-L1, and a combination thereof.
  • the anti-PD-Ll antibody is atezolizumab, avelumab, or durvalumab.
  • the anti-CTLA-4 antibody is tremelimumab or ipilimumab.
  • the anti-PDl antibody is nivolumab or pembrolizumab.
  • the polynucleotides within the composition are mRNA, wherein each mRNA includes at least one chemical modification.
  • the chemical modification is selected from the group consisting of pseudouridine, Nl- methylpseudouridine, 2-thiouridine, 4'-thiouridine, 5-methylcytosine, 2-thio-l -methyl- 1-deaza- pseudouridine, 2-thio-l -methyl-pseudouridine, 2-thio-5-aza-uridine, 2-thio-dihydropseudouridine, 2- thio-dihydrouridine, 2-thio-pseudouridine, 4-methoxy-2-thio-pseudouridine, 4-methoxy- pseudouridine, 4-thio-l -methyl-pseudouridine, 4-thio-pseudouridine, 5-aza-uridine,
  • the mRNA comprises at least one chemically modified nucleoside, wherein the at least one chemically modified nucleoside is selected from the group consisting of pseudouridine, Nl-methylpseudouridine, 5-methylcytosine, 5-methoxyuridine, and a combination thereof.
  • the at least one chemically modified nucleoside is Nl- methylpseudouridine.
  • the polynucleotide is a fully modified Nl- methylpseudouridine mRNA. Additional chemical modifications are disclosed herein.
  • the composition is formulated in a lipid nanoparticle carrier.
  • a composition comprising a first and second polynucleotide, and optionally a third polynucleotide, as described herein, are formulated such that all polynucleotides within the composition are carried by the same lipid nanoparticle carrier.
  • the lipid nanoparticle carrier comprises a molar ratio of about 20-60% ionizable amino lipid: 5-25% phospholipid: 25-55% sterol; and 0.5-15% PEG-modified lipid.
  • the ionizable amino lipid is selected from the group consisting of for example, 2,2-dilinoleyl-4- dimethylaminoethyl-[l,3]-dioxolane (DLin-KC2-DMA), dilinoleyl-methyl-4-dimethylaminobutyrate (DLin-MC3-DMA), and di((Z)-non-2-en-l-yl) 9-((4-(dimethylamino)butanoyl)oxy)- heptadecanedioate (L319).
  • the ionizable amino lipid is Compound 18.
  • the lipid nanoparticle comprises a molar ratio of about 20-60% ionizable amino lipid: 5-25% phospholipid: 25-55% sterol; and 0.5-15% PEG-modified lipid.
  • the lipid nanoparticle carrier comprises a molar ratio of about 20-60% Compound 18: 5-25% phospholipid: 25-55% cholesterol; and 0.5-15% PEG-modified lipid.
  • the lipid nanoparticle carrier comprises a molar ratio of about 50% ionizable amino lipid: about 10% phospholipid: about 38.5% cholesterol; and about 1.5% PEG-modified lipid.
  • the lipid nanoparticle carrier comprises a molar ratio of about 50% Compound 18: about 10%
  • the lipid nanoparticle carrier comprises a molar ratio of about 49.83% ionizable amino lipid: about 9.83% phospholipid: about 30.33% cholesterol; and about 2.0% PEG-modified lipid. In other aspects, the lipid nanoparticle carrier comprises a molar ratio of about 49.83% Compound 18: about 9.83% phospholipid: about 30.33% cholesterol; and about 2.0% PEG-modified lipid.
  • the invention pertains to a method of reducing or decreasing a size of a tumor or inhibiting a tumor growth in a subject in need thereof comprising administering to the subject any of the compositions described herein.
  • the composition is administered intratumorally.
  • the composition is administered regionally (i.e., into the region in which the tumor is growing), for example the composition can be
  • the tumor is administered intraperitoneally for tumors in the peritoneal cavity.
  • the tumor is a hepatocellular carcinoma.
  • the tumor is an ovarian tumor, a colon tumor or a disseminated gastric tumor.
  • Other suitable tumors and cancers for treatment are disclosed herein.
  • the IL-23 polypeptide comprises an IL-12p40 subunit comprising an amino acid sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identical to a sequence listed in TABLE 1, wherein the amino acid sequence is capable of binding to an IL-23pl9 subunit and forming IL-23, which has an IL-23 activity.
  • the IL-23 polypeptide comprises an IL-23pl9 subunit comprising an amino acid sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identical to a sequence listed in TABLE 1, wherein the amino acid sequence is capable of binding to an IL- 12p40 subunit and forming IL-23, which has an IL-23 activity.
  • the IL-12p40 subunit and the IL-23P19 subunit are on a single polypeptide chain or two different chains.
  • the IL-36-gamma polypeptide comprises an amino acid sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identical to a sequence listed in TABLE 1, wherein the amino acid sequence has IL-36-gamma activity.
  • the method of the disclosure further comprises administering a third protein or a third polynucleotide encoding the third protein.
  • the third protein comprises an OX40L polypeptide.
  • the OX40L polypeptide comprises an amino acid sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% identical to a sequence listed in TABLE 1A, wherein the amino acid sequence has a OX40L activity.
  • the first polynucleotide (e.g., mRNA), the second polynucleotide (e.g., mRNA), and/or the third polynucleotide (e.g., mRNA) further comprise a nucleic acid sequence comprising a miRNA binding site, e.g., miR- 122, e.g., aacgccauua ucacacuaaa ua (SEQ ID NO: 23) or uggaguguga caaugguguu ug (SEQ ID NO: 25).
  • the first polynucleotide and/or the second polynucleotide and/or the third polynucleotide can further comprise a 5' UTR, a 3' UTR, a 5' terminal cap, and/or a 3' polyA tail.
  • the first polynucleotide (e.g., mRNA), the second polynucleotide (e.g., mRNA), and/or the third polynucleotide (e.g., mRNA) are codon optimized, in vitro transcribed, chimeric, or circular.
  • the first polynucleotide e.g., mRNA
  • the second polynucleotide e.g., mRNA
  • the third polynucleotide e.g., mRNA
  • the delivery agent comprises a com ound having formula (I)
  • Ri is selected from the group consisting of C5-30 alkyl, C5-20 alkenyl, -R*YR", -YR", and -R"M'R';
  • R2 and R3 are independently selected from the group consisting of H, Ci-i 4 alkyl, C2-14 alkenyl, -R*YR", -YR", and -R*OR", or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;
  • R 4 is selected from the group consisting of a C3-6 carbocycle, -(CH2) n Q, -(CH2) n CHQR,
  • Ci-6 alkyl where Q is selected from a carbocycle, heterocycle,
  • each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R 6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • M and M' are independently selected from -C(0)0-, -OC(O)-, -C(0)N(R ,
  • R7 is selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • R 8 is selected from the group consisting of C3-6 carbocycle and heterocycle
  • R 9 is selected from the group consisting of H, CN, NO2, Ci-6 alkyl, -OR, -S(0)2R, -S(0)2N(R)2, C2-6 alkenyl, C3-6 carbocycle and heterocycle;
  • each R is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H; each R' is independently selected from the group consisting of CMS alkyl, C2-18 alkenyl, -R*YR", -YR", and H;
  • each R" is independently selected from the group consisting of C3-14 alkyl and C3-14 alkenyl
  • each R* is independently selected from the group consisting of Ci-12 alkyl and C2-12 alkenyl
  • each Y is independently a C3-6 carbocycle
  • each X is independently selected from the group consisting of F, CI, Br, and I;
  • n is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13;
  • R 4 is -(CH 2 ) n Q, -(CH 2 ) n CHQR, -CHQR, or -CQ(R) 2 , then (i) Q is not -N(R) 2 when n is 1, 2, 3, 4 or 5, or (ii) Q is not 5, 6, or 7-membered heterocycloalkyl when n is 1 or 2.
  • the delivery agent comprising a compound having the formula I)
  • Ri is selected from the group consisting of C5-20 alkyl, C5-20 alkenyl, -R*YR", -YR", and -R"M'R';
  • R2 and R3 are independently selected from the group consisting of H, Ci-14 alkyl, C2-14 alkenyl, -R*YR", -YR", and -R*OR", or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;
  • R 4 is selected from the group consisting of a C3-6 carbocycle, -(CH2) n Q, -(CH2) n CHQR,
  • Ci- ⁇ alkyl where Q is selected from a carbocycle, heterocycle, -OR, -0(CH 2 )nN(R) 2 , -C(0)OR, -OC(0)R, -CX3, -CX 2 H, -CXH 2 , -CN, -N(R) 2 , -C(0)N(R) 2 , -N(R)C(0)R, -N(R)S(0) 2 R, -N(R)C(0)N(R) 2 , -N(R)C(S)N(R) 2 , and -C(R)N(R) 2 C(0)OR, and each n is independently selected from 1, 2, 3, 4, and 5;
  • each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R 6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • M and M' are independently selected from -C(0)0-, -OC(O)-, -C(0)N(R , -N(R')C(0)-, -C(O)-, -C(S)-, -C(S)S-, -SC(S)-, -CH(OH)-, -P(0)(OR')0-, -S(0) 2 -, an aryl group, and a heteroaryl group;
  • R 7 is selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;
  • each R' is independently selected from the group consisting of O-is alkyl, C2-18 alkenyl, -R*YR", -YR", and H;
  • each R" is independently selected from the group consisting of C3-14 alkyl and C3-14 alkenyl
  • each R* is independently selected from the group consisting of Ci-12 alkyl and C2-12 alkenyl
  • each Y is independently a C3-6 carbocycle
  • each X is independently selected from the group consisting of F, CI, Br, and I;
  • n is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13;
  • R 4 is -(CH 2 ) n Q, -(CH 2 ) n CHQR, -CHQR, or -CQ(R) 2 , then (i) Q is not -N(R) 2 when n is 1, 2, 3, 4 or 5, or (ii) Q is not 5, 6, or 7-membered heterocycloalkyl when n is 1 or 2.
  • the compound is of Formula (IA):
  • 1 is selected from 1, 2, 3, 4, and 5;
  • n is selected from 5, 6, 7, 8, and 9;
  • Mi is a bond or M' ;
  • R 4 is unsubstituted C1-3 alkyl, or -(CH2) n Q, in which n is 1, 2, 3, 4, or 5 and Q is
  • M and M' are independently selected from -C(0)0-, -OC(O)-, -C(0)N(R')-, -P(0)(OR')0-, -S-S-, an aryl group, and a heteroaryl group; and R 2 and R 3 are independently selected from the group consisting of H, C 1-14 alkyl, and C2-14 alkenyl.
  • m is 5, 7, or 9.
  • the compound is of Formula (IA), or a salt or stereoisomer thereof, wherein
  • 1 is selected from 1, 2, 3, 4, and 5;
  • n is selected from 5, 6, 7, 8, and 9;
  • Mi is a bond or M' ;
  • R 4 is unsubstituted Ci- 3 alkyl, or -(CH 2 ) n Q, in which n is 1, 2, 3, 4, or 5 and Q is
  • M and M' are independently selected from -C(0)0-, -OC(O)-, -C(0)N(R')-, -P(0)(OR')0-, an aryl group, and a heteroaryl group;
  • R 2 and R 3 are independently selected from the group consisting of H, C 1-14 alkyl, and C2-14 alkenyl.
  • m is 5, 7, or 9.
  • the compound is of Formula (II):
  • 1 is selected from 1, 2, 3, 4, and 5;
  • Mi is a bond or M' ;
  • R 4 is unsubstituted Ci- 3 alkyl, or -(CH 2 ) n Q, in which n is 2, 3, or 4 and Q is
  • M and M' are independently selected from -C(0)0-, -OC(O)-, -C(0)N(R')-, -P(0)(OR')0-, -S-S-, an aryl group, and a heteroaryl group; and R 2 and R 3 are independently selected from the group consisting of H, C 1-14 alkyl, and C2-14 alkenyl.
  • the compound is of Formula (II), or a salt or stereoisomer thereof, wherein
  • 1 is selected from 1, 2, 3, 4, and 5;
  • Mi is a bond or M' ;
  • R 4 is unsubstituted Ci- 3 alkyl, or -(CH 2 ) n Q, in which n is 2, 3, or 4 and Q is
  • M and M' are independently selected from -C(0)0-, -OC(O)-, -C(0)N(R')-, -P(0)(OR')0-, an aryl group, and a heteroaryl group;
  • R 2 and R 3 are independently selected from the group consisting of H, C 1-14 alkyl, and C2-14 alkenyl.
  • Mi is M' .
  • M and M' are independently -C(0)0- or -OC(O)-.
  • 1 is 1, 3, or 5.
  • the compound is selected from the group consisting of
  • the compound is selected from the group consisting of Compound 1 to Compound 147, salts and stereoisomers thereof, and any combination thereof.
  • the delivery agent comprises the compound of the Formula
  • the delivery agent comprises the compound of the Formula (lib), or a salt or stereoisomer thereof.
  • the delivery agent comprises the compound of the Formula
  • R 4 is as described herein. In some embodiments, R 4 is selected from -(CH 2 ) n Q and -(CH 2 ) n CHQR.
  • the delivery agent comprises the compound of the Formula
  • n is selected from 2, 3, and 4, and m, R', R", and R 2 through R 6 are as described herein.
  • each of R 2 and R 3 may be independently selected from the group consisting of C5-14 alkyl and C5-14 alkenyl.
  • the compound is of the Formula (lid), or a salt or stereoisomer thereof, wherein R 2 and R 3 are independently selected from the group consisting of C5-14 alkyl and C5-14 alkenyl, n is selected from 2, 3, and 4, and R' , R", R5, R 6 and m are as defined herein.
  • R 2 is Cs alkyl.
  • R 3 is C5 alkyl, C 6 alkyl, C7 alkyl, Cs alkyl, or C9 alkyl.
  • m is 5, 7, or 9.
  • each R5 is H.
  • each R 6 is H.
  • the delivery agent further comprises a phospholipid, a structural lipid, a PEG lipid, an ionizable lipid, and/or a quaternary amine compound.
  • the disclosure further comprises a composition comprising the first polynucleotide
  • the first polynucleotide, the second polynucleotide, and/or the third polynucleotide are formulated in the delivery agent disclosed herein.
  • the disclosure further comprises a composition comprising the first polynucleotide
  • the first polynucleotide, the second polynucleotide, and the third polynucleotide are formulated in the delivery agent disclosed herein.
  • the present disclosure also discloses a kit comprising the composition disclosed herein and instructions to use according to the method disclosed herein.
  • the compositions of the present disclosure, or the kit of the present disclosure results in (i) increase in granulocyte level in one or more samples obtained from the subject after administration of doublet or triplet relative to a threshold level or relative to the level after administration of a single polynucleotide encoding an IL-23, an IL-36-gamma, or an OX40L polypeptide; (ii) increase in cross-presenting dendritic cell level in one or more samples obtained from the subject after administration of doublet or triplet relative to a threshold level or relative to the level after administration of a single polynucleotide encoding an IL-23, an IL-36- gamma, or an OX40L polypeptide; (iii) increase in effector to suppressor T cell ratio in one or more samples obtained from the subject after administration of doublet or triplet relative to a threshold level
  • the present disclosure also provides a method of reducing or decreasing a size of a tumor or inhibiting a tumor growth in a subject in need thereof comprising administering to the subject a composition comprising (a) two polynucleotides in combination (doublet), wherein the first polynucleotide encodes a first protein comprising an interleukin-23 polypeptide (IL-23), and the second polynucleotide encodes a second protein comprising an interleukin-36-gamma polypeptide (IL-36-gamma); or, (b) three polynucleotides in combination (triplet), where the first polynucleotide encodes a first protein comprising an IL-23 polypeptide, the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide, and the third polynucleotide encodes a third protein comprising an OX40L polypeptide (OX40L), wherein the administration of the administration of
  • the increase in granulocyte level is quantitated as (i) granulocytes as percent of CD45+ cells, or (ii) granulocytes per mg of tumor.
  • the cross-presenting dendritic cells are CD 103+ cells.
  • the increase in cross-presenting dendritic cell level is quantitated as (i) cross-presenting dendritic cells per mg of tumor, (ii) cross-presenting CD 103+ dendritic cells in tumor draining lymph node (TdLN), or (iii) cross-presenting CD103+ dendritic cells as percentage of CD45+ cells.
  • the effector to suppressor T cell ratio is quantitated as CD8:Treg ratio.
  • the effector memory T cells are CD4+ and/or CD8+ cells.
  • PDLl expression level is quantitated as (i) number of positive CD1 lb+ cells, or (ii) PDLl expression in CD1 lb+ cells.
  • the present disclosure also provides a method to increase granulocyte levels in a subject in need thereof comprising administering to the subject a composition comprising (a) two polynucleotides in combination (doublet), wherein first polynucleotide encodes a first protein comprising an IL-23 polypeptide, and the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide; or, (b) three polynucleotides in combination (triplet), where first polynucleotide encodes a first protein comprising an IL-23 polypeptide, the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide, and the third polynucleotide encodes a third protein comprising an OX40L polypeptide, wherein granulocyte levels are measured in one or more samples obtained from the subject.
  • the increase in granulocyte level is measured as (i) granulocytes as percent of CD45+ cells, and/or (ii) granulocytes per mg of tumor, relative to a threshold level or relative to the level after administration of a single polynucleotide encoding IL-23 or a single polynucleotide encoding IL-36-gamma.
  • the present disclosure also provides a method to increase cross-presenting dendritic cell levels in a subject in need thereof comprising administering to the subject a composition comprising (a) two polynucleotides in combination (doublet), wherein first polynucleotide encodes a first protein comprising an IL-23 polypeptide, and the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide; or, (b) three polynucleotides in combination (triplet), where first polynucleotide encodes a first protein comprising an IL-23 polypeptide, the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide, and the third polynucleotide encodes a third protein comprising an OX40L polypeptide, wherein cross- presenting dendritic cell levels are measured in one or more samples obtained from the subject.
  • the cross-presenting dendritic cells are CD 103+ cells.
  • the increase in cross-presenting CD 103+ dendritic cell level is measured as (i) cross-presenting CD 103+ dendritic cells per mg of tumor, (ii) cross-presenting CD 103+ dendritic cells in TdLN, (iii) cross-presenting CD 103+ dendritic cells as percentage of CD45+ cells, or (iv) a combination thereof, relative to a threshold level or relative to the level after administration of a single polynucleotide encoding IL-23, a single polynucleotide encoding IL-36-gamma, or a single polynucleotide encoding OX40L.
  • the present disclosure also provides a method to increase the effector to suppressor T cell ratio in a subject in need thereof comprising administering to the subject a composition comprising (a) two polynucleotides in combination (doublet), wherein first polynucleotide encodes a first protein comprising an IL-23 polypeptide, and the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide; or, (b) three polynucleotides in combination (triplet), where first polynucleotide encodes a first protein comprising an IL-23 polypeptide, the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide, and the third polynucleotide encodes a third protein comprising an OX40L polypeptide, wherein the effector to suppressor T cell ratio is measured in one or more samples obtained from the subject.
  • the effector to suppressor T cell ratio is
  • the present disclosure also provides a method to increase effector memory T cells levels in a subject in need thereof comprising administering to the subject a composition comprising (a) two polynucleotides in combination (doublet), wherein first polynucleotide encodes a first protein comprising an IL-23 polypeptide, and the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide; or, (b) three polynucleotides in combination (triplet), where first polynucleotide encodes a first protein comprising an IL-23 polypeptide, the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide, and the third polynucleotide encodes a third protein comprising an OX40L polypeptide, wherein the effector memory T cells levels are measured in one or more samples obtained from the subject.
  • the effector memory T cells are CD4+ and/or CD8+ cells.
  • the increase in effector memory T cells levels is measured as effector memory T cells within the tumor relative to a threshold level or relative to the level after administration of a single polynucleotide encoding OX40L.
  • the present disclosure also provides a method to increase PDL1 positive cells levels in a subject in need thereof comprising administering to the subject a composition comprising (a) two polynucleotides in combination (doublet), wherein first polynucleotide encodes a first protein comprising an IL-23 polypeptide, and the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide; or, (b) three polynucleotides in combination (triplet), where first polynucleotide encodes a first protein comprising an IL-23 polypeptide, the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide, and the third polynucleotide encodes a third protein comprising an OX40L polypeptide, wherein the PDL1 positive cells levels are measured in one or more samples obtained from the subject.
  • the PDL1 positive cells are CD1 lb+ cells.
  • the sample obtained from the subject is selected, for example, from tumoral tissue, tumor infiltrate, blood, plasma, or a combination thereof.
  • any of the cells measured in the methods disclosed herein e.g., granulocytes, cross-presenting dendritic cells, effector T cells, suppressor T cells, PDL1 positive cells, etc.
  • parameters corresponding to those measurements e.g., absolute or relative levels of cells, ratios to other cells, level of specific subtypes, activation levels, presence/absence of markers, etc.
  • any of the cells measured in the methods disclosed herein e.g., granulocytes, cross-presenting dendritic cells, effector T cells, suppressor T cells, PDL1 positive cells, etc.
  • parameters corresponding to those measurements e.g., absolute or relative levels of cells, ratios to other cells, level of specific subtypes, activation levels, presence/absence of markers, etc.
  • the one or more control samples is a sample or samples obtained from a healthy subject or a subject with a tumor.
  • the threshold level is a predetermined value or a value obtained from one or more samples.
  • the present disclosure also provides a method of determining whether to treat a subject having a tumor disease with a composition
  • a composition comprising (a) two polynucleotides in combination (doublet), wherein first polynucleotide encodes a first protein comprising an IL-23 polypeptide, and the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide; or, (b) three polynucleotides in combination (triplet), where first polynucleotide encodes a first protein comprising an IL-23 polypeptide, the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide, and the third polynucleotide encodes a third protein comprising an OX40L polypeptide; the method comprising (1) administering to the submitted an initial dose of doublet or triplet, and (2) treating the subject if after administration of the initial dose of doublet or triplet the subject is determined to
  • the present disclosure also provides a method of selecting a subject diagnosed with a tumor as a candidate for treatment with a composition
  • a composition comprising (a) two polynucleotides in combination (doublet), wherein first polynucleotide encodes a first protein comprising an IL-23 polypeptide, and the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide; or, (b) three polynucleotides in combination (triplet), where first polynucleotide encodes a first protein comprising an IL-23 polypeptide, the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide, and the third polynucleotide encodes a third protein comprising an OX40L polypeptide; the method comprising (1) administering to the subject an initial dose of doublet or triplet, and (2) selecting the subject for treatment if after administration of the initial dose of doublet or triplet the
  • the present disclosure also provides a method of measuring the efficacy of a composition to treat a tumor in a subject in need thereof, wherein the composition comprises (a) two polynucleotides in combination (doublet), wherein first polynucleotide encodes a first protein comprising an IL-23 polypeptide, and the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide; or, (b) three polynucleotides in combination (triplet), where first polynucleotide encodes a first protein comprising an IL-23 polypeptide, the second polynucleotide encodes a second protein comprising an IL-36-gamma polypeptide, and the third polynucleotide encodes a third protein comprising an OX40L polypeptide; wherein the method comprises measuring in at least one sample taken from the subject (a) level of granulocytes, (b) level of cross-presenting dendritic cells
  • FIGS. 1A and IB show IL-23 mRNA monotherapy efficacy in the A20 lymphoma animal model.
  • FIG. 1A shows treatment with NST-FIX control (2.5 ⁇ g mRNA). Complete response was observed in 1 of 12 subjects (8.3%).
  • FIG. IB shows treatment with mIL-23 miRless (2.5 ⁇ g mRNA). Complete response was observed in 5 of 12 subjects (41.6%).
  • Dosing conditions 2.5 ⁇ g mRNA, intratumoral (iTu) administration, Compound 18-based lipid nanoparticles (SM68 LNP).
  • NST-FIX is negative control mRNA.
  • FIGS. 2A and 2B show IL-23 mRNA monotherapy efficacy in the MC38-C colon cancer animal model.
  • FIG. 2A shows treatment with NST-OX40L (2.5 ⁇ g mRNA).
  • FIG. 2B shows treatment with mIL-23 mRNA lacking miR binding sites in the 3' UTR, "miRless" (2.5 ⁇ g mRNA). Complete response was observed in 4 of 10 subjects (40%). Partial response was observed in 2 of 10 subjects (20%).
  • Dosing conditions 2.5 ⁇ g mRNA, iTu, Compound 18-based LNP.
  • NST-OX40L is negative control mRNA.
  • FIGS. 3A-3F show that addition of mRNA encoding either IL-36-gamma or IL-18 to
  • FIG. 3A shows treatment with mRNA encoding IL-23 and NST-FIX (2.5 ⁇ g each mRNA). Complete response was observed in 3 of 10 subjects (30%). Partial response was observed in 6 of 10 subjects (60%).
  • FIG. 3B shows treatment with mRNA encoding IL-23 in combination with mRNA encoding IL-36- gamma (2.5 ⁇ g each mRNA). Complete response was observed in 9 of 10 subjects (90%). Partial response was observed in 1 of 10 subjects (10%).
  • FIG. 3C shows treatment with mRNA encoding IL-23 in combination with mRNA encoding IL- 18 (2.5 ⁇ g each mRNA).
  • FIG. 3D shows treatment with NST-FIX control (5 ⁇ g mRNA). Dosing conditions: 2.5 ⁇ g mRNA each mRNA (5 ⁇ g for control), iTu, Compound 18-based LNP. NST-FIX is negative control mRNA.
  • FIG. 3E, FIG. 3F, and FIG. 3G show data corresponding to the same experiments presented in FIG. 3A, FIG. 3B, and FIG. 3D, respectively, but extending the time frame of the experiments to day 90.
  • FIGS. 4A-4C show efficacy of IL-23 and IL-36-gamma or IL-18 combination mRNA therapy in the A20 lymphoma model.
  • FIG. 4A shows treatment with mRNA encoding IL-23 miRless and NST-FIX (2.5 ⁇ g each mRNA). Complete response was observed in 8 of 12 subjects (66.6%). Partial response was observed in 1 of 12 subjects (8.3%).
  • FIG. 4B shows treatment with mRNA encoding IL-23 miRless in combination with mRNA encoding IL-36-miR-122 (2.5 ⁇ g each mRNA). Complete response was observed in 10 of 12 subjects (83.3%).
  • FIG. 4A shows treatment with mRNA encoding IL-23 miRless and NST-FIX (2.5 ⁇ g each mRNA). Complete response was observed in 8 of 12 subjects (66.6%). Partial response was observed in 1 of 12 subjects (8.3%).
  • FIG. 4B shows treatment with mRNA
  • FIG. 4C shows treatment with IL-23 -encoding "miRless” mRNA and IL-18 -encoding "miRless” mRNA (2.5 ⁇ g each mRNA). Complete response was observed in 6 of 12 subjects (50%).
  • FIG. 4D shows treatment with NST- FIX control (5 ⁇ g mRNA). Dosing conditions: 2.5 ⁇ g mRNA each RNA (5 ⁇ g for control), iTu, Compound 18-based LNP. NST-FIX is negative control mRNA.
  • FIGS. 5A-5C show early indication of superior efficacy of mRNA encoding IL-36- gamma plus mRNA encoding IL-23 over mRNA encoding IL-23 alone with fixed 5 ⁇ g dose of mRNA in the A20 lymphoma model.
  • FIG. 5A shows treatment with mRNA encoding IL-23 (5 ⁇ g mRNA). Complete response was observed in 1 of 10 subjects (10%). Partial response was observed in 4 of 10 subjects (40%).
  • FIG. 5B shows treatment with mRNA encoding IL-36-gamma (5 ⁇ g mRNA). Complete response was observed in 2 of 10 subjects (20%). Partial response was observed in 1 of 10 subjects (10/%).
  • FIG. 5A shows treatment with mRNA encoding IL-36-gamma (5 ⁇ g mRNA). Complete response was observed in 2 of 10 subjects (20%). Partial response was observed in 1 of 10 subjects (10/%).
  • FIG. 5A shows treatment with mRNA
  • FIG. 5C shows treatment with mRNA encoding IL-23 and mRNA encoding IL-36-gamma (2.5 ⁇ g each mRNA).
  • FIG. 5D shows treatment with NST-FIX mRNA control (5 ⁇ g mRNA). Dosing conditions: 2.5 ⁇ g mRNA each mRNA (5 ⁇ g for control), iTu, Compound 18-based LNP. NST-FIX is negative control mRNA. IL-23/IL-36-gamma combination is superior to mono constituents at fixed 5 ⁇ g mRNA dose.
  • FIGS. 6A-6C show a MC38 colon cancer model comparison of immune infiltrate.
  • FIG. 6A shows a quantification of the infiltration of CD4+, CD8+ and CDl lb+ cells in the MC38 model system in cells per mg of tissue. Results are shown for MC38-M (poorly immunogenic) and MC38-C (strongly immunogenic).
  • FIG. 6B shows a tissue micrograph of a poorly immunogenic MC38-M sample) and
  • FIG. 6C shows a tissue micrograph of a strongly immunogenic MC38-C sample.
  • FIGS. 7A-7D analyzes the efficacy of IL-23 mRNA monotherapy and IL-23/IL-36- gamma or I1-23/IL-18 combination mRNA therapy in the MC38-M colon cancer model.
  • FIG. 7A-7D analyzes the efficacy of IL-23 mRNA monotherapy and IL-23/IL-36- gamma or I1-23/IL-18 combination mRNA therapy in the MC38-M colon cancer model.
  • FIG. 7 A shows treatment with NST-OX40L (2.5 ⁇ g mRNA) in Compound 18-based LNPs. No response was observed.
  • FIG. 7B shows treatment with IL-23 mRNA "miRless" (2.5 ⁇ g mRNA) in Compound 18- based LNPs. Only one partial response was observed (1 of 10, 10%).
  • MC38-M is a relatively insensitive model in which OX40L, anti-PD-1 antibody, and IL-23 monotherapies are ineffective.
  • FIG. 7C shows treatment with mRNAs encoding IL-23 and IL-36-gamma (2.5 ⁇ g each mRNA). Complete responses were observed in 2 of 10 subjects (20%). Partial responses were observed in 5 of 10 subjects (50%).
  • FIG. 7E shows that treatment with mRNAs encoding IL-23 and IL-18 (2.5 ⁇ g each mRNA). Only one partial response was observed (1 of 10, 10%).
  • FIG. 7D shows treatment with NST-FIX control (5 ⁇ g mRNA).
  • FIG. 8 analyzes the efficacy of OX40L mRNA monotherapy in the A20 tumor model.
  • mRNA encoding OX40L 2.5 ⁇ g mRNA
  • Compound 18-based LNPs Two complete responses were observed.
  • FIGS. 9A-9C show OX40L mRNA "miRless” or anti-PD-1 monotherapy efficacy in
  • FIG. 9A shows treatment with OX40L mRNA "miRless” (2.5 ⁇ g mRNA) in Compound 18-based LNPs.
  • FIG. 9B shows treatment with anti-PD-1 antibody (5 mg/kg 2x/week IP dosing).
  • FIG. 9C shows a microphotography of MC38-M colon cancer model tissue.
  • FIGS. 10A-10H show the effect of monotherapy, binary combination therapy; and triple combination therapy (including single and multi-dose administration at varying dosage levels) using mRNAs encoding IL-23, IL-36-gamma, and OX40L, wherein each mRNA comprises an miR122 binding site.
  • FIG. 10A shows monotherapy treatment with IL-23_miR-122. No complete responses were observed, but eight escapers.
  • FIG. 10B shows combination treatment with IL- 23_miR-122 and IL-36-gamma_miR-122. Three complete responses were observed (25%). Six escapers were observed.
  • FIG. 10A shows monotherapy treatment with IL-23_miR-122. No complete responses were observed, but eight escapers.
  • FIG. 10B shows combination treatment with IL- 23_miR-122 and IL-36-gamma_miR-122. Three complete responses were observed (25%). Six escapers were observed.
  • FIG. 10A
  • IOC shows treatment with IL-23_miR-122, IL-36-gamma_miR-122 and OX40L_miR-122 triple combination therapy. Three complete responses were observed (25%). Four escapers were observed. For each sample: 5 ⁇ g total mRNA/dose was administered intratumorally (iTu). When non-translated control mRNA and IL-36gamma_miR-122 alone were administered, all mice progressed by day 26 (data not shown).
  • FIG. 10D, FIG. 10E, and FIG. 10F show data corresponding to the same experiments presented in FIG. 10A, FIG. 10B, and FIG. IOC, respectively, but extending the time frame of the experiments to day 70.
  • FIG. 10D, FIG. 10E, and FIG. 10F show data corresponding to the same experiments presented in FIG. 10A, FIG. 10B, and FIG. IOC, respectively, but extending the time frame of the experiments to day 70.
  • 10G shows treatment with IL-23_miR-122 and IL-36-gamma_miR-122 doublet therapy at a single dose (8 ⁇ g) and IL- 23_miR- 122, IL-36-gamma_miR- 122, and OX40L_miR-122 triplet therapy at a single dose or multiple doses (12 ⁇ g) in MC38 luciferase cells relative to a mock control.
  • 10H shows survival through day 47 following treatment with a single 8 ⁇ g dose of IL-23_miR- 122 and IL-36- gamma_miR-122 doublet therapy, a single 12 ⁇ g dose of IL-23_miR- 122, IL-36-gamma_miR-122, and OX40L_miR- 122 triplet therapy, or multiple 12 ⁇ g doses of IL-23_miR- 122, IL-36- gamma_miR-122, and OX40L_miR-122 triplet therapy.
  • Treatment-related deaths were observed with multiple 12 ⁇ g doses of IL-23_miR-122, IL-36-gamma_miR- 122, and OX40L_miR-122 triplet therapy.
  • FIG. 11 shows the bioactivity (e.g., induction of murine Interleukin 17 (mIL- 17) expression from primary mouse splenocytes) of IL-23 protein produced from an mRNA compared to recombinant IL-23 protein.
  • the solid upper line shows mIL- 17 (pg/ml) secreted from primary mouse splenocytes after adding murine IL-23 (mIL-23) obtained from HeLa cells transfected with an mRNA encoding mIL-23 ; the solid lower line shows mIL-17 (pg/ml) expression after adding human IL-23 (hIL-23) obtained from HeLa cells transfected with an mRNA encoding hIL-23.
  • mIL- 17 murine Interleukin 17
  • the dotted black line shows mIL- 17 secreted from mouse primary splenocytes after adding recombinant hIL-23; and the dotted gray line shows mIL-17 expression from splenocytes after adding recombinant mlL- 23.
  • the IL-23 protein levels used in the experiment were 0.1 ng/ml, 1 ng/ml, 3.3 ng/ml, 10 ng/ml and 100 ng/ml.
  • FIG. 12A shows murine Interleukin 6 (mIL6) (ng/ml) production in bone marrow derived dendritic cells as induced by murine IL-36gamma (mIL-36y) protein.
  • the first panel (NT) is a negative control.
  • the second panel shows mIL6 expression after adding recombinant mIL-36y.
  • the third panel shows mIL6 expression after adding mIL- 36 ⁇ obtained from HeLa cells transfected with mRNA encoding mIL-36y.
  • the fourth panel (mock) shows a mock control.
  • FIGS. 13A-13E show the costimulatory biological activity of OX40L expressed on the surface of cells treated with OX40L mRNA.
  • FIG. 13A shows a schematic drawing of the T-cell activation assay. OX40L-expressing B 16F10 cells or HeLa cells were co-cultured with CD4 + T-cells and anti-mouse CD3 antibody (B 16F10 cells) or Dynabeads human T-activator (HeLa cells).
  • FIG. 13B shows results of the T-cell activation assay as measured by mouse IL-2.
  • FIG. 13C shows results of the T-cell activation assay as measured by human IL-2. The y-axis shows mIL-2 expression in ng/ml.
  • FIG. 13D shows the data from FIG. 13C with schematic diagram showing the addition of OX40L expressing cells to the naive T-cell activation assay.
  • FIG. 13E shows a T-cell activation assay using pre- stimulated T-cells cultured in the presence or absence of OX40L expressing HeLa cells and in the presence or absence of anti-human CD3 antibody.
  • FIGS. 14A-14D show the different types of immune cells that infiltrate the tumor microenvironment in A20 tumors following administration of a polynucleotide comprising an mRNA encoding an OX40L polypeptide.
  • FIG. 14A shows the percentage of NK cells in the tumor infiltrate 24 hours after treatment, as detected by the DX5 marker.
  • FIG. 14B shows the percentage of CD4 + T-cells in the tumor infiltrate 14 days after treatment, as detected by the CD4 marker.
  • FIG. 14C shows the percentage of CD8 + T-cells in the tumor infiltrate 14 days after treatment, as detected by the CD8 marker.
  • FIG. 14A shows the percentage of NK cells in the tumor infiltrate 24 hours after treatment, as detected by the DX5 marker.
  • FIG. 14B shows the percentage of CD4 + T-cells in the tumor infiltrate 14 days after treatment, as detected by the CD4 marker.
  • FIG. 14C shows the percentage of CD8 + T-cell
  • 14D shows the percentage of CD8 + T-cells in the tumor infiltrate of MC38 tumors 24 and 72 hours after a first and second dose of a polynucleotide comprising an mRNA encoding an OX40L polypeptide.
  • FIGS. 15A and 15B show in vivo anti-tumor efficacy of mOX40L_miR-122 delivered intratumorally.
  • FIG. 15A shows tumor growth in animals treated intratumorally with control mRNA ("NST-OX40L”) (arrows mark injection days).
  • FIG. 15B shows tumor growth in animals treated intratumorally with mOX40L_miR-122 mRNA ("OX40L-miR-122”) (arrows mark injection days).
  • FIGS. 16A-16F show in vivo anti-tumor efficacy of combination therapy comprising a polynucleotide comprising an mRNA encoding an OX40L polypeptide and a miR-122 binding site and an anti-PD-1 antibody.
  • FIG. 16A shows tumor growth in animals treated with intratumoral injections of control mRNA ("NST_mOX40L_122”) and control antibody ("Rat IgG2a").
  • FIG. 16B shows tumor growth in animals treated with intratumoral injections of mOX40L_miR-122 (“mOX40L_122”) and control antibody (“Rat IgG2a”).
  • FIG. 16C shows tumor growth in animals treated with intratumoral injections of control mRNA ("NST_mOX40L_122”) and anti-PD-1 antibody ("anti-PD-1”).
  • FIG. 16D shows tumor growth in animals treated with intratumoral injections of mOX40L_miR-122 (“mOX40L_122”) and anti-PD-1 antibody ("anti-PD-1 ").
  • FIG. 16E shows tumor growth in animals treated with intratumoral injections of anti-PD-1 antibody and PBS.
  • FIG. 16F shows tumor growth in animals treated with PBS and control antibody ("Rat IgG2a").
  • CR complete responder.
  • FIG. 17 shows survival curves for animals treated intratumorally with combination therapy comprising control mRNA and control antibody ("NST_mOX40L_122 + Rat IgG2a”), mOX40L_miR-122 and control antibody ("mOX40L_122 + Rat IgG2a"), control mRNA and anti- PD-1 antibody ("NST_mOX40L_122 + anti-PD-1"), mOX40L_miR-122 and anti-PD-1 antibody (“mOX40L_122 + anti-PD-1”), anti-PD-1 antibody and PBS (“PBS + anti-PD-1”), and PBS and control antibody (“PBS + Rat IgG2a”).
  • FIG. 18A and 18B show a memory immune response in animals treated with combination therapy comprising a polynucleotide comprising an mRNA encoding an OX40L polypeptide and a miR-122 binding site and an anti-PD-1 antibody.
  • Animals were initially treated with intratumoral injections of mOX40L_miR-122 and anti-PD-1 antibody as shown in FIG. 16D.
  • Four animals identified as complete responders (CR) were re-challenged with MC38 tumor cells.
  • FIG. 18A shows tumor growth in naive animals challenged with MC38 tumor cells.
  • FIG. 18B shows tumor growth in the four CR animals re-challenged with MC38 tumor cells.
  • FIG. 19A-19G show in vivo tumor efficacy in both primary treated and untreated distal tumors with double mRNA therapy (combination of mRNAs encoding IL-23 and IL-36) and triplet mRNA therapy (combination of mRNAs encoding IL-23, IL-36, and OX40L).
  • FIG. 19A shows a schematic description of the MC38-S dual flank model used in the experiments. A tumor implanted in one flank is treated, and the effect is measured in both the primary treated tumor and the untreated tumor in the other flank.
  • FIG. 19B shows the effect of the negative control mRNA (non-translating mRNA encoding for OX40L) on the primary treated tumor.
  • FIG. 19C shows the effect of the negative control mRNA on the untreated tumor.
  • FIG. 19D shows the effect of the double mRNA therapy (mRNA encoding IL-23 and mRNA encoding IL-36-gamma) on the primary treated tumor.
  • FIG. 19E shows the effect of the double mRNA therapy (mRNA encoding IL-23 and mRNA encoding IL-36-gamma) on the distal untreated tumor.
  • FIG. 19F shows the effect of the triplet mRNA therapy (mRNA encoding IL-23, mRNA encoding IL-36-gamma, and mRNA encoding OX40L) on the primary treated tumor.
  • FIG. 19D shows the effect of the double mRNA therapy (mRNA encoding IL-23 and mRNA encoding IL-36-gamma) on the primary treated tumor.
  • FIG. 19E shows the effect of the double mRNA therapy (mRNA encoding IL-23 and
  • 19G shows the effect of the triplet mRNA therapy (mRNA encoding IL-23, mRNA encoding IL-36-gamma, and mRNA encoding OX40L) on the distal untreated tumor.
  • the total dose of mRNA injected in the tumor was 5 micrograms.
  • mRNAs were administered intratumorally in a single dose.
  • FIG. 20A-20D show that triplet mRNA therapy combined with an anti-PD-Ll antibody has improved efficacy in a difficult to treat B 16F10-AP3 tumor model.
  • FIG. 20A shows tumor growth in animals treated with negative control.
  • FIG. 20B shows tumor growth in animals treated with an anti-PD-Ll antibody.
  • FIG. 20C shows tumor growth in animals treated with triplet mRNA therapy (mRNA encoding IL-23, mRNA encoding IL-36-gamma, and mRNA encoding OX40L).
  • FIG. 20D shows tumor growth in animals treated with triplet mRNA therapy (mRNA encoding IL-23, mRNA encoding IL-36-gamma, and mRNA encoding OX40L) plus the anti-PD-Ll antibody.
  • FIG. 21A and FIG. 21B show a memory immune response in animals treated with doublet mRNA therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma).
  • Animals were initially treated with 5 ug total mRNA (2.5 ug of mRNA encoding IL-23 and 2.5 ug of mRNA encoding IL-36-gamma) administered intratumorally Q7D.
  • Ten animals identified as complete responders (CR) were re-challenged with MC38-S tumor cells.
  • FIG. 21A shows tumor growth in naive animals challenged with MC38-S tumor cells.
  • FIG. 21B shows tumor growth in the ten CR animals re-challenged with MC38-S tumor cells.
  • FIG. 22A and FIG. 22B show an increase in Ly6G+ granulocytes in response to treatment of MC38 tumors with doublet mRNA therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma).
  • FIG. 22A shows the level of granulocytes as percentage of CD45+ cells 24 hours, 72 hours, 7 days, and 14 days after treatment.
  • FIG. 22B shows the level of granulocytes as granulocytes per mg of tumor 24 hours, 72 hours, 7 days, and 14 days after treatment.
  • the measurements presented correspond to treatment with controls (“NoRx” and “NST”), IL-23 and IL- 36-gamma monotherapies (“IL23” and “IL36”), and doublet mRNA combination therapy ("Combo,” corresponding to mice receiving a single dose of the combination therapy, and "Combo 2 dose” corresponding to mice receiving two doses of the combination therapy).
  • the vertical bars represent mean with S.D.
  • the horizontal bars above the data represent statistical significance.
  • FIG. 23 shows an increase in Ly6G+ granulocytes as percentage of CD45+ cells 24 hours, 72 hours and 7 days after treatment of MC38 tumors with triplet mRNA combination therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma plus mRNA encoding OX40L).
  • the vertical bars represent mean with S.D.
  • the horizontal bars above the data represent statistical significance.
  • FIG. 24A and FIG. 24B show an increase in CD 103+ dendritic cells (DC) in response to treatment of MC38 tumors with doublet mRNA therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma).
  • FIG. 24A shows the level of CD103+ dendritic cells as percentage of CD45+ cells 7 days after treatment.
  • FIG. 24B shows the level of CD 103+ dendritic cells as CD 103+ dendritic cells per mg of tumor 7 days after treatment.
  • the measurements presented correspond to treatment with controls (“NoRx” and “NST”), IL-23 and IL-36-gamma monotherapies (“IL23” and “IL36”), and doublet mRNA combination therapy (“Combo”).
  • the vertical bars represent mean with S.D.
  • the horizontal bars above the data represent statistical significance.
  • FIG. 25A and FIG. 25B show an increase in CD 103+ dendritic cells (DC) in response to treatment of MC38 tumors with doublet mRNA therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma) or triplet mRNA therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma plus mRNA encoding OX40L).
  • FIG. 25A shows the level of CD103+ dendritic cells as CD8+ cell per mg of tumor 7 days after treatment.
  • FIG. 25B shows the level of CD8+ dendritic cells in the tumor draining lymph node (TdLN) 7 days after treatment.
  • TdLN tumor draining lymph node
  • the measurements presented correspond to treatment with controls ("Naive” and “NST”), OX40L monotherapy (“OX40L”), and doublet and triplet mRNA combination therapies ("Doublet” and “Triplet,” respectively).
  • the vertical bars represent mean with S.D.
  • the horizontal bars above the data represent statistical significance.
  • FIGS. 26A-26D show increase in CDl lb+ dendritic cells in MC38 tumors and draining lymph node in response to treatment with triplet mRNA therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma plus mRNA encoding OX40L).
  • FIG. 26A shows the level of CD11+ cDC2 cells as cells per mg of tumor 7 days after treatment.
  • FIG. 26B shows the level of CD 11+ cDC2 dendritic cells in the tumor draining lymph node (TdLN) 7 days after treatment.
  • TdLN tumor draining lymph node
  • FIG. 26C shows CD86 activation on CDl lb+ cDC2 in the draining lymph node 24h and 72h post intratumoral administration of triplet mRNA therapy measured as percentage of CD24 cDC2 cells.
  • FIG. 26D shows CD86 activation on CDl lb+ cDC2 in the draining lymph node 24h and 72h post intratumoral administration of triplet mRNA therapy measured as mean fluorescence intensity (MFI).
  • MFI mean fluorescence intensity
  • FIGS. 27A and FIG. 27B show CD86 activation on CD8 cDCl in the draining lymph node 24h and 72h post intratumoral administration of triplet mRNA therapy to MC38 tumors measured as percentage of CD8 cDCl cells (FIG. 27A) or as mean fluorescence intensity (MFI) (FIG. 27B).
  • the vertical bars represent mean with S.D.
  • the horizontal bars above the data represent statistical significance.
  • FIGS. 28A-28D show an increase in inflammatory dendritic cells (iDCs) in MC38 tumors and draining lymph nodes in response to treatment with triplet mRNA therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma plus mRNA encoding OX40L).
  • FIG. 28A shows the level of iDCs in tumor as cells per mg of tumor 7 days after treatment.
  • FIG. 28B shows the level of iDCs in the tumor draining lymph node (TdLN) 7 days after treatment.
  • FIG. 28C shows CD86 activation on iDCs in the draining lymph node 24h and 72h post intratumoral administration of triplet mRNA therapy measured as percentage of iDCs.
  • 28D shows CD86 activation on iDCs in the draining lymph node 24h and 72h post intratumoral administration of triplet mRNA therapy measured as mean fluorescence intensity (MFI).
  • MFI mean fluorescence intensity
  • FIG. 29 shows an increase in the ratio of effector CD8 (Killer) T cells to regulatory T cells (Treg) in response to treatment of MC38 tumors with doublet mRNA therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma) and triplet mRNA therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma plus mRNA encoding OX40L). Measurements were taken 72 hours and 7 days after treatment. The measurements presented correspond to treatment with controls (“NST”), OX40L monotherapy (“OX40L”), and doublet and triplet mRNA combination therapies ("Doublet" and "Triplet,” respectively). The vertical bars represent mean with S.D.
  • FIG. 30A and FIG. 30B show an increase in central and effector CD4 and CD8 cells in response to treatment of MC38 tumors with doublet mRNA therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma) or triplet mRNA therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma plus mRNA encoding OX40L).
  • FIG. 30A shows the level of CD4 cells as CD4 cells per mg of tumor 7 days and 10 days after treatment.
  • FIG. 30B shows the level of CD8 cells as CD8 cells per mg of tumor 7 days and 10 days after treatment.
  • the measurements presented correspond to treatment with controls (“NST”), OX40L monotherapy (“OX40L”), and doublet and triplet mRNA combination therapies ("Doublet” and “Triplet,” respectively).
  • the bars show levels of naive, central memory, and effector memory CD4 and CD8 cells.
  • FIG. 31 presents survival curves showing the effect of CD cell depletion on the efficacy of treatment of MC38 tumors with triplet mRNA therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma plus mRNA encoding OX40L).
  • CD4 and CD8 cell levels were depleted by administering anti-CD4 and anti-CD8 antibodies to mice with MC38 tumors.
  • the arrow indicates the administration of the triplet therapy.
  • CD cell depleting doses of antibodies (indicated by circles) were administered prior and after the administration of the triplet therapy.
  • FIGS. 32A and 32B show the expression of PD-L1 in cancer cells of mice with
  • FIG. 32A shows the percentage of cancer cells (CD45-, FSchi, MHCII-) positive for PD-L1 7 days after treatment with triplet mRNA therapy.
  • FIG. 32B shows the level of PD-L1 expression in cancer cells (CD45-, FSchi, MHCII-) measured as MFI (mean fluorescence intensity). The vertical bars represent mean with S.D. The horizontal bars above the data represent statistical significance.
  • FIG. 33A and FIG. 33B show the expression of PD-L1 in mice with MC38 tumors in response to the administration of IL-23 or IL-36-gamma monotherapies or doublet mRNA therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma).
  • FIG. 33A shows the percentage of CDl lb+ cells positive for PD-L1.
  • FIG. 33B shows the strength of PD-L1 expression in CDl lb+ cells, measured as MFI (mean fluorescence intensity).
  • FIG. 34B show the expression of PD-Ll in mice with MC38 tumors in response to the administration of OX40L monotherapy or doublet (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma) or triplet (mRNA encoding IL-23 plus mRNA encoding IL-36- gamma plus mRNA encoding OX40L) mRNA therapies.
  • FIG. 34A shows the percentage of CDl lb+ cells positive for PD-Ll.
  • FIG. 34B shows the strength of PD-Ll expression in CDl lb+ cells, measured as MFI (mean fluorescence intensity).
  • the measurements presented correspond to treatment with controls (“NoRx”), OX40L monotherapy (“OX40L”), and doublet and triplet mRNA combination therapies ("doublet” and “triplet,” respectively).
  • the vertical bars represent mean with S.D.
  • the horizontal bars above the data represent statistical significance. All the measurements were done 7 days after tumor cells implant were implanted
  • FIGS. 35A-35D show in vivo anti-tumor efficacy of triplet mRNA therapy combined with an anti PD-Ll antibody (10F.9G2) in immunosuppressive MC38 tumors.
  • FIG. 35A shows tumor growth in animals treated with intratumoral injections of control antibody.
  • FIG. 35B shows tumor growth in animals treated with intratumoral injections of anti PD-Ll antibody (10F.9G2) alone.
  • FIG. 35C shows tumor growth in animals treated with intratumoral injections of triplet mRNA therapy.
  • FIG. 35D shows tumor growth in animals treated with intratumoral injections of triple mRNA therapy plus anti PD-Ll antibody (10F.9G2).
  • Vertical dashed lines indicate day of administration of the control antibody, the anti PD-Ll antibody, the triplet mRNA therapy, or the triplet mRNA therapy plus anti PD-Ll antibody.
  • FIG. 36A and FIG. 36B show the in vivo anti-tumor efficacy of triplet mRNA combination therapy (mRNA encoding IL-23 plus mRNA encoding IL-36-gamma plus mRNA encoding OX40L) in the syngenic H22 (hepatocellular carcinoma (HCC)) model.
  • FIG. 36A shows tumor growth in animals treated with intratumoral injections of control mRNA ("NST-FIX").
  • FIG. 36B shows tumor growth in animals treated with intratumoral injections of triplet mRNA combination therapy.
  • FIG. 37 shows mean tumor volume (mm 3 ) for each group of mice treated according to the design outlined in Table 11.
  • the dashed arrows show the lack of efficacy of OX40L administered in Group 8, and the synergistic effect of the combination of OX40L with IL-23 in Group 5.
  • FIG. 38A shows mean tumor volume (mm 3 ) for groups of mice treated with triplet combinations comprising mouse OX40L, mouse IL-23, and mouse IL-36-gamma. Different amounts of mRNA encoding mouse IL-36-gamma were used in each triplet. The total amount of mRNA in each triplet dose was kept constant by adding the appropriate amount of NST control mRNA.
  • FIG. 38B shows mean tumor volume (mm 3 ) for groups of mice treated with triplet combinations comprising mouse OX40L, mouse IL-23, and human IL-36-gamma. Different amounts of mRNA encoding human IL-36-gamma were used in each triplet. The total amount of mRNA in each triplet dose was kept constant by adding the appropriate amount of NST control mRNA.
  • FIG. 39A-390 show tumor volume (mm 3 ) for each group of mice treated according to the study design outlined in Table 11. The dates when mRNAs were administered are indicated by vertical dashed lines. Each drawing indicates the number of animals per group (n), the number of complete responders (CR), and the number of animals with tumors below 100 mm 3 in volume at the end of the study. Each drawing also indicates the composition administered to each animal and the ratio between each mRNA in the composition.
  • FIG. 40 shows changes in body weight (%) for each group of mice treated according to the study design outlined in Table 11.
  • the drawing shows the mean body weight values for each group.
  • FIG. 41A-410 show changes in body weight (%) for each group of mice treated according to the study design outlined in Table 11. The drawing shows the individual changes in body weight values for each animal in each group.
  • FIG. 42 presents survival curves showing the effect of the treatment of MC38 tumors according to the design outlined in Table 11.
  • the dashed arrows show (i) the lack of efficacy of OX40L administered in Group 8, (ii) the moderate efficacy of IL-23 in Group 9, (iii) the synergistic effect of the combination of OX40L with IL-23 in Group 5, and (iv) the highest efficacy observed, which corresponded to Group 1 (mOX40L/mIL-23/mIL-36-gamma 1: 1: 1).
  • FIG. 43A shows mean tumor volume (mm 3 ) for mice bearing MC38-S tumors and treated with triplet combinations comprising IL-23, IL-36-gamma and OX40L.
  • FIG. 43B shows mean tumor volume (mm 3 ) for mice bearing MC38-S tumors and treated with doublet combinations comprising IL-23 and OX40L.
  • FIG. 44 is a diagram illustrating the abscopal effect for cancer treatment.
  • a particularly exciting approach to treating cancer involves the prevention or treatment of disease with substances that stimulate the immune response, known as immunotherapy.
  • Immunotherapy also referred to in the art as immuno-oncology, has begun to revolutionize cancer treatment, by introducing therapies that target not the tumor, but the host immune system. These therapies possess unique pharmacological response profiles, and thus represent therapies that might cure many distinct types of cancer. Cancers of the lungs, kidney, bladder and skin are among those that derive substantial efficacy from treatment with immuno-oncology in terms of survival or tumor response, with melanoma possibly showing the greatest benefits.
  • Immunotherapy often features checkpoint inhibitor treatment with an exciting new class of biologic drugs known as checkpoint inhibitor antibodies.
  • the present disclosure features methods and compositions for treating cancer, in particular, immunotherapeutic methods and compositions.
  • the disclosure features methods and compositions for treating cancer using a combination therapy that features two or more polynucleotides (e.g., mRNAs) encoding a first immune response primer polypeptide and a second, different, immune response primer polypeptide, and, optionally, a polynucleotide encoding an immune response co- stimulatory signal polypeptide and, optionally, a polynucleotide encoding a checkpoint inhibitor polypeptide or a polypeptide comprising a checkpoint inhibitor polypeptide.
  • polynucleotides e.g., mRNAs
  • the disclosure provides an immunomodulatory composition comprising a polynucleotide encoding an Interleukin-23 (IL-23) polypeptide, a polynucleotide encoding an Interleukin-36 gamma (IL-36 gamma) polypeptide and, optionally, a polynucleotide encoding an OX40L polypeptide.
  • the disclosure provides an immunomodulatory composition comprising a polynucleotide encoding an IL-23 polypeptide, a polynucleotide encoding an Interleukin 18 (IL-18) polypeptide and, optionally, a polynucleotide encoding an OX40L polypeptide.
  • the disclosure relates to methods of treating cancer using a combination approach that features mRNAs encoding IL-23, IL-36 or IL-18 and/or OX40L.
  • priming of an anti-cancer immune response is possible by administering, e.g., intratumorally, mRNAs encoding an IL-12 family member (e.g, IL-23) and/or IL-1 family member (e.g., IL-36 or IL-18).
  • IL-23 is important in the stimulation of, for example, T- cells, natural killer cells, macrophages, and or dendritic cells.
  • IL-36 is important in the stimulation of, for example, T-cells, natural killer cells, granulocytes, and/or dendritic cells.
  • IL-18 together with IL-12, induces cell-mediated immunity and is important in the stimulation of, for example, T- cells, natural killer cells, and/or macrophages.
  • mRNA encoding IL-36, or mRNA encoding IL-18, in combination with mRNA encoding IL-23 is believed to provide a first stimulation signal to the immune system, for example, within the tumor environment, e.g., via intratumoral injection of said mRNAs.
  • mRNA encoding an immune response co- stimulatory signal polypeptide for example, OX40L is believed to provide a second stimulation signal, when provided in combination with mRNAs encoding IL-23 and IL-36, due at least in part, to the ability of OX40L to stimulate T cells.
  • the immune therapeutic methods disclosed herein can (1) transform the tumor microenvironment (TME) to optimize immunogenicity, and/or (2) enhance T cell responses to elicit abscopal control and anti-cancer memory.
  • TAE tumor microenvironment
  • the abscopal effect, i.e., treating a tumor locally yet acting globally is illustrated in FIG. 44.
  • Some aspects of the disclosure feature treatment with mRNA encoding IL-23 in combination with mRNA encoding IL-36. Other aspects of the disclosure feature treatment with mRNA encoding IL-23 in combination with mRNA encoding IL-18. Exemplary aspects feature treatment with lipid nanoparticle- (LNP-) encapsulated mRNAs. Exemplary aspects feature intratumoral administration of mRNAs in ionizable amino lipid-based LNPs.
  • LNP- lipid nanoparticle-
  • the mRNA combination comprises a first polynucleotide encoding an IL-23 polypeptide, a second polynucleotide encoding a second protein comprising an IL-36-gamma polypeptide or an IL-18 polypeptide, and a third polynucleotide encoding a third protein comprising an OX40L polypeptide.
  • compositions comprising two or more polynucleotides (e.g., mRNAs) encoding an IL-23 polypeptide, a polynucleotide (e.g., mRNA) encoding an IL-36-gamma polypeptide or an IL- 18 polypeptide, and a polynucleotide (e.g., mRNA) encoding an OX40L polypeptide.
  • polynucleotides e.g., mRNAs
  • the composition is a lipid composition comprising an ionizable amino lipid, such as a compound of formula (I) as disclosed below, e.g., Compounds 18, 25, 26 or 48.
  • the lipid composition of the pharmaceutical composition comprises additional lipids/components.
  • the lipid composition can include one or more phospholipids, e.g., MSPC or DSPC.
  • the lipid composition can also comprise a quaternary amine compound such as DOTAP.
  • a lipid composition e.g., a lipid nanoparticle (LNP)
  • a lipid nanoparticle comprising: (1) a compound having the formula (I); (2) optionally a helper lipid (e.g. a phospholipid); (3) optionally a structural lipid (e.g. a sterol); (4) optionally a lipid conjugate (e.g. a PEG-lipid); and (5) optionally a quaternary amine compound.
  • the disclosure includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process.
  • the disclosure includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
  • the singular forms “a”, “an” and “the” include plural referents unless the context clearly dictates otherwise.
  • the terms “a” (or “an”), as well as the terms “one or more,” and “at least one” can be used interchangeably herein.
  • the term “a” or “an” means “single.”
  • the term “a” or “an” includes “two or more” or “multiple.”
  • Nucleotides are referred to by their commonly accepted single-letter codes. Unless otherwise indicated, nucleic acids are written left to right in 5' to 3' orientation. Nucleotides are referred to herein by their commonly known one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Accordingly, A represents adenine, C represents cytosine, G represents guanine, T represents thymine, and U represents uracil.
  • Amino acids are referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Unless otherwise indicated, amino acid sequences are written left to right in amino to carboxy orientation.
  • Administered in combination means that two or more agents are administered to a subject at the same time or within an interval such that there can be an overlap of an effect of each agent on the patient. In some embodiments, they are administered within about 60, 30, 15, 10, 5, or 1 minute of one another. In some embodiments, the administrations of the agents are spaced sufficiently closely together such that a combinatorial (e.g., a synergistic) effect is achieved.
  • a combinatorial e.g., a synergistic
  • amino acid substitution refers to replacing an amino acid residue present in a parent or reference sequence (e.g., a wild type sequence) with another amino acid residue.
  • An amino acid can be substituted in a parent or reference sequence (e.g., a wild type polypeptide sequence), for example, via chemical peptide synthesis or through recombinant methods known in the art.
  • substitution at position X refers to the substitution of an amino acid present at position X with an alternative amino acid residue.
  • substitution patterns can be described according to the schema AnY, wherein A is the single letter code corresponding to the amino acid naturally or originally present at position n, and Y is the substituting amino acid residue.
  • substitution patterns can be described according to the schema An(YZ), wherein A is the single letter code corresponding to the amino acid residue substituting the amino acid naturally or originally present at position X, and Y and Z are alternative substituting amino acid residue.
  • substitutions are conducted at the nucleic acid level, i.e., substituting an amino acid residue with an alternative amino acid residue is conducted by substituting the codon encoding the first amino acid with a codon encoding the second amino acid.
  • animal refers to any member of the animal kingdom. In some embodiments, “animal” refers to humans at any stage of development. In some embodiments, “animal” refers to non-human animals at any stage of development. In certain embodiments, the non-human animal is a mammal (e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, or a pig). In some embodiments, animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, and worms. In some embodiments, the animal is a transgenic animal, genetically-engineered animal, or a clone.
  • mammal e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, or a pig.
  • animals include, but are not limited to, mammals,
  • the term “approximately,” as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term “approximately” refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).
  • association means that the symptom, measurement, characteristic, or status in question is linked to the diagnosis, development, presence, or progression of that disease. As association may, but need not, be causatively linked to the disease.
  • conjugated when used with respect to two or more moieties, means that the moieties are physically associated or connected with one another, either directly or via one or more additional moieties that serves as a linking agent, to form a structure that is sufficiently stable so that the moieties remain physically associated under the conditions in which the structure is used, e.g., physiological conditions.
  • An “association” need not be strictly through direct covalent chemical bonding. It may also suggest ionic or hydrogen bonding or a hybridization based connectivity sufficiently stable such that the "associated" entities remain physically associated.
  • Biocompatible As used herein, the term “biocompatible” means compatible with living cells, tissues, organs or systems posing little to no risk of injury, toxicity or rejection by the immune system.
  • Biodegradable As used herein, the term “biodegradable” means capable of being broken down into innocuous products by the action of living things.
  • sequence optimization refers to a process or series of processes by which nucleobases in a reference nucleic acid sequence are replaced with alternative nucleobases, resulting in a nucleic acid sequence with improved properties, e.g., improved protein expression or decreased immunogenicity.
  • the goal in sequence optimization is to produce a synonymous nucleotide sequence than encodes the same polypeptide sequence encoded by the reference nucleotide sequence.
  • Codon substitution refers to replacing a codon present in a reference nucleic acid sequence with another codon.
  • a codon can be substituted in a reference nucleic acid sequence, for example, via chemical peptide synthesis or through recombinant methods known in the art. Accordingly, references to a "substitution” or “replacement” at a certain location in a nucleic acid sequence (e.g., an mRNA) or within a certain region or subsequence of a nucleic acid sequence (e.g., an mRNA) refer to the substitution of a codon at such location or region with an alternative codon.
  • coding region and “region encoding” and grammatical variants thereof, refer to an Open Reading Frame (ORF) in a polynucleotide that upon expression yields a polypeptide or protein.
  • ORF Open Reading Frame
  • stereoisomer means any geometric isomer (e.g., cis- and trans- isomer), enantiomer, or diastereomer of a compound.
  • the present disclosure encompasses any and all stereoisomers of the compounds described herein, including stereomerically pure forms (e.g., geometrically pure, enantiomerically pure, or diastereomerically pure) and enantiomeric and stereoisomeric mixtures, e.g., racemates.
  • isotopes refers to atoms having the same atomic number but different mass numbers resulting from a different number of neutrons in the nuclei.
  • isotopes of hydrogen include tritium and deuterium.
  • a compound, salt, or complex of the present disclosure can be prepared in combination with solvent or water molecules to form solvates and hydrates by routine methods.
  • Conservative amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain.
  • Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, or histidine), acidic side chains (e.g., aspartic acid or glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, or cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, or tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, or hist
  • basic side chains e.g.
  • amino acid substitution is considered to be conservative.
  • a string of amino acids can be conservatively replaced with a structurally similar string that differs in order and/or composition of side chain family members.
  • Non-conservative amino acid substitutions include those in which (i) a residue having an electropositive side chain (e.g., Arg, His or Lys) is substituted for, or by, an electronegative residue (e.g., Glu or Asp), (ii) a hydrophilic residue (e.g., Ser or Thr) is substituted for, or by, a hydrophobic residue (e.g., Ala, Leu, lie, Phe or Val), (iii) a cysteine or proline is substituted for, or by, any other residue, or (iv) a residue having a bulky hydrophobic or aromatic side chain (e.g., Val, His, He or Trp) is substituted for, or by, one having a smaller side chain (e.g., Ala or Ser) or no side chain (e.g., Gly).
  • an electropositive side chain e.g., Arg, His or Lys
  • an electronegative residue e.g., Glu or Asp
  • a substitution can be taken from any one of D-alanine, glycine, beta-alanine, L-cysteine and D-cysteine.
  • a replacement can be any one of D- lysine, arginine, D-arginine, homo-arginine, methionine, D-methionine, ornithine, or D- ornithine.
  • substitutions in functionally important regions that can be expected to induce changes in the properties of isolated polypeptides are those in which (i) a polar residue, e.g., serine or threonine, is substituted for (or by) a hydrophobic residue, e.g., leucine, isoleucine, phenylalanine, or alanine; (ii) a cysteine residue is substituted for (or by) any other residue; (iii) a residue having an electropositive side chain, e.g., lysine, arginine or histidine, is substituted for (or by) a residue having an electronegative side chain, e.g., glutamic acid or aspartic acid; or (iv) a residue having a bulky side chain, e.g., phenylalanine, is substituted for (or by) one not having such a side chain, e.g., glycine.
  • a polar residue e.g
  • conserved refers to nucleotides or amino acid residues of a polynucleotide sequence or polypeptide sequence, respectively, that are those that occur unaltered in the same position of two or more sequences being compared. Nucleotides or amino acids that are relatively conserved are those that are conserved amongst more related sequences than nucleotides or amino acids appearing elsewhere in the sequences. [173] In some embodiments, two or more sequences are said to be "completely conserved” if they are 100% identical to one another.
  • two or more sequences are said to be "highly conserved” if they are at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another. In some embodiments, two or more sequences are said to be “highly conserved” if they are about 70% identical, about 80% identical, about 90% identical, about 95%, about 98%, or about 99% identical to one another. In some embodiments, two or more sequences are said to be "conserved” if they are at least 30% identical, at least 40% identical, at least 50% identical, at least 60% identical, at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another.
  • two or more sequences are said to be "conserved” if they are about 30% identical, about 40% identical, about 50% identical, about 60% identical, about 70% identical, about 80% identical, about 90% identical, about 95% identical, about 98% identical, or about 99% identical to one another. Conservation of sequence may apply to the entire length of an polynucleotide or polypeptide or may apply to a portion, region or feature thereof.
  • contacting means establishing a physical connection between two or more entities.
  • contacting a mammalian cell with a nanoparticle composition means that the mammalian cell and a nanoparticle are made to share a physical connection.
  • Methods of contacting cells with external entities both in vivo and ex vivo are well known in the biological arts.
  • contacting a nanoparticle composition and a mammalian cell disposed within a mammal may be performed by varied routes of administration (e.g., intravenous, intramuscular, intradermal, and subcutaneous) and may involve varied amounts of nanoparticle compositions.
  • routes of administration e.g., intravenous, intramuscular, intradermal, and subcutaneous
  • more than one mammalian cell may be contacted by a nanoparticle composition.
  • Controlled Release refers to a pharmaceutical composition or compound release profile that conforms to a particular pattern of release to effect a therapeutic outcome.
  • Covalent derivative when referring to polypeptides include modifications of a native or starting protein with an organic proteinaceous or non- proteinaceous derivatizing agent, and/or post-translational modifications. Covalent modifications are traditionally introduced by reacting targeted amino acid residues of the protein with an organic derivatizing agent that is capable of reacting with selected side-chains or terminal residues, or by harnessing mechanisms of post-translational modifications that function in selected recombinant host cells. The resultant covalent derivatives are useful in programs directed at identifying residues important for biological activity, for immunoassays, or for the preparation of anti-protein antibodies for immunoaffinity purification of the recombinant glycoprotein. Such modifications are within the ordinary skill in the art and are performed without undue experimentation.
  • Cyclic or Cyclized As used herein, the term “cyclic” refers to the presence of a continuous loop. Cyclic molecules need not be circular, only joined to form an unbroken chain of subunits. Cyclic molecules such as the engineered RNA or mRNA of the present disclosure can be single units or multimers or comprise one or more components of a complex or higher order structure.
  • Cytotoxic refers to killing or causing injurious, toxic, or deadly effect on a cell (e.g., a mammalian cell (e.g., a human cell)), bacterium, virus, fungus, protozoan, parasite, prion, or a combination thereof.
  • Delivering means providing an entity to a destination.
  • delivering a polynucleotide to a subject may involve administering a nanoparticle composition including the polynucleotide to the subject (e.g., by an intravenous, intramuscular, intradermal, or subcutaneous route).
  • Administration of a nanoparticle composition to a mammal or mammalian cell may involve contacting one or more cells with the nanoparticle composition.
  • Delivery agent refers to any substance that facilitates, at least in part, the in vivo, in vitro, or ex vivo delivery of a polynucleotide to targeted cells.
  • Destabilized As used herein, the term “destable,” “destabilize,” or “destabilizing region” means a region or molecule that is less stable than a starting, wild-type or native form of the same region or molecule.
  • Detectable label refers to one or more markers, signals, or moieties that are attached, incorporated or associated with another entity that is readily detected by methods known in the art including radiography, fluorescence, chemiluminescence, enzymatic activity, absorbance and the like. Detectable labels include radioisotopes, fluorophores, chromophores, enzymes, dyes, metal ions, ligands such as biotin, avidin, streptavidin and haptens, quantum dots, and the like. Detectable labels can be located at any position in the peptides or proteins disclosed herein. They can be within the amino acids, the peptides, or proteins, or located at the N- or C- termini.
  • Diastereomer As used herein, the term “diastereomer,” means stereoisomers that are not mirror images of one another and are non-superimposable on one another.
  • Digest means to break apart into smaller pieces or components. When referring to polypeptides or proteins, digestion results in the production of peptides.
  • distal As used herein, the term “distal” means situated away from the center or away from a point or region of interest.
  • Domain refers to a motif of a polypeptide having one or more identifiable structural or functional characteristics or properties (e.g., binding capacity, serving as a site for protein-protein interactions).
  • Dosing regimen As used herein, a "dosing regimen” or a “dosing regimen” is a schedule of administration or physician determined regimen of treatment, prophylaxis, or palliative care.
  • Effective Amount As used herein, the term "effective amount" of an agent is that amount sufficient to effect beneficial or desired results, for example, clinical results, and, as such, an "effective amount” depends upon the context in which it is being applied. For example, in the context of administering an agent that treats a tumor, an effective amount of an agent is, for example, an amount sufficient to reduce or decrease a size of a tumor or to inhibit a tumor growth, as compared to the response obtained without administration of the agent.
  • the term “effective amount” can be used interchangeably with “effective dose,” “therapeutically effective amount,” or “therapeutically effective dose.”
  • Enantiomer As used herein, the term “enantiomer” means each individual optically active form of a compound of the disclosure, having an optical purity or enantiomeric excess (as determined by methods standard in the art) of at least 80% (i.e., at least 90% of one enantiomer and at most 10% of the other enantiomer), at least 90%, or at least 98%.
  • Encapsulate As used herein, the term “encapsulate” means to enclose, surround or encase.
  • Encapsulation efficiency refers to the amount of a polynucleotide that becomes part of a nanoparticle composition, relative to the initial total amount of polynucleotide used in the preparation of a nanoparticle composition. For example, if 97 mg of polynucleotide are encapsulated in a nanoparticle composition out of a total 100 mg of polynucleotide initially provided to the composition, the encapsulation efficiency may be given as 97%. As used herein, “encapsulation” may refer to complete, substantial, or partial enclosure, confinement, surrounding, or encasement.
  • Encoded protein cleavage signal refers to the nucleotide sequence that encodes a protein cleavage signal.
  • Engineered As used herein, embodiments of the disclosure are "engineered” when they are designed to have a feature or property, whether structural or chemical, that varies from a starting point, wild type or native molecule.
  • enhanced delivery means delivery of more (e.g., at least 1.5 fold more, at least 2-fold more, at least 3-fold more, at least 4-fold more, at least 5-fold more, at least 6-fold more, at least 7-fold more, at least 8-fold more, at least 9-fold more, at least 10-fold more) of a polynucleotide by a nanoparticle to a target tissue of interest (e.g., mammalian liver) compared to the level of delivery of a polynucleotide by a control nanoparticle to a target tissue of interest (e.g., MC3, KC2, or DLinDMA).
  • a target tissue of interest e.g., mammalian liver
  • the level of delivery of a nanoparticle to a particular tissue may be measured by comparing the amount of protein produced in a tissue to the weight of said tissue, comparing the amount of polynucleotide in a tissue to the weight of said tissue, comparing the amount of protein produced in a tissue to the amount of total protein in said tissue, or comparing the amount of polynucleotide in a tissue to the amount of total polynucleotide in said tissue.
  • a surrogate such as an animal model (e.g., a rat model).
  • Exosome is a vesicle secreted by mammalian cells or a complex involved in RNA degradation.
  • expression refers to one or more of the following events: (1) production of an RNA template from a DNA sequence ⁇ e.g., by transcription); (2) processing of an RNA transcript ⁇ e.g., by splicing, editing, 5' cap formation, and/or 3' end processing); (3) translation of an RNA into a polypeptide or protein; and (4) post- translational modification of a polypeptide or protein.
  • Ex vivo refers to events that occur outside of an organism ⁇ e.g., animal, plant, or microbe or cell or tissue thereof). Ex vivo events may take place in an environment minimally altered from a natural ⁇ e.g., in vivo) environment.
  • Feature refers to a characteristic, a property, or a distinctive element.
  • features are defined as distinct amino acid sequence-based components of a molecule.
  • features of the polypeptides encoded by the polynucleotides of the present disclosure include surface manifestations, local conformational shape, folds, loops, half-loops, domains, half-domains, sites, termini or any combination thereof.
  • a “formulation” includes at least a polynucleotide and one or more of a carrier, an excipient, and a delivery agent.
  • fragments of proteins can comprise polypeptides obtained by digesting full-length protein isolated from cultured cells.
  • a fragment is a subsequences of a full-length protein (e.g., one of the subunits of IL-23) wherein N-terminal, and/or C-terminal, and/or internal subsequences have been deleted.
  • the fragments of a protein of the present disclosure are functional fragments.
  • a "functional" biological molecule is a biological molecule in a form in which it exhibits a property and/or activity by which it is characterized.
  • a functional fragment of a polynucleotide of the present disclosure is a polynucleotide capable of expressing a functional interleukin fragment.
  • a functional fragment of an interleukin refers to a fragment of a wild type interleukin ⁇ i.e., a fragment of a naturally occurring form of the interleukin), or a mutant or variant thereof, wherein the fragment retains a least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, or at least about 95% of the biological activity of the corresponding full-length protein.
  • helper lipid refers to a compound or molecule that includes a lipidic moiety (for insertion into a lipid layer, e.g., lipid bilayer) and a polar moiety (for interaction with physiologic solution at the surface of the lipid layer).
  • the helper lipid is a phospholipid.
  • a function of the helper lipid is to "complement" the amino lipid and increase the fusogenicity of the bilayer and/or to help facilitate endosomal escape, e.g., of nucleic acid delivered to cells.
  • Helper lipids are also believed to be a key structural component to the surface of the LNP.
  • homology refers to the overall relatedness between polymeric molecules, e.g. between nucleic acid molecules ⁇ e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Generally, the term “homology” implies an evolutionary relationship between two molecules. Thus, two molecules that are homologous will have a common evolutionary ancestor. In the context of the present disclosure, the term homology encompasses both to identity and similarity.
  • polymeric molecules are considered to be "homologous" to one another if at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of the monomers in the molecule are identical (exactly the same monomer) or are similar (conservative substitutions).
  • the term “homologous” necessarily refers to a comparison between at least two sequences (polynucleotide or polypeptide sequences).
  • Identity refers to the overall monomer conservation between polymeric molecules, e.g., between polynucleotide molecules ⁇ e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of the percent identity of two polynucleotide sequences, for example, can be performed by aligning the two sequences for optimal comparison purposes ⁇ e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes).
  • the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the length of the reference sequence.
  • the nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position.
  • the percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences.
  • the comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. When comparing DNA and RNA, thymine (T) and uracil (U) can be considered equivalent.
  • Suitable software programs are available from various sources, and for alignment of both protein and nucleotide sequences.
  • One suitable program to determine percent sequence identity is bl2seq, part of the BLAST suite of program available from the U.S. government's National Center for Biotechnology Information BLAST web site (blast.ncbi.nlm.nih.gov).
  • B12seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm.
  • BLASTN is used to compare nucleic acid sequences
  • BLASTP is used to compare amino acid sequences.
  • MAFFT Clustal (ClustalW, Clustal X or Clustal Omega), MUSCLE, etc.
  • Different regions within a single polynucleotide or polypeptide target sequence that aligns with a polynucleotide or polypeptide reference sequence can each have their own percent sequence identity. It is noted that the percent sequence identity value is rounded to the nearest tenth. For example, 80.11, 80.12, 80.13, and 80.14 are rounded down to 80.1, while 80.15, 80.16, 80.17, 80.18, and 80.19 are rounded up to 80.2. It also is noted that the length value will always be an integer.
  • sequence alignments can be generated by integrating sequence data with data from heterogeneous sources such as structural data (e.g., crystallographic protein structures), functional data (e.g., location of mutations), or phylogenetic data.
  • a suitable program that integrates heterogeneous data to generate a multiple sequence alignment is T-Coffee, available at www.tcoffee.org, and alternatively available, e.g., from the EBI. It will also be appreciated that the final alignment used to calculate percent sequence identity can be curated either automatically or manually.
  • Immune checkpoint inhibitor An "immune checkpoint inhibitor" or simply
  • checkpoint inhibitor refers to a molecule that prevents immune cells from being turned off by cancer cells.
  • the term checkpoint inhibitor refers to polypeptides (e.g., antibodies) or polynucleotides encoding such polypeptides (e.g., mRNAs) that neutralize or inhibit inhibitory checkpoint molecules such as cytotoxic T-lymphocyte-associated protein 4 (CTLA-4), programmed death 1 receptor (PD-1), or PD-1 ligand 1 (PD-L1).
  • CTLA-4 cytotoxic T-lymphocyte-associated protein 4
  • PD-1 programmed death 1 receptor
  • PD-L1 PD-1 ligand 1
  • Immune response refers to the action of, for example, lymphocytes, antigen presenting cells, phagocytic cells, granulocytes, and soluble macromolecules produced by the above cells or the liver (including antibodies, cytokines, and complement) that results in selective damage to, destruction of, or elimination from the human body of invading pathogens, cells or tissues infected with pathogens, cancerous cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues.
  • Immune response co-stimulatory signal refers to an immuno-stimulatory molecule that promotes T cell and/or NK cell recruitment, proliferation, activation, survival, or a combination thereof.
  • the immune response co-stimulatory signal is a polypeptide that enhances T-cell expansion, function and memory formation (e.g., OX40L).
  • the co- stimulatory signal promotes Thl, Th2 and/or Th9 development, suppresses Treg development or activity, enhances the expansion and/or survival of CD4 and/or CD8 T cells and/or promotes memory cells.
  • the immune response co-stimulatory signal polypeptide is selected from the group consisting of: OX40L, CD80, and IL- 15. In some specific aspects, the immune response co-stimulatory signal polypeptide is selected from the group consisting of OX40L and CD80 .
  • Immune response primer refers to an immuno- stimulatory molecule that enhances antigen presentation and/or recognition.
  • an immune response primer is a polypeptide that primes dendritic cells, promotes dendritic cell maturation, promotes antigen presenting cell cytokine/chemokine production, expands and/or maintains Thl7 cells, enhances T cell proliferation and/or enhances Thl and/or Th9 differentiation.
  • the immune response primer is a member of the IL-12 family (e.g., IL-12, IL-23, IL-12p40 subunit, IL-23pl9 subunit, IL-27, IL-35).
  • the immune response primer is a member of the IL-1 family (e.g., IL-l , IL- ⁇ , IL-IRa, IL-18, IL-33, IL-36Ra, IL-36 , IL-36 , IL-36y, IL-37, IL-38).
  • the immune response primer is a polypeptide selected from the group consisting of: IL-23, IL-12p40 subunit, IL-23pl9 subunit, IL-12, IL-36-gamma, and IL-18.
  • Inflammatory response refers to immune responses involving specific and non-specific defense systems.
  • a specific defense system reaction is a specific immune system reaction to an antigen. Examples of specific defense system reactions include antibody responses.
  • a non-specific defense system reaction is an inflammatory response mediated by leukocytes generally incapable of immunological memory, e.g., macrophages, eosinophils and neutrophils.
  • an immune response includes the secretion of inflammatory cytokines, resulting in elevated inflammatory cytokine levels.
  • Inflammatory cytokine refers to cytokines that are elevated in an inflammatory response.
  • inflammatory cytokines include interleukin-6 (IL-6), CXCL1 (chemokine (C-X-C motif) ligand 1; also known as GRO , interferon- ⁇ (IFNy), tumor necrosis factor a (TNF ), interferon ⁇ -induced protein 10 (IP-10), or granulocyte-colony stimulating factor (G-CSF).
  • IL-6 interleukin-6
  • CXCL1 chemokine (C-X-C motif) ligand 1
  • GRO interferon- ⁇
  • TNF tumor necrosis factor a
  • IP-10 interferon ⁇ -induced protein 10
  • G-CSF granulocyte-colony stimulating factor
  • inflammatory cytokines includes also other cytokines associated with inflammatory responses known in the art, e.g., interleukin-1 (IL-1), interleukin-8 (IL-8), interleukin-12 (IL-12), interleukin-13 (IL-13), interferon a (IFN-a), etc.
  • IL-1 interleukin-1
  • IL-8 interleukin-8
  • IL-12 interleukin-12
  • IL-13 interleukin-13
  • IFN-a interferon a
  • in vitro refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, in a Petri dish, etc., rather than within an organism (e.g., animal, plant, or microbe).
  • in Vivo refers to events that occur within an organism (e.g., animal, plant, or microbe or cell or tissue thereof).
  • Insertional and deletional variants when referring to polypeptides are those with one or more amino acids inserted immediately adjacent to an amino acid at a particular position in a native or starting sequence. "Immediately adjacent" to an amino acid means connected to either the alpha-carboxy or alpha-amino functional group of the amino acid. "Deletional variants” when referring to polypeptides are those with one or more amino acids in the native or starting amino acid sequence removed. Ordinarily, deletional variants will have one or more amino acids deleted in a particular region of the molecule.
  • Intact As used herein, in the context of a polypeptide, the term “intact” means retaining an amino acid corresponding to the wild type protein, e.g., not mutating or substituting the wild type amino acid. Conversely, in the context of a nucleic acid, the term “intact” means retaining a nucleobase corresponding to the wild type nucleic acid, e.g., not mutating or substituting the wild type nucleobase.
  • Ionizable amino lipid includes those lipids having one, two, three, or more fatty acid or fatty alkyl chains and a pH-titratable amino head group (e.g., an alkylamino or dialkylamino head group).
  • An ionizable amino lipid is typically protonated (i.e., positively charged) at a pH below the pKa of the amino head group and is substantially not charged at a pH above the pKa.
  • Such ionizable amino lipids include, but are not limited to DLin-MC3-DMA (MC3) and (13Z,165Z)-N,N-dimethyl-3-nonydocosa-13-16-dien-l-amine (L608).
  • in vitro refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, in a Petri dish, etc., rather than within an organism (e.g., animal, plant, or microbe).
  • in vivo refers to events that occur within an organism (e.g., animal, plant, or microbe or cell or tissue thereof).
  • Isolated refers to a substance or entity that has been separated from at least some of the components with which it was associated (whether in nature or in an experimental setting). Isolated substances (e.g., nucleotide sequence or protein sequence) can have varying levels of purity in reference to the substances from which they have been associated. Isolated substances and/or entities can be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or more of the other components with which they were initially associated.
  • Isolated substances e.g., nucleotide sequence or protein sequence
  • Isolated substances and/or entities can be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or more of the other components with which they were initially associated.
  • isolated agents are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure.
  • a substance is "pure” if it is substantially free of other components.
  • substantially isolated means that the compound is substantially separated from the environment in which it was formed or detected. Partial separation can include, for example, a composition enriched in the compound of the present disclosure.
  • Substantial separation can include compositions containing at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% by weight of the compound of the present disclosure, or salt thereof.
  • a polynucleotide, vector, polypeptide, cell, or any composition disclosed herein which is "isolated” is a polynucleotide, vector, polypeptide, cell, or composition which is in a form not found in nature.
  • Isolated polynucleotides, vectors, polypeptides, or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature.
  • a polynucleotide, vector, polypeptide, or composition which is isolated is substantially pure.
  • Isomer means any tautomer, stereoisomer, enantiomer, or diastereomer of any compound of the disclosure. It is recognized that the compounds of the disclosure can have one or more chiral centers and/or double bonds and, therefore, exist as stereoisomers, such as double-bond isomers ⁇ i.e., geometric E/Z isomers) or diastereomers ⁇ e.g., enantiomers ⁇ i.e., (+) or (-)) or cis/trans isomers).
  • the chemical structures depicted herein, and therefore the compounds of the disclosure encompass all of the corresponding stereoisomers, that is, both the stereomerically pure form ⁇ e.g., geometrically pure, enantiomerically pure, or diastereomerically pure) and enantiomeric and stereoisomeric mixtures, e.g., racemates.
  • Enantiomeric and stereoisomeric mixtures of compounds of the disclosure can typically be resolved into their component enantiomers or stereoisomers by well-known methods, such as chiral-phase gas chromatography, chiral-phase high performance liquid chromatography, crystallizing the compound as a chiral salt complex, or crystallizing the compound in a chiral solvent.
  • Enantiomers and stereoisomers can also be obtained from stereomerically or enantiomerically pure intermediates, reagents, and catalysts by well-known asymmetric synthetic methods.
  • Linker refers to a group of atoms, e.g., 10-1,000 atoms, and can be comprised of the atoms or groups such as, but not limited to, carbon, amino, alkylamino, oxygen, sulfur, sulfoxide, sulfonyl, carbonyl, and imine.
  • the linker can be attached to a modified nucleoside or nucleotide on the nucleobase or sugar moiety at a first end, and to a payload, e.g., a detectable or therapeutic agent, at a second end.
  • the linker can be of sufficient length as to not interfere with incorporation into a nucleic acid sequence.
  • the linker can be used for any useful purpose, such as to form polynucleotide multimers (e.g., through linkage of two or more chimeric polynucleotides molecules or IVT polynucleotides) or polynucleotides conjugates, as well as to administer a payload, as described herein.
  • Examples of chemical groups that can be incorporated into the linker include, but are not limited to, alkyl, alkenyl, alkynyl, amido, amino, ether, thioether, ester, alkylene, heteroalkylene, aryl, or heterocyclyl, each of which can be optionally substituted, as described herein.
  • linkers include, but are not limited to, unsaturated alkanes, polyethylene glycols (e.g., ethylene or propylene glycol monomeric units, e.g., diethylene glycol, dipropylene glycol, triethylene glycol, tripropylene glycol, tetraethylene glycol, or tetraethylene glycol), and dextran polymers and derivatives thereof.
  • Non-limiting examples of a selectively cleavable bond include an amido bond can be cleaved for example by the use of tris(2- carboxyethyl)phosphine (TCEP), or other reducing agents, and/or photolysis, as well as an ester bond can be cleaved for example by acidic or basic hydrolysis.
  • TCEP tris(2- carboxyethyl)phosphine
  • Methods of administration may include intravenous, intramuscular, intradermal, subcutaneous, or other methods of delivering a composition to a subject.
  • a method of administration may be selected to target delivery (e.g., to specifically deliver) to a specific region or system of a body.
  • Modified refers to a changed state or structure of a molecule of the disclosure. Molecules can be modified in many ways including chemically, structurally, and functionally. In some embodiments, the mRNA molecules of the present disclosure are modified by the introduction of non-natural nucleosides and/or nucleotides, e.g., as it relates to the natural ribonucleotides A, U, G, and C. Noncanonical nucleotides such as the cap structures are not considered “modified” although they differ from the chemical structure of the A, C, G, U ribonucleotides.
  • Nanoparticle composition is a composition comprising one or more lipids. Nanoparticle compositions are typically sized on the order of micrometers or smaller and may include a lipid bilayer. Nanoparticle compositions encompass lipid nanoparticles (LNPs), liposomes ⁇ e.g., lipid vesicles), and lipoplexes. For example, a nanoparticle composition may be a liposome having a lipid bilayer with a diameter of 500 nm or less.
  • Naturally occurring As used herein, “naturally occurring” means existing in nature without artificial aid.
  • Non-human vertebrate As used herein, a "non-human vertebrate” includes all vertebrates except Homo sapiens, including wild and domesticated species. Examples of non-human vertebrates include, but are not limited to, mammals, such as alpaca, banteng, bison, camel, cat, cattle, deer, dog, donkey, gayal, goat, guinea pig, horse, llama, mule, pig, rabbit, reindeer, sheep water buffalo, and yak.
  • mammals such as alpaca, banteng, bison, camel, cat, cattle, deer, dog, donkey, gayal, goat, guinea pig, horse, llama, mule, pig, rabbit, reindeer, sheep water buffalo, and yak.
  • nucleic acid sequence The terms “nucleic acid sequence,” “nucleotide sequence,” or
  • polynucleotide sequence are used interchangeably and refer to a contiguous nucleic acid sequence.
  • the sequence can be either single stranded or double stranded DNA or RNA, e.g., an mRNA.
  • nucleic acid in its broadest sense, includes any compound and/or substance that comprises a polymer of nucleotides. These polymers are often referred to as polynucleotides.
  • Exemplary nucleic acids or polynucleotides of the disclosure include, but are not limited to, ribonucleic acids (RNAs), deoxyribonucleic acids (DNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs), peptide nucleic acids (PNAs), locked nucleic acids (LNAs, including LNA having a ⁇ - D-ribo configuration, a-LNA having an a-L-ribo configuration (a diastereomer of LNA), 2'-amino-LNA having a 2'-amino functionalization, and 2'-amino- a-LNA having a 2'-amino functionalization), ethylene nucleic acids (ENA), cyclohexen
  • nucleotide sequence encoding refers to the nucleic acid ⁇ e.g., an mRNA or DNA molecule) coding sequence which encodes a polypeptide.
  • the coding sequence can further include initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of an individual or mammal to which the nucleic acid is administered.
  • the coding sequence can further include sequences that encode signal peptides.
  • Off-target refers to any unintended effect on any one or more target, gene, or cellular transcript.
  • Open reading frame As used herein, "open reading frame” or “ORF” refers to a sequence which does not contain a stop codon in a given reading frame.
  • Operably linked refers to a functional connection between two or more molecules, constructs, transcripts, entities, moieties or the like.
  • Optionally substituted a phrase of the form "optionally substituted X" ⁇ e.g., optionally substituted alkyl) is intended to be equivalent to "X, wherein X is optionally substituted” ⁇ e.g., "alkyl, wherein said alkyl is optionally substituted”). It is not intended to mean that the feature "X” ⁇ e.g., alkyl) per se is optional.
  • Part As used herein, a "part" or “region" of a polynucleotide is defined as any portion of the polynucleotide that is less than the entire length of the polynucleotide.
  • Patient refers to a subject who may seek or be in need of treatment, requires treatment, is receiving treatment, will receive treatment, or a subject who is under care by a trained professional for a particular disease or condition.
  • compositions, and/or dosage forms that are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
  • compositions refers any ingredient other than the compounds described herein (for example, a vehicle capable of suspending or dissolving the active compound) and having the properties of being substantially nontoxic and non-inflammatory in a patient.
  • Excipients can include, for example: antiadherents, antioxidants, binders, coatings, compression aids, disintegrants, dyes (colors), emollients, emulsifiers, fillers (diluents), film formers or coatings, flavors, fragrances, glidants (flow enhancers), lubricants, preservatives, printing inks, sorbents, suspensing or dispersing agents, sweeteners, and waters of hydration.
  • antiadherents antioxidants, binders, coatings, compression aids, disintegrants, dyes (colors), emollients, emulsifiers, fillers (diluents), film formers or coatings, flavors, fragrances, glidants (flow enhancers), lubricants, preservatives, printing inks, sorbents, suspensing or dispersing agents, sweeteners, and waters of hydration.
  • excipients include, but are not limited to: butylated hydroxytoluene (BHT), calcium carbonate, calcium phosphate (dibasic), calcium stearate, croscarmellose, crosslinked polyvinyl pyrrolidone, citric acid, crospovidone, cysteine, ethylcellulose, gelatin, hydroxypropyl cellulose, hydroxypropyl methylcellulose, lactose, magnesium stearate, maltitol, mannitol, methionine, methylcellulose, methyl paraben, microcrystalline cellulose, polyethylene glycol, polyvinyl pyrrolidone, povidone, pregelatinized starch, propyl paraben, retinyl palmitate, shellac, silicon dioxide, sodium carboxymethyl cellulose, sodium citrate, sodium starch glycolate, sorbitol, starch (corn), stearic acid, sucrose, talc, titanium dioxide, vitamin A, vitamin E, vitamin C,
  • compositions described herein also includes pharmaceutically acceptable salts of the compounds described herein.
  • pharmaceutically acceptable salts refers to derivatives of the disclosed compounds wherein the parent compound is modified by converting an existing acid or base moiety to its salt form (e.g., by reacting the free base group with a suitable organic acid).
  • examples of pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like.
  • Representative acid addition salts include acetate, acetic acid, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzene sulfonic acid, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, fumarate, glucoheptonate, glycerophosphate, hemisulfate, heptonate, hexanoate, hydrobromide, hydrochloride, hydroiodide, 2- hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, ole
  • alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like, as well as nontoxic ammonium, quaternary ammonium, and amine cations, including, but not limited to ammonium, tetramethylammonium, tetraethylammonium, methylamine, dimethylamine, trimethylamine, triethylamine, ethylamine, and the like.
  • the pharmaceutically acceptable salts of the present disclosure include the conventional non-toxic salts of the parent compound formed, for example, from non-toxic inorganic or organic acids.
  • the pharmaceutically acceptable salts of the present disclosure can be synthesized from the parent compound that contains a basic or acidic moiety by conventional chemical methods.
  • such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two; generally, nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are used.
  • nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are used.
  • Lists of suitable salts are found in Remington's Pharmaceutical Sciences, 17 th ed., Mack Publishing Company, Easton, Pa., 1985, p. 1418, Pharmaceutical Salts: Properties, Selection, and Use, P.H. Stahl and C.G. Wermuth (eds.), Wiley- VCH, 2008, and Berge et al., Journal of Pharmaceutical Science, 66, 1-19 (1977), each of which is incorporated herein by reference in its entirety.
  • solvate means a compound of the disclosure wherein molecules of a suitable solvent are incorporated in the crystal lattice.
  • a suitable solvent is physiologically tolerable at the dosage administered.
  • solvates can be prepared by crystallization, recrystallization, or precipitation from a solution that includes organic solvents, water, or a mixture thereof.
  • Suitable solvents are ethanol, water (for example, mono-, di-, and tri-hydrates), N- methylpyrrolidinone (NMP), dimethyl sulfoxide (DMSO), N,N'-dimethylformamide (DMF), ⁇ , ⁇ '- dimethylacetamide (DMAC), l,3-dimethyl-2-imidazolidinone (DMEU), l,3-dimethyl-3,4,5,6- tetrahydro-2-(lH)-pyrimidinone (DMPU), acetonitrile (ACN), propylene glycol, ethyl acetate, benzyl alcohol, 2-pyrrolidone, benzyl benzoate, and the like.
  • NMP N- methylpyrrolidinone
  • DMSO dimethyl sulfoxide
  • DMF N,N'-dimethylformamide
  • DMAC ⁇ , ⁇ '- dimethylacetamide
  • DMEU dimethyl-2-imidazolidinone
  • Pharmacokinetic refers to any one or more properties of a molecule or compound as it relates to the determination of the fate of substances administered to a living organism. Pharmacokinetics is divided into several areas including the extent and rate of absorption, distribution, metabolism and excretion. This is commonly referred to as ADME where: (A) Absorption is the process of a substance entering the blood circulation; (D) Distribution is the dispersion or dissemination of substances throughout the fluids and tissues of the body; (M) Metabolism (or Biotransformation) is the irreversible transformation of parent compounds into daughter metabolites; and (E) Excretion (or Elimination) refers to the elimination of the substances from the body. In rare cases, some drugs irreversibly accumulate in body tissue. [247] Physicochemical: As used herein, "physicochemical” means of or relating to a physical and/or chemical property.
  • Polynucleotide refers to polymers of nucleotides of any length, including ribonucleotides, deoxyribonucleotides, analogs thereof, or mixtures thereof. This term refers to the primary structure of the molecule. Thus, the term includes triple-, double- and single- stranded deoxyribonucleic acid ("DNA”), as well as triple-, double- and single-stranded ribonucleic acid (“RNA”). It also includes modified, for example by alkylation, and/or by capping, and unmodified forms of the polynucleotide.
  • DNA triple-, double- and single- stranded deoxyribonucleic acid
  • RNA triple-, double- and single-stranded ribonucleic acid
  • polynucleotide includes polydeoxyribonucleotides (containing 2-deoxy-D-ribose), polyribonucleotides (containing D-ribose), including tRNA, rRNA, hRNA, siRNA and mRNA, whether spliced or unspliced, any other type of polynucleotide which is an N- or C-glycoside of a purine or pyrimidine base, and other polymers containing normucleotidic backbones, for example, polyamide (e.g., peptide nucleic acids "PNAs”) and polymorpholino polymers, and other synthetic sequence-specific nucleic acid polymers providing that the polymers contain nucleobases in a configuration which allows for base pairing and base stacking, such as is found in DNA and RNA.
  • PNAs peptide nucleic acids
  • the polynucleotide comprises an mRNA.
  • the mRNA is a synthetic mRNA.
  • the synthetic mRNA comprises at least one unnatural nucleobase.
  • all nucleobases of a certain class have been replaced with unnatural nucleobases (e.g., all uridines in a polynucleotide disclosed herein can be replaced with an unnatural nucleobase, e.g., 5-methoxyuridine).
  • the polynucleotide (e.g., a synthetic RNA or a synthetic DNA) comprises only natural nucleobases, i.e., A,C, T and U in the case of a synthetic DNA, or A, C, T, and U in the case of a synthetic RNA.
  • T bases in the codon maps disclosed herein are present in DNA, whereas the T bases would be replaced by U bases in corresponding RNAs.
  • a codon-nucleotide sequence disclosed herein in DNA form e.g., a vector or an in-vitro translation (IVT) template, would have its T bases transcribed as U based in its corresponding transcribed mRNA.
  • IVT in-vitro translation
  • both codon-optimized DNA sequences (comprising T) and their corresponding RNA sequences (comprising U) are considered codon-optimized nucleotide sequence of the present disclosure.
  • a TTC codon (DNA map) would correspond to a UUC codon (RNA map), which in turn would correspond to a ⁇ codon (RNA map in which U has been replaced with pseudouridine).
  • Standard A-T and G-C base pairs form under conditions which allow the formation of hydrogen bonds between the N3-H and C4-oxy of thymidine and the Nl and C6-NH2, respectively, of adenosine and between the C2-oxy, N3 and C4-NH 2 , of cytidine and the C2-NH 2 , N'— H and C6- oxy, respectively, of guanosine.
  • guanosine (2-amino-6-oxy-9-P-D-ribofuranosyl- purine) can be modified to form isoguanosine (2-oxy-6-amino-9-P-D-ribofuranosyl-purine).
  • isocytidine can be prepared by the method described by Switzer et al. (1993) Biochemistry 32: 10489-10496 and references cited therein; 2'-deoxy-5-methyl-isocytidine can be prepared by the method of Tor et al. (1993) J. Am. Chem. Soc. 115:4461-4467, and references cited therein; and isoguanine nucleotides can be prepared using the method described by Switzer et al., 1993, supra, and Mantsch et al. (1993) Biochem. 14:5593-5601, or by the method described in U.S. Pat. No. 5,780,610 to Collins et al.
  • Nonnatural base pairs can be synthesized by the method described in Piccirilli et al. (1990) Nature 343:33-37, for the synthesis of 2,6- diaminopyrimidine and its complement (l-methylpyrazolo-[4,3]pyrimidine-5,7-(4H,6H)-dione.
  • Other such modified nucleotide units which form unique base pairs are known, such as those described in Leach et al. (1992) J. Am. Chem. Soc. 114:3675-3683 and Switzer et al., supra.
  • Nucleic acid sequence The terms “nucleic acid sequence,” “nucleotide sequence,” or
  • polynucleotide are used interchangeably and refer to a contiguous nucleic acid sequence.
  • the sequence can be either single stranded or double stranded DNA or RNA, e.g., an mRNA.
  • nucleotide sequence encoding refers to the nucleic acid ⁇ e.g., an mRNA or DNA molecule) coding sequence that comprises a nucleotide sequence which encodes a polypeptide or functional fragment thereof as set forth herein.
  • the coding sequence can further include initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of an individual or mammal to which the nucleic acid is administered.
  • the coding sequence can further include sequences that encode signal peptides.
  • Polypeptide The terms "polypeptide,” “peptide,” and “protein” are used interchangeably herein to refer to polymers of amino acids of any length.
  • the polymer can comprise modified amino acids.
  • the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
  • polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids such as homocysteine, ornithine, p-acetylphenylalanine, D-amino acids, and creatine), as well as other modifications known in the art.
  • polypeptides refers to proteins, polypeptides, and peptides of any size, structure, or function.
  • Polypeptides include gene products, naturally occurring polypeptides, synthetic polypeptides, homologs, orthologs, paralogs, fragments and other equivalents, variants, and analogs of the foregoing.
  • a polypeptide can be a single polypeptide or can be a multi-molecular complex such as a dimer, trimer or tetramer. They can also comprise single chain or multichain polypeptides. Most commonly disulfide linkages are found in multichain polypeptides.
  • polypeptide can also apply to amino acid polymers in which one or more amino acid residues are an artificial chemical analogue of a corresponding naturally occurring amino acid.
  • a "peptide" can be less than or equal to 50 amino acids long, e.g., about 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50 amino acids long.
  • polypeptide variant refers to molecules that differ in their amino acid sequence from a native or reference sequence.
  • the amino acid sequence variants can possess substitutions, deletions, and/or insertions at certain positions within the amino acid sequence, as compared to a native or reference sequence.
  • variants will possess at least about 50% identity, at least about 60% identity, at least about 70% identity, at least about 80% identity, at least about 90% identity, at least about 95% identity, at least about 99% identity to a native or reference sequence. In some embodiments, they will be at least about 80%, or at least about 90% identical to a native or reference sequence.
  • Polypeptide per unit drug As used herein, a PUD or product per unit drug, is defined as a subdivided portion of total daily dose, usually 1 mg, pg, kg, etc., of a product (such as a polypeptide) as measured in body fluid or tissue, usually defined in concentration such as pmol/mL, mmol/mL, etc. divided by the measure in the body fluid.
  • the term "preventing” refers to partially or completely delaying onset of an infection, disease, disorder and/or condition; partially or completely delaying onset of one or more symptoms, features, or clinical manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying onset of one or more symptoms, features, or manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying progression from an infection, a particular disease, disorder and/or condition; and/or decreasing the risk of developing pathology associated with the infection, the disease, disorder, and/or condition.
  • Prodrug The present disclosure also includes prodrugs of the compounds described herein.
  • prodrugs refer to any substance, molecule or entity that is in a form predicate for that substance, molecule or entity to act as a therapeutic upon chemical or physical alteration. Prodrugs may by covalently bonded or sequestered in some way and that release or are converted into the active drug moiety prior to, upon or after administered to a mammalian subject. Prodrugs can be prepared by modifying functional groups present in the compounds in such a way that the modifications are cleaved, either in routine manipulation or in vivo, to the parent compounds.
  • Prodrugs include compounds wherein hydroxyl, amino, sulfhydryl, or carboxyl groups are bonded to any group that, when administered to a mammalian subject, cleaves to form a free hydroxyl, amino, sulfhydryl, or carboxyl group respectively.
  • Preparation and use of prodrugs is discussed in T. Higuchi and V. Stella, "Pro-drugs as Novel Delivery Systems," Vol. 14 of the A.C.S. Symposium Series, and in Bioreversible Carriers in Drug Design, ed. Edward B. Roche, American Pharmaceutical Association and Pergamon Press, 1987, both of which are hereby incorporated by reference in their entirety.
  • Proliferate As used herein, the term “proliferate” means to grow, expand or increase or cause to grow, expand or increase rapidly. “Proliferative” means having the ability to proliferate. “Anti-proliferative” means having properties counter to or inapposite to proliferative properties. [260] Prophylactic: As used herein, “prophylactic” refers to a therapeutic or course of action used to prevent the spread of disease.
  • Prophylaxis As used herein, a “prophylaxis” refers to a measure taken to maintain health and prevent the spread of disease. An “immune prophylaxis” refers to a measure to produce active or passive immunity to prevent the spread of disease.
  • Protein cleavage site refers to a site where controlled cleavage of the amino acid chain can be accomplished by chemical, enzymatic or photochemical means.
  • Protein cleavage signal refers to at least one amino acid that flags or marks a polypeptide for cleavage.
  • Protein of interest As used herein, the terms “proteins of interest” or “desired proteins” include those provided herein and fragments, mutants, variants, and alterations thereof.
  • Proximal As used herein, the term “proximal” means situated nearer to the center or to a point or region of interest.
  • Pseudouridine As used herein, pseudouridine refers to the C-glycoside isomer of the nucleoside uridine.
  • a "pseudouridine analog” is any modification, variant, isoform or derivative of pseudouridine.
  • pseudouridine analogs include but are not limited to 1-carboxymethyl- pseudouridine, 1-propynyl -pseudouridine, 1-taurinomethyl-pseudouridine, l-taurinomethyl-4-thio- pseudouridine, 1-methylpseudouridine 4-thio-l- methyl-pseudouridine, 3-methyl-pseudouridine (m 3 ⁇
  • purify means to make substantially pure or clear from unwanted components, material defilement, admixture or imperfection.
  • Reference Nucleic Acid Sequence The term "reference nucleic acid sequence" or
  • reference nucleic acid or “reference nucleotide sequence” or “reference sequence” refers to a starting nucleic acid sequence (e.g., a RNA, e.g., a mRNA sequence) that can be sequence optimized.
  • the reference nucleic acid sequence is a wild type nucleic acid sequence, a fragement or a variant thereof.
  • the reference nucleic acid sequence is a previously sequence optimized nucleic acid sequence.
  • the term "repeated transfection” refers to transfection of the same cell culture with a polynucleotide a plurality of times.
  • the cell culture can be transfected at least twice, at least 3 times, at least 4 times, at least 5 times, at least 6 times, at least 7 times, at least 8 times, at least 9 times, at least 10 times, at least 11 times, at least 12 times, at least 13 times, at least 14 times, at least 15 times, at least 16 times, at least 17 times at least 18 times, at least 19 times, at least 20 times, at least 25 times, at least 30 times, at least 35 times, at least 40 times, at least 45 times, at least 50 times or more.
  • salts include any anionic and cationic complex.
  • anions include inorganic and organic anions, e.g., fluoride, chloride, bromide, iodide, oxalate ⁇ e.g., hemioxalate), phosphate, phosphonate, hydrogen phosphate, dihydrogen phosphate, oxide, carbonate, bicarbonate, nitrate, nitrite, nitride, bisulfite, sulfide, sulfite, bisulfate, sulfate, thiosulfate, hydrogen sulfate, borate, formate, acetate, benzoate, citrate, tartrate, lactate, acrylate, polyacrylate, fumarate, maleate, itaconate, glycolate, gluconate, malate, mandelate
  • sample refers to a subset of its tissues, cells or component parts ⁇ e.g., body fluids, including but not limited to blood, mucus, lymphatic fluid, synovial fluid, cerebrospinal fluid, saliva, amniotic fluid, amniotic cord blood, urine, vaginal fluid and semen).
  • body fluids including but not limited to blood, mucus, lymphatic fluid, synovial fluid, cerebrospinal fluid, saliva, amniotic fluid, amniotic cord blood, urine, vaginal fluid and semen).
  • a sample further can include a homogenate, lysate or extract prepared from a whole organism or a subset of its tissues, cells or component parts, or a fraction or portion thereof, including but not limited to, for example, plasma, serum, spinal fluid, lymph fluid, the external sections of the skin, respiratory, intestinal, and genitourinary tracts, tears, saliva, milk, blood cells, tumors, organs.
  • a sample further refers to a medium, such as a nutrient broth or gel, which may contain cellular components, such as proteins or nucleic acid molecule.
  • transit peptide are used interchangeably and refer to a sequence that can direct the transport or localization of a protein to a certain organelle, cell compartment, or extracellular export.
  • the term encompasses both the signal sequence polypeptide and the nucleic acid sequence encoding the signal sequence.
  • references to a signal sequence in the context of a nucleic acid refer in fact to the nucleic acid sequence encoding the signal sequence polypeptide.
  • Signal transduction pathway refers to the biochemical relationship between a variety of signal transduction molecules that play a role in the transmission of a signal from one portion of a cell to another portion of a cell.
  • cell surface receptor includes, for example, molecules and complexes of molecules capable of receiving a signal and the transmission of such a signal across the plasma membrane of a cell.
  • Similarity refers to the overall relatedness between polymeric molecules, e.g. between polynucleotide molecules ⁇ e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of percent similarity of polymeric molecules to one another can be performed in the same manner as a calculation of percent identity, except that calculation of percent similarity takes into account conservative substitutions as is understood in the art.
  • Specific delivery means delivery of more ⁇ e.g., at least 1.5 fold more, at least 2-fold more, at least 3-fold more, at least 4-fold more, at least 5-fold more, at least 6-fold more, at least 7-fold more, at least 8-fold more, at least 9-fold more, at least 10-fold more) of a polynucleotide by a nanoparticle to a target tissue of interest ⁇ e.g., mammalian liver) compared to an off-target tissue ⁇ e.g., mammalian spleen).
  • a target tissue of interest e.g., mammalian liver
  • off-target tissue e.g., mammalian spleen
  • the level of delivery of a nanoparticle to a particular tissue may be measured by comparing the amount of protein produced in a tissue to the weight of said tissue, comparing the amount of polynucleotide in a tissue to the weight of said tissue, comparing the amount of protein produced in a tissue to the amount of total protein in said tissue, or comparing the amount of polynucleotide in a tissue to the amount of total polynucleotide in said tissue.
  • a polynucleotide is specifically provided to a mammalian kidney as compared to the liver and spleen if 1.5, 2-fold, 3-fold, 5-fold, 10-fold, 15 fold, or 20 fold more polynucleotide per 1 g of tissue is delivered to a kidney compared to that delivered to the liver or spleen following systemic administration of the polynucleotide.
  • a surrogate such as an animal model (e.g., a rat model).
  • Stable refers to a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture, and in some cases capable of formulation into an efficacious therapeutic agent.
  • Stabilized As used herein, the term “stabilize,” “stabilized,” “stabilized region” means to make or become stable.
  • stereoisomer refers to all possible different isomeric as well as conformational forms that a compound may possess (e.g., a compound of any formula described herein), in particular all possible stereochemically and conformationally isomeric forms, all diastereomers, enantiomers and/or conformers of the basic molecular structure. Some compounds of the present disclosure may exist in different tautomeric forms, all of the latter being included within the scope of the present disclosure.
  • Subject By “subject” or “individual” or “animal” or “patient” or “mammal,” is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired.
  • Mammalian subjects include, but are not limited to, humans, domestic animals, farm animals, zoo animals, sport animals, pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows; primates such as apes, monkeys, orangutans, and chimpanzees; canids such as dogs and wolves; felids such as cats, lions, and tigers; equids such as horses, donkeys, and zebras; bears, food animals such as cows, pigs, and sheep; ungulates such as deer and giraffes; rodents such as mice, rats, hamsters and guinea pigs; and so on.
  • the subject include, but are
  • Substantially refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest.
  • One of ordinary skill in the biological arts will understand that biological and chemical phenomena rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result. The term “substantially” is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical phenomena.
  • Substantially equal As used herein as it relates to time differences between doses, the term means plus/minus 2%.
  • Substantially simultaneous As used herein and as it relates to plurality of doses, the term means within 2 seconds.
  • Susceptible to An individual who is "susceptible to" a disease, disorder, and/or condition has not been diagnosed with and/or may not exhibit symptoms of the disease, disorder, and/or condition but harbors a propensity to develop a disease or its symptoms.
  • an individual who is susceptible to a disease, disorder, and/or condition can be characterized by one or more of the following: (1) a genetic mutation associated with development of the disease, disorder, and/or condition; (2) a genetic polymorphism associated with development of the disease, disorder, and/or condition; (3) increased and/or decreased expression and/or activity of a protein and/or nucleic acid associated with the disease, disorder, and/or condition; (4) habits and/or lifestyles associated with development of the disease, disorder, and/or condition; (5) a family history of the disease, disorder, and/or condition; and (6) exposure to and/or infection with a microbe associated with development of the disease, disorder, and/or condition.
  • an individual who is susceptible to a disease, disorder, and/or condition will develop the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will not develop the disease, disorder, and/or condition.
  • Sustained release refers to a pharmaceutical composition or compound release profile that conforms to a release rate over a specific period of time.
  • Synthetic means produced, prepared, and/or manufactured by the hand of man. Synthesis of polynucleotides or other molecules of the present disclosure can be chemical or enzymatic.
  • Targeted cells refers to any one or more cells of interest.
  • the cells may be found in vitro, in vivo, in situ, or in the tissue or organ of an organism.
  • the organism may be an animal, preferably a mammal, more preferably a human and most preferably a patient.
  • Target tissue refers to any one or more tissue types of interest in which the delivery of a polynucleotide would result in a desired biological and/or pharmacological effect.
  • target tissues of interest include specific tissues, organs, and systems or groups thereof.
  • a target tissue may be a kidney, a lung, a spleen, vascular endothelium in vessels ⁇ e.g., intra-coronary or intra-femoral), or tumor tissue ⁇ e.g., via intratumoral injection).
  • An "off-target tissue” refers to any one or more tissue types in which the expression of the encoded protein does not result in a desired biological and/or pharmacological effect.
  • off-target tissues may include the liver and the spleen.
  • Targeting sequence refers to a sequence that can direct the transport or localization of a protein or polypeptide.
  • Terminus refers to an extremity of a peptide or polypeptide. Such extremity is not limited only to the first or final site of the peptide or polypeptide but can include additional amino acids in the terminal regions.
  • the polypeptide based molecules of the disclosure can be characterized as having both an N-terminus (terminated by an amino acid with a free amino group (NH 2 )) and a C-terminus (terminated by an amino acid with a free carboxyl group (COOH)).
  • Proteins of the disclosure are in some cases made up of multiple polypeptide chains brought together by disulfide bonds or by non- covalent forces (multimers, oligomers). These sorts of proteins will have multiple N- and C-termini.
  • the termini of the polypeptides can be modified such that they begin or end, as the case can be, with a non-polypeptide based moiety such as an organic conjugate.
  • therapeutic agent refers to an agent that, when administered to a subject, has a therapeutic, diagnostic, and/or prophylactic effect and/or elicits a desired biological and/or pharmacological effect.
  • a mRNA encoding an IL-36-gamma polypeptide can be a therapeutic agent.
  • therapeutically effective amount means an amount of an agent to be delivered ⁇ e.g., nucleic acid, drug, therapeutic agent, diagnostic agent, prophylactic agent, etc.) that is sufficient, when administered to a subject suffering from or susceptible to an infection, disease, disorder, and/or condition, to treat, improve symptoms of, diagnose, prevent, and/or delay the onset of the infection, disease, disorder, and/or condition.
  • an agent to be delivered e.g., nucleic acid, drug, therapeutic agent, diagnostic agent, prophylactic agent, etc.
  • therapeutically effective outcome means an outcome that is sufficient in a subject suffering from or susceptible to an infection, disease, disorder, and/or condition, to treat, improve symptoms of, diagnose, prevent, and/or delay the onset of the infection, disease, disorder, and/or condition.
  • Total daily dose As used herein, a "total daily dose" is an amount given or prescribed in 24 hr. period. The total daily dose can be administered as a single unit dose or a split dose.
  • Transcription factor refers to a DNA- binding protein that regulates transcription of DNA into RNA, for example, by activation or repression of transcription. Some transcription factors effect regulation of transcription alone, while others act in concert with other proteins. Some transcription factor can both activate and repress transcription under certain conditions. In general, transcription factors bind a specific target sequence or sequences highly similar to a specific consensus sequence in a regulatory region of a target gene. Transcription factors may regulate transcription of a target gene alone or in a complex with other molecules.
  • Transcription refers to methods to introduce exogenous nucleic acids into a cell. Methods of transfection include, but are not limited to, chemical methods, physical treatments and cationic lipids or mixtures.
  • Transfection refers to the introduction of a polynucleotide into a cell wherein a polypeptide encoded by the polynucleotide is expressed (e.g., mRNA) or the polypeptide modulates a cellular function (e.g., siRNA, miRNA).
  • expression of a nucleic acid sequence refers to translation of a polynucleotide (e.g., an mRNA) into a polypeptide or protein and/or post-translational modification of a polypeptide or protein.
  • Treating, treatment, therapy As used herein, the term “treating” or “treatment” or
  • “therapy” refers to partially or completely alleviating, ameliorating, improving, relieving, delaying onset of, inhibiting progression of, reducing severity of, and/or reducing incidence of one or more symptoms or features of a hyper-proliferative disease, e.g., cancer.
  • “treating” cancer can refer to inhibiting survival, growth, and/or spread of a tumor.
  • Treatment can be administered to a subject who does not exhibit signs of a disease, disorder, and/or condition and/or to a subject who exhibits only early signs of a disease, disorder, and/or condition for the purpose of decreasing the risk of developing pathology associated with the disease, disorder, and/or condition.
  • Tumor Microenvironment refers to the cellular compositions within a tumor with respect to the presence or absence of infiltrating immune and/or inflammatory cells, as well as the type(s) of such cells within the tumor.
  • a tumor microenvironment is an "inflamed tumor microenvironment”, which refers to the presence of immune and/or inflammatory cells infiltrated into the tumor, with the predominant cell type being granulocytes.
  • a tumor microenvironment is an "immunosuppressive tumor microenvironment”, which refers to the presence of immune and/or inflammatory cells infiltrated into the tumor, with the predominant cell types being monocytic cells and macrophages.
  • a tumor microenvironment is an "immunologically barren tumor microenvironment", which refers to an absence of significant infilatration into the tumor of immune and/or inflammatory cells.
  • Unmodified refers to any substance, compound or molecule prior to being changed in any way. Unmodified can, but does not always, refer to the wild type or native form of a biomolecule. Molecules can undergo a series of modifications whereby each modified molecule can serve as the "unmodified" starting molecule for a subsequent modification.
  • Uracil is one of the four nucleobases in the nucleic acid of RNA, and it is represented by the letter U.
  • Uracil can be attached to a ribose ring, or more specifically, a ribofuranose via a ⁇ - ⁇ -glycosidic bond to yield the nucleoside uridine.
  • the nucleoside uridine is also commonly abbreviated according to the one letter code of its nucleobase, i.e., U.
  • U when a monomer in a polynucleotide sequence is U, such U is designated interchangeably as a "uracil” or a "uridine.”
  • Uridine Content The terms "uridine content” or “uracil content” are interchangeable and refer to the amount of uracil or uridine present in a certain nucleic acid sequence. Uridine content or uracil content can be expressed as an absolute value (total number of uridine or uracil in the sequence) or relative (uridine or uracil percentage respect to the total number of nucleobases in the nucleic acid sequence).
  • Uridine-Modified Sequence refers to a sequence optimized nucleic acid (e.g., a synthetic mRNA sequence) with a different overall or local uridine content (higher or lower uridine content) or with different uridine patterns (e.g., gradient distribution or clustering) with respect to the uridine content and/or uridine patterns of a candidate nucleic acid sequence.
  • a "high uridine codon” is defined as a codon comprising two or three uridines
  • a "low uridine codon” is defined as a codon comprising one uridine
  • a "no uridine codon” is a codon without any uridines.
  • a uridine-modified sequence comprises substitutions of high uridine codons with low uridine codons, substitutions of high uridine codons with no uridine codons, substitutions of low uridine codons with high uridine codons, substitutions of low uridine codons with no uridine codons, substitution of no uridine codons with low uridine codons, substitutions of no uridine codons with high uridine codons, and combinations thereof.
  • a high uridine codon can be replaced with another high uridine codon.
  • a low uridine codon can be replaced with another low uridine codon.
  • a no uridine codon can be replaced with another no uridine codon.
  • a uridine-modified sequence can be uridine enriched or uridine rarefied.
  • Uridine Enriched As used herein, the terms "uridine enriched" and grammatical variants refer to the increase in uridine content (expressed in absolute value or as a percentage value) in an sequence optimized nucleic acid (e.g., a synthetic mRNA sequence) with respect to the uridine content of the corresponding candidate nucleic acid sequence. Uridine enrichment can be implemented by substituting codons in the candidate nucleic acid sequence with synonymous codons containing less uridine nucleobases. Uridine enrichment can be global (i.e., relative to the entire length of a candidate nucleic acid sequence) or local (i.e., relative to a subsequence or region of a candidate nucleic acid sequence).
  • Uridine Rarefied As used herein, the terms "uridine rarefied" and grammatical variants refer to a decrease in uridine content (expressed in absolute value or as a percentage value) in an sequence optimized nucleic acid (e.g., a synthetic mRNA sequence) with respect to the uridine content of the corresponding candidate nucleic acid sequence. Uridine rarefication can be implemented by substituting codons in the candidate nucleic acid sequence with synonymous codons containing less uridine nucleobases. Uridine rarefication can be global (i.e., relative to the entire length of a candidate nucleic acid sequence) or local (i.e., relative to a subsequence or region of a candidate nucleic acid sequence). [307] Variant: The term variant as used in present disclosure refers to both natural variants
  • substitutional variants can be single, where only one amino acid in the molecule has been substituted, or they can be multiple, where two or more amino acids have been substituted in the same molecule. If amino acids are inserted or deleted, the resulting variant would be an "insertional variant” or a “deletional variant” respectively.
  • compositions of the disclosure for the treatment of cancer.
  • the compositions comprise, in a single formulation, at least two polynucleotides (e.g., mRNAs) or at least three polynucleotides (e.g., mRNAs), each of the compositions selected from a first polynucleotide encoding IL-23, a second polynucleotide encoding IL-36-gamma (or, alternatively, IL- 18), and/or a third polynucleotide encoding OX40L.
  • the present disclosure provides, for example, (i) a first polynucleotide (e.g., mRNA) encoding a first protein comprising an IL-23 polypeptide, (ii) a second polynucleotide (e.g., mRNA) encoding a second protein comprising an IL-36-gamma polypeptide (or an IL-18 polypeptide), and (iii) a third polynucleotide (e.g., mRNA) encoding a third protein comprising an OX40L polypeptide, wherein the first polynucleotide, the second polynucleotide, and the third polypeptide are used in various combinations.
  • a first polynucleotide e.g., mRNA
  • a second polynucleotide e.g., mRNA
  • a third polynucleotide e.g., mRNA
  • the composition comprises the first polynucleotide, the second polynucleotide, and the third polynucleotide.
  • polynucleotides of the disclosure refers to the first polynucleotide, the second polynucleotide, and the third polynucleotide disclosed herein.
  • the term "combinations of the disclosure” comprises, e.g., the combination of (i) a first polynucleotide (e.g., mRNA) encoding a first protein comprising an IL-23 polypeptide, and a second polynucleotide encoding a second protein comprising an IL-36-gamma polypeptide or IL- 18 polypeptide; (ii) a first polynucleotide (e.g., mRNA) encoding a first protein comprising an IL-23 polypeptide, and a third polynucleotide (e.g., mRNA) encoding a third protein comprising an OX40L polypeptide; (iii) a second polynucleotide (e.g., mRNA) encoding a second protein comprising an IL-36-gamma polypeptide or IL- 18 polypeptide, and a third polynu
  • the composition of the present disclosure comprises a polynucleotide (e.g., mRNA) encoding a single polypeptide, IL-23, IL-36-gamma or IL- 18, or OX40L, but each of the composition (e.g., a composition comprising a first polynucleotide encoding IL-23, a composition comprising a second polynucleotide encoding IL-36-gamma or IL- 18, and a third polynucleotide encoding OX40L) can be used in combination in the methods described herein.
  • a polynucleotide e.g., mRNA
  • each of the composition e.g., a composition comprising a first polynucleotide encoding IL-23, a composition comprising a second polynucleotide encoding IL-36-gamma or IL- 18, and a third polynucleotide
  • the present disclosure encompasses combination therapy of (i) a first polynucleotide (e.g., mRNA) encoding IL-23 and a second protein comprising IL-36-gamma or IL- 18; a first protein comprising IL-23 and a second polynucleotide (e.g., mRNA) encoding a second protein which comprises IL-36 gamma IL- 18; or (iii) a first protein comprising IL-23 and a second protein comprising IL-36 gamma or IL- 18.
  • a first polynucleotide e.g., mRNA
  • a second polynucleotide e.g., mRNA
  • the present disclosure further encompasses combination therapy of a IL-23 polynucleotide (e.g., mRNA) or a first protein comprising an IL-23 polypeptide, an IL-36-gamma polynucleotide or an IL- 18 polynucleotide (e.g., mRNA) or a second protein comprising an IL-36-gamma polypeptide or an IL- 18 polypeptide, an OX40L polynucleotide (e.g., mRNA) or a third protein comprising an OX40L polypeptide, or combinations thereof.
  • a IL-23 polynucleotide e.g., mRNA
  • a first protein comprising an IL-23 polypeptide
  • an IL-36-gamma polynucleotide or an IL- 18 polynucleotide e.g., mRNA
  • a second protein comprising an IL-36-gam
  • IL-23 is a pro-inflammatory cytokine that plays an important role in innate and adaptive immunity. Croxford et al. (2012) Eur. J. Immunol. 42:2263-2273. IL-23 functions primarily as a 60 kDa heterodimeric protein consisting of disulfide-linked pl9 and p40 subunits. IL-23 is structurally and functionally similar to the pro -inflammatory cytokine IL-12. IL-23 contains the same p40 subunit as IL-12, but includes the pl9 subunit rather than IL-12's p35. Oppman et al. (2000) Immunity 13:715-725.
  • the precursor form of the pl9 subunit (NCBI Reference Sequence: NP_057668; NM_016584; Uniprot: Q9NPF7; also referred to as IL-23A and IL-23 subunit alpha) is 189 amino acids in length, while its mature form is 170 amino acids long.
  • the precursor form of the p40 subunit (NCBI Reference Sequence: NM_002187; Uniprot:P29460; also referred to as IL-12B, natural killer cell stimulatory factor 2, and cytotoxic lymphocyte maturation factor 2) is 328 amino acids in length, while its mature form is 306 amino acids long.
  • IL-12 is associated with the development and activity of Thl T cell populations, while IL-23 is associated with the development and activity of Thl7 T cell populations. See Vignali et al. (2014) Nat. Immunol. 13:722-728.
  • IL-23 polypeptide refers to, e.g., a IL-
  • the fusion protein comprises from N-terminus to C-terminus:
  • an IL- 12p40 subunit comprising the IL-12p40 signal peptide, a peptide linker, and a mature IL-23pl9 subunit, or
  • an IL-23pl9 subunit comprising the IL-23pl9 signal peptide, a peptide linker, and a mature IL-12p40.
  • the IL-23 polypeptide comprises, consists of, or consists essentially of a human or murine IL-23 polypeptide of Table 1 (e.g., a precursor or mature IL- 12p40 or IL-23p l9) or a combination thereon.
  • the polynucleotide encoding the IL- 23 polypeptide comprises, consists of, or consists essentially of an IL-23 -encoding polynucleotide of Table 1.
  • the IL-23 polypeptide comprises an amino acid sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to an IL-23 amino acid sequence listed in Table 1 or an amino acid sequence encoded by a nucleotide sequence listed in Table 1, wherein the IL-23 polypeptide has at least 10% of the activity (e.g., binding to its receptor) of the corresponding wild type IL-23 polypeptide.
  • the IL-23 polypeptide comprises an amino acid sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 1, SEQ ID NO: 5 or SEQ ID NO: 140 and has at least 10% of the activity (e.g., binding to its receptor) of the corresponding wild type IL-23 polypeptide.
  • the IL-23 polypeptide consists essentially of SEQ ID NO: 1, SEQ ID NO: 5 or SEQ ID NO: 140 and has at least 10% of the activity (e.g., binding to its receptor) of the corresponding wild type IL-23 polypeptide.
  • the IL-23 polypeptide encoded by a polynucleotide of the disclosure comprises an amino acid sequence listed in Table 1 or shown in SEQ ID NOs: 1, 5 or 140 with one or more conservative substitutions, wherein the conservative substitutions do not significantly affect the binding activity of the IL-23 polypeptide to its receptor, i.e., the IL-23 polypeptide binds to the IL-23 receptor after the substitutions.
  • a nucleotide sequence ⁇ i.e., mRNA) encoding an IL-23 polypeptide comprises a sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to an IL-23 polypeptide encoding nucleic acid sequence listed in Table 1.
  • the nucleotide sequence ⁇ i.e., mRNA) encoding an IL-23 polypeptide comprises a sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 19, SEQ ID NO:71, SEQ ID NO: 141 or SEQ ID NO: 142.
  • the nucleotide sequence ⁇ i.e., mRNA) encoding an IL- 23 polypeptide consists essentially of SEQ ID NO: 19, SEQ ID NO:71, SEQ ID NO: 141 or SEQ ID NO: 142.
  • nucleotide sequence ⁇ i.e., mRNA, e.g., SEQ ID NO: 19, SEQ ID NO:71 or SEQ ID NO: 141) encoding an IL-23 polypeptide open reading frame (ORF) can be one element within a larger construct, e.g., further including a 5' terminal cap, 5 'UTR (e.g., SEQ ID NOs: 27 or 44), 3'UTR (e.g., SEQ ID NOs: 119 or 120), and/or polyA tail.
  • 5 'UTR e.g., SEQ ID NOs: 27 or 44
  • 3'UTR e.g., SEQ ID NOs: 119 or 120
  • polyA tail e.g., polyA tail
  • the first polynucleotide encodes a first protein comprising an IL-12 polypeptide.
  • IL-12 polypeptide refers to, e.g., a IL- 12p40 subunit of IL-12 ⁇ i.e., IL12B), to an IL-12p35 subunit of IL-12 ⁇ i.e., IL12Aa), or to a fusion protein comprising an IL-12p40 subunit polypeptide and an IL-12p35 subunit polypeptide.
  • the fusion protein comprises an IL12B polypetide selected from:
  • a variant thereof ⁇ e.g., full length or truncated IL12B proteins in which one or more amino acids have been replaced, e.g., variants that retain all or most of the IL12B activity of the polypeptide with respect to the wild type IL12B polypeptide (such as, e.g., V33I, V298F, or any other natural or artificial variants known in the art); or
  • a fusion protein comprising (i) a full length IL12B wild-type, a functional fragment or a variant thereof, and (ii) a heterologous protein;
  • an IL12A polypeptide selected from:
  • the full-length IL12A polypeptide (e.g., having the same or essentially the same length as wild-type IL12A);
  • a functional fragment of the full-length IL12A polypeptide e.g., a truncated (e.g., deletion of carboxy, amino terminal, or internal regions) sequence shorter than an IL12A wild-type; but still retaining IL12A enzymatic activity;
  • a variant thereof e.g., full length or truncated IL12A proteins in which one or more amino acids have been replaced, e.g., variants that retain all or most of the IL12A activity of the polypeptide with respect to the wtIL12A polypeptide (such as natural or artificial variants known in the art); or
  • a fusion protein comprising (i) a full length IL12A wild-type, a functional fragment or a variant thereof, and (ii) a heterologous protein.
  • the IL- 12 polypeptide comprises, consists of, or consists essentially of a human or murine IL- 12 polypeptide of Table 1 (e.g., a precursor or mature IL- 12p40 or IL-12p35) or a combination thereon.
  • the polynucleotide encoding the IL- 12 polypeptide comprises, consists of, or consists essentially of an IL-23 -encoding polynucleotide of Table 1.
  • the IL- 12 polypeptide comprises an amino acid sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to an IL- 12 amino acid sequence listed in Table 1 or an amino acid sequence encoded by a nucleotide sequence listed in Table 1, wherein the IL- 12 polypeptide has at least 10% of the activity (e.g., binding to its receptor) of the corresponding wild type IL- 12 polypeptide.
  • the IL- 12 polypeptide encoded by a polynucleotide of the disclosure comprises an amino acid sequence listed in Table 1 with one or more conservative substitutions, wherein the conservative substitutions do not significantly affect the binding activity of the IL-12 polypeptide to its receptor, i.e., the IL-12 polypeptide binds to the IL-12 receptor after the substitutions.
  • a nucleotide sequence (i.e., mRNA) encoding an IL-12 polypeptide comprises a sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to an IL-12 polypeptide encoding nucleic acid sequence listed in Table 1.
  • the nucleotide sequence (i.e., mRNA) encoding an IL-12 polypeptide comprises a sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 183.
  • nucleotide sequence i.e., mRNA
  • ORF polypeptide open reading frame
  • the first polynucleotide encoding a first protein comprising an IL-23 polypeptide can be combined with a polynucleotide encoding a second comprising an IL-36 polypeptide.
  • IL-36-gamma is a member of the Interleukin-1 family of cytokines. Like other members of the interleukin-1 family of cytokines, IL-36-gamma requires N-terminal cleavage for full bioactivity. IL-36-gamma does not have a signal sequence and, therefore, is not secreted through the endoplasmic reticulum Golgi pathway. See Gresnigt and van de Veerdonk (2013) Seminars in Immunology 25:458-465). It is unclear how IL-36-gamma is released from cells to act on, e.g., immune cells, other epithelial cells, and fibroblasts (Gabay et al.
  • a polynucleotide encoding IL-36 includes a sequence encoding a heterologous signal peptide.
  • a heterologous signal peptide includes a sequence encoding a heterologous signal peptide.
  • polynucleotides encoding such "engineered" signal peptide-interleukin chimeric proteins provide for the generation of active protein when expressed in vivo, in the absence of inflammasome activation.
  • the heterologous signal peptide is derived from an immunoglobulin heavy or light chain.
  • the heterologous signal peptide is derived from an immunoglobulin light chain, e.g. , from the variable region of said light chan.
  • the heterologous signal peptide is derived from human immunoglobulin kappa light chain variable region, MGVK4.
  • a polynucleotide of the invention encodes a heterologous signal peptide, operably linked to sequence encoding an IL-36-gamma polypeptide.
  • the IL-36-gamma polypeptide comprises, consists of, or consists essentially of an IL-36-gamma polypeptide of Table 1.
  • the polynucleotide encoding the IL-36-gamma polypeptide comprises, consists of, or consists essentially of an IL-36-gamma-encoding polynucleotide of Table 1.
  • the IL-36-gamma polypeptide comprises an amino acid sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to an IL-36-gamma amino acid sequence listed in Table 1 or an amino acid sequence encoded by a nucleotide sequence listed in Table 1, wherein the IL-36-gamma polypeptide has at least 10% of the activity (e.g., binding to its receptor) of the corresponding wild type IL-36-gamma polypeptide.
  • the IL-36-gamma polypeptide comprises an amino acid sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 16 and has at least 10% of the activity (e.g., binding to its receptor) of the corresponding wild type IL-36-gamma polypeptide.
  • the IL-36-gamma polypeptide consists essentially of SEQ ID NO: 16 and has at least 10% of the activity (e.g., binding to its receptor) of the corresponding wild type IL-36-gamma polypeptide.
  • the IL-36-gamma polypeptide encoded by a polynucleotide of the disclosure comprises an amino acid sequence listed in Table 1 or shown in SEQ ID NO: 16 with one or more conservative substitutions, wherein the conservative substitutions do not significantly affect the binding activity of the IL-36-gamma polypeptide to its receptor, i.e. , the IL-36-gamma polypeptide binds to the IL-36-gamma receptor after the substitutions.
  • a nucleotide sequence i.e. , mRNA
  • the nucleotide sequence (i.e., mRNA) encoding an IL-36-gamma polypeptide comprises a sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 17, SEQ ID NO:94, SEQ ID NO: 143 or SEQ ID NO: 144.
  • the nucleotide sequence (i.e., mRNA) encoding an IL-36-gamma polypeptide consists essentially of SEQ ID NO: 17, SEQ ID NO:94, SEQ ID NO: 143 OR SEQ ID NO: 144.
  • nucleotide sequence i.e., mRNA, e.g., SEQ ID NO: 17, SEQ ID NO:94 or SEQ ID NO: 143
  • encoding an IL-23 polypeptide open reading frame ORF
  • the first polynucleotide encoding a first protein comprising an IL-23 polypeptide can be combined with a second polynucleotide encoding a second protein, wherein the second protein comprises an IL-18 polypeptide.
  • IL-18 also known as interferon-gamma inducing factor (IGIF) and IFN- ⁇ inducing factor, is a member of the Interleukin-1 family of cytokines. IL-18 has two known isoforms, Isoform 1 and Isoform 2. Isoform 2 differs from Isoform 1 in that it is missing residues 27-30. Like other members of the interleukin-1 family of cytokines, IL-18 requires N-terminal cleavage for full bioactivity (Dinarello et al. (2013) Frontiers in Immunology 4:289). IL- 18 does not have a signal sequence and, therefore, is not secreted through the endoplasmic reticulum Golgi pathway. See Gresnigt and van de Veerdonk (2013) Seminars in Immunology 25:458-465).
  • IL-18 is a pro-inflammatory agonist that signals through the IL-18a and IL- ⁇ co- receptors to induce a signaling cascade activating NFKB and MAPKs (Dinarello et al. (2013). As in the case of IL-23, there are conflicting reports regarding the potential use of IL-18 for anticancer therapy. Ma et al. (2016) Clin. Cancer Res. 22:2969-2680 teaches that co-treatment with IL-18 enhances the antitumor activity elicited by anti-PD-Ll and/or anti-CTLA-4. However, Fabbi et al. (2015) J. Leukoc. Biol.
  • IL-18 may play divergent roles in cancer, having anticancer activities in some cases and tumor-promoting activities in other cases. Fabbi indicates that although the preclinical studies and some clinical trials suggest that IL-18 has anti-tumor activities, other studies indicate that IL-18 may exert proinvasive, proangiogenic, and immune-regulatory activities in different tumor models.
  • Term et al. (2011) Cancer Res. 71: 5393-9 teaches that IL-18 is an immunosuppressive cytokine in cancer, and that IL-18 produced by tumor cells promotes the development of NK-controlled metastases in a PD-1 -dependent manner. Kang et al. (2009) Carcinogenesis 30: 1987-86 teaches that IL-18 increases metastases and immune escape of stomach cancer.
  • a polynucleotide encoding IL-18 includes a sequence encoding a heterologous signal peptide. Without being bound in theory, it is believed that polynucleotides encoding such "engineered" signal peptide-interleukin chimeric proteins provide for the generation of active protein when expressed in vivo, in the absence of inflammasome activation.
  • the heterologous signal peptide is derived from an immunoglobulin heavy or light chain.
  • the heterologous signal peptide is derived from an immunoglobulin light chain, e.g. , from the variable region of said light chain.
  • the heterologous signal peptide is derived from human immunoglobulin kappa light chain variable region, hIGVK4.
  • a polynucleotide of the invention encodes a heterologous signal peptide, operably linked to sequence encoding an IL- 18 polypeptide.
  • the IL-18 polypeptide comprises, consists of, or consists essentially of an IL-18 polypeptide of Table 1.
  • the polynucleotide encoding the IL-18 polypeptide comprises, consists of, or consists essentially of an IL-18 -encoding polynucleotide of Table 1.
  • the IL-18 polypeptide comprises an amino acid sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to an IL-18 amino acid sequence listed in Table 1 or an amino acid sequence encoded by a nucleotide sequence listed in Table 1, wherein the IL-18 polypeptide has at least 10% of the activity (e.g., binding to its receptor) of the corresponding wild type IL-18 polypeptide.
  • the nucleotide sequence ⁇ i.e., mRNA) encoding an IL-18 polypeptide comprises a sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 148, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158, SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161 or SEQ ID NO: 162.
  • the nucleotide sequence i.e.
  • mRNA encoding an IL18 polypeptide consists essentially of to SEQ ID NO: 148, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158, SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161 or SEQ ID NO: 162. It should be understood that the nucleotide sequence (i.e.
  • mRNA e.g., to SEQ ID NO: 148, SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, SEQ ID NO: 158, SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161 or SEQ ID NO: 162) encoding an IL- 18 polypeptide open reading frame (ORF) can be one element within a larger construct, e.g., further including a 5' terminal cap, 5'UTR (e.g., SEQ ID NOs: 27 or 44), 3'UTR (e.g., SEQ ID NOs: 119 or 120), and/or polyA tail.
  • 5'UTR e.g., SEQ ID NOs: 27 or 44
  • 3'UTR e.g., SEQ ID NOs: 119 or 120
  • the first polynucleotide encoding a first protein comprising an IL-23 polypeptide can be combined with a third polynucleotide encoding a third protein, wherein the third protein comprises an OX40L polypeptide.
  • the second polynucleotide encoding a second protein comprising an IL-36-gamma polypeptide or an IL- 18 polypeptide can be combined with a third polynucleotide encoding a third protein, wherein the third protein comprises an OX40L polypeptide.
  • the first polynucleotide encoding a first protein comprising an IL-23 polypeptide and the second polynucleotide encoding a second protein comprising an IL-36-gamma polypeptide or an IL- 18 polypeptide can be combined with a third polynucleotide encoding a third protein, wherein the third protein comprises an OX40L polypeptide.
  • OX40L Human OX40L was first identified on the surface of human lymphocytes infected with human T-cell leukemia virus type-I (HTLV-I) by Tanaka et al. (Tanaka et ah , International Journal of Cancer (1985), 36(5):549-55).
  • OX40L is the ligand for OX40 (CD134).
  • CD252 cluster of differentiation 252
  • ligand tumor necrosis factor
  • member 4 tax-transcriptionally activated glycoprotein 1, TXGP1, or gp34.
  • Human OX40L is 183 amino acids in length and contains three domains: a cytoplasmic domain of amino acids 1 - 23; a transmembrane domain of amino acids 24 - 50, and an extracellular domain of amino acids 51 - 183.
  • the third polynucleotide comprises an mRNA encoding a mammalian OX40L polypeptide.
  • the mammalian OX40L polypeptide is a murine OX40L polypeptide.
  • the mammalian OX40L polypeptide is a human OX40L polypeptide.
  • the OX40L polypeptide comprises an amino acid sequence set forth in Table 1A.
  • each polynucleotide of the disclosure comprises an mRNA, i.e., an mRNA encoding an IL-23 polypeptide, an mRNA encoding an IL-36-gamma polypeptide, and an mRNA encoding an OX40L polypeptide.
  • the mRNA encoding an IL- 23 polypeptide encodes a mammalian IL-23 polypeptide.
  • the mRNA encoding an IL-36-gamma polypeptide encodes a mammalian IL-36-gamma polypeptide.
  • the mRNA encoding an OX40L polypeptide encodes a mammalian OX40L polypeptide. In some embodiments, the mRNA encoding an IL-23 polypeptide encodes a murine IL- 23 polypeptide. In some embodiments, the mRNA encoding an IL-36-gamma polypeptide encodes a murine IL-36-gamma polypeptide. In some embodiments, the mRNA encoding an OX40L polypeptide encodes a murine OX40L polypeptide. In some embodiments, the mRNA encoding an IL-23 polypeptide encodes a human IL-23 polypeptide.
  • the mRNA encoding an IL-36-gamma polypeptide encodes a human IL-36-gamma polypeptide. In some embodiments, the mRNA encoding an OX40L polypeptide encodes a human OX40L polypeptide.
  • the IL-23 polypeptide comprises a human amino acid sequence set forth in Table 1.
  • the IL-36-gamma polypeptide comprises a human amino acid sequence set forth in Table 1.
  • the OX40L polypeptide comprises a human amino acid sequence set forth in Table 1A.
  • the OX40L polypeptide comprises an amino acid sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to an amino acid sequence listed in Table 1A or an amino acid sequence encoded by a nucleotide sequence listed in Table 1A, wherein the amino acid sequence is capable of binding to an OX40 receptor.
  • the OX40L polypeptide comprises an amino acid sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 21 and is capable of binding to an OX40 receptor.
  • the OX40L polypeptide consists essentially of SEQ ID NO: 21 and is capable of binding to an OX40 receptor.
  • the OX40L polypeptide encoded by a polynucleotide of the disclosure comprises an amino acid sequence listed in Table 1A or shown in SEQ ID NO: 21 with one or more conservative substitutions, wherein the conservative substitutions do not significantly affect the binding activity of the OX40L polypeptide to its receptor, i.e., the OX40L polypeptide binds to the OX40 receptor after the substitutions.
  • a nucleotide sequence i.e., mRNA
  • encoding an OX40L polypeptide comprises a sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to a nucleic acid sequence listed in Table 1A.
  • the nucleotide sequence i.e.
  • mRNA) encoding an OX40L polypeptide comprises a sequence at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99%, or 100% identical to SEQ ID NO: 116, SEQ ID NO: 145 or SEQ ID NO: 146.
  • the nucleotide sequence (i.e. , mRNA) encoding an OX40L polypeptide consists essentially of SEQ ID NO: 116, SEQ ID NO: 145 or SEQ ID NO: 146. It should be understood that the nucleotide sequence (i.e.
  • mRNA e.g., SEQ ID NO: 116 or SEQ ID NO: 145) encoding an OX40L polypeptide open reading frame (ORF)
  • ORF OX40L polypeptide open reading frame
  • mRNA e.g., SEQ ID NO: 116 or SEQ ID NO: 145
  • encoding an OX40L polypeptide open reading frame can be one element within a larger construct, e.g., further including a 5' terminal cap, 5'UTR (e.g., SEQ ID NOs: 27 or 44), 3'UTR (e.g., SEQ ID NOs: 119 or 120), and/or poly A tail.
  • 5'UTR e.g., SEQ ID NOs: 27 or 44
  • 3'UTR e.g., SEQ ID NOs: 119 or 120
  • poly A tail e.g., poly A tail.
  • the polynucleotide (e.g., mRNA) useful for the methods and compositions comprises an open reading frame encoding an extracellular domain of OX40L.
  • the polynucleotide (e.g., mRNA) comprises an open reading frame encoding a cytoplasmic domain of OX40L.
  • the polynucleotide (e.g., mRNA) comprises an open reading frame encoding a transmembrane domain of OX40L.
  • the polynucleotide (e.g., mRNA) comprises an open reading frame encoding an extracellular domain of OX40L and a transmembrane of OX40L.
  • the polynucleotide (e.g., mRNA) comprises an open reading frame encoding an extracellular domain of OX40L and a cytoplasmic domain of OX40L.
  • the polynucleotide (e.g., mRNA) comprises an open reading frame encoding an extracellular domain of OX40L, a transmembrane of OX40L, and a cytoplasmic domain of OX40L.
  • Table 1 or Table 1A present, e.g., precursor and mature sequences for IL-23, IL-36- gamma, and OX40L as well as constructs comprising IL-23 or IL-36-gamma.
  • IL-23 polynucleotide or IL-23 polypeptide encompass both "precursor” and “mature” forms.
  • a construct comprising a polynucleotide encoding IL-23, IL-36- gamma, and OX40L and further comprising components such 3' UTR and 5' UTR would be considered an IL-23, IL-36-gamma, and OX40L encoding polynucleotide.
  • a person of skill in the art would understand that in addition to the native signal sequences and propeptide sequences implicitly disclosed in Table 1 or 1A (sequences present in the precursor for and absent in the mature corresponding form) and the non-native signal peptide disclosed in Table 1 or 1A (IgKV4 signal peptide), other signal sequences can be used.
  • references to an IL-23, IL-36-gamma, and OX40L polypeptide or polynucleotide according to Table 1 encompass variants in which an alternative signal peptide (or encoding sequence) known in the art has been attached to said IL-23, IL-36-gamma, and OX40L polypeptide (or polynucleotide). It is also understood that references to the sequences disclosed in Table 1 through the application are equally applicable and encompass orthologs and functional variants (for example polymorphic variants) and isoforms of those sequences known in the art at the time the application was filed.
  • IL-23 IL- Amino acid RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVP SEQ ID 23pl9 subunit sequence of HIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDS NO: 5 (Mature) human IL- PVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSL
  • hIL-23 (IL- Amino Acid MCHQQLVI SWFSLVFLASPLVAIWELKKDVYWELDWYPDAPGEMWLTC 140 12p40 subunit sequence of DTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHS and IL-23pl9 human IL- LLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTI ST subunit) 23 (IL- DLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACP
  • hIL-23 (IL- Nucleotide AUGUGUCACCAGCAGUUGGUCAUCUCUUGGUUUUCCCUGGUAUUUCUGGCA 141 12p40 subunit sequence UCUCCCCUCGUGGCCAUAUGGGAACUGAAGAAAGAUGUUUAUGUCGUAGAA and IL-23pl9 (ORF) of UUGGAUUGGUAUCCGGAUGCCCCUGGAGAAAUGGUGGUCCUCACCUGUGAC subunit) human IL- ACCCCUGAAGAAGAUGGUAUCACCUGGACCUUGGACCAGAGCAGUGAGGUC
  • IL-23pl9 CAGAAAGAACCCAAGAAUAAGACCUUUCUAAGAUGCGAGGCCAAGAAUUAU subunit UCUGGACGUUUCACCUGCUGGUGGCUGACGACAAUCAGUACUGAUUUGACA linked by UUCAGUGUCAAGAGCAGCAGAGGCUCUUCUGACCCCCAAGGGGUGACGUGC
  • hIL-23 (IL- Full-length 5 ' 7Me GpppG 2 ' o Me GGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGA 142 12p40 subunit mRNA GCCACCAUGUGUCACCAGCAGUUGGUCAUCUCUUGGUUUUCCCUGGUAUUU and IL-23pl9 Nucleotide CUGGCAUCUCCCCUCGUGGCCAUAUGGGAACUGAAGAAAGAUGUUUAUGUC subunit) sequence (5' GUAGAAUUGGAUUGGUAUCCGGAUGCCCCUGGAGAAAUGGUGGUCCUCACC
  • IL-23 (IL- UUGACAUUCAGUGUCAAGAGCAGCAGAGGCUCUUCUGACCCCCAAGGGGUG
  • IL-36- TGTGGACCCTTCAGGGTCAGAACCTTGTGGCAGTTCCACGAAGTGACAGT gamma (Pre GTGACCCCAGTCACTGTTGCTGTTATCACATGCAAGTATCCAGAGGCTCT cursor) TGAGCAAGGCAGAGGGGATCCCATTTATTTGGGAATCCAGAATCCAGAAA
  • IgKV4 signal Amino acid MVLQTQVFISLLLWISGAYG SEQ ID Encoded SEQ ID
  • IgKV4 signal Nucleotide ATGGTGTTGCAGACCCAGGTCTTCATTTCTCTGTTGCTCTGGATCTCTGG SEQ ID peptide sequence of TGCCTACGGG NO: 15
  • hIGKV4-hIL- MGKV4- MVLQTQVF I S LLLWI S GAYGSMCKP I TGT INDLNQQVWTLQGQNLVAVPR SEQ ID 36g construct hIL-36g SD SVTPVTVAVI TCKYPEALEQGRGDP I YLG I QNPEMCLYCEKVGEQP TL NO: 16 (protein) construct QLKEQKIMDLYGQPEPVKPFLFYRAKTGRT S TLE SVAFPDWF IAS SKRDQ
  • IL-18 isoform Human IL MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRN SEQ ID 1 18 isoform 1 LNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFI I SMYKDSQPRGMAVTI
  • IL-18 isoform Amino acid YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFI I S SEQ ID 1 sequence of MYKDSQPRGMAVTI SVKCEKI STLSCENKI I SFKEMNPPDNIKDTKSDI I
  • IL-18 Nucleotide Subsequence of precursor sequence encoding IL-18 SEQ ID isoform 1 sequence of Isoform 1 which encodes the mature amino acid
  • IL-18 isoform Amino acid MAAEPVEDNCINFVAMKFIDNTLYFIENLESDYFGKLESKLSVIRNLNDQ SEQ ID 2 sequence of VLFIDQGNRPLFEDMTDSDCRDNAPRTIFI I SMYKDSQPRGMAVTI SVKC
  • IL-18 isoform Amino acid YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIIS SEQ ID 2 sequence of MYKDSQPRGMAVTI SVKCEKI STLSCENKI I SFKEMNPPDNIKDTKSDI I
  • hIL12AB_002 mRNA ORF AUGUGCCACCAGCAGCUGGUGAUCAGCUGGUUCAGCCUGGUGUUCCUGGCCAGCCCC SEQ ID for human CUGGUGGCCAUCUGGGAGCUGAAGAAGGACGUGUACGUGGUGGAGUUGGAUUGGUAC NO: IL-12 CCCGACGCCCCCGGCGAGAUGGUGGUGCUGACCUGCGACACCCCCGAGGAGGACGGC 183
  • IL12B CCTGGAGAAATGGTGGTCCTCACCTGTGACACCCCTGAAGAAGATGGTATCACCTGG NO: without ACCTTGGACCAGAGCAGTGAGGTCTTAGGCTCTGGCAAAACCCTGACCATCCAAGTC 185

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Epidemiology (AREA)
  • Engineering & Computer Science (AREA)
  • Organic Chemistry (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Zoology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Immunology (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Toxicology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Cell Biology (AREA)
  • Biomedical Technology (AREA)
  • Nanotechnology (AREA)
  • Biotechnology (AREA)
  • Physics & Mathematics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Optics & Photonics (AREA)
  • Microbiology (AREA)
  • Mycology (AREA)
  • Dispersion Chemistry (AREA)
  • General Engineering & Computer Science (AREA)
  • Oil, Petroleum & Natural Gas (AREA)
  • Dermatology (AREA)
  • Wood Science & Technology (AREA)
  • Endocrinology (AREA)
  • Medical Informatics (AREA)
PCT/US2017/033395 2016-05-18 2017-05-18 Combinations of mrnas encoding immune modulating polypeptides and uses thereof Ceased WO2017201325A1 (en)

Priority Applications (30)

Application Number Priority Date Filing Date Title
KR1020227045735A KR20230008243A (ko) 2016-05-18 2017-05-18 면역 조정 폴리펩타이드를 암호화하는 mRNA의 조합물 및 이의 용도
CN202310702910.3A CN116726203A (zh) 2016-05-18 2017-05-18 编码免疫调节多肽的mrna的组合及其用途
EP17727999.9A EP3458474B1 (en) 2016-05-18 2017-05-18 Combinations of mrnas encoding immune modulating polypeptides and uses thereof
LTEPPCT/US2017/033395T LT3458474T (lt) 2016-05-18 2017-05-18 Imunitetą moduliuojančius polipeptidus koduojančių mrnr deriniai ir jų naudojimas
CN201780044529.5A CN109476718B (zh) 2016-05-18 2017-05-18 编码免疫调节多肽的mrna的组合及其用途
EP22181855.2A EP4137509A1 (en) 2016-05-18 2017-05-18 Combinations of mrnas encoding immune modulating polypeptides and uses thereof
DK17727999.9T DK3458474T3 (da) 2016-05-18 2017-05-18 Kombinationer af mrna'er, der koder for immunmodulerende polypeptider og anvendelser deraf
ES17727999T ES2932516T3 (es) 2016-05-18 2017-05-18 Combinaciones de ARNm que codifican polipéptidos inmunomoduladores y usos de los mismos
SM20230003T SMT202300003T1 (it) 2016-05-18 2017-05-18 Combinazioni di mrna che codificano polipeptidi immunitari modulanti e loro usi
AU2017266929A AU2017266929B2 (en) 2016-05-18 2017-05-18 Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
JP2018560868A JP7194594B2 (ja) 2016-05-18 2017-05-18 免疫調節ポリペプチドをコードするmRNAの組み合わせ及びその使用
KR1020187036733A KR102482867B1 (ko) 2016-05-18 2017-05-18 면역 조정 폴리펩타이드를 암호화하는 mRNA의 조합물 및 이의 용도
HRP20221135TT HRP20221135T8 (hr) 2016-05-18 2017-05-18 KOMBINACIJE mRNK KOJE KODIRAJU IMUNOMODULIRAJUĆE POLIPEPTIDE I NJIHOVE UPOTREBE
RS20220929A RS63625B1 (sr) 2016-05-18 2017-05-18 Kombinacije irnk koje kodiraju imunomodulirajuće polipeptide i njihova upotreba
CA3024917A CA3024917A1 (en) 2016-05-18 2017-05-18 Combinations of mrnas encoding immune modulating polypeptides and uses thereof
SI201731226T SI3458474T1 (sl) 2016-05-18 2017-05-18 Kombinacije MRNK, ki kodirajo imunomodulirne polipeptide, in njihova uporaba
PL17727999.9T PL3458474T3 (pl) 2016-05-18 2017-05-18 Kombinacje mrna kodujących polipeptydy immunomodulujące i ich zastosowania
MA45035A MA45035B1 (fr) 2016-05-18 2017-05-18 Combinaisons d'arnm codant pour des polypeptides de modulation immunitaire et leurs utilisations
US15/995,889 US10172808B2 (en) 2016-05-18 2018-06-01 Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US16/184,282 US10322090B2 (en) 2016-05-18 2018-11-08 Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US16/219,418 US10322091B2 (en) 2016-05-18 2018-12-13 Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US16/222,155 US10406113B2 (en) 2016-05-18 2018-12-17 Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US16/227,810 US10285950B2 (en) 2016-05-18 2018-12-20 Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US16/543,102 US11185510B2 (en) 2016-05-18 2019-08-16 Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US17/071,685 US11071716B2 (en) 2016-05-18 2020-10-15 Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US17/352,904 US11344504B1 (en) 2016-05-18 2021-06-21 Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US17/826,387 US20230041964A1 (en) 2016-05-18 2022-05-27 Combinations of mrnas encoding immune modulating polypeptides and uses thereof
US17/930,369 US11596609B2 (en) 2016-05-18 2022-09-07 Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
JP2022197763A JP7586883B2 (ja) 2016-05-18 2022-12-12 免疫調節ポリペプチドをコードするmRNAの組み合わせ及びその使用
AU2023210606A AU2023210606A1 (en) 2016-05-18 2023-08-03 Combinations of mRNAs encoding immune modulating polypeptides and uses thereof

Applications Claiming Priority (24)

Application Number Priority Date Filing Date Title
US201662338496P 2016-05-18 2016-05-18
US201662338506P 2016-05-18 2016-05-18
US201662338483P 2016-05-18 2016-05-18
US201662338467P 2016-05-18 2016-05-18
US62/338,467 2016-05-18
US62/338,483 2016-05-18
US62/338,506 2016-05-18
US62/338,496 2016-05-18
US201662404173P 2016-10-04 2016-10-04
US201662404175P 2016-10-04 2016-10-04
US62/404,175 2016-10-04
US62/404,173 2016-10-04
US201662415424P 2016-10-31 2016-10-31
US62/415,424 2016-10-31
US201662438942P 2016-12-23 2016-12-23
US201662438945P 2016-12-23 2016-12-23
US62/438,942 2016-12-23
US62/438,945 2016-12-23
US201762443693P 2017-01-07 2017-01-07
US62/443,693 2017-01-07
US201762472513P 2017-03-16 2017-03-16
US62/472,513 2017-03-16
US201762480400P 2017-04-01 2017-04-01
US62/480,400 2017-04-01

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US15/995,889 Continuation US10172808B2 (en) 2016-05-18 2018-06-01 Combinations of mRNAs encoding immune modulating polypeptides and uses thereof

Publications (2)

Publication Number Publication Date
WO2017201325A1 true WO2017201325A1 (en) 2017-11-23
WO2017201325A8 WO2017201325A8 (en) 2018-08-30

Family

ID=59009786

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2017/033395 Ceased WO2017201325A1 (en) 2016-05-18 2017-05-18 Combinations of mrnas encoding immune modulating polypeptides and uses thereof

Country Status (19)

Country Link
US (10) US10172808B2 (https=)
EP (2) EP3458474B1 (https=)
JP (2) JP7194594B2 (https=)
KR (2) KR102482867B1 (https=)
CN (2) CN116726203A (https=)
AU (2) AU2017266929B2 (https=)
CA (1) CA3024917A1 (https=)
DK (1) DK3458474T3 (https=)
ES (1) ES2932516T3 (https=)
HR (1) HRP20221135T8 (https=)
HU (1) HUE059955T2 (https=)
LT (1) LT3458474T (https=)
MA (1) MA45035B1 (https=)
PL (1) PL3458474T3 (https=)
PT (1) PT3458474T (https=)
RS (1) RS63625B1 (https=)
SI (1) SI3458474T1 (https=)
SM (1) SMT202300003T1 (https=)
WO (1) WO2017201325A1 (https=)

Cited By (61)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018170306A1 (en) * 2017-03-15 2018-09-20 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US10143723B2 (en) 2015-12-23 2018-12-04 Modernatx, Inc. Methods of using OX40 ligand encoding polynucleotides
US10195156B2 (en) 2015-12-22 2019-02-05 Modernatx, Inc. Compounds and compositions for intracellular delivery of agents
WO2019067464A1 (en) * 2017-09-27 2019-04-04 The Board Of Trustees Of The Leland Stanford Junior University THERAPEUTIC AGENTS SPECIALLY ADMINISTERED BY EXOSOMES FOR THE TREATMENT OF CANCER
US10266485B2 (en) 2015-09-17 2019-04-23 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US10285950B2 (en) 2016-05-18 2019-05-14 Modernatx, Inc. Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US10323076B2 (en) 2013-10-03 2019-06-18 Modernatx, Inc. Polynucleotides encoding low density lipoprotein receptor
US10335486B2 (en) 2016-05-18 2019-07-02 Modernatx, Inc. MRNA combination therapy for the treatment of cancer
WO2019143910A1 (en) * 2018-01-22 2019-07-25 Modernatx, Inc. Multimeric polynucleotides and uses thereof
CN110055275A (zh) * 2018-01-19 2019-07-26 科济生物医药(上海)有限公司 一种质粒载体对、其修饰的免疫细胞及其应用
WO2020056304A1 (en) * 2018-09-14 2020-03-19 Modernatx, Inc. Methods and compositions for treating cancer using mrna therapeutics
WO2020097409A3 (en) * 2018-11-08 2020-07-30 Modernatx, Inc. Use of mrna encoding ox40l to treat cancer in human patients
WO2020198338A1 (en) * 2019-03-25 2020-10-01 Ohio State Innovation Foundation Combination immunoregulation and uses thereof
CN111954535A (zh) * 2018-02-19 2020-11-17 联合治疗公司 用于编码核糖核酸的器官保护性表达和调节的组合物和方法
WO2021072172A1 (en) * 2019-10-09 2021-04-15 Translate Bio, Inc. Compositions, methods and uses of messenger rna
WO2021076811A1 (en) 2019-10-15 2021-04-22 Moderna TX, Inc. Mrnas encoding granulocyte-macrophage colony stimulating factor for treating parkinson's disease
US11066355B2 (en) 2019-09-19 2021-07-20 Modernatx, Inc. Branched tail lipid compounds and compositions for intracellular delivery of therapeutic agents
WO2021231854A1 (en) 2020-05-14 2021-11-18 Modernatx, Inc. Lnp compositions comprising an mrna therapeutic and an effector molecule
US11203569B2 (en) 2017-03-15 2021-12-21 Modernatx, Inc. Crystal forms of amino lipids
WO2021262909A2 (en) 2020-06-23 2021-12-30 Modernatx, Inc. Lnp compositions comprising mrna therapeutics with extended half-life
JP2022534498A (ja) * 2019-05-29 2022-08-01 オービス ヘルス ソリューションズ エルエルシー キメラ受容体を発現させるための送達ベクターおよび粒子ならびにその使用方法
WO2022174079A1 (en) 2021-02-12 2022-08-18 Modernatx, Inc. Lnp compositions comprising payloads for in vivo therapy
WO2022204380A1 (en) 2021-03-24 2022-09-29 Modernatx, Inc. Lipid nanoparticles containing polynucleotides encoding propionyl-coa carboxylase alpha and beta subunits and uses thereof
WO2022204369A1 (en) 2021-03-24 2022-09-29 Modernatx, Inc. Polynucleotides encoding methylmalonyl-coa mutase for the treatment of methylmalonic acidemia
WO2022204371A1 (en) 2021-03-24 2022-09-29 Modernatx, Inc. Lipid nanoparticles containing polynucleotides encoding glucose-6-phosphatase and uses thereof
WO2022204390A1 (en) 2021-03-24 2022-09-29 Modernatx, Inc. Lipid nanoparticles containing polynucleotides encoding phenylalanine hydroxylase and uses thereof
WO2022204370A1 (en) 2021-03-24 2022-09-29 Modernatx, Inc. Lipid nanoparticles and polynucleotides encoding ornithine transcarbamylase for the treatment of ornithine transcarbamylase deficiency
WO2022266083A2 (en) 2021-06-15 2022-12-22 Modernatx, Inc. Engineered polynucleotides for cell-type or microenvironment-specific expression
WO2022271776A1 (en) 2021-06-22 2022-12-29 Modernatx, Inc. Polynucleotides encoding uridine diphosphate glycosyltransferase 1 family, polypeptide a1 for the treatment of crigler-najjar syndrome
US11583504B2 (en) 2016-11-08 2023-02-21 Modernatx, Inc. Stabilized formulations of lipid nanoparticles
WO2023031394A1 (en) 2021-09-03 2023-03-09 CureVac SE Novel lipid nanoparticles for delivery of nucleic acids
WO2023056044A1 (en) 2021-10-01 2023-04-06 Modernatx, Inc. Polynucleotides encoding relaxin for the treatment of fibrosis and/or cardiovascular disease
WO2023073228A1 (en) 2021-10-29 2023-05-04 CureVac SE Improved circular rna for expressing therapeutic proteins
WO2023077170A1 (en) 2021-11-01 2023-05-04 Modernatx, Inc. Polynucleotides encoding integrin beta-6 and methods of use thereof
WO2023144330A1 (en) 2022-01-28 2023-08-03 CureVac SE Nucleic acid encoded transcription factor inhibitors
WO2023159197A1 (en) 2022-02-18 2023-08-24 Modernatx, Inc. Mrnas encoding checkpoint cancer vaccines and uses thereof
WO2023183909A2 (en) 2022-03-25 2023-09-28 Modernatx, Inc. Polynucleotides encoding fanconi anemia, complementation group proteins for the treatment of fanconi anemia
CN116829578A (zh) * 2021-10-08 2023-09-29 苏州艾博生物科技有限公司 编码白细胞介素-12(il-12)的多核苷酸以及其相关组合物和方法
WO2023196399A1 (en) 2022-04-06 2023-10-12 Modernatx, Inc. Lipid nanoparticles and polynucleotides encoding argininosuccinate lyase for the treatment of argininosuccinic aciduria
US11793843B2 (en) 2019-01-10 2023-10-24 Janssen Biotech, Inc. Prostate neoantigens and their uses
WO2023227608A1 (en) 2022-05-25 2023-11-30 Glaxosmithkline Biologicals Sa Nucleic acid based vaccine encoding an escherichia coli fimh antigenic polypeptide
WO2023246840A1 (en) * 2022-06-22 2023-12-28 Wuhan Houxian Biopharmaceutical Co. Ltd. Combination of il-12 and ox40l for cancer immunotherapy
WO2024015724A1 (en) * 2022-07-10 2024-01-18 Precigen, Inc. POLYCISTRONIC miRNA CONSTRUCTS FOR IMMUNE CHECKPOINT INHIBITION
WO2024026254A1 (en) 2022-07-26 2024-02-01 Modernatx, Inc. Engineered polynucleotides for temporal control of expression
DE202023106198U1 (de) 2022-10-28 2024-03-21 CureVac SE Impfstoff auf Nukleinsäurebasis
US11969506B2 (en) 2017-03-15 2024-04-30 Modernatx, Inc. Lipid nanoparticle formulation
WO2024130158A1 (en) 2022-12-16 2024-06-20 Modernatx, Inc. Lipid nanoparticles and polynucleotides encoding extended serum half-life interleukin-22 for the treatment of metabolic disease
US12018289B2 (en) 2019-11-18 2024-06-25 Janssen Biotech, Inc. Vaccines based on mutant CALR and JAK2 and their uses
US12042527B2 (en) 2019-01-08 2024-07-23 Modernatx, Inc. Use of mRNAs encoding OX40L, IL-23 and IL-36gamma in combination with immune checkpoint blockade for treating particular cancers
US12077501B2 (en) 2017-06-14 2024-09-03 Modernatx, Inc. Compounds and compositions for intracellular delivery of agents
WO2024182301A2 (en) 2023-02-27 2024-09-06 Modernatx, Inc. Lipid nanoparticles and polynucleotides encoding galactose-1-phosphate uridylyltransferase (galt) for the treatment of galactosemia
WO2024184500A1 (en) 2023-03-08 2024-09-12 CureVac SE Novel lipid nanoparticle formulations for delivery of nucleic acids
WO2024206329A1 (en) 2023-03-27 2024-10-03 Modernatx, Inc. Nucleic acid molecules encoding bi-specific secreted engagers and uses thereof
WO2024229321A1 (en) 2023-05-03 2024-11-07 Modernatx, Inc. Polynucleotides encoding cystic fibrosis transmembrane conductance regulator for the treatment of cystic fibrosis
WO2024230934A1 (en) 2023-05-11 2024-11-14 CureVac SE Therapeutic nucleic acid for the treatment of ophthalmic diseases
US12263248B2 (en) 2018-09-19 2025-04-01 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US12295997B2 (en) 2020-07-06 2025-05-13 Janssen Biotech, Inc. Prostate neoantigens and their uses
WO2025184429A1 (en) 2024-02-28 2025-09-04 Modernatx, Inc. Bromodomain and extra-terminal domain (bet) epigenetic reader decoy
WO2025255199A1 (en) 2024-06-05 2025-12-11 Modernatx, Inc. Argininosuccinate synthase 1 and argininosuccinate lyase polypeptides and polynucleotides and uses thereof
WO2026025031A1 (en) 2024-07-26 2026-01-29 Modernatx, Inc. Mrna encoding mageb2 tcer molecule
US12595226B2 (en) 2019-09-19 2026-04-07 Modernatx, Inc. Carbonate containing lipid compounds and compositions for intracellular delivery of therapeutic agents

Families Citing this family (26)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017223176A1 (en) 2016-06-24 2017-12-28 Modernatx, Inc. Methods and apparatus for filtration
AU2018367452B2 (en) 2017-11-14 2024-06-13 Memorial Sloan-Kettering Cancer Center IL-36 secreting immunoresponsive cells and uses thereof
US20240108747A1 (en) * 2019-03-21 2024-04-04 Lonza Sales Ag Extracellular vesicle conjugates and uses thereof
MX2022000541A (es) 2019-07-12 2022-04-18 Univ Oregon Health & Science Construcciones terapeuticas para la administracion conjunta de un inhibidor de la quinasa mitotica y un inhibidor de puntos de control inmunitario.
US20220249389A1 (en) 2019-07-12 2022-08-11 Oregon Health & Science University Immunotherapeutic constructs and methods of their use
EP4031165A4 (en) * 2019-09-20 2023-10-11 University of Pittsburgh - Of the Commonwealth System of Higher Education ONCOLYTIC VIRUSES EXPRESSING IL-36 CYTOKINE FOR THE TREATMENT OF CANCER
WO2021204175A1 (en) 2020-04-09 2021-10-14 Suzhou Abogen Biosciences Co., Ltd. Lipid nanoparticle composition
EP4132576A1 (en) 2020-04-09 2023-02-15 Suzhou Abogen Biosciences Co., Ltd. Nucleic acid vaccines for coronavirus
EP4157319A1 (en) * 2020-05-28 2023-04-05 Modernatx, Inc. Use of mrnas encoding ox40l, il-23 and il-36gamma for treating cancer
US11611540B2 (en) * 2020-07-01 2023-03-21 Vmware, Inc. Protection of authentication data of a server cluster
CN111931428B (zh) * 2020-07-06 2023-06-20 武汉第二船舶设计研究所(中国船舶重工集团公司第七一九研究所) 一种用于优化海洋核动力平台的方法及系统
CN114073677B (zh) * 2020-08-20 2023-06-09 深圳深信生物科技有限公司 一种脂质纳米颗粒
CN112516378B (zh) * 2020-12-02 2022-02-11 浙江工业大学 一种植酸/丝素蛋白/煅烧白云石骨粘合剂的制备方法
WO2022120560A1 (zh) * 2020-12-08 2022-06-16 深圳市瑞吉生物科技有限公司 一种mRNA剂型的免疫抑制剂及其在制备肿瘤治疗药物中的应用
CA3208643A1 (en) 2021-01-18 2022-07-21 Conserv Bioscience Limited Coronavirus immunogenic compositions, methods and uses thereof
AU2022291742A1 (en) * 2021-06-14 2023-12-21 Generation Bio Co. Cationic lipids and compositions thereof
CN115611757A (zh) * 2021-07-16 2023-01-17 江苏慧聚药业股份有限公司 mRNA传递剂的合成
CN115703713B (zh) * 2021-08-13 2025-06-10 广州谷森制药有限公司 阳离子脂质化合物
CN114231624A (zh) * 2021-10-28 2022-03-25 苏州大学附属第一医院 一种环状非编码rna在肾癌骨转移早期诊断及治疗中的应用
NL2030022B1 (en) 2021-12-03 2023-06-21 Wisdom Pharmaceutical Co Ltd SYNTHESIS OF mRNA TRANSMITTER
CN115304756B (zh) * 2022-01-30 2023-05-09 上海科技大学 一种五元脂质纳米颗粒及其制备方法和应用
IL319596A (en) * 2022-09-22 2025-05-01 Univ Texas Novel secretory signal peptides
CN115869332A (zh) * 2022-10-27 2023-03-31 北京新合睿恩生物医疗科技有限公司 递送至体内后在肝脏少表达的mRNA药物及其制备方法
CN115671045B (zh) * 2022-12-30 2023-04-07 华南理工大学 非肝靶向的核酸纳米制剂及其制备方法和应用
CN119101681A (zh) * 2023-06-09 2024-12-10 仁景(苏州)生物科技有限公司 表达可调控的工程化rna分子
WO2025231407A1 (en) * 2024-05-03 2025-11-06 Nutech Ventures Lipid nanoparticles and methods of making and using

Citations (46)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5082767A (en) 1989-02-27 1992-01-21 Hatfield G Wesley Codon pair utilization
US5681702A (en) 1994-08-30 1997-10-28 Chiron Corporation Reduction of nonspecific hybridization by using novel base-pairing schemes
WO2000018778A1 (en) 1998-09-29 2000-04-06 Phylos, Inc. Synthesis of codon randomized nucleic acids
US6617106B1 (en) 1990-10-09 2003-09-09 Steven Albert Benner Methods for preparing oligonucleotides containing non-standard nucleotides
US20050032730A1 (en) 2001-06-05 2005-02-10 Florian Von Der Mulbe Pharmaceutical composition containing a stabilised mRNA optimised for translation in its coding regions
US6984720B1 (en) 1999-08-24 2006-01-10 Medarex, Inc. Human CTLA-4 antibodies
US20070117112A1 (en) 2005-06-30 2007-05-24 Diener John L Materials and methods for the generation of fully 2'-modified nucleic acid transcripts
WO2007113648A2 (en) 2006-04-05 2007-10-11 Pfizer Products Inc. Ctla4 antibody combination therapy
US20080046192A1 (en) 2006-08-16 2008-02-21 Richard Lathrop Polypepetide-encoding nucleotide sequences with refined translational kinetics and methods of making same
US20080076161A1 (en) 2002-04-01 2008-03-27 The Government Of The United States, As Represented By The Secretary Of The Army Method of designing synthetic nucleic acid sequences for optimal protein expression in a host cell
US7378262B2 (en) 2001-12-03 2008-05-27 Roche Molecular Systems, Inc. Reversibly modified thermostable enzymes for DNA synthesis and amplification in vitro
US7384739B2 (en) 2001-11-14 2008-06-10 Toyo Boseki Kabushiki Kaisha Compositions for enhancing DNA synthesis, DNA polymerase-related factors and utilization thereof
WO2008078180A2 (en) 2006-12-22 2008-07-03 Archemix Corp. Materials and methods for the generation of transcripts comprising modified nucleotides
US7550264B2 (en) 2005-06-10 2009-06-23 Datascope Investment Corporation Methods and kits for sense RNA synthesis
US7561973B1 (en) 2008-07-31 2009-07-14 Dna Twopointo, Inc. Methods for determining properties that affect an expression property value of polynucleotides in an expression system
US20090226470A1 (en) 2007-12-11 2009-09-10 Mauro Vincent P Compositions and methods related to mRNA translational enhancer elements
US20100120024A1 (en) 2005-06-30 2010-05-13 Sharon Cload Materials and methods for the generation of transcripts comprising modified nucleotides
US20100129877A1 (en) 2005-09-28 2010-05-27 Ugur Sahin Modification of RNA, Producing an Increased Transcript Stability and Translation Efficiency
US20100293625A1 (en) 2007-09-26 2010-11-18 Interexon Corporation Synthetic 5'UTRs, Expression Vectors, and Methods for Increasing Transgene Expression
US20110082055A1 (en) 2009-09-18 2011-04-07 Codexis, Inc. Reduced codon mutagenesis
US7943743B2 (en) 2005-07-01 2011-05-17 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (PD-L1)
US8008449B2 (en) 2005-05-09 2011-08-30 Medarex, Inc. Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics
US8126653B2 (en) 2008-07-31 2012-02-28 Dna Twopointo, Inc. Synthetic nucleic acids for expression of encoded proteins
US8217149B2 (en) 2008-12-09 2012-07-10 Genentech, Inc. Anti-PD-L1 antibodies, compositions and articles of manufacture
WO2012122444A1 (en) 2011-03-10 2012-09-13 Provectus Pharmaceuticals, Inc. Combination of local and systemic immunomodulative therapies for enhanced treatment of cancer
US20120251618A1 (en) 2011-03-31 2012-10-04 modeRNA Therapeutics Delivery and formulation of engineered nucleic acids
US20130017199A1 (en) 2009-11-24 2013-01-17 AMPLIMMUNE ,Inc. a corporation Simultaneous inhibition of pd-l1/pd-l2
US8367328B2 (en) 1998-04-23 2013-02-05 Takara Bio Inc. Method for synthesizing DNA
US8401798B2 (en) 2008-06-06 2013-03-19 Dna Twopointo, Inc. Systems and methods for constructing frequency lookup tables for expression systems
WO2013039857A1 (en) 2011-09-12 2013-03-21 modeRNA Therapeutics Engineered nucleic acids and methods of use thereof
WO2013052523A1 (en) 2011-10-03 2013-04-11 modeRNA Therapeutics Modified nucleosides, nucleotides, and nucleic acids, and uses thereof
WO2013053775A1 (en) * 2011-10-11 2013-04-18 Universität Zürich Prorektorat Mnw Combination medicament comprising il-12 and an agent for blockade of t-cell inhibitory molecules for tumour therapy
US20130183718A1 (en) 2010-09-21 2013-07-18 RibpxX GmbH Method for Synthesizing RNA using DNA Template
US20130195759A1 (en) 2008-04-25 2013-08-01 Northwestern University Nanostructures suitable for sequestering cholesterol and other molecules
US8519110B2 (en) 2008-06-06 2013-08-27 Board Of Supervisors Of Louisiana State University And Agricultural And Mechanical College mRNA cap analogs
US20130259923A1 (en) 2012-04-02 2013-10-03 modeRNA Therapeutics Modified polynucleotides for the production of secreted proteins
WO2013173223A1 (en) 2012-05-15 2013-11-21 Bristol-Myers Squibb Company Cancer immunotherapy by disrupting pd-1/pd-l1 signaling
US8609089B2 (en) 2008-08-25 2013-12-17 Amplimmune, Inc. Compositions of PD-1 antagonists and methods of use
WO2014028429A2 (en) 2012-08-14 2014-02-20 Moderna Therapeutics, Inc. Enzymes and polymerases for the synthesis of rna
WO2014093924A1 (en) 2012-12-13 2014-06-19 Moderna Therapeutics, Inc. Modified nucleic acid molecules and uses thereof
US20140228558A1 (en) 2002-12-23 2014-08-14 Geneart Ag Method and device for optimizing a nucelotide sequence for the purpose of expression in a protein
WO2014164253A1 (en) 2013-03-09 2014-10-09 Moderna Therapeutics, Inc. Heterologous untranslated regions for mrna
US20140341917A1 (en) 2011-11-28 2014-11-20 Merck Patent Gmbh Anti-pd-l1 antibodies and uses thereof
US8900587B2 (en) 2007-06-18 2014-12-02 Merck Sharp & Dohme Corp. Antibodies to human programmed death receptor PD-1
WO2015034925A1 (en) 2013-09-03 2015-03-12 Moderna Therapeutics, Inc. Circular polynucleotides
US20150079109A1 (en) 2013-09-13 2015-03-19 Beigene, Ltd. Anti-PD1 Antibodies and their Use as Therapeutics and Diagnostics

Family Cites Families (12)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE102004042546A1 (de) 2004-09-02 2006-03-09 Curevac Gmbh Kombinationstherapie zur Immunstimulation
KR101867606B1 (ko) * 2007-11-07 2018-06-18 제넨테크, 인크. 미생물 질환의 치료를 위한 조성물 및 방법
CA2721333C (en) * 2008-04-15 2020-12-01 Protiva Biotherapeutics, Inc. Novel lipid formulations for nucleic acid delivery
EP3466443B1 (en) 2012-02-14 2020-12-16 Boehringer Ingelheim Animal Health USA Inc. Recombinant poxviral vectors expressing both rabies and ox40 proteins, and vaccines made therefrom
AU2013374345A1 (en) 2013-01-17 2015-08-06 Moderna Therapeutics, Inc. Signal-sensor polynucleotides for the alteration of cellular phenotypes
WO2015095423A2 (en) 2013-12-17 2015-06-25 Genentech, Inc. Combination therapy comprising ox40 binding agonists and pd-1 axis binding antagonists
PL4023249T3 (pl) * 2014-04-23 2025-03-10 Modernatx, Inc. Szczepionki z kwasem nukleinowym
EP3137105A4 (en) * 2014-04-30 2017-12-27 President and Fellows of Harvard College Combination vaccine devices and methods of killing cancer cells
CN108064176A (zh) 2015-04-22 2018-05-22 库瑞瓦格股份公司 用于治疗肿瘤疾病的含有rna的组合物
JP2019519516A (ja) 2016-05-18 2019-07-11 モデルナティーエックス, インコーポレイテッド がんの治療のためのmRNA併用療法
JP7194594B2 (ja) * 2016-05-18 2022-12-22 モデルナティエックス インコーポレイテッド 免疫調節ポリペプチドをコードするmRNAの組み合わせ及びその使用
KR102019331B1 (ko) 2017-07-05 2019-09-09 한국과학기술연구원 모노포스포릴 지질 a를 구성적으로 생산하는 세균, 및 이를 이용한 모노포스포릴 지질 a 생산 방법

Patent Citations (59)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5082767A (en) 1989-02-27 1992-01-21 Hatfield G Wesley Codon pair utilization
US6617106B1 (en) 1990-10-09 2003-09-09 Steven Albert Benner Methods for preparing oligonucleotides containing non-standard nucleotides
US5681702A (en) 1994-08-30 1997-10-28 Chiron Corporation Reduction of nonspecific hybridization by using novel base-pairing schemes
US5780610A (en) 1994-08-30 1998-07-14 Collins; Mark L. Reduction of nonspecific hybridization by using novel base-pairing schemes
US8367328B2 (en) 1998-04-23 2013-02-05 Takara Bio Inc. Method for synthesizing DNA
WO2000018778A1 (en) 1998-09-29 2000-04-06 Phylos, Inc. Synthesis of codon randomized nucleic acids
US6984720B1 (en) 1999-08-24 2006-01-10 Medarex, Inc. Human CTLA-4 antibodies
US20050032730A1 (en) 2001-06-05 2005-02-10 Florian Von Der Mulbe Pharmaceutical composition containing a stabilised mRNA optimised for translation in its coding regions
US7384739B2 (en) 2001-11-14 2008-06-10 Toyo Boseki Kabushiki Kaisha Compositions for enhancing DNA synthesis, DNA polymerase-related factors and utilization thereof
US7378262B2 (en) 2001-12-03 2008-05-27 Roche Molecular Systems, Inc. Reversibly modified thermostable enzymes for DNA synthesis and amplification in vitro
US20080076161A1 (en) 2002-04-01 2008-03-27 The Government Of The United States, As Represented By The Secretary Of The Army Method of designing synthetic nucleic acid sequences for optimal protein expression in a host cell
US20140228558A1 (en) 2002-12-23 2014-08-14 Geneart Ag Method and device for optimizing a nucelotide sequence for the purpose of expression in a protein
US8008449B2 (en) 2005-05-09 2011-08-30 Medarex, Inc. Human monoclonal antibodies to programmed death 1 (PD-1) and methods for treating cancer using anti-PD-1 antibodies alone or in combination with other immunotherapeutics
US7550264B2 (en) 2005-06-10 2009-06-23 Datascope Investment Corporation Methods and kits for sense RNA synthesis
US20070117112A1 (en) 2005-06-30 2007-05-24 Diener John L Materials and methods for the generation of fully 2'-modified nucleic acid transcripts
US8101385B2 (en) 2005-06-30 2012-01-24 Archemix Corp. Materials and methods for the generation of transcripts comprising modified nucleotides
US20100120024A1 (en) 2005-06-30 2010-05-13 Sharon Cload Materials and methods for the generation of transcripts comprising modified nucleotides
US7943743B2 (en) 2005-07-01 2011-05-17 Medarex, Inc. Human monoclonal antibodies to programmed death ligand 1 (PD-L1)
US20100129877A1 (en) 2005-09-28 2010-05-27 Ugur Sahin Modification of RNA, Producing an Increased Transcript Stability and Translation Efficiency
WO2007113648A2 (en) 2006-04-05 2007-10-11 Pfizer Products Inc. Ctla4 antibody combination therapy
US20080046192A1 (en) 2006-08-16 2008-02-21 Richard Lathrop Polypepetide-encoding nucleotide sequences with refined translational kinetics and methods of making same
WO2008078180A2 (en) 2006-12-22 2008-07-03 Archemix Corp. Materials and methods for the generation of transcripts comprising modified nucleotides
US8900587B2 (en) 2007-06-18 2014-12-02 Merck Sharp & Dohme Corp. Antibodies to human programmed death receptor PD-1
US20100293625A1 (en) 2007-09-26 2010-11-18 Interexon Corporation Synthetic 5'UTRs, Expression Vectors, and Methods for Increasing Transgene Expression
US20090226470A1 (en) 2007-12-11 2009-09-10 Mauro Vincent P Compositions and methods related to mRNA translational enhancer elements
US20130195759A1 (en) 2008-04-25 2013-08-01 Northwestern University Nanostructures suitable for sequestering cholesterol and other molecules
US8401798B2 (en) 2008-06-06 2013-03-19 Dna Twopointo, Inc. Systems and methods for constructing frequency lookup tables for expression systems
US8519110B2 (en) 2008-06-06 2013-08-27 Board Of Supervisors Of Louisiana State University And Agricultural And Mechanical College mRNA cap analogs
US7561973B1 (en) 2008-07-31 2009-07-14 Dna Twopointo, Inc. Methods for determining properties that affect an expression property value of polynucleotides in an expression system
US8126653B2 (en) 2008-07-31 2012-02-28 Dna Twopointo, Inc. Synthetic nucleic acids for expression of encoded proteins
US8609089B2 (en) 2008-08-25 2013-12-17 Amplimmune, Inc. Compositions of PD-1 antagonists and methods of use
US8217149B2 (en) 2008-12-09 2012-07-10 Genentech, Inc. Anti-PD-L1 antibodies, compositions and articles of manufacture
US20110082055A1 (en) 2009-09-18 2011-04-07 Codexis, Inc. Reduced codon mutagenesis
US20130017199A1 (en) 2009-11-24 2013-01-17 AMPLIMMUNE ,Inc. a corporation Simultaneous inhibition of pd-l1/pd-l2
US20130183718A1 (en) 2010-09-21 2013-07-18 RibpxX GmbH Method for Synthesizing RNA using DNA Template
US20120263677A1 (en) 2011-03-10 2012-10-18 Provectus Pharmaceuticals, Inc. Combination of Local and Systemic Immunomodulative Therapies for Enhanced Treatment of Cancer
WO2012122444A1 (en) 2011-03-10 2012-09-13 Provectus Pharmaceuticals, Inc. Combination of local and systemic immunomodulative therapies for enhanced treatment of cancer
US20120251618A1 (en) 2011-03-31 2012-10-04 modeRNA Therapeutics Delivery and formulation of engineered nucleic acids
US8710200B2 (en) 2011-03-31 2014-04-29 Moderna Therapeutics, Inc. Engineered nucleic acids encoding a modified erythropoietin and their expression
WO2012135805A2 (en) 2011-03-31 2012-10-04 modeRNA Therapeutics Delivery and formulation of engineered nucleic acids
WO2013039857A1 (en) 2011-09-12 2013-03-21 modeRNA Therapeutics Engineered nucleic acids and methods of use thereof
WO2013052523A1 (en) 2011-10-03 2013-04-11 modeRNA Therapeutics Modified nucleosides, nucleotides, and nucleic acids, and uses thereof
US20130115272A1 (en) 2011-10-03 2013-05-09 modeRNA Therapeutics Modified nucleosides, nucleotides, and nucleic acids, and uses thereof
WO2013053775A1 (en) * 2011-10-11 2013-04-18 Universität Zürich Prorektorat Mnw Combination medicament comprising il-12 and an agent for blockade of t-cell inhibitory molecules for tumour therapy
US20140341917A1 (en) 2011-11-28 2014-11-20 Merck Patent Gmbh Anti-pd-l1 antibodies and uses thereof
US20130259923A1 (en) 2012-04-02 2013-10-03 modeRNA Therapeutics Modified polynucleotides for the production of secreted proteins
WO2013151671A1 (en) 2012-04-02 2013-10-10 modeRNA Therapeutics Modified polynucleotides for the production of cosmetic proteins and peptides
US8999380B2 (en) 2012-04-02 2015-04-07 Moderna Therapeutics, Inc. Modified polynucleotides for the production of biologics and proteins associated with human disease
US20150044277A1 (en) 2012-04-02 2015-02-12 Moderna Therapeutics, Inc. Modified polynucleotides encoding caspase 3
WO2013173223A1 (en) 2012-05-15 2013-11-21 Bristol-Myers Squibb Company Cancer immunotherapy by disrupting pd-1/pd-l1 signaling
WO2014028429A2 (en) 2012-08-14 2014-02-20 Moderna Therapeutics, Inc. Enzymes and polymerases for the synthesis of rna
US20150211039A1 (en) 2012-08-14 2015-07-30 Moderna Therapeutics, Inc. Enzymes and polymerases for the synthesis of rna
US20150307542A1 (en) 2012-10-03 2015-10-29 Moderna Therapeutics, Inc. Modified nucleic acid molecules and uses thereof
WO2014093924A1 (en) 2012-12-13 2014-06-19 Moderna Therapeutics, Inc. Modified nucleic acid molecules and uses thereof
WO2014164253A1 (en) 2013-03-09 2014-10-09 Moderna Therapeutics, Inc. Heterologous untranslated regions for mrna
US20160022840A1 (en) 2013-03-09 2016-01-28 Moderna Therapeutics, Inc. Heterologous untranslated regions for mrna
WO2015034925A1 (en) 2013-09-03 2015-03-12 Moderna Therapeutics, Inc. Circular polynucleotides
US20160194368A1 (en) 2013-09-03 2016-07-07 Moderna Therapeutics, Inc. Circular polynucleotides
US20150079109A1 (en) 2013-09-13 2015-03-19 Beigene, Ltd. Anti-PD1 Antibodies and their Use as Therapeutics and Diagnostics

Non-Patent Citations (105)

* Cited by examiner, † Cited by third party
Title
"Bioreversible Carriers in Drug Design", 1987, AMERICAN PHARMACEUTICAL ASSOCIATION AND PERGAMON PRESS
"Pharmaceutical Salts: Properties, Selection, and Use", 2008, WILEY-VCH
"Remington: The Science and Practice of Pharmacy", 2005, LIPPINCOTT WILLIAMS & WILKINS
"Remington's Pharmaceutical Sciences", 1985, MACK PUBLISHING COMPANY, pages: 1418
"The Dictionary of Cell and Molecular Biology", 1999, ACADEMIC PRESS
"the Oxford Dictionary Of Biochemistry And Molecular Biology", 2000, OXFORD UNIVERSITY PRESS
AKINC ET AL., MOL THER., vol. 17, 2009, pages 872 - 879
AKINC ET AL., NAT BIOTECHNOL., vol. 26, 2008, pages 561 - 569
ALEXOPOULOU ET AL., NATURE, vol. 413, 2001, pages 732 - 738
BELLADONNA ET AL., J. IMMUNOL, vol. 168, 2002, pages 5448 - 5454
BERGE ET AL., JOURNAL OF PHARMACEUTICAL SCIENCE, vol. 66, 1977, pages 1 - 19
CHENG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, 1994, pages 5695 - 5699
CHENG, ASCO, 2015
CHUNG ET AL., BMC SYSTEMS BIOLOGY, vol. 6, 2012, pages 134
COMERON; AGUADE, J. MOL. EVOL., vol. 47, 1998, pages 268 - 274
COMPTON, NATURE, vol. 350, 1991, pages 91 - 92
CROXFORD ET AL., EUR. J. IMMUNOL., vol. 42, 2012, pages 2263 - 2273
DAUBENDIEK ET AL., JACS, vol. 117, 1995, pages 7818 - 7819
DIEBOLD ET AL., EUR. J. IMMUNOL., vol. 36, 2006, pages 3256 - 3267
DIEBOLD ET AL., SCIENCE, vol. 303, 2004, pages 1529 - 1531
DINARELLO ET AL., FRONTIERS IN IMMUNOLOGY, vol. 4, 2013, pages 289
ESVELT ET AL., NATURE, vol. 472, 2011, pages 499 - 503
FOX; ERIL, DNA RES, vol. 17, no. 3, 2010, pages 185 - 196
FRANK-KAMENETSKY ET AL., PROC NATL ACAD SCI USA., vol. 105, 2008, pages 11915 - 11920
FREEMAN ET AL., BIOTECHNIQUES, vol. 26, no. 112-22, 1999, pages 124 - 125
GABAY ET AL., JOURNAL OF LEUKOCYTE BIOLOGY, vol. 97, 2015, pages 645 - 652
GAYONG SHIM ET AL: "Application of cationic liposomes for delivery of nucleic acids", ASIAN JOURNAL OF PHARMACEUTICAL SCIENCES, vol. 8, no. 2, 1 April 2013 (2013-04-01), pages 72 - 80, XP055198336, ISSN: 1818-0876, DOI: 10.1016/j.ajps.2013.07.009 *
GRESNIGT; VAN DE VEERDONK, SEMINARS IN IMMUNOLOGY, vol. 25, 2013, pages 458 - 465
GUSTAFSSON ET AL., JOURNAL/TRENDS BIOTECHNOL, vol. 22, 2004, pages 346 - 353
GUSTAFSSON ET AL., PROTEIN EXPRESSION AND PURIFICATION, vol. 83, 2012, pages 37 - 46
HARA I ET AL: "Effectiveness of cancer vaccine therapy using cells transduced with the interleukin-12 gene combined with systemic interleukin-18 administration", CANCER GENE THERAPY, APPLETON & LANGE, GB, vol. 7, no. 1, 1 January 2000 (2000-01-01), pages 83 - 90, XP002533119, ISSN: 0929-1903, DOI: 10.1038/SJ.CGT.7700083 *
HEIL ET AL., SCIENCE, vol. 303, 2004, pages 1526 - 1529
HEMMI ET AL., NATURE, vol. 408, 2000, pages 740 - 745
HERBST ET AL., J CLIN ONCOL, vol. 31, 2013, pages 3000
IGNACIO MELERO ET AL: "Evolving synergistic combinations of targeted immunotherapies to combat cancer", NATURE REVIEWS. CANCER, vol. 15, no. 8, 24 July 2015 (2015-07-24), GB, pages 457 - 472, XP055316136, ISSN: 1474-175X, DOI: 10.1038/nrc3973 *
IKEMURA, J. MOL. BIOL., vol. 151, no. 3, 1981, pages 389 - 409
INNIS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 9436 - 9440
ISMAIL M. MERAZ ET AL: "Adjuvant Cationic Liposomes Presenting MPL and IL-12 Induce Cell Death, Suppress Tumor Growth, and Alter the Cellular Phenotype of Tumors in a Murine Model of Breast Cancer", MOLECULAR PHARMACEUTICS, vol. 11, no. 10, 6 October 2014 (2014-10-06), US, pages 3484 - 3491, XP055388647, ISSN: 1543-8384, DOI: 10.1021/mp5002697 *
J. LEUKOC. BIOL, vol. 97, 2015, pages 665 - 675
JONATHAN M WEISS ET AL: "Immunotherapy of cancer by IL-12-based cytokine combinations", EXPERT OPINION ON BIOLOGICAL THERAPY, vol. 7, no. 11, 1 November 2007 (2007-11-01), pages 1705 - 1721, XP055007188, ISSN: 1471-2598, DOI: 10.1517/14712598.7.11.1705 *
JUO, PEI-SHOW: "Concise Dictionary of Biomedicine and Molecular Biology", 2002, CRC PRESS
KANG ET AL., CARCINOGENESIS, vol. 30, 2009, pages 1987 - 1986
KARIKO ET AL., IMMUNITY, vol. 23, 2005, pages 165 - 175
KHLEIF, PROCEEDINGS FROM THE EUROPEAN CANCER CONGRESS 2013, 27 September 2013 (2013-09-27)
KIM ET AL., NATURE, vol. 351, no. 6324, 1991, pages 331 - 332
KORE ET AL., BIOORGANIC & MEDICINAL CHEMISTRY, vol. 21, 2013, pages 4570 - 4574
KORMANN ET AL., NATURE BIOTECHNOLOGY, vol. 29, 2010, pages 154 - 157
LANGOWSKI ET AL., NATURE, vol. 442, 2006, pages 461 - 465
LANGOWSKI ET AL., TRENDS IMMUNOL., vol. 28, 2007, pages 207 - 212
LEACH ET AL., J. AM. CHEM. SOC, vol. 114, 1992, pages 3675 - 3683
LEUSCHNER ET AL., NAT BIOTECHNOL., vol. 29, 2011, pages 1005 - 1010
LI ET AL., CURRENT BIOLOGY, vol. 15, 2005, pages 1501 - 1507
LINCH S N ET AL: "OX40 agonists and combination immunotherapy: Putting the pedal to the metal", FRONTIERS IN ONCOLOGY, FRONTIERS RESEARCH FOUNDATION, CH, vol. 5, 16 February 2015 (2015-02-16), pages 1 - 14, XP002760409, ISSN: 2234-943X, [retrieved on 20150101], DOI: 10.3389/FONC.2015.00034 *
LIU; HUANG, MOLECULAR THERAPY., 2010, pages 669 - 670
LIZARDI ET AL., NATURE GENETICS, vol. 19, 1998, pages 225 - 232
LOVE ET AL., PROC NATL ACAD SCI USA., vol. 107, 2010, pages 1864 - 1869
LOVE ET AL., PROC. NATL. ACAD. SCI. USA, vol. 107, 2010, pages 1864 - 1869
MA ET AL., CLIN. CANCER RES., vol. 22, 2016, pages 2969 - 2680
MAHON ET AL., BIOCONJUG CHEM, vol. 21, 2010, pages 1448 - 1454
MANTSCH ET AL., BIOCHEM., vol. 14, 1993, pages 5593 - 5601
MARIO P COLOMBO ET AL: "Interleukin-12 in anti-tumor immunity and immunotherapy", CYTOKINE AND GROWTH FACTOR REVIEWS, vol. 13, no. 2, 1 April 2002 (2002-04-01), GB, pages 155 - 168, XP055389487, ISSN: 1359-6101, DOI: 10.1016/S1359-6101(01)00032-6 *
MATSUDA; MAURO, PLOS ONE, vol. 5, 2010, pages 11
MELLMAN ET AL., NATURE, vol. 480, 2011, pages 480 - 489
MURUGAIAH ET AL., ANALYTICAL BIOCHEMISTRY, vol. 401, 2010, pages 61
NGIOW ET AL., TRENDS IMMUNOL., vol. 34, 2013, pages 548 - 555
OCHMAN ET AL., GENETICS, vol. 120, 1988, pages 621 - 623
OPPMAN ET AL., IMMUNITY, vol. 13, 2000, pages 715 - 725
P CHAROENSIT ET AL: "Enhanced growth inhibition of metastatic lung tumors by intravenous injection of ATRA-cationic liposome/IL-12 pDNA complexes in mice", CANCER GENE THERAPY, vol. 17, no. 7, 23 April 2010 (2010-04-23), GB, pages 512 - 522, XP055388601, ISSN: 0929-1903, DOI: 10.1038/cgt.2010.12 *
PICCIRILLI ET AL., NATURE, vol. 343, 1990, pages 33 - 37
POLIDOROS ET AL., BIOTECHNIQUES, vol. 41, 2006, pages 35 - 42
QUERIDO ET AL., J. CELL SCI., vol. 124, 2014, pages 1703 - 1714
REMINGTON; A. R. GENNARO: "The Science and Practice of Pharmacy", 2006, LIPPINCOTT, WILLIAMS & WILKINS
S TUGUES ET AL: "New insights into IL-12-mediated tumor suppression", CELL DEATH AND DIFFERENTIATION., vol. 22, no. 2, 5 September 2014 (2014-09-05), GB, pages 237 - 246, XP055285716, ISSN: 1350-9047, DOI: 10.1038/cdd.2014.134 *
SAHIN ET AL., NATURE REVIEWS DRUG DISCOVERY I AOP, 19 September 2014 (2014-09-19)
SANDHU ET AL., IN SILICO BIOL., vol. 8, no. 2, 2008, pages 187 - 192
SCHROEDER ET AL., J INTERN MED, vol. 267, 2010, pages 9 - 21
SHARP; LI, NUCLEIC ACIDS RES., vol. 15, no. 3, 1987, pages 1281 - 1295
SHIN FOONG NGIOW ET AL: "A balance of interleukin-12 and -23 in cancer", TRENDS IN IMMUNOLOGY, vol. 34, no. 11, 1 November 2013 (2013-11-01), GB, pages 548 - 555, XP055401377, ISSN: 1471-4906, DOI: 10.1016/j.it.2013.07.004 *
SIEGWART ET AL., PROC NATL ACAD SCI USA., vol. 108, 2011, pages 12996 - 3001
SUZUKI ET AL., DNA RES., vol. 15, no. 6, 2008, pages 357 - 365
SWITZER ET AL., BIOCHEMISTRY, vol. 32, 1993, pages 10489 - 10496
T. HIGUCHI; V. STELLA: "Pro-drugs as Novel Delivery Systems", vol. 14, A.C.S. SYMPOSIUM SERIES
TANAKA ET AL., INTERNATIONAL JOURNAL OF CANCER, vol. 36, no. 5, 1985, pages 549 - 555
TENG ET AL., CANCER RES., vol. 72, 2012, pages 3987 - 3996
TENG ET AL., NATURE MEDICINE, vol. 21, 2015, pages 719 - 729
TENG ET AL., PROC. NATL. ACAD. SCI. USA, vol. 107, 2010, pages 8328 - 8333
TERM ET AL., CANCER RES., vol. 71, 2011, pages 5393 - 5399
TOR ET AL., J. AM. CHEM. SOC., vol. 115, 1993, pages 4461 - 4467
TOURIOL ET AL., BIOLOGY OF THE CELL, vol. 95, 2003, pages 169 - 178
UGUR SAHIN ET AL: "mRNA-based therapeutics - developing a new class of drugs", NATURE REVIEWS DRUG DISCOVERY, vol. 13, no. 10, 19 September 2014 (2014-09-19), pages 759 - 780, XP055159205, ISSN: 1474-1776, DOI: 10.1038/nrd4278 *
VIGNALI ET AL., NAT. IMMUNOL, vol. 13, 2014, pages 722 - 728
VILLALOBOS ET AL., JOURNAL/BMC BIOINFORMATICS, vol. 7, 2006, pages 285
W. W. OVERWIJK ET AL: "Immunological and Antitumor Effects of IL-23 as a Cancer Vaccine Adjuvant", THE JOURNAL OF IMMUNOLOGY, vol. 176, no. 9, 1 May 2006 (2006-05-01), US, pages 5213 - 5222, XP055236716, ISSN: 0022-1767, DOI: 10.4049/jimmunol.176.9.5213 *
WALKER ET AL., PROC. NATL. ACAD. SCI. USA, vol. 89, 1992, pages 392 - 396
WANG ET AL., CANCER IMMUNOL RES, vol. 2, no. 9, 2014, pages 846 - 856
WANG ET AL., CLIN. EXP. RHEUMATOL., vol. 33, no. 92, 2015, pages S87 - S90
WANG ET AL., NAT. MED., vol. 10, 2004, pages 1366 - 1373
WANG J ET AL: "Synergistic anti-tumor effect by combinatorial gene-gun therapy using IL-23 and IL-18 cDNA", JOURNAL OF DERMATOLOGICAL SCI, ELSEVIER, AMSTERDAM, NL, vol. 36, no. 1, 1 October 2004 (2004-10-01), pages 66 - 68, XP004603021, ISSN: 0923-1811, DOI: 10.1016/J.JDERMSCI.2004.08.001 *
WANG XUEFENG ET AL: "IL-36[gamma] Transforms the Tumor Microenvironment and Promotes Type 1 Lymphocyte-Mediated Antitumor Immune Respo", CANCER CELL, vol. 28, no. 3, 14 September 2015 (2015-09-14), pages 296 - 306, XP029268946, ISSN: 1535-6108, DOI: 10.1016/J.CCELL.2015.07.014 *
WELCH ET AL., PLOS ONE, vol. 4, no. 9, 2009, pages E7002
WIEDMANN ET AL., PCR METHODS AND APPLICATION, vol. 3, no. 4, 1994, pages S51 - S64
WILKE ET AL., CARCINOGENESIS, vol. 32, 2011, pages 643 - 649
XU ET AL., CLIN. DEV. IMMUNOL., 2010
ZANDBERG ET AL., ORAL ONCOL, vol. 50, 2014, pages 627 - 632
ZHU ET AL., NUCLEIC ACIDS RESEARCH, vol. 288, 2013, pages 3545 - 3552

Cited By (98)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10323076B2 (en) 2013-10-03 2019-06-18 Modernatx, Inc. Polynucleotides encoding low density lipoprotein receptor
US12151995B2 (en) 2015-09-17 2024-11-26 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US12404232B2 (en) 2015-09-17 2025-09-02 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US11220476B2 (en) 2015-09-17 2022-01-11 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US10266485B2 (en) 2015-09-17 2019-04-23 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US10442756B2 (en) 2015-09-17 2019-10-15 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US10392341B2 (en) 2015-09-17 2019-08-27 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US12396961B2 (en) 2015-12-22 2025-08-26 Modernatx, Inc. Compounds and compositions for intracellular delivery of agents
US10195156B2 (en) 2015-12-22 2019-02-05 Modernatx, Inc. Compounds and compositions for intracellular delivery of agents
US10799463B2 (en) 2015-12-22 2020-10-13 Modernatx, Inc. Compounds and compositions for intracellular delivery of agents
US11687256B2 (en) 2015-12-23 2023-06-27 Modernatx, Inc. Methods of using OX40 ligand encoding polynucleotides
US11403008B2 (en) 2015-12-23 2022-08-02 Modernatx, Inc. Methods of using OX40 ligand encoding polynucleotides
US11003366B2 (en) 2015-12-23 2021-05-11 Modernatx, Inc. Methods of using OX40 ligand encoding polynucleotides
US10379767B2 (en) 2015-12-23 2019-08-13 Modernatx, Inc. Methods of using OX40 ligand encoding polynucleotides
US10383951B2 (en) 2015-12-23 2019-08-20 Modernatx, Inc. Methods of using OX40 ligand encoding polynucleotides
US10143723B2 (en) 2015-12-23 2018-12-04 Modernatx, Inc. Methods of using OX40 ligand encoding polynucleotides
US10322091B2 (en) 2016-05-18 2019-06-18 Modernatx, Inc. Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US10322090B2 (en) 2016-05-18 2019-06-18 Modernatx, Inc. Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US10335486B2 (en) 2016-05-18 2019-07-02 Modernatx, Inc. MRNA combination therapy for the treatment of cancer
US11185510B2 (en) 2016-05-18 2021-11-30 Modernatx, Inc. Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US10406113B2 (en) 2016-05-18 2019-09-10 Modernatx, Inc. Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US10285950B2 (en) 2016-05-18 2019-05-14 Modernatx, Inc. Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US11071716B2 (en) 2016-05-18 2021-07-27 Modernatx, Inc. Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US11344504B1 (en) 2016-05-18 2022-05-31 Modernatx, Inc. Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US11596609B2 (en) 2016-05-18 2023-03-07 Modernatx, Inc. Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US12144895B2 (en) 2016-11-08 2024-11-19 Modernatx, Inc. Stabilized formulations of lipid nanoparticles
US11583504B2 (en) 2016-11-08 2023-02-21 Modernatx, Inc. Stabilized formulations of lipid nanoparticles
WO2018170306A1 (en) * 2017-03-15 2018-09-20 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US12324859B2 (en) 2017-03-15 2025-06-10 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US10857105B2 (en) 2017-03-15 2020-12-08 MordernaTX, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
US11969506B2 (en) 2017-03-15 2024-04-30 Modernatx, Inc. Lipid nanoparticle formulation
US11203569B2 (en) 2017-03-15 2021-12-21 Modernatx, Inc. Crystal forms of amino lipids
US12552738B2 (en) 2017-03-15 2026-02-17 Modernatx, Inc. Crystal forms of amino lipids
EP4186888A1 (en) * 2017-03-15 2023-05-31 ModernaTX, Inc. Compound and compositions for intracellular delivery of therapeutic agents
US12077501B2 (en) 2017-06-14 2024-09-03 Modernatx, Inc. Compounds and compositions for intracellular delivery of agents
US11517530B2 (en) 2017-09-27 2022-12-06 The Board Of Trustees Of The Leland Stanford Junior University Therapeutic agents specifically delivered by exosomes for cancer treatment
WO2019067464A1 (en) * 2017-09-27 2019-04-04 The Board Of Trustees Of The Leland Stanford Junior University THERAPEUTIC AGENTS SPECIALLY ADMINISTERED BY EXOSOMES FOR THE TREATMENT OF CANCER
CN110055275A (zh) * 2018-01-19 2019-07-26 科济生物医药(上海)有限公司 一种质粒载体对、其修饰的免疫细胞及其应用
WO2019143910A1 (en) * 2018-01-22 2019-07-25 Modernatx, Inc. Multimeric polynucleotides and uses thereof
CN111954535A (zh) * 2018-02-19 2020-11-17 联合治疗公司 用于编码核糖核酸的器官保护性表达和调节的组合物和方法
JP2021514190A (ja) * 2018-02-19 2021-06-10 コンバインド セラピューティクス インコーポレイテッドCombined Therapeutics, Inc. コード化リボ核酸の器官保護発現および調節のための組成物および方法
CN113015540A (zh) * 2018-09-14 2021-06-22 莫得纳特斯公司 使用mrna治疗剂治疗癌症的方法和组合物
WO2020056304A1 (en) * 2018-09-14 2020-03-19 Modernatx, Inc. Methods and compositions for treating cancer using mrna therapeutics
US12263248B2 (en) 2018-09-19 2025-04-01 Modernatx, Inc. Compounds and compositions for intracellular delivery of therapeutic agents
WO2020097409A3 (en) * 2018-11-08 2020-07-30 Modernatx, Inc. Use of mrna encoding ox40l to treat cancer in human patients
US12042527B2 (en) 2019-01-08 2024-07-23 Modernatx, Inc. Use of mRNAs encoding OX40L, IL-23 and IL-36gamma in combination with immune checkpoint blockade for treating particular cancers
US12582683B2 (en) 2019-01-10 2026-03-24 Janssen Biotech, Inc. Prostate neoantigens and their uses
US11793843B2 (en) 2019-01-10 2023-10-24 Janssen Biotech, Inc. Prostate neoantigens and their uses
JP7744829B2 (ja) 2019-03-25 2025-09-26 オハイオ・ステイト・イノベーション・ファウンデーション 組み合わせ免疫調節及びその使用
CN114423449A (zh) * 2019-03-25 2022-04-29 俄亥俄州国家创新基金会 联合免疫调节及其用途
JP2022527272A (ja) * 2019-03-25 2022-06-01 オハイオ・ステイト・イノベーション・ファウンデーション 組み合わせ免疫調節及びその使用
US20220152085A1 (en) * 2019-03-25 2022-05-19 Ohio State Innovation Foundation Combination immunoregulation and uses thereof
WO2020198338A1 (en) * 2019-03-25 2020-10-01 Ohio State Innovation Foundation Combination immunoregulation and uses thereof
JP2022534498A (ja) * 2019-05-29 2022-08-01 オービス ヘルス ソリューションズ エルエルシー キメラ受容体を発現させるための送達ベクターおよび粒子ならびにその使用方法
US11597698B2 (en) 2019-09-19 2023-03-07 Modernatx, Inc. Branched tail lipid compounds and compositions for intracellular delivery of therapeutic agents
US12595226B2 (en) 2019-09-19 2026-04-07 Modernatx, Inc. Carbonate containing lipid compounds and compositions for intracellular delivery of therapeutic agents
US12312293B2 (en) 2019-09-19 2025-05-27 Modernatx, Inc. Branched tail lipid compounds and compositions for intracellular delivery of therapeutic agents
US11066355B2 (en) 2019-09-19 2021-07-20 Modernatx, Inc. Branched tail lipid compounds and compositions for intracellular delivery of therapeutic agents
WO2021072172A1 (en) * 2019-10-09 2021-04-15 Translate Bio, Inc. Compositions, methods and uses of messenger rna
US12076438B2 (en) 2019-10-09 2024-09-03 Translate Bio, Inc. Compositions, methods and uses of messenger RNA
EP4529928A3 (en) * 2019-10-09 2025-05-28 Translate Bio, Inc. Compositions, methods and uses of messenger rna
CN114728176A (zh) * 2019-10-09 2022-07-08 川斯勒佰尔公司 信使rna的组合物、方法和使用
WO2021076811A1 (en) 2019-10-15 2021-04-22 Moderna TX, Inc. Mrnas encoding granulocyte-macrophage colony stimulating factor for treating parkinson's disease
US12018289B2 (en) 2019-11-18 2024-06-25 Janssen Biotech, Inc. Vaccines based on mutant CALR and JAK2 and their uses
WO2021231854A1 (en) 2020-05-14 2021-11-18 Modernatx, Inc. Lnp compositions comprising an mrna therapeutic and an effector molecule
WO2021262909A2 (en) 2020-06-23 2021-12-30 Modernatx, Inc. Lnp compositions comprising mrna therapeutics with extended half-life
US12295997B2 (en) 2020-07-06 2025-05-13 Janssen Biotech, Inc. Prostate neoantigens and their uses
WO2022174079A1 (en) 2021-02-12 2022-08-18 Modernatx, Inc. Lnp compositions comprising payloads for in vivo therapy
WO2022204369A1 (en) 2021-03-24 2022-09-29 Modernatx, Inc. Polynucleotides encoding methylmalonyl-coa mutase for the treatment of methylmalonic acidemia
WO2022204370A1 (en) 2021-03-24 2022-09-29 Modernatx, Inc. Lipid nanoparticles and polynucleotides encoding ornithine transcarbamylase for the treatment of ornithine transcarbamylase deficiency
WO2022204380A1 (en) 2021-03-24 2022-09-29 Modernatx, Inc. Lipid nanoparticles containing polynucleotides encoding propionyl-coa carboxylase alpha and beta subunits and uses thereof
WO2022204390A1 (en) 2021-03-24 2022-09-29 Modernatx, Inc. Lipid nanoparticles containing polynucleotides encoding phenylalanine hydroxylase and uses thereof
WO2022204371A1 (en) 2021-03-24 2022-09-29 Modernatx, Inc. Lipid nanoparticles containing polynucleotides encoding glucose-6-phosphatase and uses thereof
WO2022266083A2 (en) 2021-06-15 2022-12-22 Modernatx, Inc. Engineered polynucleotides for cell-type or microenvironment-specific expression
WO2022271776A1 (en) 2021-06-22 2022-12-29 Modernatx, Inc. Polynucleotides encoding uridine diphosphate glycosyltransferase 1 family, polypeptide a1 for the treatment of crigler-najjar syndrome
WO2023031394A1 (en) 2021-09-03 2023-03-09 CureVac SE Novel lipid nanoparticles for delivery of nucleic acids
WO2023056044A1 (en) 2021-10-01 2023-04-06 Modernatx, Inc. Polynucleotides encoding relaxin for the treatment of fibrosis and/or cardiovascular disease
CN116829578A (zh) * 2021-10-08 2023-09-29 苏州艾博生物科技有限公司 编码白细胞介素-12(il-12)的多核苷酸以及其相关组合物和方法
WO2023073228A1 (en) 2021-10-29 2023-05-04 CureVac SE Improved circular rna for expressing therapeutic proteins
WO2023077170A1 (en) 2021-11-01 2023-05-04 Modernatx, Inc. Polynucleotides encoding integrin beta-6 and methods of use thereof
WO2023144330A1 (en) 2022-01-28 2023-08-03 CureVac SE Nucleic acid encoded transcription factor inhibitors
WO2023159197A1 (en) 2022-02-18 2023-08-24 Modernatx, Inc. Mrnas encoding checkpoint cancer vaccines and uses thereof
WO2023183909A2 (en) 2022-03-25 2023-09-28 Modernatx, Inc. Polynucleotides encoding fanconi anemia, complementation group proteins for the treatment of fanconi anemia
WO2023196399A1 (en) 2022-04-06 2023-10-12 Modernatx, Inc. Lipid nanoparticles and polynucleotides encoding argininosuccinate lyase for the treatment of argininosuccinic aciduria
WO2023227608A1 (en) 2022-05-25 2023-11-30 Glaxosmithkline Biologicals Sa Nucleic acid based vaccine encoding an escherichia coli fimh antigenic polypeptide
WO2023246840A1 (en) * 2022-06-22 2023-12-28 Wuhan Houxian Biopharmaceutical Co. Ltd. Combination of il-12 and ox40l for cancer immunotherapy
WO2024015724A1 (en) * 2022-07-10 2024-01-18 Precigen, Inc. POLYCISTRONIC miRNA CONSTRUCTS FOR IMMUNE CHECKPOINT INHIBITION
WO2024026254A1 (en) 2022-07-26 2024-02-01 Modernatx, Inc. Engineered polynucleotides for temporal control of expression
DE202023106198U1 (de) 2022-10-28 2024-03-21 CureVac SE Impfstoff auf Nukleinsäurebasis
WO2024130158A1 (en) 2022-12-16 2024-06-20 Modernatx, Inc. Lipid nanoparticles and polynucleotides encoding extended serum half-life interleukin-22 for the treatment of metabolic disease
WO2024182301A2 (en) 2023-02-27 2024-09-06 Modernatx, Inc. Lipid nanoparticles and polynucleotides encoding galactose-1-phosphate uridylyltransferase (galt) for the treatment of galactosemia
WO2024184500A1 (en) 2023-03-08 2024-09-12 CureVac SE Novel lipid nanoparticle formulations for delivery of nucleic acids
WO2024206329A1 (en) 2023-03-27 2024-10-03 Modernatx, Inc. Nucleic acid molecules encoding bi-specific secreted engagers and uses thereof
WO2024229321A1 (en) 2023-05-03 2024-11-07 Modernatx, Inc. Polynucleotides encoding cystic fibrosis transmembrane conductance regulator for the treatment of cystic fibrosis
WO2024230934A1 (en) 2023-05-11 2024-11-14 CureVac SE Therapeutic nucleic acid for the treatment of ophthalmic diseases
WO2025184429A1 (en) 2024-02-28 2025-09-04 Modernatx, Inc. Bromodomain and extra-terminal domain (bet) epigenetic reader decoy
WO2025255199A1 (en) 2024-06-05 2025-12-11 Modernatx, Inc. Argininosuccinate synthase 1 and argininosuccinate lyase polypeptides and polynucleotides and uses thereof
WO2026025031A1 (en) 2024-07-26 2026-01-29 Modernatx, Inc. Mrna encoding mageb2 tcer molecule

Also Published As

Publication number Publication date
HUE059955T2 (hu) 2023-01-28
DK3458474T3 (da) 2022-09-26
US20190105280A1 (en) 2019-04-11
PT3458474T (pt) 2022-11-08
US20230026381A1 (en) 2023-01-26
HRP20221135T1 (hr) 2022-11-25
JP7194594B2 (ja) 2022-12-22
US11071716B2 (en) 2021-07-27
US10406113B2 (en) 2019-09-10
KR20190020299A (ko) 2019-02-28
EP3458474B1 (en) 2022-07-06
US20200113844A1 (en) 2020-04-16
HRP20221135T8 (hr) 2023-02-03
PL3458474T3 (pl) 2022-11-14
MA45035A (fr) 2019-03-27
US20230041964A1 (en) 2023-02-09
KR102482867B1 (ko) 2023-01-02
AU2017266929B2 (en) 2023-05-11
ES2932516T3 (es) 2023-01-20
US10322090B2 (en) 2019-06-18
US20210038529A1 (en) 2021-02-11
CN109476718A (zh) 2019-03-15
JP2019519517A (ja) 2019-07-11
US10285950B2 (en) 2019-05-14
US20190060246A1 (en) 2019-02-28
US20190111003A1 (en) 2019-04-18
KR20230008243A (ko) 2023-01-13
US10322091B2 (en) 2019-06-18
US20180318229A1 (en) 2018-11-08
SI3458474T1 (sl) 2022-10-28
CN109476718B (zh) 2023-07-04
US11185510B2 (en) 2021-11-30
LT3458474T (lt) 2022-10-10
RS63625B1 (sr) 2022-10-31
JP7586883B2 (ja) 2024-11-19
CA3024917A1 (en) 2017-11-23
WO2017201325A8 (en) 2018-08-30
AU2023210606A1 (en) 2023-08-24
CN116726203A (zh) 2023-09-12
AU2017266929A1 (en) 2019-01-17
US10172808B2 (en) 2019-01-08
EP4137509A1 (en) 2023-02-22
JP2023022326A (ja) 2023-02-14
US11596609B2 (en) 2023-03-07
EP3458474A1 (en) 2019-03-27
US11344504B1 (en) 2022-05-31
US20190105281A1 (en) 2019-04-11
SMT202300003T1 (it) 2023-03-17
AU2017266929A8 (en) 2019-03-14
MA45035B1 (fr) 2024-11-29

Similar Documents

Publication Publication Date Title
US11596609B2 (en) Combinations of mRNAs encoding immune modulating polypeptides and uses thereof
US11660341B2 (en) mRNA combination therapy for the treatment of cancer
EP3458083B1 (en) Polynucleotides encoding interleukin-12 (il12) and uses thereof
HK40086833A (en) Combinations of mrnas encoding immune modulating polypeptides and uses thereof
HK40004825A (en) Combinations of mrnas encoding immune modulating polypeptides and uses thereof
HK40004825B (en) Combinations of mrnas encoding immune modulating polypeptides and uses thereof
HK40004215A (en) Polynucleotides encoding interleukin-12 (il12) and uses thereof
HK40004215B (en) Polynucleotides encoding interleukin-12 (il12) and uses thereof

Legal Events

Date Code Title Description
ENP Entry into the national phase

Ref document number: 2018560868

Country of ref document: JP

Kind code of ref document: A

Ref document number: 3024917

Country of ref document: CA

NENP Non-entry into the national phase

Ref country code: DE

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 17727999

Country of ref document: EP

Kind code of ref document: A1

ENP Entry into the national phase

Ref document number: 20187036733

Country of ref document: KR

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 2017727999

Country of ref document: EP

Effective date: 20181218

ENP Entry into the national phase

Ref document number: 2017266929

Country of ref document: AU

Date of ref document: 20170518

Kind code of ref document: A