WO2017177337A1 - Multi-specific antigen-binding constructs targeting immunotherapeutics - Google Patents
Multi-specific antigen-binding constructs targeting immunotherapeutics Download PDFInfo
- Publication number
- WO2017177337A1 WO2017177337A1 PCT/CA2017/050463 CA2017050463W WO2017177337A1 WO 2017177337 A1 WO2017177337 A1 WO 2017177337A1 CA 2017050463 W CA2017050463 W CA 2017050463W WO 2017177337 A1 WO2017177337 A1 WO 2017177337A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antigen
- binding
- cell
- tumour
- construct
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/46—Hybrid immunoglobulins
- C07K16/468—Immunoglobulins having two or more different antigen binding sites, e.g. multifunctional antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/12—Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
- A61K35/14—Blood; Artificial blood
- A61K35/17—Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/10—Cellular immunotherapy characterised by the cell type used
- A61K40/11—T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/30—Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
- A61K40/31—Chimeric antigen receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/421—Immunoglobulin superfamily
- A61K40/4211—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4202—Receptors, cell surface antigens or cell surface determinants
- A61K40/4214—Receptors for cytokines
- A61K40/4215—Receptors for tumor necrosis factors [TNF], e.g. lymphotoxin receptor [LTR], CD30
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K40/00—Cellular immunotherapy
- A61K40/40—Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
- A61K40/41—Vertebrate antigens
- A61K40/42—Cancer antigens
- A61K40/4254—Adhesion molecules, e.g. NRCAM, EpCAM or cadherins
- A61K40/4255—Mesothelin [MSLN]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2878—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/42—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins
- C07K16/4208—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/42—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins
- C07K16/4208—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig
- C07K16/4241—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against immunoglobulins against an idiotypic determinant on Ig against anti-human or anti-animal Ig
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/44—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/27—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by targeting or presenting multiple antigens
- A61K2239/29—Multispecific CARs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K40/00
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/55—Fab or Fab'
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/569—Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/033—Fusion polypeptide containing a localisation/targetting motif containing a motif for targeting to the internal surface of the plasma membrane, e.g. containing a myristoylation motif
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
Definitions
- immunotherapeutics display enhanced ability to overcome tumour genetic resistance mechanisms and reduced healthy tissue toxicity profiles.
- TAAs tumour-associated antigens
- directing immune-mediated tumour cytolysis toward tumour-associated antigens (TAAs) has revolutionized hematopoietic and solid tissue neoplasm treatment protocols, providing long-lasting remission in many patients.
- TAA downregulation necessitating development of refined treatment options.
- Certain aspects of the disclosure relate to a method of re-directing tumour cell binding by an immunotherapeutic, the method comprising contacting the immunotherapeutic with a multi-specific antigen-binding construct comprising a first antigen-binding polypeptide construct that binds to the immunotherapeutic and a second antigen-binding polypeptide construct that binds to a first tumour-associated antigen epitope, wherein the immunotherapeutic is: i) a T-cell or NK cell engineered to express an antigen- binding domain that binds to a second tumour-associated antigen epitope, or ii) a therapeutic agent capable of binding to a T-cell and to a second tumour-associated antigen epitope, and wherein the first and second tumour-associated antigen epitopes are different.
- Some aspects of the present disclosure relate to a method of extending the therapeutic effect of an immunotherapeutic in a patient who is undergoing or has undergone treatment with the immunotherapeutic, the method comprising administering to the patient an effective amount of a multi-specific antigen-binding construct comprising a first antigen-binding polypeptide construct that binds to the immunotherapeutic and a second antigen-binding polypeptide construct that binds to a first tumour-associated antigen epitope, wherein the immunotherapeutic is: i) a T-cell or NK cell engineered to express an antigen-binding domain that binds to a second tumour-associated antigen epitope, or ii) a therapeutic agent capable of binding to a T-cell and to a second tumour-associated antigen epitope, and wherein the first and second tumour-associated antigen epitopes are different.
- Some aspects of the present disclosure relate to a method of treating cancer in a patient who is undergoing or has undergone treatment with an immunotherapeutic, the method comprising administering an effective amount of a multi-specific antigen-binding construct to the patient, the multi-specific antigen-binding construct comprising a first antigen-binding polypeptide construct that binds to the immunotherapeutic and a second antigen-binding polypeptide construct that binds to a first tumour-associated antigen epitope, wherein the immunotherapeutic is: i) a T-cell or NK cell engineered to express an antigen-binding domain that binds to a second tumour-associated antigen epitope, or ii) a therapeutic agent capable of binding to a T-cell and to a second tumour-associated antigen epitope, and wherein the first and second tumour-associated antigen epitopes are different.
- Some aspects of the present disclosure relate to a method of activating a T-cell or NK cell comprising contacting a T-cell or NK cell engineered to express a chimeric antigen receptor (CAR) or a T-cell receptor (TCR) with a multi-specific antigen-binding construct comprising a first antigen-binding polypeptide construct that binds to the CAR or TCR and a second antigen-binding polypeptide construct that binds to a first tumour-associated antigen epitope, wherein the CAR or TCR comprises an antigen-binding domain that binds to a second tumour-associated antigen epitope.
- CAR chimeric antigen receptor
- TCR T-cell receptor
- a multi-specific antigen-binding construct comprising: a first antigen-binding polypeptide construct that binds to an immunotherapeutic, and a second antigen binding polypeptide construct that binds to a first tumour-associated antigen epitope, wherein the immunotherapeutic is: i) a T-cell or NK cell engineered to express an antigen-binding domain that binds to a second tumour-associated antigen epitope, or ii) a therapeutic agent capable of binding to a T-cell and to a second tumour- associated antigen epitope, and wherein the first and second tumour-associated antigen epitopes are different.
- nucleic acid encoding a multi-specific antigen-binding construct as described herein Some aspects relate to a host cell comprising nucleic acid encoding a multi-specific antigen-binding construct as described herein.
- Certain aspects of the disclosure relate to a use of a multi-specific antigen-binding construct to re-direct tumour cell binding by an immunotherapeutic, the multi-specific antigen- binding construct comprising a first antigen-binding polypeptide construct that binds to the immunotherapeutic and a second antigen-binding polypeptide construct that binds to a first tumour-associated antigen epitope, wherein the immunotherapeutic is: i) a T-cell or NK cell engineered to express an antigen-binding domain that binds to a second tumour-associated antigen epitope, or ii) a therapeutic agent capable of binding to a T-cell and to a second tumour- associated antigen epitope, and wherein the first and second tumour-associated antigen epitopes are different.
- Some aspects of the present disclosure relate to a use of a multi-specific antigen- binding construct to extend the therapeutic effect of an immunotherapeutic in a patient who is undergoing or has undergone treatment with the immunotherapeutic, the multi-specific antigen-binding construct comprising a first antigen-binding polypeptide construct that binds to the immunotherapeutic and a second antigen-binding polypeptide construct that binds to a first tumour-associated antigen epitope, wherein the immunotherapeutic is: i) a T-cell or NK cell engineered to express an antigen-binding domain that binds to a second tumour-associated antigen epitope, or ii) a therapeutic agent capable of binding to a T-cell and to a second tumour- associated antigen epitope, and wherein the first and second tumour-associated antigen epitopes are different.
- Some aspects of the present disclosure relate to a use of a multi-specific antigen- binding construct to treat cancer in a patient who is undergoing or has undergone treatment with an immunotherapeutic, the multi-specific antigen-binding construct comprising a first antigen-binding polypeptide construct that binds to the immunotherapeutic and a second antigen-binding polypeptide construct that binds to a first tumour-associated antigen epitope, wherein the immunotherapeutic is: i) a T-cell or NK cell engineered to express an antigen- binding domain that binds to a second tumour-associated antigen epitope, or ii) a therapeutic agent capable of binding to a T-cell and to a second tumour-associated antigen epitope, and wherein the first and second tumour-associated antigen epitopes are different.
- Some aspects of the present disclosure relate to a use of a multi-specific antigen- binding construct to activate a T-cell or NK cell that is engineered to express a chimeric antigen receptor (CAR) or a T-cell receptor (TCR), the multi-specific antigen-binding construct comprising a first antigen-binding polypeptide construct that binds to the CAR or TCR and a second antigen-binding polypeptide construct that binds to a first tumour-associated antigen epitope, wherein the CAR or TCR comprises an antigen-binding domain that binds to a second tumour-associated antigen epitope.
- CAR chimeric antigen receptor
- TCR T-cell receptor
- Some aspects of the present disclosure relate to a pharmaceutical composition
- a pharmaceutical composition comprising a multi-specific antigen-binding construct and a pharmaceutically acceptable carrier, the multi-specific antigen-binding construct comprising a first antigen-binding polypeptide construct that binds to an immunotherapeutic and a second antigen-binding polypeptide construct that binds to a first tumour-associated antigen epitope
- the immunotherapeutic is: i) a T-cell or NK cell engineered to express an antigen-binding domain that binds to a second tumour-associated antigen epitope, or ii) a therapeutic agent capable of binding to a T-cell and to a second tumour-associated antigen epitope, and wherein the first and second tumour-associated antigen epitopes are different.
- Some aspects of the present disclosure relate to a use of a multi-specific antigen- binding construct in the manufacture of a medicament, the multi-specific antigen-binding construct comprising a first antigen-binding polypeptide construct that binds to an immunotherapeutic and a second antigen-binding polypeptide construct that binds to a first tumour-associated antigen epitope, wherein the immunotherapeutic is: i) a T-cell or NK cell engineered to express an antigen-binding domain that binds to a second tumour-associated antigen epitope, or ii) a therapeutic agent capable of binding to a T-cell and to a second tumour- associated antigen epitope, and wherein the first and second tumour-associated antigen epitopes are different.
- Figure 1 depicts (A) a schematic diagram of one embodiment of a multi-specific antigen-binding construct which targets an anti-CD 19 CAR-T and CD79b as the tumour- associated antigen, and (B) some exemplary formats for the described multi-specific antigen- binding constructs.
- Figure 2 depicts binding of an anti-FLAG x anti-mesothelin (MSLN) bispecific antibody and an anti-FMC63id x anti-MSLN bispecific antibody to MSLN+ A1847 cells, but not control RPMI8226 cells (A), and binding of an anti-FLAG x anti-BCMA bispecific antibody and an anti-FMC63id x anti-BCMA bispecific antibody to BCMA+ RPMI8226 cells, but not control A1847 cells (B).
- MSLN anti-FLAG x anti-mesothelin
- Figure 3 depicts selective binding of anti-FMC63id x anti-mesothelin and anti- FMC63id x anti-BCMA bispecific antibodies to anti-CD 19 CAR constructs containing FMC63 that are stably expressed on either HEK293 (A) or primary CAR-T cells (B).
- Figure 4 shows (A) CD19-CAR-T cells are robustly activated upon co-culture with CD 19+ Raji cells, but not CD19-negative SKOV3 cells, and (B) an anti-FMC63id x anti- mesothelin bispecific antibody re-directed CAR-T cells and potentiated activation in the presence of MSLN+ SKOV3 cells, and an anti-FMC63id x anti-BCMA bispecific antibody redirected CAR-T cells and potentiated activation in the presence of BCMA+ RPMI8226 cells.
- the multi-specific antigen-binding constructs are capable of binding to an immunotherapeutic and to at least one tumour-associated antigen.
- the multi-specific antigen-binding constructs comprise a first antigen-binding polypeptide construct that binds to an immunotherapeutic, and a second antigen-binding polypeptide construct that binds to a tumour-associated antigen.
- the immunotherapeutic may be an effector cell, such as a T-cell or an NK cell, that is engineered to express an antigen-binding domain that binds to a tumour-associated antigen.
- the immunotherapeutic may be a therapeutic agent that is capable of binding to a T-cell and to a tumour-associated antigen.
- the tumour-associated antigen that is targeted by the multi-specific antigen-binding construct is different to the tumour-associated antigen that is targeted by the immunotherapeutic.
- the tumour-associated antigen that is targeted by the multi-specific antigen-binding construct is the same as the tumour-associated antigen targeted by the immunotherapeutic, but the multi- specific antigen-binding construct and the immunotherapeutic bind to different epitopes on the tumour-associated antigen.
- the multi-specific antigen-binding construct binds to the immunotherapeutic through a first antigen-binding polypeptide construct, and binds to a tumour-associated antigen on a tumour cell through a second antigen-binding polypeptide.
- the second antigen-binding polypeptide either binds to a different tumour-associated antigen to that targeted by the immunotherapeutic, or binds to a different epitope on the tumour-associated antigen to that targeted by the immunotherapeutic.
- the multi- specific antigen-binding construct re-directs the binding of the immunotherapeutic from its cognate tumour-associated antigen or epitope to the tumour-associated antigen or epitope targeted by the second antigen-binding polypeptide construct.
- the immunotherapeutic retains binding to its cognate tumour-associated antigen or epitope on a tumour cell, and also binds the tumour cell via the multi-specific antigen-binding construct and its cognate tumour-associated antigen or epitope. In this embodiment, binding of the tumour cell by the immunotherapeutic may thus be enhanced.
- the multi- specific antigen-binding constructs may find use as a follow-on or adjunctive therapy.
- the terms “comprising,” “having,” “including” and “containing,” and grammatical variations thereof, are inclusive or open-ended and do not exclude additional, unrecited elements and/or method steps.
- the term “consisting essentially of when used herein in connection with a composition, use or method, denotes that additional elements and/or method steps may be present, but that these additions do not materially affect the manner in which the recited composition, method or use functions.
- the term “consisting of when used herein in connection with a composition, use or method excludes the presence of additional elements and/or method steps.
- compositions, use or method described herein as comprising certain elements and/or steps may also, in certain embodiments consist essentially of those elements and/or steps, and in other embodiments consist of those elements and/or steps, whether or not these embodiments are specifically referred to. [0026] It is contemplated that any embodiment discussed herein can be implemented with respect to any method, use or composition disclosed herein, and vice versa.
- multi-specific antigen-binding constructs capable of binding to an immunotherapeutic and at least one tumour-associated antigen.
- the multi-specific antigen-binding constructs comprise a first antigen-binding polypeptide construct that binds to an immunotherapeutic, and a second antigen-binding polypeptide construct that binds to a tumour-associated antigen.
- the multi-specific antigen-binding constructs may comprise one or more additional antigen-binding polypeptide constructs each of which binds to a tumour-associated antigen.
- each antigen-binding polypeptide construct comprised by the multi-specific antigen-binding construct specifically binds to its target antigen.
- an antigen-binding construct refers to an agent, e.g. polypeptide or polypeptide complex, capable of binding to an antigen.
- an antigen-binding construct may be a polypeptide that specifically binds to a target antigen of interest.
- An antigen-binding construct may be a monomer, dimer, multimer, a protein, a peptide, a protein or peptide complex, an antibody, an antibody fragment, a Fab, an scFv, a single domain antibody (sdAb), a VHH, or the like.
- a multi-specific antigen-binding construct may include one or more antigen-binding moieties (e.g.
- Fabs, scFvs, VHHs or sdAbs linked to a scaffold.
- Examples of multi-specific antigen-binding constructs are described below and provided in the Examples section. Some exemplary, non-limiting, formats of multi- specific antigen-binding constructs are shown in Fig. IB.
- the antigen-binding construct is a multi-specific antigen- binding construct.
- the term "multi-specific antigen-binding construct," as used herein, is an antigen-binding construct which has two or more antigen-binding moieties (e.g. antigen- binding polypeptide constructs), each with a unique binding specificity.
- the multi-specific antigen-binding construct comprises two antigen-binding moieties (i.e. is bispecific).
- the multi-specific antigen-binding construct comprises three antigen-binding moieties (i.e. is trispecific).
- the multi- specific antigen-binding construct comprises more than three antigen-binding moieties, for example, four antigen-binding moieties.
- bispecific antigen-binding constructs refers to an antigen-binding construct that has two antigen-binding moieties (e.g. antigen-binding polypeptide constructs), each with a unique binding specificity.
- the bispecific antigen-binding construct may comprise a first antigen-binding moiety that binds to an epitope on a first antigen and a second antigen-binding moiety that binds to an epitope on a second antigen, or the bispecific antigen-binding construct may comprise a first antigen-binding moiety that binds to an epitope on a first antigen and a second antigen-binding moiety that binds to a different epitope on the first antigen.
- the term "biparatopic" may be used to refer to a bispecific antigen-binding construct in which the first antigen-binding moiety and the second antigen-binding moiety bind to different epitopes on the same antigen.
- the biparatopic antigen-binding construct may bind to a single antigen molecule through the two epitopes, or it may bind to two separate antigen molecules, each through a different epitope.
- the antigen-binding construct comprises two or more antigen- binding moieties that are antigen-binding polypeptide constructs, each of the antigen-binding polypeptide constructs being independently a Fab, an scFv or an sdAb, optionally of camelid origin (VHH).
- the multi-specific antigen-binding construct further comprises a scaffold and the antigen-binding polypeptide constructs are operably linked to the scaffold.
- the term "operably linked,” as used herein, means that the components described are in a relationship permitting them to function in their intended manner.
- the multi-specific antigen-binding construct may be an antibody or antigen-binding antibody fragment.
- antibody and “immunoglobulin” are used interchangeably herein to refer to a polypeptide encoded by an immunoglobulin gene or genes, or a modified version of an immunoglobulin gene, which polypeptide specifically binds and recognizes an analyte (e.g. antigen).
- the recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon and mu constant region genes, as well as the myriad immunoglobulin variable region genes.
- Light chains are classified as either kappa or lambda.
- the "class" of an antibody or immunoglobulin refers to the type of constant domain or constant region possessed by its heavy chain. There are five major classes of antibodies: IgA, IgD, IgE, IgG and IgM, and several of these may be further divided into subclasses (isotypes), e.g. IgGi, IgG 2 , IgG3, IgG4, IgAi and IgA 2 .
- the heavy chain constant domains that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ and ⁇ , respectively.
- An exemplary immunoglobulin (antibody) structural unit is composed of two pairs of polypeptide chains, each pair having one "light” chain (about 25 kD) and one "heavy” chain (about 50-70 kD).
- the N-terminal domain of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the terms variable light chain (VL) and variable heavy chain (VH) refer to these light and heavy chain domains respectively.
- the IgGl heavy chain comprises the VH, CHI, CH2 and CH3 domains, respectively, from N- to C-terminus.
- the light chain comprises the VL and CL domains from N- to C-terminus.
- the IgGl heavy chain comprises a hinge between the CHI and CH2 domains.
- the multi-specific antigen-binding constructs comprise at least one immunoglobulin domain from IgG, IgM, IgA, IgD or IgE.
- the multi-specific antigen-binding construct comprises one or more immunoglobulin domains from or derived from an immunoglobulin-based construct such as a diabody or a nanobody.
- the multi-specific antigen-binding construct comprises at least one immunoglobulin domain from a heavy chain antibody such as a camelid antibody.
- the multi-specific antigen-binding construct comprises at least one immunoglobulin domain from a mammalian antibody such as a bovine antibody, a human antibody, a camelid antibody, a mouse antibody or any chimeric antibody.
- hypervariable region refers to each of the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops ("hypervariable loops").
- native four-chain antibodies comprise six HVRs; three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3).
- HVRs generally comprise amino acid residues from the hypervariable loops and/or from the complementarity determining regions (CDRs), the latter being of highest sequence variability and/or involved in antigen recognition. With the exception of CDR1 in VH, CDRs generally comprise the amino acid residues that form the hypervariable loops.
- hypervariable regions HVRs
- CDRs complementarity determining regions
- the multi-specific antigen-binding constructs described herein comprise two or more antigen-binding polypeptide constructs, one of which binds (e.g. specifically binds) to an immunotherapeutic, and one or more of which each independently bind (e.g. specifically bind) to a tumour-associated antigen.
- one or more of the antigen-binding polypeptide constructs are immunoglobulin-based constructs, for example, antibody fragments.
- one or more of the antigen-binding polypeptide constructs may be a non-immunoglobulin based antibody mimetic format, including, but not limited to, an anticalin, a fynomer, an affimer, an alphabody, a DARPin or an avimer.
- the antigen-binding polypeptide constructs may each independently be a Fab, an scFv or a sdAb, depending on the intended application of the multi- specific antigen-binding construct.
- At least one of the antigen-binding polypeptide constructs comprised by the multi-specific antigen-binding construct may be a Fab fragment.
- a "Fab fragment” (also referred to as fragment antigen-binding) contains the constant domain (CL) of the light chain and the first constant domain (CHI) of the heavy chain along with the variable domains VL and VH on the light and heavy chains, respectively.
- the variable domains comprise the CDRs, which are involved in antigen-binding.
- Fab' fragments differ from Fab fragments by the addition of a few amino acid residues at the C-terminus of the heavy chain CHI domain, including one or more cysteines from the antibody hinge region.
- one of the antigen-binding polypeptide constructs comprised by the multi- specific antigen-binding construct may be a Fab' fragment.
- single-chain refers to a molecule comprising amino acid monomers linearly linked by peptide bonds.
- one or more of the antigen-binding polypeptide constructs comprised by the multi-specific antigen-binding construct may be a single-chain Fab molecule, i.e. a Fab molecule in which the Fab light chain and the Fab heavy chain are connected by a peptide linker to form a single peptide chain.
- an antigen-binding polypeptide construct comprised by the multi-specific antigen-binding construct is a single-chain Fab molecule
- the C-terminus of the Fab light chain may be connected to the N-terminus of the Fab heavy chain in the single- chain Fab molecule.
- At least one of the antigen-binding polypeptide constructs comprised by the multi-specific antigen-binding construct may be a single-chain Fv (scFv).
- An "scFv” includes a heavy chain variable domain (VH) and a light chain variable domain (VL) of an antibody in a single polypeptide chain.
- the scFv may optionally further comprise a polypeptide linker between the VH and VL domains which enables the scFv to form a desired structure for antigen binding.
- an scFv may include a VL connected from its C-terminus to the N-terminus of a VH by a polypeptide linker.
- an scFv may comprise a VH connected through its C-terminus to the N-terminus of a VL by a polypeptide chain or linker.
- a polypeptide chain or linker For a review of scFvs see Pluckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).
- At least one of the antigen-binding polypeptide constructs comprised by the multi-specific antigen-binding construct may be in a single domain antibody (sdAb) format.
- An sdAb format refers to a single immunoglobulin domain.
- the sdAb may be, for example, of camelid origin. Camelid antibodies lack light chains and their antigen-binding sites consist of a single domain, termed a "VHH.”
- An sdAb comprises three CDR/hypervariable loops that form the antigen-binding site: CDR1, CDR2 and CDR3.
- At least one of the antigen-binding polypeptide constructs comprised by the multi-specific antigen-binding construct that binds a tumour-associated antigen may be a natural ligand for a tumour-associated antigen, or a functional fragment of such a ligand. Examples include, but are not limited to, folate (ligand for FRalpha), recombinant EGF (ligand for EGFR) or Wnt5a (ligand for ROR1). Formats
- the multi-specific antigen-binding constructs described herein may be considered to have a modular architecture that includes two or more antigen-binding polypeptide construct modules and an optional scaffold module.
- these modules may be combined in various ways to provide multi-specific antigen-binding constructs having different formats. These formats are based generally on art-known antibody formats (see, for example, review by Brinkmann & Kontermann, MABS, 9(2): 182-212 (2017), and Miiller & Kontermann, "Bispecific Antibodies” in Handbook of Therapeutic Antibodies, Wiley -VCH Verlag GmbH & Co. (2014)), and include those described above and the exemplary, non-limiting, formats of multi-specific antigen-binding constructs shown in Fig.
- Multi-specific antigen-binding constructs that lack a scaffold typically comprise two or more antigen-binding polypeptide constructs operably linked by one or more linkers.
- the antigen-binding polypeptide constructs may be in the form of scFvs, Fabs, sdAbs, or a combination thereof.
- scFvs as the antigen-binding polypeptide constructs, formats such as a tandem scFv ((scFv) 2 or taFv) or a triplebody (3 scFvs) may be constructed, in which the scFvs are connected together by a flexible linker.
- scFvs may also be used to construct diabody, triabody and tetrabody (tandem diabodies or TandAbs) formats, which comprise 2, 3 and 4 scFvs, respectively, connected by a short linker (usually about 5 amino acids in length).
- the restricted length of the linker results in dimerization of the scFvs in a head-to-tail manner.
- the scFvs may be further stabilized by inclusion of an interdomain disulfide bond.
- a disulfide bond may be introduced between VL and VH through introduction of an additional cysteine residue in each chain (for example, at position 44 in VH and 100 in VL) (see, for example, Fitzgerald et al, Protein Engineering, 10: 1221-1225 (1997)), or a disulfide bond may be introduced between two VHs to provide construct having a DART format (see, for example, Johnson et al, J Mol. Biol., 399:436-449 (2010)).
- formats comprising two or more sdAbs, such as VHs or VHHs, connected together through a suitable linker may be used for the multi-specific antigen-binding construct.
- multi-specific antigen-binding construct formats that lack a scaffold include those based on Fab fragments, for example, Fab 2 , F(ab') 2 and F(ab')3 formats, in which the Fab fragments are connected through a linker or an IgG hinge region.
- an scFv or a sdAb may be fused to the C-terminus of either or both of the light and heavy chain of a Fab fragment resulting in a bivalent (Fab-scFV/sdAb) or trivalent (Fab-(scFv) 2 or Fab-(sdAb) 2 ) construct.
- one or two scFvs or sdAbs may be fused at the hinge region of a F(ab') fragment to produce a tri-or tetravalent F(ab')2-scFv/sdAb construct.
- the multi-specific antigen-binding construct comprises two or more antigen-binding polypeptide constructs and one or more linkers, and does not include a scaffold.
- the multi-specific antigen-binding construct comprises two or more antigen-binding polypeptide constructs and one or more linkers, in which the antigen- binding polypeptide constructs are scFvs, Fabs, sdAbs, or a combination thereof.
- the multi-specific antigen-binding construct comprises two or more antigen- binding polypeptide constructs and one or more linkers, in which the antigen-binding polypeptide constructs are scFvs.
- Multi-specific antigen-binding constructs comprising a scaffold may be constructed by linking two or more antigen-binding polypeptide constructs to a suitable scaffold.
- the antigen-binding polypeptide constructs may be in one or a combination of the forms described above (e.g. scFvs, Fabs and/or sdAbs).
- Suitable scaffolds include, but are not limited to, immunoglobulin Fc regions, albumin, albumin analogs and derivatives, heterodimerizing peptides (such as leucine zippers, heterodimer- forming "zipper” peptides derived from Jun and Fos, IgG CHI and CL domains or barnase- barstar toxins), cytokines, chemokines or growth factors.
- Other examples include multi- specific antigen-binding constructs based on the DOCK-AND-LOCKTM (DNLTM) technology developed by IBC Pharmaceuticals, Inc. and Immunomedics (see, for example, Chang, et al, Clin Cancer Res 13:5586s-5591s (2007)).
- the multi-specific antigen-binding construct comprises two or more antigen-binding polypeptide constructs and a scaffold.
- the multi-specific antigen-binding construct comprises two or more antigen-binding polypeptide constructs and a scaffold which is based on an IgG Fc region, an albumin or an albumin analog or derivative.
- the multi-specific antigen-binding construct comprises a scaffold that is based on an Fc, which may be a dimeric or a heterodimeric Fc, comprising a first Fc polypeptide and a second Fc polypeptide, each comprising a CH3 sequence, and optionally a CH2 sequence.
- the multi-specific antigen-binding construct comprises an Fc which comprises first and second Fc polypeptides, and a first antigen-binding polypeptide construct is operably linked to the first Fc polypeptide and a second antigen-binding polypeptide construct is operably linked to the second Fc polypeptide.
- the multi-specific antigen-binding construct comprises an Fc which comprises first and second Fc polypeptides, and a first antigen-binding polypeptide construct is operably linked to the C- terminus of the first Fc polypeptide or the second Fc polypeptide, with or without a linker.
- the multi-specific antigen-binding construct comprises a heavy chain polypeptide comprising a CHI and a VH and light chain polypeptide comprising a CL and a VL, in which a first antigen-binding polypeptide construct is operably linked to the N-terminus of the VL, the C-terminus of the CL, or the N-terminus of the VH, with or without a linker.
- multi-specific antigen-binding constructs that comprise three or more antigen-binding polypeptide constructs, including multi-specific antigen-binding constructs in an "Octopus antibody” or “dual-variable domain immunoglobulin” (DVD) format (see, e.g. U.S. Patent Application Publication No. US2006/0025576, and Wu et al, Nature Biotechnology 25: 1290-1297 (2007)).
- the multi-specific antigen-binding construct may also include a "Dual Acting FAb” or “DAF” comprising an antigen-binding polypeptide construct that binds to an immunotherapeutic as well as to the target tumour-associated antigen (see, U.S. Patent Application Publication No. US2008/0069820, for example).
- a "Dual Acting FAb” or “DAF” comprising an antigen-binding polypeptide construct that binds to an immunotherapeutic as well as to the target tumour-associated antigen
- the multi-specific antigen-binding constructs described herein comprise a scaffold.
- a scaffold may be a peptide, polypeptide, polymer, nanoparticle or other chemical entity.
- each antigen-binding polypeptide construct of the multi-specific antigen-binding construct may be linked to either the N- or C- terminus of the polypeptide scaffold.
- Multi-specific antigen-binding constructs comprising a polypeptide scaffold in which one or more of the antigen-binding polypeptide constructs are linked to a region other than the N- or C-terminus, for example, via the side chain of an amino acid with or without a linker, are also contemplated in certain embodiments.
- the antigen-binding construct may be linked to the scaffold by genetic fusion or chemical conjugation. In some embodiments, where the scaffold is a polymer or nanoparticle, the antigen-binding construct may be linked to the scaffold by chemical conjugation.
- a number of protein domains are known in the art that comprise selective pairs of two different antigen-binding polypeptides and may be used to form a scaffold.
- An example is leucine zipper domains such as Fos and Jun that selectively pair together (Kostelny, et al, J Immunol, 148: 1547-53 (1992); Wranik, et al, J. Biol.
- protein scaffolds include immunoglobulin Fc regions, albumin, albumin analogs and derivatives, toxins, cytokines, chemokines and growth factors.
- the use of protein scaffolds in combination with antigen-binding moieties has been described, for example, in Muller et al, J Biol Chem, 282: 12650-12660 (2007); McDonaugh et al, Mol Cancer Ther, 11 :582-593 (2012); Vallera et al, Clin Cancer Res, 11 :3879-3888 (2005); Song et al, Biotech Appl Biochem, 45: 147-154 (2006), and U.S. Patent Application Publication No. US2009/0285816.
- Antigen-binding moieties such as scFvs, diabodies or single chain diabodies to albumin has been shown to improve the serum half-life of the antigen-binding moieties (Muller et al, ibid.).
- Antigen-binding moieties may be fused at the N- and/or C- termini of albumin, optionally via a linker.
- the heteromultimer includes four termini and thus can be fused to up to four different antigen-binding moieties, optionally via linkers.
- the multi-specific antigen-binding construct comprises a protein scaffold.
- the multi-specific antigen-binding construct comprises a protein scaffold that is based on an Fc region (as described below), an albumin or an albumin analog or derivative. In some embodiments, the multi-specific antigen-binding construct comprises a protein scaffold that is based on an albumin, for example human serum albumin (HSA), or an albumin analog or derivative. In some embodiments, the multi-specific antigen- binding construct comprises a protein scaffold that is based on an albumin derivative as described in International Patent Publication No. WO 2012/116453 or WO 2014/012082.
- the multi-specific antigen-binding construct comprises two or more antigen-binding polypeptide constructs that are in the form of scFvs and a protein scaffold that is based on an albumin derivative as described in International Patent Publication No. WO 2012/116453 or WO 2014/012082.
- Fc Regions are in the form of scFvs and a protein scaffold that is based on an albumin derivative as described in International Patent Publication No. WO 2012/116453 or WO 2014/012082.
- the multi-specific antigen-binding constructs described herein comprise a scaffold that is based on a Fc region.
- Fc region refers to a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region.
- the term includes native sequence Fc regions and variant Fc regions. Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al, Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD (1991).
- an "Fc polypeptide" of a dimeric Fc refers to one of the two polypeptides forming the dimeric Fc domain, i.e. a polypeptide comprising C-terminal constant regions of an immunoglobulin heavy chain that is capable of stable self-association.
- an Fc polypeptide of a dimeric IgG Fc comprises an IgG CH2 and an IgG CH3 constant domain sequence.
- An Fc domain comprises either a CH3 domain or a CH3 and a CH2 domain.
- the CH3 domain comprises two CH3 sequences, one from each of the two Fc polypeptides of the dimeric Fc.
- the CH2 domain comprises two CH2 sequences, one from each of the two Fc polypeptides of the dimeric Fc.
- the multi-specific antigen-binding construct comprises an Fc comprising one or two CH3 sequences.
- the Fc is coupled, with or without one or more linkers, to a first antigen-binding polypeptide construct and a second antigen-binding polypeptide construct.
- the Fc is based on a human Fc.
- the Fc is based on a human IgG Fc, for example a human IgGl Fc.
- the Fc is a heterodimeric Fc.
- the Fc comprises one or two CH2 sequences.
- the Fc comprises one or two CH3 sequences at least one of which comprises one or more amino acid modifications. In some embodiments, the Fc comprises one or two CH2 sequences, at least one of which comprises one or more amino acid modifications. In some embodiments, the Fc may be composed of a single polypeptide. In some embodiments, the Fc may be composed of multiple peptides, e.g. two polypeptides. [0065] In some embodiments, the multi-specific antigen-binding construct comprises an Fc as described in International Patent Publication No. WO 2012/058768 or International Patent Publication No. WO 2013/063702.
- the multi-specific antigen-binding construct described herein comprises a heterodimeric Fc comprising a modified CH3 domain, wherein the modified CH3 domain is an asymmetrically modified CH3 domain.
- the heterodimeric Fc may comprise two heavy chain constant domain polypeptides: a first Fc polypeptide and a second Fc polypeptide, which can be used interchangeably provided that the Fc comprises one first Fc polypeptide and one second Fc polypeptide.
- the first Fc polypeptide comprises a first CH3 sequence
- the second Fc polypeptide comprises a second CH3 sequence.
- Two CH3 sequences that comprise one or more amino acid modifications introduced in an asymmetric fashion generally results in a heterodimeric Fc, rather than a homodimer, when the two CH3 sequences dimerize.
- asymmetric amino acid modifications refers to a modification where an amino acid at a specific position on a first CH3 sequence is different to the amino acid on a second CH3 sequence at the same position.
- the first and second CH3 sequence will typically preferentially pair to form a heterodimer, rather than a homodimer.
- asymmetric amino acid modifications can be a result of modification of only one of the two amino acids at the same respective amino acid position on each sequence, or different modifications of both amino acids on each sequence at the same respective position on each of the first and second CH3 sequences.
- the first and second CH3 sequence of a heterodimeric Fc can comprise one or more than one asymmetric amino acid modification.
- Table A provides the amino acid sequence of the human IgGl Fc sequence, corresponding to amino acids 231 to 447 of the full-length human IgGl heavy chain.
- the CH3 sequence comprises amino acids 341-447 of the full-length human IgGl heavy chain.
- an Fc includes two heavy chain polypeptide sequences (A and B) that are capable of dimerizing.
- one or both polypeptide sequences of an Fc may include modifications at one or more of the following positions: L351, F405, Y407, T366, K392, T394, T350, S400 and/or N390, using EU numbering.
- the multi-specific antigen-binding construct comprises a heterodimeric Fc comprising a modified CH3 domain having a first polypeptide sequence that comprises amino acid modifications at positions F405 and Y407, and optionally further comprises an amino acid modification at position L351, and a second polypeptide sequence that comprises amino acid modifications at positions T366 and T394, and optionally further comprises an amino acid modification at position K392.
- a first polypeptide sequence of the modified CH3 domain comprises amino acid modifications at positions F405 and Y407, and optionally further comprises an amino acid modification at position L351
- a second polypeptide sequence of the modified CH3 domain comprises amino acid modifications at positions T366 and T394, and optionally further comprises an amino acid modification at position K392
- the amino acid modification at position F405 is F405A, F405I, F405M, F405S, F405T or F405V
- the amino acid modification at position Y407 is Y407I or Y407V
- the amino acid modification at position T366 is T366I, T366L or T366M
- the amino acid modification at position T394 is T394W
- the amino acid modification at position L351 is L351Y
- the amino acid modification at position K392 is K392F, K392L or K392M.
- a first polypeptide sequence of the Fc comprises amino acid modifications at positions F405 and Y407, and optionally further comprises an amino acid modification at position L351
- a second polypeptide sequence of the Fc comprises amino acid modifications at positions T366 and T394, and optionally further comprises an amino acid modification at position K392
- the amino acid modification at position F405 is F405A, F405I, F405M, F405S, F405T or F405V
- the amino acid modification at position Y407 is Y407I or Y407V
- the amino acid modification at position T366 is T366I, T366L or T366M
- the amino acid modification at position T394 is T394W
- the amino acid modification at position L351 is L351Y
- the amino acid modification at position K392 is K392F, K392L or K392M
- one or both of the first and second polypeptide sequences of the Fc further comprises the amino acid modification
- the multi-specific antigen-binding construct comprises a heterodimeric Fc comprising a modified CH3 domain having a first polypeptide sequence that comprises amino acid modifications at positions F405 and Y407, and optionally further comprises an amino acid modification at position L351, and a second polypeptide sequence that comprises amino acid modifications at positions T366 and T394, and optionally further comprises an amino acid modification at position K392, and the first polypeptide sequence further comprises an amino acid modification at one or both of positions S400 or Q347 and/or the second polypeptide sequence further comprises an amino acid modification at one or both of positions K360 or N390, where the amino acid modification at position S400 is S400E, S400D, S400R or S400K; the amino acid modification at position Q347 is Q347R, Q347E or Q347K; the amino acid modification at position K360 is K360D or K360E, and the amino acid modification at position N390 is N390R, N390K or N390
- the multi-specific antigen-binding construct comprises a heterodimeric Fc comprising a modified CH3 domain comprising the modifications of any one of Variant 1, Variant 2, Variant 3, Variant 4 or Variant 5, as shown in Table A.
- the multi-specific antigen-binding construct comprises a heterodimeric Fc comprising a modified CH3 domain having a first CH3 sequence having amino acid modifications at positions F405 and Y407, and a second CH3 sequence having amino acid modifications at position T394.
- the heterodimeric Fc comprises a modified CH3 domain with a first CH3 sequence having one or more amino acid modifications selected from L351Y, F405A, and Y407V, and the second CH3 sequence having one or more amino acid modifications selected from T366L, T366I, K392L, K392M, and T394W.
- the multi-specific antigen-binding construct comprises a heterodimeric Fc comprising a modified CH3 domain having a first CH3 sequence having amino acid modifications at positions L351, F405 and Y407, and a second CH3 sequence having amino acid modifications at positions T366, K392, and T394, and one of the first or second CH3 sequences further comprising amino acid modifications at position Q347, and the other CH3 sequence further comprising amino acid modification at position K360.
- the heterodimeric Fc comprises a modified CH3 domain with a first CH3 sequence having amino acid modifications at positions L351, F405 and Y407, and a second CH3 sequence having amino acid modifications at position T366, K392, and T394, one of the first or second CH3 sequences further comprising amino acid modifications at position Q347, and the other CH3 sequence further comprising amino acid modification at position K360, and one or both of said CH3 sequences further comprise the amino acid modification T350V.
- the multi-specific antigen-binding construct comprises a heterodimeric Fc comprising a modified CH3 domain having a first CH3 sequence having amino acid modifications at positions L351, F405 and Y407, and a second CH3 sequence having amino acid modifications at positions T366, K392, and T394 and one of said first and second CH3 sequences further comprising amino acid modification of D399R or D399K and the other CH3 sequence comprising one or more of T411E, T411D, K409E, K409D, K392E and K392D.
- the heterodimeric Fc comprises a modified CH3 domain with a first CH3 sequence having amino acid modifications at positions L351, F405 and Y407, and a second CH3 sequence having amino acid modifications at positions T366, K392, and T394, one of said first and second CH3 sequences further comprises amino acid modification of D399R or D399K and the other CH3 sequence comprising one or more of T41 IE, T41 ID, K409E, K409D, K392E and K392D, and one or both of said CH3 sequences further comprise the amino acid modification T350V.
- the multi-specific antigen-binding construct comprises a heterodimeric Fc comprising a modified CH3 domain having a first CH3 sequence having amino acid modifications at positions L351, F405 and Y407, and a second CH3 sequence having amino acid modifications at positions T366, K392, and T394, wherein one or both of said CH3 sequences further comprise the amino acid modification of T350V.
- the multi-specific antigen-binding construct comprises a heterodimeric Fc comprising a modified CH3 domain having a first polypeptide sequence that comprises an amino acid modification at position Y407, and a second polypeptide sequence that comprises amino acid modifications at positions T366 and K409.
- a first polypeptide sequence of the modified CH3 domain comprises an amino acid modification at position Y407
- a second polypeptide sequence of the modified CH3 domain comprises amino acid modifications at positions T366 and K409
- the amino acid modification at position Y407 is Y407A, Y407I, Y407L or Y407V
- the amino acid modification at position T366 is T366A, T366I, T366L, T366M or T366V
- the amino acid modification at position K409 is K409F, K409I, K409S or K409W.
- the one or more asymmetric amino acid modifications comprised by the Fc can promote the formation of a heterodimeric Fc in which the heterodimeric CH3 domain has a stability that is comparable to a wild-type homodimeric CH3 domain. In some embodiments, the one or more asymmetric amino acid modifications promote the formation of a heterodimeric Fc domain in which the heterodimeric Fc domain has a stability that is comparable to a wild-type homodimeric Fc domain.
- the stability of the CH3 domain can be assessed by measuring the melting temperature (Tm) of the CH3 domain, for example by differential scanning calorimetry (DSC).
- Tm melting temperature
- DSC differential scanning calorimetry
- the one or more asymmetric amino acid modifications promote the formation of a heterodimeric Fc domain in which the CH3 domain has a stability as observed via the melting temperature (Tm) in a differential scanning calorimetry study that is within about 8°C, for example, within about 7°C, about 6°C, about 5°C, or about 4°C, of that observed for the corresponding symmetric wild-type homodimeric CH3 domain.
- the CH3 domain of the heterodimeric Fc may have a melting temperature (Tm) of about 68°C or higher, about 70°C or higher, about 72°C or higher, 73°C or higher, about 75°C or higher, about 78°C or higher, about 80°C or higher, about 82°C or higher, or about 84°C or higher.
- Tm melting temperature
- a heterodimeric Fc comprising modified CH3 sequences can be formed with a purity of at least about 75% as compared to homodimeric Fc in the expressed product.
- the heterodimeric Fc is formed with a purity greater than about 80%, greater than about 85%, greater than about 90%, greater than about 95% or greater than about 97%. In some embodiments, the Fc is a heterodimer formed with a purity greater than about 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98 or 99% when expressed.
- Additional methods for modifying monomeric Fc polypeptides to promote heterodimeric Fc formation include, for example, those described in International Patent Publication No. WO 96/027011 (knobs into holes), in Gunasekaran et al. J Biol Chem, 285, 19637-46 (2010) (electrostatic design to achieve selective heterodimerization), in Davis et al, Prot Eng Des Sel, 23(4): 195-202 (2010) (strand exchange engineered domain (SEED) technology), and in Labrijn et al, Proc Natl Acad Sci USA, 110(13):5145-50 (2013) (Fab-arm exchange).
- SEED strand exchange engineered domain
- the multi-specific antigen-binding construct comprises an Fc comprising a CH2 domain.
- Fc Fc receptors
- Fc receptor is used to describe a receptor that binds to the Fc region of an antibody.
- an FcR can be a native sequence human FcR.
- an FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
- FcyRII receptors include FcyRIIA (an "activating receptor") and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
- FcR also includes in certain embodiments the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al, J. Immunol. 117:587 (1976) and Kim et al, J. Immunol. 24:249 (1994)).
- Modifications in the CH2 domain can affect the binding of FcRs to the Fc.
- a number of amino acid modifications in the Fc region are known in the art for selectively altering the affinity of the Fc for different Fcgamma receptors.
- the Fc comprised by the multi-specific antigen-binding construct may comprise one or more modifications to promote selective binding of Fc-gamma receptors.
- Non-limiting examples of modifications that alter the binding of the Fc by FcRs include: S298A/E333A/K334A and S298A/E333A/K334A/K326A (Lu, et al , J Immunol Methods, 365(1-2): 132-41 (2011)); F243L/R292P/Y300L/V305I/P396L and F243L/R292P/Y300L/L235V/P396L (Stavenhagen, et al, Cancer Res, 67(18):8882-90 (2007) and Nordstrom JL, et al, Breast Cancer Res, 13(6):R123 (2011)); F243L (Stewart, et al , Protein Eng Des Sel.
- S239D/D265S/S298A/I332E examples include S239E/S298A/K326A/A327H; G237F/S298A/A330L/I332; S239D/I332E/S298A;S239D/K326E/A330L/I332E/S298A; G236A/S239D/D270L/I332E; S239E/S267E/H268D; L234F/S267E/N325L; G237F/V266L/S267D, and other mutations described in International Patent Publication No. WO 2011/120134.
- the multi-specific antigen-binding construct comprises an Fc including a CH2 domain comprising one or more asymmetric amino acid modifications. In some embodiments, the multi-specific antigen-binding construct comprises an Fc including a CH2 domain comprising asymmetric modifications that provide superior biophysical properties, for example stability and/or ease of manufacture, relative to an antigen-binding construct which does not include the asymmetric modifications.
- a multi-specific antigen-binding construct comprising an Fc region may include modifications to improve its ability to mediate effector function. Such modifications are known in the art and include afucosylation, or engineering of the affinity of the Fc towards an activating receptor, mainly FcyRIIIa for ADCC, and towards Clq for CDC.
- the multi-specific antigen-binding constructs may be aglycosylated.
- the multi-specific antigen-binding constructs may be fully afucosylated (i.e.
- the multi-specific antigen-binding construct contains less than 95%, less than 85%, less than 75%, less than 65%, less than 55%, less than 45%, less than 35%, less than 25%, less than 15% or less than 5% of the amount of fucose normally detected for a similar construct produced by a mammalian expression system.
- Fc modifications reducing FcyR and/or complement binding and/or effector function are known in the art and include those described above.
- Various publications describe strategies that have been used to engineer antibodies with reduced or silenced effector activity (see, for example, Strohl, Curr Opin Biotech 20:685-691 (2009), and Strohl & Strohl, "Antibody Fc engineering for optimal antibody performance” In Therapeutic Antibody Engineering, Cambridge: Woodhead Publishing (2012), pp 225-249). These strategies include reduction of effector function through modification of glycosylation, use of IgG2/IgG4 scaffolds, or the introduction of mutations in the hinge or CH2 regions of the Fc (see also, U.S. Patent Publication No.
- the multi-specific antigen-binding construct comprises an Fc that comprises at least one amino acid modification identified in Table B. In some embodiments, the multi-specific antigen-binding construct comprises an Fc that comprises amino acid modification of at least one of L234, L235, or D265. In some embodiments, the multi-specific antigen-binding construct comprises an Fc that comprises amino acid modifications at L234, L235 and D265. In some embodiments, the multi-specific antigen- binding construct comprises an Fc that comprises the amino acid modifications L234A, L235A and D265S.
- the multi-specific antigen-binding constructs described herein include two or more antigen-binding polypeptide constructs and one or more linkers.
- the linkers may, for example, function to join two domains of an antigen-binding polypeptide construct (such as the VH and VL of an scFv or diabody), or they may function to join two antigen-binding polypeptide constructs together (such as two or more Fabs or sdAbs), or they may function to join an antigen-binding polypeptide construct to a scaffold.
- the multi-specific antigen-binding constructs may comprise multiple linkers (i.e.
- a multi-specific antigen-binding construct one or more scFvs linked to a scaffold may comprise a linker joining the VH and VL of the scFv and a linker joining the scFv to the scaffold.
- Appropriate linkers are known in the art and can be readily selected by the skilled artisan based on the intended use of the linker (see, for example, Miiller & Kontermann, "Bispecific Antibodies” in Handbook of Therapeutic Antibodies, Wiley -VCH Verlag GmbH & Co. (2014)).
- Useful linkers include glycine-serine (GlySer) linkers, which are well-known in the art and comprise glycine and serine units combined in various orders. Examples include, but are not limited to, (GS) bombard, (GSGGS) n , (GGGS) n and (GGGGS) n , where n is an integer of at least one, typically an integer between 1 and about 10, for example, between 1 and about 8, between 1 and about 6, or between 1 and about 5.
- GlySer glycine-serine
- linker include sequences derived from immunoglobulin hinge sequences.
- the linker may comprise all or part of a hinge sequence from any one of the four IgG classes and may optionally include additional sequences.
- the linker may include a portion of an immunoglobulin hinge sequence and a glycine-serine sequence.
- a non- limiting example is a linker that includes approximately the first 15 residues of the IgGl hinge followed by a GlySer linker sequence, such as those described above, that is about 10 amino acids in length.
- the length of the linker will vary depending on its application. Appropriate linker lengths can be readily selected by the skilled person. For example, when the linker is to connect the VH and VL domains of an scFv, the linker is typically between about 5 and about 20 amino acids in length, for example, between about 10 and about 20 amino acid in length, or between about 15 and about 20 amino acids in length. When the linker is to connect the VH and VL domains of a diabody, the linker should be short enough to prevent association of these two domains within the same chain. For example, the linker may be between about 2 and about 12 amino acids in length, such as, between about 3 and about 10 amino acids in length, or about 5 amino acids in length.
- the linker when the linker is to connect two Fab fragments, the linker may be selected such that it maintains the relative spatial conformation of the paratopes of a F(ab') fragment, and is capable of forming a covalent bond equivalent to the disulphide bond in the core hinge of IgG.
- suitable linkers include IgG hinge regions such as, for example those from IgGl, IgG2 or IgG4. Modified versions of these exemplary linkers can also be used. For example, modifications to improve the stability of the IgG4 hinge are known in the art (see for example, Labrijn et al, Nature Biotechnology, 27:767-771 (2009)).
- the multi-specific antigen-binding construct comprises a linker operably linking an antigen-binding polypeptide construct to a scaffold as described herein.
- the multi-specific antigen-binding construct comprises an Fc coupled to the one or more antigen-binding polypeptide constructs with one or more linkers.
- the multi-specific antigen-binding construct comprises an Fc coupled to the heavy chain of each antigen-binding polypeptide construct by a linker.
- the multi-specific antigen-binding constructs described herein comprise an antigen- binding polypeptide construct that binds to an immunotherapeutic.
- the immunotherapeutic may be an effector cell, such as a T-cell or a NK cell, engineered to express an antigen-binding domain, or the immunotherapeutic may be a therapeutic agent, such as an antibody or antibody fragment, capable of binding to a T-cell and to a tumour-associated antigen.
- the immunotherapeutic is an engineered T-cell or NK cell.
- the antigen-binding domain comprised by the T-cell or NK cell is part of an engineered receptor.
- the antigen-binding domain comprised by the engineered T-cell or NK cell may be, for example, part of a chimeric antigen receptor (CAR) or a T-cell receptor (TCR), such as a transgenic or recombinant TCR.
- the multi-specific antigen-binding construct binds to an extracellular portion of the CAR or TCR.
- the multi-specific antigen-binding construct may bind to the antigen-binding domain of the CAR or TCR, or it may bind to an extracellular region of the CAR or TCR that is not involved in antigen binding.
- CAR and TCR constructs may be designed to include a "tag," which is typically a short amino acid sequence that is specifically recognized by an antibody.
- the immunotherapeutic is a T-cell or a NK cell engineered to express a CAR or TCR which includes a tag.
- the multi-specific antigen-binding construct may bind to the tag or it may bind to a region of the CAR or TCR other than the tag.
- the multi-specific antigen- binding construct binds to a region of the CAR or TCR other than the tag.
- the immunotherapeutic is a T-cell or a NK cell engineered to express a CAR or TCR which does not include a tag. In some embodiments, the immunotherapeutic is a T-cell or a NK cell engineered to express a CAR or TCR which does not include a tag or any heterologous tumour-associated antigens or fragments of tumour- associated antigens.
- the immunotherapeutic is a T-cell or a NK cell engineered to express a CAR and the multi-specific antigen-binding construct binds to an extracellular part of the CAR.
- a CAR is a cell-surface receptor comprising an extracellular domain, a transmembrane domain and a cytoplasmic domain in a combination that is not naturally found in a single protein.
- the extracellular domain comprises an antigen-binding domain, which may be an antibody or antibody fragment.
- the antibody or antibody fragment may be a human antibody or fragment, humanized antibody or fragment or a non-human antibody or fragment.
- the antigen-binding domain is an antibody fragment, such as a Fab or scFv.
- the antigen-binding domain is an scFv.
- the extracellular domain also typically comprises a spacer (or hinge) region linking the antigen-binding domain to the transmembrane domain.
- the spacer region may be derived from an immunoglobulin, such as IgGl or IgG4, or it may be derived from altemative cell-surface proteins, including, but not limited to, CD4, CD8, or CD28.
- the transmembrane domain of the CAR links the extracellular domain to the cytoplasmic domain.
- the transmembrane domain is derived from a type I membrane protein, such as CD3 zeta, CD4, CD8 or CD28.
- the transmembrane domain may be modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
- transmembrane domains include those derived from the alpha, beta or zeta chain of the T-cell receptor, CD3 epsilon, CD45, CD5, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154 or ICOS.
- the cytoplasmic domain of the CAR comprises at least one intracellular signalling domain and is responsible for activation of at least one of the normal effector functions of the immune cell into which the CAR has been placed.
- effector function refers to a specialized function of a cell. Effector function of a T-cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines.
- intracellular signalling domain refers to the portion of a protein that transduces the effector function signal and directs the cell to perform a specialized function.
- intracellular signalling domains frequently used in CARs include the cytoplasmic sequences of the TCR and co- receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as derivatives or variants of these sequences having the same functional capability.
- T- cell activation can be said to be mediated by two distinct classes of cytoplasmic signalling sequence: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signalling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signalling sequences).
- primary cytoplasmic signalling sequences those that initiate antigen-dependent primary activation through the TCR
- secondary cytoplasmic signalling sequences those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal
- Primary cytoplasmic signalling sequences regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way.
- Primary cytoplasmic signalling sequences that act in a stimulatory manner may contain signalling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
- ITAM containing primary cytoplasmic signalling sequences examples include those derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CD3 zeta, CD5, CD22, CD79a, CD79b and CD66d.
- the cytoplasmic domain in a CAR will comprise a cytoplasmic signalling sequence derived from CD3 zeta.
- the cytoplasmic domain of the CAR may comprise an ITAM containing primary cytoplasmic signalling sequence by itself or combined with one or more co-stimulatory domains.
- a co-stimulatory domain is derived from the intracellular domain of a co-stimulatory molecule.
- a co-stimulatory molecule is a cell surface molecule other than an antigen receptor that is required for an efficient response of lymphocytes to an antigen. Examples of such molecules include CD27, CD28, 4-lBB (CD 137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C and B7-H3.
- CARs comprise one or more co-stimulatory domains derived from 4-lBB, CD28 or OX40.
- First generation CARs include only a CD3 zeta-derived intracellular signalling domain
- second generation CARs include a CD3 zeta-derived intracellular signalling domain, together with a co-stimulatory domain derived from either 4- IBB or CD28.
- Third generation CARs include a CD3 zeta-derived intracellular signalling domain, together with two co-stimulatory domains, the first co-stimulatory domain derived from either 4-lBB or CD28, and the second co-stimulatory domain derived from 4-lBB, CD28 or OX40.
- Table 1 Examples of CAR constructs currently in development, and their component domains are provided in Table 1.
- the immunotherapeutic targeted by the multi-specific antigen-binding construct is a T-cell engineered to express a CAR (CAR-T).
- the immunotherapeutic is a CAR-T and an antigen-binding polypeptide construct of the multi-specific antigen-binding construct binds to the antigen-binding domain of the CAR.
- the antigen-binding polypeptide construct may comprise an anti-idiotype antibody or antigen-binding fragment thereof.
- Antigens targeted by CARs are typically cell surface tumour-associated antigens.
- tumour-associated antigen refers to an antigen that is expressed by cancer cells.
- a tumour-associated antigen may or may not be expressed by normal cells.
- a tumour-associated antigen When a tumour-associated antigen is not expressed by normal cells (i.e. when it is unique to tumour cells) it may also be referred to as a "tumour-specific antigen.”
- a tumour-associated antigen When a tumour-associated antigen is not unique to a tumour cell, it is also expressed on a normal cell under conditions that fail to induce a state of immunologic tolerance to the antigen. The expression of the antigen on the tumour may occur under conditions that enable the immune system to respond to the antigen.
- Tumour-associated antigens may be antigens that are expressed on normal cells during fetal development when the immune system is immature and unable to respond, or they may be antigens that are normally present at low levels on normal cells but which are expressed at much higher levels on tumour cells. Those tumour-associated antigens of greatest clinical interest are differentially expressed compared to the corresponding normal tissue and allow for a preferential recognition of tumour cells by specific T-cells or immunoglobulins.
- tumour- associated antigens targeted by CARs or engineered TCRs currently in clinical development include NY-ESO (New York Esophageal Squamous Cell Carcinoma 1), MART-1 (melanoma antigen recognized by T cells 1, also known as Melan-A), HPV (human papilloma virus) E6, BCMA (B-cell maturation antigen), CD123, CD133, CD171, CD19, CD20, CD22, CD30, CD33, CEA (carcinoembryonic antigen), EGFR (epidermal growth factor receptor), EGFRvIII (epidermal growth factor receptor variant III), EpCAM (epithelial cell adhesion molecule), EphA2 (ephrin type-A receptor 2), disialoganglioside GD2, GPC3 (glypican-3), HER2, IL13Ralpha2 (Interleukin 13 receptor subunit alpha-2), LeY (a difucosylated type 2 blood group-related antigen
- the multi-specific antigen-binding construct comprises an antigen-binding polypeptide construct derived from an anti-idiotype antibody or antigen-binding fragment thereof, wherein the anti-idiotype antibody is an anti-idiotype antibody of NY-ESO-1, MART-1, HPV E6, BCMA, CD123, CD133, CD171, CD19, CD20, CD22, CD30, CD33, CEA, EGFR, EGFRvIII, EpCAM, EphA2, disialoganglioside GD2, GPC3, HER2, IL13Ralpha2, LeY, MAGE- A3, melanoma glycoprotein, mesothelin, MUC1, myelin, NKG2D ligands, PSMA or ROR1.
- the anti-idiotype antibody is an anti-idiotype antibody of NY-ESO-1, MART-1, HPV E6, BCMA, CD123, CD133, CD171, CD19, CD20, CD22, CD30, CD33, CEA, EGFR, EGFRv
- the multi-specific antigen- binding construct comprises an antigen-binding polypeptide construct derived from an antiidiotype antibody specific for an anti-CD 19 antibody, or antigen-binding fragment of the anti- idiotype antibody. In some embodiments, the multi-specific antigen-binding construct comprises an antigen-binding polypeptide construct derived from an anti-idiotype antibody specific for an anti-mesothelin antibody, or antigen-binding fragment of the anti-idiotype antibody.
- a number of anti-idiotype antibodies are known in the art.
- International Patent Application Publication No. WO 2014/190273 and Jena et al. PLOS One, 8:3 e57838 (2013) describe an anti-idiotype antibody (mAb clone no. 136.20.1) that recognizes the anti- CD ⁇ scFv FMC63, which is used in a number of CAR constructs in current development.
- the sequence of the VH and VL of mAb clone no. 136.20.1 are provided in Table 5 (SEQ ID NOs: 1 and 2, respectively).
- the multi-specific antigen-binding construct comprises an antigen-binding polypeptide construct derived from an anti-idiotype antibody specific for an anti-CD 19 antibody, or antigen-binding fragment of the anti-idiotype antibody, that may have one or more of the same CDRs (i.e. one or more of, or all of, VH CDRl, VH CDR2, CH CDR3, VL CDRl, VL CDR2, and VL CDR3, using the Kabat definition, the Chothia definition, or a combination of the Kabat and Chothia definitions) as mAb clone no. 136.20.1.
- the multi-specific antigen-binding construct comprises an antigen-binding polypeptide construct derived from an anti-idiotype antibody specific for an anti-CD 19 antibody, or antigen-binding fragment of the anti-idiotype antibody, that may have one or more (for example, two) variable regions from mAb clone no. 136.20.1.
- the multi-specific antigen-binding construct comprises an antigen-binding polypeptide construct derived from an anti-idiotype antibody specific for an anti-CD 19 antibody, or antigen-binding fragment of the anti-idiotype antibody, that binds to the same epitope as mAb clone no. 136.20.1.
- anti-idiotype antibodies include those that are commercially available from AbD Serotec®, an anti-idiotype antibody specific for an anti-CD22 antibody described in International Patent Publication No. WO 2013/188864, an anti-idiotype antibody specific for an anti-CEA antibody described in International Patent Publication No. WO 97/34636, an anti-idiotype antibody specific for an anti-GD2 antibody described in U.S. Patent No. 5,935,821, and an anti-idiotype antibody specific for an anti-NY-ESO-1 antibody described in Jakka et al. , Anticancer Research, 33: 10, 4189-420 (2013).
- Custom anti-idiotype antibodies may also be obtained from AbD Serotec®.
- anti-idiotype antibodies to CARs targeting CD19 or other tumour- associated antigens may be made according to the method described in Jena et al., PLOS One, 8:3 e57838 (2013), and used for the construction of an anti-idiotype antigen-binding polypeptide construct.
- the multi-specific antigen-binding construct comprises an antigen-binding polypeptide construct that binds to an extracellular region of a CAR that is not involved in antigen binding.
- the antigen-binding polypeptide construct may bind to a hinge region of the CAR.
- the hinge region may be an scFv-CD28 or scFv-CD8 junction, which comprises neo-epitopes that may be targeted by the antigen-binding polypeptide constructs.
- the hinge region may comprise mutated (Fc-binding null) IgG CH2/3 that may be targeted by the antigen- binding polypeptide constructs.
- the hinge region may comprise a spacer such as a Strep-tag II as described by Liu et al. (Nature Biotechnology, 34, 430-434 (2016)) that may be targeted by the antigen-binding polypeptide constructs.
- an anti-CAR antibody that binds to a hinge region of the CAR molecule is the 2D3 antibody described in International Patent Application Publication No. WO 2014/190273, which binds to an IgG4 CH2-CH3 hinge region.
- the multi-specific antigen-binding construct comprises an antigen-binding polypeptide construct that binds to an IgG4 CH2-CH3 hinge region.
- the multi-specific antigen-binding construct comprises an antigen-binding polypeptide construct that binds to an IgG4 CH2-CH3 hinge region and has one or more of the same CDRs (i.e.
- the multi-specific antigen-binding construct comprises an antigen-binding polypeptide construct that binds to an IgG4 CH2-CH3 hinge region and binds to the same epitope as 2D3 as described in WO 2014/190273.
- the immunotherapeutic is an engineered T-cell or NK cell that expresses an engineered TCR and the multi-specific antigen-binding construct binds an extracellular part of the TCR.
- Native TCRs comprise two different protein chains, an alpha and beta chain.
- the TCRalpha/beta pair is expressed on the T-cell surface in a complex with CD3 epsilon, CD3 gamma, CD3 delta and CD3 epsilon.
- the native alpha and beta chains of a TCR are modified to introduce an improved or new specificity for a tumour-associated antigen.
- a multi-specific antigen-binding construct as described herein comprises a antigen-binding polypeptide construct targeting an engineered TCR immunotherapeutic
- the antigen-binding polypeptide construct will typically target the antigen-binding domain of the TCR.
- the immunotherapeutic is a T-cell or NK cell comprising an engineered TCR
- the antigen-binding polypeptide construct of the multi- specific antigen-binding construct may be derived from an anti-idiotype antibody or fragment thereof, as described above.
- Antigen-binding polypeptide constructs that bind to a non-antigen binding region of an engineered TCR are also contemplated in some embodiments, for example, where the engineered TCR includes one or more non-native sequences in the non-antigen binding domains to which the antigen-binding polypeptide construct could be targeted.
- the antigen-binding polypeptide construct is targeted to the engineered TCR Valpha or Vbeta region.
- the antigen-binding polypeptide construct may also bind to native TCRs as engineered TCR V region domains would also be present in the endogenous TCR repertoire, but at very low frequencies.
- engineered TCRs may be targeted to intracellular tumour-associated antigens.
- intracellular tumour-associated antigens include, but are not limited to, peptides derived from NY-ESO-1, MART- 1, WT-1, HPV E6 or HPV E7.
- the multi-specific antigen- binding construct comprises an antigen-binding polypeptide construct that is derived from an anti-TCR idiotype antibody, wherein the TCR specifically binds MHC complexes containing peptides derived from, for example, NY-ESO, MART-1, WT-1, HPV-E6 or HPV-E7, or an antigen-binding fragment of such an anti-TCR idiotype antibody.
- the multi-specific antigen-binding construct comprises an antigen-binding polypeptide construct derived from an anti-TCR idiotype (or clonotype) antibody, wherein the TCR specifically binds MHC complexes containing peptides derived from NY-ESO, MART-1 or HPV-E6, or an antigen-binding fragment of such an anti-TCR idiotype/clonotype antibody.
- Anti-TCR idiotype/clonotype antibodies are well-known in the art and include, but are not limited to, 6B11 (Montoya, et al, Immunology, 122(1): 1-14 (2007)) and KJI-26 (Haskins, et al, J Exp Med, 157(4): 1149-69 (1983)).
- the immunotherapeutic may be a therapeutic agent, such as an antibody or antibody fragment, capable of binding to a T-cell and to a tumour-associated antigen.
- the therapeutic agent typically comprises at least two antigen-binding domains, one of which binds to an extracellular portion of the T-cell and the other binds to the tumour-associated antigen.
- therapeutic agents include, for example, bispecific T-cell engagers (BiTEs), such as blinotumumab, which targets CD3 and CD 19, and solitomab, which targets CD3 and EpCAM, and other "T-cell engaging" antibodies or antibody fragments.
- the antigen-binding polypeptide construct of the multi-specific antigen-binding construct typically binds to the antigen-binding domain of the therapeutic agent.
- the antigen-binding polypeptide construct of the multi-specific antigen-binding construct may be derived from an anti-idiotype antibody or fragment thereof, as described above.
- the antigen-binding polypeptide construct is derived from an anti-idiotype antibody specific for an anti-CD 19 antibody or an anti-EpCAM antibody, or an antigen-binding fragment of the anti-idiotype antibody. Examples of such anti-idiotype antibodies include those described above.
- the immunotherapeutic targeted antigen-binding polypeptide construct comprised by the multi-specific antigen-binding constructs described herein may be in any one of various known formats, including for example, a Fab format, scFv format or sdAb format.
- the immunotherapeutic targeted antigen-binding polypeptide construct may be in a Fab or scFv format.
- the immunotherapeutic targeted antigen- binding polypeptide construct may be in a non-immunoglobulin based antibody mimetic format as described above.
- the multi-specific antigen-binding constructs described herein comprise at least one antigen-binding polypeptide construct that binds to a tumour-associated antigen (TAA).
- TAA tumour-associated antigen
- the multi-specific antigen-binding constructs comprise two or more TAA-binding polypeptide constructs.
- each of the TAA-binding polypeptide constructs may bind a different TAA, or two or more of the TAA-binding polypeptide constructs may bind different epitopes on the same TAA.
- TAAs are defined above and include antigens that are expressed only by tumour cells (tumour-specific antigens), as well as antigens that are expressed on both tumour cells and normal cells, but typically at a lower level on normal cells.
- TAAs antigens that are expressed only by tumour cells
- antigens that are expressed on both tumour cells and normal cells but typically at a lower level on normal cells.
- Selection of a TAA as a target for the multi-specific antigen-binding constructs described herein will be dependent on the intended use of the multi-specific antigen-binding construct.
- the multi-specific antigen-binding construct binds to an immunotherapeutic that targets a TAA, and also itself binds to a TAA.
- the TAA epitope bound by the multi-specific antigen-binding construct is different to the TAA epitope bound by the immunotherapeutic.
- the multi-specific antigen-binding construct and the immunotherapeutic may both target the same TAA but bind to different epitopes on the antigen molecule, or they may target different TAAs.
- the multi-specific antigen-binding construct and the immunotherapeutic target different TAAs.
- the different antigens will typically both be associated with the same type of cancer.
- targeting TAAs that are associated with different types of cancer is also contemplated in certain embodiments.
- TAAs examples include, but are not limited to, 17-lA-antigen, alpha-fetoprotein (AFP), alpha- actinin-4, A3, antigen specific for A33 antibody, ART-4, B7, Ba 733, BAGE, bcl-2, bcl-6, BCMA, BrE3-antigen, CA125, CAMEL, CAP-1, carbonic anhydrase IX (CAIX), CASP-8/m, CCL19, CCL21, CD1, CDla, CD2, CD3, CD4, CD5, CD8, CD11A, CD14, CD15, CD16, CD18, CD19, CD20, CD21, CD22, CD23, CD25, CD29, CD30, CD32b, CD33, CD37, CD38, CD40, CD40L, CD44, CD45, CD46, CD52, CD54, CD55, CD59, CD64, CD66a-e, CD67, CD70, CD
- the TAA targeted by the multi-specific antigen-binding construct is an antigen associated with a hematological cancer.
- antigens include, but are not limited to, BCMA, C5, CD19, CD20, CD22, CD25, CD30, CD33, CD38, CD40, CD45, CD52, CD56, CD66, CD74, CD79a, CD79b, CD80, CD138, CTLA-4, CXCR4, DKK, EphA3, GM2, HLA-DR beta, integrin ⁇ 3, IGF-R1, IL6, KIR, PD-1, PD-L1, TRAILRl, TRAILR2, transferrin receptor and VEGF.
- the TAA is an antigen expressed by malignant B cells, such as CD19, CD20, CD22, CD25, CD38, CD40, CD45, CD74, CD80, CTLA-4, IGF-R1, IL6, PD-1, TRAILR2 or VEGF.
- the TAA targeted by the multi-specific antigen-binding construct is an antigen associated with a solid tumour.
- antigens include, but are not limited to, CAIX, cadherins, CEA, c-MET, CTLA-4, EGFR family members, EpCAM, EphA3, FAP, folate-binding protein, FR-alpha, gangliosides (such as GC2, GD3 and GM2), HER2, HER3, IGF-1R, integrin ⁇ 3, integrin ⁇ 5 ⁇ 1, e 1 , Livl, mesothelin, mucins, NaPi2b, PD-1, PD-L1, PD-1 receptor, pgA33, PSMA, RANKL, ROR1, TAG-72, tenascin, TRAILR1, TRAILR2, VEGF, VEGFR, and others listed above.
- the TAA-binding polypeptide construct(s) comprised by the multi-specific antigen- binding constructs may be in any one of various known formats, including for example, a Fab format, scFv format or sdAb format.
- the TAA-binding polypeptide construct comprised by the multi-specific antigen-binding construct may be a natural ligand for the TAA, or a functional fragment of the natural ligand.
- the multi- specific antigen-binding construct comprises more than one TAA-binding polypeptide construct.
- the TAA-binding polypeptide constructs may be linked together, for example, as a Fab-Fab, an scFv-scFv or a Fab-scFv, as shown in Fig. IB.
- Other formats are also contemplated including, for example, multi-specific antigen binding constructs comprising an Fc and two or more antigen binding polypeptide constructs each targeting a TAA in which the antigen binding polypeptide constructs are linked to different parts of the Fc.
- the one or more TAA-binding polypeptide constructs are in a Fab or scFv format, or a combination thereof.
- the antigen-binding polypeptide constructs can be derived from known antibodies directed against a TAA or their binding domains or fragments of the antibodies. Examples of types of binding domains include Fab fragments, scFvs, and sdAbs. Furthermore, if the antigen-binding moieties of a known anti-TAA antibody or binding domain is a Fab, the Fab can be converted to an scFv. Likewise, if the antigen-binding moiety of a known anti-TAA antibody or binding domain is an scFv, the scFv can be converted to a Fab.
- Known antibodies directed against TAAs may be commercially obtained from a number of known sources. For example, a variety of antibody secreting hybridoma lines are available from the American Type Culture Collection (ATCC, Manassas, Va.). A number of antibodies against various TAAs have been deposited at the ATCC and/or have published variable region sequences and may be used to prepare the multi-specific antigen-binding constructs in certain embodiments. The skilled artisan will appreciate that antibody sequences or antibody-secreting hybridomas against various TAAs may be obtained by a simple search of the ATCC, NCBI and/or USPTO databases.
- TAA-targeted antibodies that may be of use in preparing the multi-specific antigen-binding constructs described herein include, but are not limited to, LL1 (anti-CD74), LL2 or RFB4 (anti-CD22), veltuzumab (hA20, anti-CD20), rituxumab (anti-CD20), obinutuzumab (GA101, anti-CD20), daratumumab (anti-CD38), lambrolizumab (anti-PD-1 receptor), nivolumab (anti-PD-1 receptor), ipilimumab (anti-CTLA-4), RS7 (anti-TROP-2), PAM4 or KC4 (both anti-mucin), MN-14 (anti-CEA), MN-15 or MN-3 (anti-CEACAM6), Mu-9 (anti-colon-specific antigen-p), Immu 31 (an anti-alpha-fetoprotein), Rl (anti-IGF-lR), A
- the TAA-binding polypeptide construct comprised by the multi-specific antigen binding construct is derived from a humanized, or chimeric version of a known antibody.
- "Humanized" forms of non-human (e.g. rodent) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
- humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
- framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues.
- humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable regions correspond to those of a non-human immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
- the humanized antibody may optionally also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- antibodies to a specific target TAA of interest may be generated by standard techniques and used as a basis for the preparation of the TAA-binding polypeptide construct(s) of the multi-specific antigen-binding construct.
- the multi-specific antigen-binding constructs described herein may be produced using standard recombinant methods known in the art (see, e.g., U. S. Patent No. 4,816,567 and "Antibodies: A Laboratory Manual," 2 nd Edition, Ed. Greenfield, Cold Spring Harbor Laboratory Press, New York, 2014).
- nucleic acid encoding the multi-specific antigen-binding construct is isolated and inserted into one or more vectors for further cloning and/or expression in a host cell.
- nucleic acid may be readily isolated and sequenced using conventional procedures (e.g. by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the multi-specific antigen-binding construct).
- Suitable host cells for cloning or expression of antigen-binding construct-encoding vectors include prokaryotic or eukaryotic cells described herein.
- a "recombinant host cell” or “host cell” refers to a cell that includes an exogenous polynucleotide, regardless of the method used for insertion, for example, direct uptake, transduction, f-mating, or other methods known in the art to create recombinant host cells.
- the exogenous polynucleotide may be maintained as a nonintegrated vector, for example, a plasmid, or alternatively, may be integrated into the host genome.
- the term "eukaryote” refers to organisms belonging to the phylogenetic domain Eucarya such as animals (including but not limited to, mammals, insects, reptiles and birds), ciliates, plants (including but not limited to, monocots, dicots and algae), fungi, yeasts, flagellates, microsporidia, protists, and the like.
- prokaryote refers to prokaryotic organisms.
- a non-eukaryotic organism can belong to the Eubacteria (including but not limited to,
- Archaea including but not limited to, Methanococcus jannaschii, Methanohacterium thermoautotrophicum, Halobacterium such as Haloferax volcanii and Halobacterium species NRC-1, Archaeoglobus
- a multi-specific antigen-binding construct may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed.
- antigen-binding construct fragments and polypeptides see, for example, U.S. Patent Nos. 5,648,237, 5,789,199, and 5,840,523. (See also Charlton, Methods in Molecular Biology, Vol. 248 (B.K.C. Lo, ed., Humana Press, Totowa, N.J., 2003), pp. 245-254, describing expression of antibody fragments in E. coli.)
- the antigen-binding construct may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
- eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for multi-specific antigen-binding construct-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been "humanized,” resulting in the production of an antigen-binding construct with a partially or fully human glycosylation pattern. See Gemgross, Nat. Biotech. 22: 1409-1414 (2004), and Li et al., Nat. Biotech. 24:210-215 (2006).
- Suitable host cells for the expression of glycosylated antigen-binding constructs are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of
- Plant cell cultures can also be utilized as hosts. See, e.g., U.S. Patent Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIESTM technology for producing antigen-binding constructs in transgenic plants).
- Vertebrate cells may also be used as hosts.
- mammalian cell lines that are adapted to grow in suspension may be useful.
- useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al, J.
- TM4 cells as described, e.g., in Mather, Biol Reprod, 23:243-251 (1980)); monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK); buffalo rat liver cells (BRL 3 A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumour (MMT 060562); TRI cells, as described, e.g., in Mather et al, Annals N.Y. Acad Sci, 383:44-68 (1982); MRC 5 cells; and FS4 cells.
- CHO Chinese hamster ovary
- DHFR CHO cells Urlaub et al, Proc Natl Acad Sci USA, 77:4216 (1980)
- myeloma cell lines such as Y0, NS0 and Sp2/0.
- the multi-specific antigen-binding constructs described herein are produced in stable mammalian cells by a method comprising transfecting at least one stable mammalian cell with nucleic acid encoding the multi-specific antigen-binding construct, in a predetermined ratio, and expressing the nucleic acid in the at least one mammalian cell.
- the predetermined ratio of nucleic acid is determined in transient transfection experiments to determine the relative ratio of input nucleic acids that results in the highest percentage of the multi-specific antigen-binding construct in the expressed product.
- the expression product of the stable mammalian cell comprises a larger percentage of the desired multi-specific antigen-binding construct as compared to the monomeric heavy or light chain polypeptides, or other antibodies.
- the multi-specific antigen-binding construct is glycosylated.
- the method further comprises identifying and purifying the desired multi-specific antigen-binding construct.
- identification is by one or both of liquid chromatography and mass spectrometry.
- the multi-specific antigen-binding constructs can be purified or isolated after expression. Proteins may be isolated or purified in a variety of ways known to those skilled in the art. Standard purification methods include chromatographic techniques, including ion exchange, hydrophobic interaction, affinity, sizing or gel filtration, and reversed-phase, carried out at atmospheric pressure or at high pressure using systems such as FPLC and HPLC. Purification methods also include electrophoretic, immunological, precipitation, dialysis, and chromatofocusing techniques. Ultrafiltration and diafiltration techniques, in conjunction with protein concentration, are also useful. As is well known in the art, a variety of natural proteins bind Fc and antibodies, and these proteins can be used for purification of antigen-binding constructs.
- the bacterial proteins A and G bind to the Fc region.
- the bacterial protein L binds to the Fab region of some antibodies.
- Purification can often be enabled by a particular fusion partner.
- antibodies may be purified using glutathione resin if a GST fusion is employed, Ni +2 affinity chromatography if a His-tag is employed, or immobilized anti-flag antibody if a flag-tag is used.
- suitable purification techniques see, e.g., Protein Purification: Principles and Practice, 3 rd Ed., Scopes, Springer-Verlag, NY (1994). The degree of purification necessary will vary depending on the use of the antigen-binding constructs. In some instances, no purification may be necessary.
- the multi-specific antigen-binding constructs may be purified using Anion Exchange Chromatography including, but not limited to, chromatography on Q- sepharose, DEAE sepharose, poros HQ, poros DEAF, Toyopearl Q, Toyopearl QAE, Toyopearl DEAE, Resource/Source Q and DEAE, Fractogel Q or DEAE columns, or their equivalents or comparables.
- Anion Exchange Chromatography including, but not limited to, chromatography on Q- sepharose, DEAE sepharose, poros HQ, poros DEAF, Toyopearl Q, Toyopearl QAE, Toyopearl DEAE, Resource/Source Q and DEAE, Fractogel Q or DEAE columns, or their equivalents or comparables.
- the multi-specific antigen-binding constructs may be purified using Cation Exchange Chromatography including, but not limited to, chromatography on SP- sepharose, CM sepharose, poros HS, poros CM, Toyopearl SP, Toyopearl CM, Resource/Source S or CM, or Fractogel S or CM columns, or their equivalents or comparables.
- Cation Exchange Chromatography including, but not limited to, chromatography on SP- sepharose, CM sepharose, poros HS, poros CM, Toyopearl SP, Toyopearl CM, Resource/Source S or CM, or Fractogel S or CM columns, or their equivalents or comparables.
- the multi-specific antigen-binding constructs are substantially pure.
- the term “substantially pure” refers to a construct described herein, or variant thereof, that may be substantially or essentially free of components that normally accompany or interact with the protein as found in its naturally occurring environment, i.e. a native cell, or host cell in the case of recombinantly produced construct.
- a construct that is substantially free of cellular material includes preparations of protein having less than about 30%, less than about 25%, less than about 20%, less than about 15%, less than about 10%, less than about 5%, less than about 4%, less than about 3%, less than about 2%, or less than about 1% (by dry weight) of contaminating protein.
- the protein in certain embodiments is present at about 30%, about 25%, about 20%, about 15%, about 10%, about 5%, about 4%, about 3%, about 2%, or about 1% or less of the dry weight of the cells.
- the protein in certain embodiments, is present in the culture medium at about 5 g/L, about 4 g/L, about 3 g/L, about 2 g/L, about 1 g/L, about 750 mg/L, about 500 mg/L, about 250 mg/L, about 100 mg/L, about 50 mg/L, about 10 mg/L, or about 1 mg/L or less.
- the term "substantially purified" as applied to a multi-specific antigen-binding construct comprising a heterodimeric Fc as described herein means that the heterodimeric Fc has a purity level of at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, specifically, a purity level of at least about 75%, 80%, 85%, and more specifically, a purity level of at least about 90%, a purity level of at least about 95%, a purity level of at least about 99% or greater as determined by appropriate methods such as SDS/PAGE analysis, RP-HPLC, size-exclusion chromotagraphy (SEC) and capillary electrophoresis.
- SDS/PAGE analysis RP-HPLC
- SEC size-exclusion chromotagraphy
- the multi-specific antigen-binding constructs may also be chemically synthesized using techniques known in the art (see, e.g., Creighton, Proteins: Structures and Molecular Principles, W. H. Freeman & Co., N.Y (1983), and Hunkapiller et al, Nature, 310: 105-111 (1984)).
- a polypeptide corresponding to a fragment of a polypeptide can be synthesized by use of a peptide synthesizer.
- nonclassical amino acids or chemical amino acid analogs can be introduced as a substitution or addition into the polypeptide sequence.
- Non-classical amino acids include, but are not limited to, to the D- isomers of the common amino acids, 2,4-diaminobutyric acid, alpha-amino isobutyric acid, 4aminobutyric acid, Abu, 2-amino butyric acid, g-Abu, e-Ahx, 6-amino hexanoic acid, Aib, 2- amino isobutyric acid, 3-amino propionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosine, citrulline, homocitrulline, cysteic acid, t-butylglycine, t- butylalanine, phenylglycine, cyclohexylalanine, ⁇ -alanine, fluoro-amino acids, designer amino acids such as a-methyl amino acids, Ca-methyl amino acids, Na-methyl amino acids, and amino acid analogs in general.
- nucleic acid encoding a multi-specific antigen-binding construct described herein.
- Such nucleic acid may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the multi-specific antigen-binding construct (e.g. the light and/or heavy chains of the antigen- binding construct).
- vectors e.g. expression vectors
- nucleic acid may be comprised by a single vector or it may be comprised by more than one vector. In some embodiments, the nucleic acid is comprised by a multicistronic vector.
- a host cell comprises (e.g. has been transformed with) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antigen-binding polypeptide construct and an amino acid sequence comprising the VH of the antigen-binding polypeptide construct.
- a host cell comprises (e.g.
- the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell, or human embryonic kidney (HEK) cell, or lymphoid cell (e.g. Y0, NS0, Sp20 cell).
- CHO Chinese Hamster Ovary
- HEK human embryonic kidney
- Certain embodiments relate to a method of making a multi-specific antigen-binding construct culturing a host cell into which nucleic acid encoding the multi-specific antigen- binding construct has been introduced, under conditions suitable for expression of the multi- specific antigen-binding construct, and optionally recovering the multi-specific antigen- binding construct from the host cell (or host cell culture medium).
- Certain embodiments of the present disclosure relate to the co-expression of a multi- specific antigen-binding construct as described herein and a CAR or engineered TCR in a T- cell or NK-cell.
- Methods of co-expression of a CAR and an antibody in T-cells are known in the art (see, for example, International Patent Publication No. WO 2014/011988).
- an engineered T-cell or NK-cell comprising nucleic acid encoding a CAR or engineered TCR, and nucleic acid encoding a multi-specific antigen-binding construct.
- Some embodiments relate to a method of co-expressing a multi- specific antigen-binding construct as described herein and a CAR or engineered TCR in a T- cell or NK-cell, which comprises introducing nucleic acid encoding the CAR or engineered TCR and nucleic acid encoding the multi-specific antigen-binding construct into the cell, and culturing the cell under conditions suitable for expression of the CAR or engineered TCR and the multi-specific antigen-binding construct.
- the nucleic acid encoding the CAR or engineered TCR, and the nucleic acid encoding the multi-specific antigen-binding construct are each in the form of a vector.
- the multi-specific antigen-binding constructs described herein may be differentially modified during or after translation.
- modified refers to any changes made to a given polypeptide, such as changes to the length of the polypeptide, the amino acid sequence, chemical structure, co-translational modification, or post-translational modification of a polypeptide.
- post-translationally modified refers to any modification of a natural or non-natural amino acid that occurs to such an amino acid after it has been incorporated into a polypeptide chain.
- the term encompasses, by way of example only, co-translational in vivo modifications, co-translational in vitro modifications (such as in a cell-free translation system), post-translational in vivo modifications, and post-translational in vitro modifications.
- the multi-specific antigen-binding constructs may comprise a modification such as glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage or linkage to an antibody molecule or antigen-binding construct or other cellular ligand, or a combination of these modifications.
- the multi-specific antigen-binding construct may be chemically modified by known techniques including, but not limited to, specific chemical cleavage by cyanogen bromide, trypsin, chymotrypsin, papain, V8 protease or NaBIrU; acetylation; formylation; oxidation; reduction or metabolic synthesis in the presence of tunicamycin.
- Additional optional post-translational modifications of antigen-binding constructs include, for example, N-linked or O-linked carbohydrate chains, processing of N-terminal or C-terminal ends, attachment of chemical moieties to the amino acid backbone, chemical modifications of N-linked or O-linked carbohydrate chains, and addition or deletion of an N- terminal methionine residue as a result of prokaryotic host cell expression.
- the multi-specific antigen-binding constructs described herein may optionally be modified with a detectable label, such as an enzymatic, fluorescent, isotopic or affinity label to allow for detection and isolation of the protein.
- suitable enzyme labels include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase;
- suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
- suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin;
- an example of a luminescent material includes luminol;
- examples of bioluminescent materials include luciferase, luciferin or aequorin;
- suitable radioactive materials include iodine, carbon, sulfur, tritium, indium, technetium, thallium, gallium, palladium, molybdenum, xenon or fluorine.
- the same type of modification may optionally be present in the same or varying degrees at several sites in a given polypeptide.
- Modifications include acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross- linking, cyclization, disulfide bond formation, demethylation, formation of covalent crosslinks, formation of cysteine, formation of pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristylation, oxidation, pegylation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination (see, e.g.
- the multi-specific antigen-binding constructs may be attached to a solid support, which may be particularly useful for immunoassays or purification of polypeptides that are bound by, or bind to, or associate with proteins described herein.
- solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene.
- the multi-specific antigen binding constructs may be tested for their ability to bind to the target immunotherapeutic and tumour-associated antigen(s) using standard assays and protocols known in the art.
- assays and protocols include, for example, ELISA-based assays and surface-plasmon resonance (SPR) techniques.
- Cells expressing a target CAR or recombinant TCR may be purchased commercially (for example, from ProMab Biotechnologies Inc., Richmond, CA, or from Creative Biolabs, Shirley, NY) or may be prepared by standard techniques (see, for example, Yam et al, Mol. Ther. 5:479 (2002); and Intemational Patent Publication No. WO 2015/095895).
- Cell lines expressing various target tumour-associated antigens are also available commercially.
- the multi-specific antigen-binding constructs may additionally be tested for their ability to re-direct the target immunotherapeutic to a tumour cell expressing the target tumour- associated antigen.
- the immunotherapeutic comprises an engineered T-cell or NK cell
- functional responses of the T-cell or NK cell after being contacted by the multi- specific antigen-binding construct may be assessed in vitro using standard assays known in the art. Some exemplary assays are provided in the Examples and described below.
- cytokine release from the engineered T-cells or NK cells may be assessed following incubation of the engineered cells with tumour-associated antigen- expressing and control cells in the presence or absence of the multi-specific antigen-binding construct. After incubation of the co-cultured cells for an appropriate time, supernatants can be collected and levels of IFN- ⁇ , TNF-alpha and/or IL-2 may be determined, for example by multiplex cytokine immunoassay (Luminex®) or ELISA.
- Luminex® multiplex cytokine immunoassay
- ELISA ELISA
- Cytokine release by T-cells or NK cells is an indicator of cell activation and is known in the art to correlate with cytotoxity (see, for example, Kochenderfer, et al, J Immunother, 32(7): 689-702 (2009); Lanitis, et al, Molec Ther, 20(3):633-643 (2012) and Mardiros, et al, Blood, 122(18):3138-3148 (2013)).
- Cytolytic activity of the T-cell or NK cell may also optionally be assessed, for example, by incubating the engineered T-cells or NK cells and the target tumour cells in the presence and absence of varying concentrations of the multi-specific antigen-binding construct. Following incubation, lysis of the target tumour cells may be monitored by various techniques, such as flow cytometry, 51 Cr release, fluorimetry, or a kinetic viability platform (such as Xcelligence (Acea)).
- Proliferation of the engineered T-cells or NK cells may also be assessed following incubation with both cells expressing the target tumour-associated antigen and the multi- specific antigen-binding construct.
- the engineered T-cells or NK cells can be labelled with an appropriate label, such as carboxyfluorescein succinmidyl ester (CFSE), and proliferation of the T-cells or NK cells may be assessed by flow cytometry.
- CFSE carboxyfluorescein succinmidyl ester
- In vivo effects of the multi-specific antigen-binding constructs may also be evaluated by standard techniques. For example, by monitoring tumours following adoptive transfer of engineered cells and administration of the multi-specific antigen-binding construct to patient- derived xenograft (PDX) tumour model animal subjects.
- PDX patient- derived xenograft
- Various PDX tumour models are available commercially and an appropriate model can be readily selected by the skilled person based on the target tumour-associated antigen being employed.
- the engineered T-cells or NK cells may be administered to the animals after tumour engraftment and then the multi-specific antigen-binding construct may be administered after an appropriate time period.
- the multi-specific antigen-binding construct may be administered intravenously (i.v.), intraperitoneally (i.p.) or subcutaneously (s.c). Dosing schedules and amounts vary, but can be readily determined by the skilled person. An exemplary dosage would be 10 mg/kg once weekly.
- Tumour growth can be monitored by standard procedures. For example, when labelled tumour cells have been used, tumour growth may be monitored by appropriate imaging techniques. For solid tumours, tumour size may also be measured by caliper.
- the ability of the multi-specific antigen-binding constructs to re-direct immunotherapeutics that are therapeutic agents capable of binding to a T-cell and a tumour- associated antigen, such as bispecific T-cell engagers (BiTEs), may be tested by first pre- treating T-cells with the therapeutic agent to allow the agent to engage the T-cell, then contacting the cells with the multi-specific antigen-binding construct. Cytotoxicity, cytokine release and proliferation of the T-cells may then be assayed using the same methods as described above.
- BiTEs bispecific T-cell engagers
- compositions comprising a multi- specific antigen-binding construct described herein and a pharmaceutically acceptable carrier.
- pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
- carrier refers to a diluent, adjuvant, excipient, vehicle, or combination thereof, with which the construct is administered.
- Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
- the carrier is a man-made carrier not found in nature.
- Water can be used as a carrier when the pharmaceutical composition is administered intravenously.
- Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
- Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
- the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. Examples of suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences" by E. W. Martin.
- the pharmaceutical compositions may be in the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like.
- composition may be formulated as a suppository, with traditional binders and carriers such as triglycerides.
- Oral formulations may include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like.
- compositions will contain a therapeutically effective amount of the multi-specific antigen-binding construct, together with a suitable amount of carrier so as to provide the form for proper administration to a patient.
- the formulation should suit the mode of administration.
- the composition comprising the multi-specific antigen- binding construct is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings.
- compositions for intravenous administration are solutions in sterile isotonic aqueous buffer.
- the composition may also include a solubilizing agent and a local anaesthetic such as lignocaine to ease pain at the site of the injection.
- the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent.
- composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline.
- an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
- compositions described herein are formulated as neutral or salt forms.
- Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxide isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, and the like.
- the multi-specific antigen-binding constructs described herein may be used to redirect a target immunotherapeutic such that it binds to a tumour cell antigen or epitope that is different from its cognate antigen or epitope.
- the tumour-associated antigen targeted antigen-binding domain comprised by the multi-specific antigen-binding construct provides an alternate antigen-binding domain to the antigen-binding domain comprised by the immunotherapeutic.
- the target tumour cell may have lost, mutated, post- translationally modified or down-regulated expression of the tumour-associated antigen targeted by the immunotherapeutic, and the multi-specific antigen-binding construct thus provides an alternate antigen-binding domain through which the immunotherapeutic may bind to the tumour cell.
- the alternate antigen-binding domain may bind to a different tumour- associated antigen on the target tumour cell, or it may bind to the same tumour-associated antigen at a different epitope.
- Certain embodiments relate to methods for re-directing tumour-associated antigen specific immunotherapeutics toward alternative tumour antigens.
- such re-direction may help to overcome common treatment resistance mechanisms in tumour cells involving antigen downregulation and/or neoplastic cell heterogeneity.
- the multi-specific antigen-binding construct may be used to increase the ability of the target immunotherapeutic to bind a tumour cell.
- the multi-specific antigen-binding construct provides an additional antigen-binding domain that binds a tumour-associated antigen on the target tumour cell.
- the additional antigen-binding domain may bind to a different tumour-associated antigen on the target tumour cell, or it may bind to the same tumour-associated antigen at a different epitope.
- Certain embodiments relate to methods of using the multi-specific antigen-binding construct to extend the therapeutic effect of an immunotherapeutic. Certain embodiments relate to methods of using the multi-specific antigen-binding construct to improve the therapeutic effect of an immunotherapeutic. For example, in some embodiments, the multi-specific antigen-binding construct may be administered to a patient currently undergoing treatment with the immunotherapeutic in order to increase the likelihood of the immunotherapeutic treatment being effective.
- the multi-specific antigen-binding construct may be administered concurrently with the immunotherapeutic or it may be administered subsequently to administration of the immunotherapeutic.
- Such subsequent administration of the multi-specific antigen-binding construct means that administration of the immunotherapeutic and the multi-specific antigen- binding construct are separated by a defined time period, which may be short (for example in the order of minutes or hours) or extended (for example in the order of days or weeks).
- the multi-specific antigen-binding construct may be administered to a patient who has previously undergone treatment with the immunotherapeutic and who has relapsed or failed to respond to treatment, for example due to low levels or loss of expression of the immunotherapeutic target tumour-associated antigen.
- re-direction of the immunotherapeutic by administration of the multi-specific antigen-binding construct is expected to initiate or re-initiate the therapeutic effect of the immunotherapeutic.
- Certain embodiments relate to methods of treating cancer in a patient who is undergoing or has undergone treatment with an immunotherapeutic, comprising administering the multi-specific antigen-binding construct to the patient.
- the patient has undergone prior treatment with the immunotherapeutic.
- the patient may have relapsed from or failed the prior treatment with the immunotherapeutic.
- patients most likely to respond to treatment with the multi- specific antigen-binding construct may be identified by assessing expression of the tumour- associated antigen targeted by the immunotherapeutic and/or assessing the presence of an appropriate biomarker indicative of persistence of the prior immunotherapy.
- Assessment of the appropriate biomarker may comprise, for example, direct detection of a CAR or transgenic TCR on T-cells or NK cells, detection of increased activated memory T-cells, or detection of a pharmacodynamic marker such as low healthy B cell numbers in B cell-targeted immunotherapies.
- Patients having reduced neoplastic cell expression of the tumour-associated antigen targeted by the immunotherapeutic and evidence of prior immunotherapy persistence are more likely to respond to treatment with the multi-specific antigen-binding construct.
- the multi-specific antigen-binding construct may be used in methods of treating a hematological cancer.
- hematological cancers include, but are not limited to, acute leukemia, for example, B-cell acute lymphoid leukemia (BALL), T-cell acute lymphoid leukemia (TALL), small lymphocytic leukemia (SLL), acute lymphoid leukemia (ALL) or acute myelogenous leukemia (AML); chronic leukemia, for example, chronic myelogenous leukemia (CML) or chronic lymphocytic leukemia (CLL); mantle cell lymphoma (MCL), B cell prolymphocytic leukemia, blastic plasmacytoid dendritic cell neoplasm, Burkitt's lymphoma, diffuse large B cell lymphoma (DLBCL) (e.g.
- BALL B-cell acute lymphoid leukemia
- TALL T-cell acute lymphoid leukemia
- T-cell/histiocyte rich large B-cell lymphoma primary DLCBL of the CNS, primary cutaneous DLBCL leg type, or EBV+ DLBCL of the elderly), DLBCL associated with chronic inflammation, follicular lymphoma, pediatric follicular lymphoma, hairy cell leukemia, small cell- or a large cell- follicular lymphoma, malignant lymphoproliferative conditions, MALT lymphoma (extranodal marginal zone lymphoma of mucosa-associated lymphoid tissue), Marginal zone lymphoma, multiple myeloma, myelodysplasia and myelodysplastic syndrome, non-Hodgkin lymphoma, Hodgkin lymphoma, plasmablastic lymphoma, plasmacytoid dendritic cell neoplasm, Waldenstrom macroglobulinemia, splenic marginal zone lymphoma, splenic lymphoma/leukemia (e.g.,
- splenic diffuse red pulp small B-cell lymphoma hairy cell leukemia-variant, lymphoplasmacytic lymphoma, a heavy chain disease (e.g. alpha heavy chain disease, gamma heavy chain disease, or mu heavy chain disease), plasma cell myeloma, solitary plasmocytoma of bone, extraosseous plasmocytoma, nodal marginal zone lymphoma, pediatric nodal marginal zone lymphoma, primary cutaneous follicle center lymphoma, lymphomatoid granulomatosis, primary mediastinal (thymic) large B-cell lymphoma, intravascular large B-cell lymphoma, ALK+ large B-cell lymphoma, large B-cell lymphoma arising in HHV8-associated multicentric Castleman disease, primary effusion lymphoma, B-cell lymphoma, or an unclassifiable haematological cancer (e.g., with features intermediate between DLBCL and
- the multi-specific antigen-binding construct may be used in methods of treating a solid tumour.
- solid tumours include, but are not limited to, cancer of the brain, breast, cervix, colon, head and neck, kidney, lung, ovary, pancreas, prostate, stomach and uterus, as well as non-small cell lung cancer and colorectal cancer.
- Various forms of lymphoma also may result in the formation of a solid tumour and, therefore, are also often considered to be solid tumours.
- Certain embodiments relate to methods of using multi-specific antigen-binding constructs that bind to a CAR or TCR and a tumour-associated antigen to activate a T-cell or NK cell engineered to express the CAR or TCR.
- Activation of the T-cell or NK cell may result in release of cytokines, such as IFN- ⁇ , TNF-alpha and/or IL-2, and/or cytotoxicity towards cells expressing the tumour-associated antigen.
- the method may be conducted in vitro, ex vivo or in vivo.
- multi-specific antigen-binding constructs for example, aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation.
- An appropriate mode and route of administration of the multi-specific antigen-binding construct can be determined by the skilled practitioner taking account of the condition and patient to be treated.
- the multi- specific antigen-binding constructs may be administered to a patient subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, intravenously (i.v.) or intraperitoneally.
- therapeutic compounds are administered systemically to patients, for example, by bolus injection or continuous infusion into a patient's bloodstream.
- the multi-specific antigen-binding construct is to be co-expressed in T-cells or NK cells with a CAR or engineered TCR
- at least one of the following occurs in vitro prior to administering the cells to a patient: i) expansion of the cells, ii) introducing nucleic acid encoding the CAR or TCR and nucleic acid encoding the multi- specific antigen-binding construct into the cells, and/or iii) cryopreservation of the cells.
- Such ex vivo procedures are well known in the art.
- isolated T-cells or NK cells are genetically modified by standard in vitro transduction or transfection techniques to introduce vectors expressing the CAR or TCR and the multi-specific antigen-binding construct.
- the cells are isolated from the patient to be treated (i.e. the cells are autologous).
- certain embodiments contemplate the use of cells that are allogeneic, syngeneic or xenogeneic with respect to the patient.
- ex vivo culture and expansion of T-cells comprises collecting PBMCs and, optionally, purifying T-cells from a subject.
- T-cells are expanded using a combination of mitogenic and, optionally, differentiative stimuli, for example anti-CD3/CD28 beads with exogenous cytokines such as IL-2, IL-7, IL-15 and/or IL-21 (Singh, et al, Cancer Res, 71(10):3516-27 (2011)).
- CD34+ hematopoietic stem and progenitor cells are isolated from a mammal from peripheral blood harvest or bone marrow explants, and such cells are expanded ex vivo in media comprising appropriate cellular growth factors, as described in U.S. Patent No. 5,199,942.
- Other factors such as Flt3-L, IL-1, IL-3 and c-kit ligand, may optionally be used for culturing and expansion of the cells.
- the modified and expanded cells are then administered to the patient by a suitable route, for example, by intradermal injection, subcutaneous injection, i.v. injection, or direct injection into a tumour or lymph node.
- kits comprising one or more multi-specific antigen- binding constructs and kits comprising one or more polynucleotides encoding a multi-specific antigen-binding construct.
- the polynucleotides may be provided in the form of a vector that may be used to transform host cells.
- kits Individual components of the kit would be packaged in separate containers and, associated with such containers, can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale.
- the kit may optionally contain instructions or directions outlining the method of use or administration regimen for the multi-specific antigen-binding construct or polynucleotide.
- the container means may itself be an inhalant, syringe, pipette, eye dropper, or other such like apparatus, from which the solution may be administered to a subject or applied to and mixed with the other components of the kit.
- the components of the kit may also be provided in dried or lyophilized form and the kit can additionally contain a suitable solvent for reconstitution of the lyophilized components.
- the kits described herein also may comprise an instrument for assisting with the administration of the composition to a patient.
- Such an instrument may be an inhalant, nasal spray device, syringe, pipette, forceps, measured spoon, eye dropper or similar medically approved delivery vehicle.
- Certain embodiments relate to an article of manufacture containing materials useful for treatment of a patient as described herein.
- the article of manufacture comprises a container and a label or package insert on or associated with the container.
- Suitable containers include, for example, bottles, vials, syringes, IV solution bags, etc.
- the containers may be formed from a variety of materials such as glass or plastic.
- the container holds a composition comprising the multi-specific antigen-binding construct which is by itself or combined with another composition effective for treating the patient and may have a sterile access port (for example the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle).
- the label or package insert indicates that the composition is used for treating the condition of choice.
- the article of manufacture may comprise (a) a first container with a composition contained therein, wherein the composition comprises a multi-specific antigen-binding construct described herein; and (b) a second container with a composition contained therein, wherein the composition in the second container comprises a further cytotoxic or otherwise therapeutic agent.
- the article of manufacture may further comprise a package insert indicating that the compositions can be used to treat a particular condition.
- the article of manufacture may further comprise a second (or third) container comprising a pharmaceutically-acceptable buffer, such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
- BWFI bacteriostatic water for injection
- phosphate-buffered saline such as bacteriostatic water for injection (BWFI), phosphate-buffered saline, Ringer's solution and dextrose solution.
- BWFI bacteriostatic water for injection
- the article of manufacture may
- the multi-specific antigen-binding constructs comprise at least one polypeptide. Certain embodiments relate to polynucleotides encoding such polypeptides described herein. [00210]
- the multi-specific antigen-binding constructs, polypeptides and polynucleotides described herein are typically isolated. As used herein, "isolated” means an agent (e.g., a polypeptide or polynucleotide) that has been identified and separated and/or recovered from a component of its natural cell culture environment.
- Contaminant components of its natural environment are materials that would interfere with diagnostic or therapeutic uses for the antigen-binding construct, and may include enzymes, hormones, and other proteinaceous or non-proteinaceous solutes. Isolated also refers to an agent that has been synthetically produced, e.g., via human intervention.
- polypeptide refers to a polymer of amino acid residues. That is, a description directed to a polypeptide applies equally to a description of a peptide and a description of a protein, and vice versa.
- the terms apply to naturally occurring amino acid polymers as well as amino acid polymers in which one or more amino acid residues is a non-naturally encoded amino acid.
- the terms encompass amino acid chains of any length, including full-length proteins, wherein the amino acid residues are linked by covalent peptide bonds.
- amino acid refers to naturally occurring and non-naturally occurring amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally encoded amino acids are the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, praline, serine, threonine, tryptophan, tyrosine, and valine) and pyrrolysine and selenocysteine.
- Amino acid analogs are compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an "R" group, such as, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
- Such analogs have modified R groups (such as, norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- Reference to an amino acid includes, for example, naturally occurring proteogenic L- amino acids; D-amino acids, chemically modified amino acids such as amino acid variants and derivatives; naturally occurring non-proteogenic amino acids such as ⁇ -alanine, ornithine, and the like, and chemically synthesized compounds having properties known in the art to be characteristic of amino acids.
- non-naturally occurring amino acids include, but are not limited to, a-methyl amino acids (e.g.
- a-methyl alanine D-amino acids, histidine-like amino acids (e.g., 2-amino-histidine, ⁇ -hydroxy-histidine, homohistidine), amino acids having an extra methylene in the side chain (“homo" amino acids), and amino acids in which a carboxylic acid functional group in the side chain is replaced with a sulfonic acid group (e.g., cysteic acid).
- non-natural amino acids including synthetic non-native amino acids, substituted amino acids, or one or more D-amino acids into the antigen-binding constructs described herein may be advantageous in a number of different ways.
- D-amino acid- containing peptides, etc. exhibit increased stability in vitro or in vivo compared to L-amino acid-containing counterparts.
- the construction of peptides, etc., incorporating D-amino acids can be particularly useful when greater intracellular stability is desired or required.
- D- peptides for example, are typically resistant to endogenous peptidases and proteases, thereby providing improved bioavailability of the molecule, and prolonged lifetimes in vivo when such properties are desirable. Additionally, D-peptides cannot be processed efficiently for major histocompatibility complex class Il-restricted presentation to T helper cells, and are therefore, less likely to induce humoral immune responses in the whole organism.
- Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
- polynucleotides encoding polypeptides of the multi-specific antigen-binding constructs.
- polynucleotide or “nucleotide sequence” is intended to indicate a consecutive stretch of two or more nucleotide molecules.
- the nucleotide sequence may be of genomic, cDNA, RNA, semisynthetic or synthetic origin, or any combination thereof, and may include deoxyribonucleotides, deoxyribonucleosides, ribonucleosides, or ribonucleotides and polymers thereof in either single- or double-stranded form.
- the term encompasses polynucleotides containing known analogs of natural nucleotides that have similar binding properties to the reference polynucleotide and are metabolized in a manner similar to naturally occurring nucleotides. Unless specifically limited otherwise, the term also refers to oligonucleotide analogs including PNA (peptidonucleic acid) and analogs of DNA used in antisense technology (phosphorothioates, phosphoroami dates, and the like). Unless otherwise indicated, a particular nucleotide sequence also implicitly encompasses conservatively modified variants thereof (including but not limited to, degenerate codon substitutions) and complementary sequences as well as the sequence explicitly indicated.
- PNA peptidonucleic acid
- analogs of DNA used in antisense technology phosphorothioates, phosphoroami dates, and the like.
- degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al, Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al, J. Biol. Chem. 260:2605-2608 (1985); Rossolini et ctl, Mol. Cell. Probes 8:91-98 (1994)).
- “Conservatively modified variants” applies to both amino acid and nucleotide sequences.
- “conservatively modified variants” refers to those nucleotide sequences which encode identical or essentially identical amino acid sequences, or where the nucleotide sequence does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GC A, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide.
- nucleic acid variations are "silent variations,” which are one species of conservatively modified variations.
- silent variations are one species of conservatively modified variations.
- AUG which is ordinarily the only codon for methionine
- TGG which is ordinarily the only codon for tryptophan
- amino acid sequences one of ordinary skill in the art will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the deletion of an amino acid, addition of an amino acid, or substitution of an amino acid with a chemically similar amino acid.
- Conservative substitution tables providing functionally similar amino acids are known to those of ordinary skill in the art.
- the following eight groups each contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and [0139] 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins: Structures and Molecular Properties (W H Freeman & Co.; 2 nd edition (December 1993)).
- nucleic acids or polypeptide sequences refers to two or more sequences or subsequences that are the same. Sequences are "substantially identical” if they have a percentage of amino acid residues or nucleotides that are the same (i.e., about 60% identity, about 65%, about 70%, about 75%, about 80%, about 85%, about 90%, or about 95% identity over a specified region), when compared and aligned for maximum correspondence over a comparison window, or designated region as measured using one of the following sequence comparison algorithms (or other algorithms available to persons of ordinary skill in the art) or by manual alignment and visual inspection. This definition also refers to the complement of a test sequence.
- the identity can exist over a region that is at least about 50 amino acids or nucleotides in length, or over a region that is 75-100 amino acids or nucleotides in length, or, where not specified, across the entire sequence of a polynucleotide or polypeptide.
- a polynucleotide encoding a polypeptide described herein, including homologs from species other than human, may be obtained by a process comprising the steps of screening a library under stringent hybridization conditions with a labeled probe having a polynucleotide sequence described herein or a fragment thereof, and isolating full- length cDNA and genomic clones containing said polynucleotide sequence. Such hybridization techniques are well known to the skilled artisan.
- sequence comparison typically one sequence acts as a reference sequence, to which test sequences are compared.
- test and reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. Default program parameters can be used, or alternative parameters can be designated.
- sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
- a “comparison window”, as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned.
- Methods of alignment of sequences for comparison are known to those of ordinary skill in the art.
- Optimal alignment of sequences for comparison can be conducted, including but not limited to, by the local homology algorithm of Smith and Waterman (1970) Adv. Appl. Math. 2:482c, by the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol.
- BLAST and BLAST 2.0 algorithms are described in Altschul et al, Nuc. Acids Res. 25:3389-3402 (1997), and Altschul et al, J. Mol. Biol. 215:403-410 (1990), respectively.
- Software for performing BLAST analyses is publicly available through the website for the National Center for Biotechnology Information.
- the BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment.
- the BLAST algorithm is typically performed with the "low complexity" filter turned off.
- the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Natl. Acad. Sci. USA 90:5873-5787(1993)).
- One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance.
- P(N) the smallest sum probability
- a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, or less than about 0.01, or less than about 0.001.
- a multi-specific antigen-binding construct comprises an amino acid sequence that is at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identical to a relevant amino acid sequence or fragment thereof set forth in the Tables or accession numbers disclosed herein.
- an isolated multi-specific antigen-binding construct comprises an amino acid sequence encoded by a polynucleotide that is at least 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, or 100% identical to a relevant nucleotide sequence or fragment thereof set forth in Tables or accession numbers disclosed herein.
- Bispecific antigen-binding constructs were prepared in the following formats: a) A hybrid antibody format in which one antigen-binding domain is an scFv and the other is a Fab. These bispecific antigen-binding constructs further comprise a IgGl heterodimeric Fc having CH3 domain amino acid substitutions that drive heterodimeric association of the two component Fc polypeptides, HetFcA and HetFcB.
- HetFcA comprises the amino acid substitutions: T350V/L351Y/F405A/Y407V
- HetFcB comprises the amino acid substitutions: T350V/T366L/K392L/T394W
- the amino acid residues in the Fc region are identified according to the EU index as in Kabat referring to the numbering of the EU antibody (Edelman et al, Proc Natl Acad Sci USA, 63:78-85 (1969)).
- the hybrid antibody format constructs include 3 polypeptide chains: a first Fc polypeptide fused to an scFv that binds the first target, a second Fc polypeptide fused to VH-CH1 domains, and a light chain, where the VH- CH1 domains and the light chain form a Fab region that binds to the second target.
- a first VL-VH sequence binding to the first target is connected by a GlySer based spacer to a second VL-VH sequence binding to the second target.
- the tandem ScFv constructs also contained a 6xHis-tag.
- anti-FMC63id is an anti-CD19 scFv (see, Immunology and Cell Biology (1991) 69:411-422, and International Patent Publication No. WO 2014/190273).
- FLAG is a well-known amino acid motif "DYKDDDDK” (Hopp, et al, Bio/Technology, 6 (10): 1204-10 (1988)) used as a negative control arm in some exemplary constructs described herein.
- BCMA and mesothelin are tumour-associated antigens (TAAs).
- TAAs tumour-associated antigens
- the scFv and Fab sequences were generated from the sequences of known antibodies, identified in Table 4 (see Example 7). Amino acid and nucleotide sequences for each of the variants listed in Table C are provided in Table 6. Tandem scFv sequences are provided without the 6xHis tag.
- the bispecific antigen-binding constructs designated as Variants # 16443 (FLAG- Mesothelin), 16445 (FMC63id-BCMA), 16446 (FMC63id-Mesothelin) and 16448 (FLAG- BCMA) described in Example 1 were prepared as follows.
- the genes encoding the antibody heavy and light chains were constructed via gene synthesis using codons optimized for human/mammalian expression.
- the bispecific antibodies were cloned and expressed following the general procedure outlined in Example 7. Heterodimeric species were isolated to >90% purity via Protein A affinity chromatography followed by size-exclusion chromatography. All preparations had ⁇ 5% multimeric species as verified by non-reducing SDS-PAGE and SEC.
- Raji cells (ATCC CCL-86) and RPMI8226 cells (ATCC CCL-155) were cultured in RPMI-1640 medium containing 10% FBS.
- A1847 cells were cultured in DMEM containing 10% FBS.
- Each of the three cell lines was centrifuged and suspended at 5 million cells/ml in cold FACS buffer (PBS + 2 mM EDTA pH 7.4 + 0.5% BSA).
- Test antibodies were diluted with PBS to 0.3 mg/ml. The antibodies were then serially diluted with PBS to 0.1 mg/ml, 30 ug/ml, 10 ug/ml, 3 ug/ml, 1 ug/ml and 0.3 ug/ml.
- the plates were incubated on ice for 30 min, then rinsed as above and cells were suspended in 200 ul of cold FACS buffer containing 1% paraformaldehyde. The plates were incubated at 4 °C overnight and the cells were acquired the following day on a BD LSR Fortessa X20 flow cytometer. The data were analyzed with FlowJo software (FlowJo, LLC, Ashland, OR). The cells were first plotted by forward light scatter versus 7-AAD staining, then the live cells (7- AAD-negative) were gated and plotted as a histogram for Alexa Fluor 488 staining. The mean fluorescence was then recorded and pasted into Prism software (GraphPad Software, Inc., La Jolla, CA), with which mean fluorescence was plotted versus antibody concentration.
- Prism software GraphPad Software, Inc., La Jolla, CA
- the bispecific mesothelin (MSLN)-directed constructs (vl6443 and vl6446) bound to MSLN+ A1847 cells, but not control RPMI8226 cells.
- the bispecific BCMA-directed constructs (vl6448 and vl6445) bound to BCMA+ RPMI8226 cells, but not control A1847 cells.
- Human T-cells were engineered to express FLAG-tagged second-generation CARs specific for CD 19 (containing extracellular anti-CD 19 (FMC63) scFv, FLAG, CD28 "hinge” and transmembrane, followed by intracellular CD28 and CD3-zeta signaling domains) were produced by ProMab Biotechnologies, Inc., Richmond, CA. Briefly, PBMC were isolated from the peripheral blood of a healthy individual using density sedimentation over Ficoll, and the PBMC were cryopreserved. Lentivirus particles containing the CAR sequences were produced by co-transfection of HEK293 cells with a CAR-encoding vector and third-generation packaging constructs.
- FMC63 extracellular anti-CD 19
- the lentivirus particles were collected from the culture medium by ultracentrifugation, titered by qRT-PCR and frozen.
- the PBMC were thawed and cultured overnight in AIM-V® medium containing 5% human AB serum, CD3/CD28 antibody-coated magnetic beads and IL-2.
- the cells were transduced with the lentivirus preparations the next day at a multiplicity of infection of 5: 1 in the presence of 5 ug/ml DEAE-dextran. Over the next two weeks of culture, the cells were counted every 2-3 days and additional medium was added to keep the cells at a density between 0.5 and 3 million per ml. CAR expression was evaluated by flow cytometry on day 9 of culture, using an antibody specific for FLAG.
- CAR-T cell preparations or HEK293 cells stably expressing the CD19 CAR were centrifuged and suspended in cold FACS buffer at 2.5 million cells per ml.
- Test antibodies were diluted in PBS to 0.4 mg/ml, and then serially diluted in PBS to 120 ug/ml and 40 ug/ml. Twenty-five microliters of antibody was mixed in triplicate with 75 ul of cells in 96-well plates on ice, and the plates were incubated on ice for 30 min. The plates were then centrifuged, the supematants were removed by decanting, and the cell pellets were suspended in 200 ul of cold FACS buffer.
- the plates were centrifuged again, the supematants were removed by decanting, and the cells were suspended in 100 ul of cold FACS buffer containing 1 ug of Alexa Fluor 488-conjugated goat anti -human IgG (Jackson ImmunoResearch, West Grove, PA) and 0.1 ug of 7-AAD.
- the plates were incubated on ice for 30 min, then rinsed as above and suspended in 200 ul of cold FACS buffer containing 1% paraformaldehyde.
- the plates were incubated at 4 °C overnight and the cells were acquired the following day on a BD FACSCaliburTM flow cytometer (BD Biosciences, San Jose, CA).
- the data were analyzed with FlowJo software (FlowJo, LLC, Ashland, OR). The cells were first plotted by forward light scatter versus 7-AAD staining, then the live cells (7-AAD- negative) were gated and plotted by Alexa Fluor 488 staining versus a dummy channel.
- anti-FMC63idiotype-containing bispecific constructs (vl6446 and vl6445) bound selectively to anti-CD19 CAR constructs containing FMC63 stably expressed on either HEK293 or primary CAR-T cells.
- the CAR constructs used in this Example contained extracellular FLAG sequences, no FLAG binding by the variants including an anti-FLAG domain was observed. This is likely due to conformational restrictions as the FLAG tag is located between the scFv and CD28 hinge of the CAR construct. This lack of binding allowed the anti-FLAG domain of these variants to be used as a negative control binding domain.
- Antibodies were diluted in PBS to 0.4 mg/ml, then serially diluted in RPMI-1640 medium to 120 ug/ml and 40 ug/ml.
- CD19 CAR-T cells (see Example 4) were centrifuged and suspended in RPMI-1640 medium at 2 million cells per ml.
- Raji, RPMI8226 and SKOV3 target cells were centrifuged and suspended in RPMI-1640 medium at 0.2 million cells per ml.
- Fifty microliters of target cells were mixed in triplicate with 50 ul of CAR-T cells and 100 ul of antibody in 96-well plates. The plates were cultured 6 or 18 hours, and cells pelleted via centrifugation. The supernatants were transferred to fresh 96-well plates and frozen. Supernatant IFN- ⁇ levels were quantified by sandwich ELISA.
- CD19-CAR-T cells were robustly activated upon co-culture with CD19+ Raji cells, but not CD19-negative SKOV3 cells.
- the anti-FMC63id x MSLN construct vl6446
- CD19-CAR-T cell responses were re-directed to BCMA-expressing RPMI8226 target cells in the presence of the anti-FMC63id x BCMA construct (vl6445) at 6 hours following co-culture initiation.
- CAR constructs are designed to mimic natural TCR/CD3 signals (but with added co-stimulatory potential).
- these findings support the use of multi-specific antigen-binding constructs directed to TCRs (using anti-TCR idiotype, V-region, or other similar binding domains) and TAAs to redirect engineered or endogenous TCR-mediated T-cell responses toward alternative TAA targets.
- Bispecific antigen-binding constructs are prepared in the following exemplary formats: a) A hybrid antibody format as described in Example 1 a). b) A full-size antibody (FSA) format in which both antigen-binding domains are Fabs. These bispecific antigen-binding constructs also comprise the heterodimeric Fc described in Example 1.
- the full-size antibody format constructs include 4 polypeptide chains: a first Fc polypeptide fused to first VH-CH1 domains, and a first light chain, where the first VH-CH1 domains and the first light chain form a Fab region that binds to the first target; and a second Fc polypeptide fused to second VH- CH1 domains, and a second light chain, where the second VH-CH1 domains and the light chain form a Fab region that binds to the second target.
- c) A tandem scFv format in which one VL-VH sequence binding to one target is connected by a (GGGGS)5 spacer to a second VL-VH sequence binding to a second target.
- EXAMPLE 7 Bispecific Antibody Production [00241] The bispecific antigen-binding constructs described in Example 6 are prepared as follows.
- the genes encoding the antibody heavy and light chains are constructed via gene synthesis using codons optimized for human/mammalian expression.
- the scFv and Fab sequences are generated from the sequences of known antibodies, identified in Table 4. Sequences are provided in Table 5.
- SEQ ID anti-BCMA ADC, human NO:7
- a disulphide link between the VH and VL of the scFv is introduced at positions VH 44 and VL 100, according to the Kabat numbering system (see Reiter ef a/, Nat Biotechnol, 14: 1239-1245 (1996)).
- the final gene products are sub-cloned into a mammalian expression vector and expressed in CHO cells (or a functional equivalent) (Durocher, et al, Nucl Acids Res, 30:E9 (2002)).
- the CHO cells are transfected in exponential growth phase.
- the DNA may be transfected in various DNA ratios of the FcA, light chain (LC), and FcB that allow for heterodimer formation.
- Transfected cell culture medium is collected after several days, centrifuged at 4000rpm and clarified using a 0.45 micron filter.
- Bispecific antigen-binding constructs are purified from the culture medium via established methods.
- the clarified culture medium is loaded onto a MabSelect SuRe (GEHealthcare) protein-A column and washed with PBS buffer at pH 7.2, eluted with citrate buffer at pH 3.6, and pooled fractions neutralized with TRIS at pH 11.
- the protein is finally desalted using an Econo-Pac 10DG column (Bio-Rad).
- the protein is further purified by protein L chromatography or gel filtration.
- EXAMPLE 8 Ability of Bispecific Antigen-Binding Constructs to Mediate Selective Lysis of Target Cells by CD19-Specific CAR-T Cells in vitro
- CD19-specific CAR-expressing T cells and target cells are incubated in triplicate at multiple ratios (optimally approximately 20: 1), in the presence or absence of varying concentrations of the bispecific antibodies described in Example 6.
- Target cells include: parental or control HeLa cells, and HeLa cells engineered via well-known methods to stably express CD 19, CD79b, BCMA or mesothelin.
- Target cells may also include cell lines with endogenous CD19, CD79b, BCMA and/or mesothelin expression (such as Raji, Ramos, RPMI8226, and A1847), or primary tumour samples.
- lysis of target cells is monitored via flow cytometry, 51 Cr release, fluorimetry, or a kinetic viability platform (such as Xcelligence (Acea)).
- Target cell lysis values (Experimental lysis value) from different assay platforms are events/time period (flow cytometry), 51 Cr release counts, relative luminescence units or relative fluorescence units.
- events/time period flow cytometry
- 51 Cr release counts 51 Cr release counts
- relative luminescence units relative fluorescence units.
- target cells are incubated without effector cells (CAR-T cells), and maximum lysis is determined following incubation of target cells with cytotoxic detergent.
- T cells expressing CD19-specific CARs are expected to be able to efficiently lyse CD19-expressing target cells (HeLa-CD19 or Raji), but not CD19-negative target cell types (HeLa, HeLa-CD79b, HeLa-BCMA, RPMI8226 (CD19-low/negative), HeLa-mesothelin, or Al 847).
- mesothelin-specific CARs are able to lyse mesothelin-expressing target cells (Hela-mesothelin or A1847), but do not lyse mesothelin-negative target cell types (HeLa or HeLa-CD19).
- Cognate CAR-driven selectivity profiles are altered upon incubation of CAR-T cells with multi-specific binding molecules that interact with CAR epitopes and alternative TAAs.
- Incubation of T cells expressing CD19-specific CARs with bispecific antibodies targeting the CAR scFv idiotype and a TAA can re-direct cytotoxic responses to alternative TAAs.
- CD19-specific CAR-T populations lyse HeLa-mesothelin or A1847 target cells in the presence of Variants 3, 6 or 9 (anti-CD 19scFv idiotype/mesothelin); b) CD19-specific CAR-T populations lyse HeLa-CD79b target cells in the presence of Variants 1, 4 or 7 (anti-CD 19scFv idiotype/CD79b); c) CD19-specific CAR-T populations lyse HeLa-BCMA or RPMI8226 target cells with increased efficacy in the presence of Variants 2, 5 or 8 (anti-CD 19scFv idiotype/BCMA).
- EXAMPLE 9 Ability of Bispecific Antigen-Binding Constructs to Stimulate Cytokine Production in Co-Culture of Target Cells and CD19-Specific CAR-T Cells in vitro
- Cytokine release is assessed following incubation of the CAR-expressing cells with antigen-expressing or control target cells in the presence or absence of bispecific antigen binding molecules.
- the target cells are the same as those described in Example 7.
- CD 19- specific CAR-T cells are co-cultured with target cells at an optimal effector to target (E:T) ratio (approximately 2: 1).
- the co-cultured cells are incubated for about 24 hours, and supernatants collected for measurement of IFN- ⁇ , TNF-a, or IL-2 using a multiplex cytokine immunoassay (Luminex®) or ELISA.
- results [00254] Incubation of T-cells expressing CD19-specific CARs with bispecific antibodies targeting the CAR scFv idiotype and a TAA are expected to re-direct cytokine production responses to alternative TAAs.
- CD19-specific CAR-T populations produce IFN- ⁇ , TNF-a and IL-2 in response to HeLa-mesothelin or A1847 target cells in the presence of Variants 3, 6 or 9 (anti-CD 19scFv idiotype/mesothelin);
- CD19-specific CAR-T populations produce IFN- ⁇ , TNF-a and IL-2 in response to HeLa-CD79b target cells in the presence of Variants 1, 4 or 7 (anti-CD 19scFv idiotype/CD79b);
- CD19-specific CAR-T populations more efficiently produce IFN- ⁇ , TNF-a and IL- 2 in response to HeLa-BCMA or RPMI8226 target cells in the presence of Variants 2, 5
- EXAMPLE 10 Ability of Bispecific Antigen-Binding Constructs to Stimulate Proliferation of CD19-Specific CAR-T Cells in the Presence of Target Cells
- CD19-specific CAR-T cells Proliferation of CD19-specific CAR-T cells following incubation with CD 19- expressing target cells is assessed by flow cytometry.
- CD19-specific CAR-T cells are labeled with carboxyfluorescein succinmidyl ester (CFSE), washed and incubated for 72 hours with target cells in serum-containing medium without exogenous cytokines.
- the target cells are the same as those described in Example 7. Division of live T-cells is indicated by CFSE dilution, as assessed by flow cytometry.
- T-cells expressing CD19-specific CARs with bispecific antibodies targeting the CAR scFv idiotype and a TAA are expected to re-direct proliferation responses to alternative TAAs.
- CD19-specific CAR-T populations proliferate in response to HeLa-mesothelin or A1847 target cells in the presence of Variants 3, 6 or 9 (anti-CD 19scFv idiotype/mesothelin);
- CD19-specific CAR-T populations proliferate in response to HeLa-CD79b target cells in the presence of Variants 1, 4 or 7 (anti-CD 19scFv idiotype/CD79b);
- CD19-specific CAR-T populations efficiently proliferate in response to HeLa-
- EXAMPLE 11 Ability of Bispecific Antigen-Binding Constructs to Re-Direct CD 19- Specific CAR-T Cells to Alternate TAAs in vivo
- the ability of the bispecific antigen-binding constructs to re-direct the CD19-specific CAR-T cells towards alternative TAAs in vivo is assessed in a patient-derived xenograft (PDX) tumour model by monitoring tumour growth following adoptive transfer of CAR-T cells and administration of the bispecific antigen-binding constructs as described below.
- PDX patient-derived xenograft
- CD19-negative Raji variants (19negRaji) are generated via CRISPR/Cas9- mediated gene editing (for example, using services available from GenScript, Piscataway, NJ), or repeated cycles of flow-cytometric CD19-low population sorting, limiting dilution, and daughter line expansion.
- Groups of six- to eight-week old female NOD.Cg.Prkdc scid IL2rg tm wi /SzJ (NSG) mice are injected intravenously (i.v.) with one of the following: a) Raji lymphoma tumour cells transfected with firefly luciferase; b) CD19-negative Raji (19negRaji) lymphoma tumour cells transfected with firefly luciferase; c) RPMI-8226 multiple myeloma cell (CD19-negative/low, BCMA-positive) tumour cells transfected with firefly luciferase.
- mice receive a single intravenous (i.v.) injection of a sub-optimal dose (an exemplary dose is 1 x 10 6 ) of CD19-specific CAR-T cells.
- a sub-optimal dose an exemplary dose is 1 x 10 6
- Example 1 On various days after CAR-T cell engraftment (commonly day 7), the bispecific antibodies described in Example 1 are administered i.v., intraperitoneally or subcutaneously. Dosing schedules and amounts vary, but exemplary studies administer 10 mg/kg once weekly. [00262] Tumour growth in the mice is monitored by bioluminescence imaging at various time points after tumour cell engraftment, commonly days 4, 7, 14, 21, 27, 34 and 41.
- mice receive intraperitoneal (i.p.) injections of luciferin substrate (CaliperLife Sciences, Hopkinton, MA) in PBS (an exemplary dose is about 15 ⁇ g/g body weight). Mice are anesthetized and imaged essentially as described in Example 7 of International Patent Publication No. WO 2015/095895 and the average radiance (p/s/cm/sr) is determined.
- Control mouse tumours are expected to continue to grow over the course of the study following adoptive transfer of non-target cell directed CAR-T cells, while CD19-specific CAR- T cells are expected to reduce CD 19+ tumour growth compared to expanded, non-transduced T-cell populations.
- CD19-specific CAR- T cells are expected to reduce CD 19+ tumour growth compared to expanded, non-transduced T-cell populations.
- - 19negRaji and RPMI-8226 multiple myeloma tumours are expected to grow normally in mice following administration of CD19-specific CAR-T cells
- CD19-specific CAR-T cell is expected to reduce Raji tumour growth
- CD 19-specific CAR-T cells are expected to reduce CD19-negative tumour growth in mice upon administration of bispecific antigen-binding constructs that bind CAR epitopes and alternative TAAs. Specifically:
- Variants 1, 4 or 7 are expected to enable CD19- specific CAR-T cell control of 19negRaji and RPMI-8226 tumours;
- Anti-BCMA (ADC, human QSVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGT Ab) 2Al (Ab-l); light chain APKLLIFNYHQRPSGVPDRFSGSKSGSSASLAISGLQSEDEADY
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Biophysics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Biomedical Technology (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Zoology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Hematology (AREA)
- Pharmacology & Pharmacy (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Virology (AREA)
- Developmental Biology & Embryology (AREA)
- Oncology (AREA)
- Mycology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines Containing Material From Animals Or Micro-Organisms (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Medicinal Preparation (AREA)
Priority Applications (10)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3021634A CA3021634A1 (en) | 2016-04-15 | 2017-04-13 | Multi-specific antigen-binding constructs targeting immunotherapeutics |
| KR1020187031618A KR20180135460A (ko) | 2016-04-15 | 2017-04-13 | 면역치료제를 표적으로 하는 다중-특이적 항원-결합 작제물 |
| CN201780027726.6A CN109153727A (zh) | 2016-04-15 | 2017-04-13 | 靶向免疫治疗剂的多特异性抗原结合构建体 |
| JP2018553871A JP2019513777A (ja) | 2016-04-15 | 2017-04-13 | 免疫療法薬を標的とする多重特異性抗原結合構築物 |
| RU2018139811A RU2018139811A (ru) | 2016-04-15 | 2017-04-13 | Мультиспецифические антигенсвязывающие конструкции, нацеливающие иммунотерапевтические средства |
| US16/088,760 US20190111079A1 (en) | 2016-04-15 | 2017-04-13 | Multi-specific antigen-binding constructs targeting immunotherapeutics |
| AU2017251116A AU2017251116A1 (en) | 2016-04-15 | 2017-04-13 | Multi-specific antigen-binding constructs targeting immunotherapeutics |
| MX2018012468A MX2018012468A (es) | 2016-04-15 | 2017-04-13 | Construcciones de union a antigeno multiespecificas dirigidas a agentes inmunoterapeuticos. |
| EP17781690.7A EP3443014A4 (en) | 2016-04-15 | 2017-04-13 | MULTI-SPECIFIC ANTIGEN-BINDING CONSTRUCTS AGAINST IMMUNOTHERAPEUTICS |
| BR112018070676A BR112018070676A2 (pt) | 2016-04-15 | 2017-04-13 | construtos de ligação a antígeno multiespecífico que têm como alvo agentes imunoterapêuticos |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201662323432P | 2016-04-15 | 2016-04-15 | |
| US62/323,432 | 2016-04-15 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017177337A1 true WO2017177337A1 (en) | 2017-10-19 |
Family
ID=60042760
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/CA2017/050463 Ceased WO2017177337A1 (en) | 2016-04-15 | 2017-04-13 | Multi-specific antigen-binding constructs targeting immunotherapeutics |
Country Status (11)
| Country | Link |
|---|---|
| US (1) | US20190111079A1 (enExample) |
| EP (1) | EP3443014A4 (enExample) |
| JP (1) | JP2019513777A (enExample) |
| KR (1) | KR20180135460A (enExample) |
| CN (1) | CN109153727A (enExample) |
| AU (1) | AU2017251116A1 (enExample) |
| BR (1) | BR112018070676A2 (enExample) |
| CA (1) | CA3021634A1 (enExample) |
| MX (1) | MX2018012468A (enExample) |
| RU (1) | RU2018139811A (enExample) |
| WO (1) | WO2017177337A1 (enExample) |
Cited By (36)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2019094574A1 (en) * | 2017-11-09 | 2019-05-16 | Medimmune, Llc | Bispecific fusion polypeptides and methods of use thereof |
| WO2019162043A1 (en) * | 2018-02-26 | 2019-08-29 | Medigene Immunotherapies Gmbh | Nyeso tcr |
| WO2019217332A1 (en) * | 2018-05-07 | 2019-11-14 | Dragonfly Therapeutics, Inc. | A protein binding nkg2d, cd16 and a tumor-associated antigen |
| JP2020508662A (ja) * | 2017-02-22 | 2020-03-26 | アレタ・バイオセラピューティクス・インコーポレイテッドAleta Biotherapeutics Inc. | 腫瘍形質導入のための組成物及び方法 |
| JP2020508663A (ja) * | 2017-02-22 | 2020-03-26 | アレタ・バイオセラピューティクス・インコーポレイテッドAleta Biotherapeutics Inc. | 癌の治療のための組成物及び方法 |
| WO2020084608A1 (en) * | 2018-10-22 | 2020-04-30 | Explore Bio 1 Ltd | Precursor bispecific antibody constructs and methods of use thereof |
| WO2020087116A1 (en) * | 2018-10-30 | 2020-05-07 | Peter Maccallum Cancer Institute | Bispecific polypeptides for engagement of car expressing immune cells with antigen presenting cells and uses thereof |
| JP2020533398A (ja) * | 2018-05-21 | 2020-11-19 | レメゲン, エルティーディー.Remegen, Ltd. | 抗体薬物複合体中間体の製造方法 |
| WO2021001458A1 (en) | 2019-07-01 | 2021-01-07 | Tonix Pharma Holdings Limited | Anti-cd154 antibodies and uses thereof |
| WO2021057906A1 (zh) * | 2019-09-25 | 2021-04-01 | 科济生物医药(上海)有限公司 | 表达il-15的免疫效应细胞 |
| CN113646334A (zh) * | 2019-02-20 | 2021-11-12 | 国家儿童医院研究所 | 癌症靶向的、病毒编码的、可调节的t细胞(catvert)或nk细胞(catvern)接头 |
| WO2021250405A1 (en) * | 2020-06-09 | 2021-12-16 | Ucl Business Ltd | Chimeric antigen receptor cell |
| JP2022517329A (ja) * | 2019-01-08 | 2022-03-08 | ラビアールエックス イミュノロジック セラピューティクス (ユーエスエー) リミテッド | ラビリンチン又はその一部を標的とする構築物及びその使用 |
| WO2022064397A1 (en) * | 2020-09-22 | 2022-03-31 | World Biotech Regenerative Medical Group Limited | Methods and compositions of car-expressing natural killer cells with bispecific antigen-binding molecules as cancer therapeutic agents |
| WO2022150452A1 (en) | 2021-01-06 | 2022-07-14 | Seth Lederman | Methods of inducing immune tolerance with modified anti-cd154 antibodies |
| WO2022261510A1 (en) | 2021-06-11 | 2022-12-15 | Sage Therapeutics, Inc. | Neuroactive steroid for the treatment of alzheimer's disease |
| US11834506B2 (en) | 2017-02-08 | 2023-12-05 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind NKG2D, CD16, and a tumor-associated antigen for activation of natural killer cells and therapeutic uses thereof to treat cancer |
| US11878995B2 (en) | 2016-05-06 | 2024-01-23 | Sage Therapeutics, Inc. | Oxysterols and methods of use thereof |
| US11884732B2 (en) | 2017-02-20 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Proteins binding HER2, NKG2D and CD16 |
| US11884733B2 (en) | 2018-02-08 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| WO2024092038A2 (en) | 2022-10-25 | 2024-05-02 | Ablexis, Llc | Anti-cd3 antibodies |
| WO2024107731A2 (en) | 2022-11-14 | 2024-05-23 | Ablexis, Llc | Anti-pd-l1 antibodies |
| WO2024182516A1 (en) * | 2023-02-28 | 2024-09-06 | Juno Therapeutics, Inc. | Cell therapy for treating systemic autoimmune diseases |
| US12097259B2 (en) * | 2022-01-11 | 2024-09-24 | Shenzhen Frontiergate Biotechnology Co., Ltd | Dendritic cell tumor vaccine and uses thereof |
| RU2827779C2 (ru) * | 2019-02-20 | 2024-10-02 | Рисёрч Институт Эт Нейшнуайд Чилдрен'З Хоспитал | Вирус-кодируемые регулируемые агенты, связывающие T-клетки (CATVERT) или NK-клетки (CATVERN), нацеленные на рак |
| US12157771B2 (en) | 2020-05-06 | 2024-12-03 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and CLEC12A |
| US12215157B2 (en) | 2018-02-20 | 2025-02-04 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use |
| US12258581B2 (en) | 2017-11-08 | 2025-03-25 | Biontech Us Inc. | T cell manufacturing compositions and methods |
| US12275791B2 (en) | 2018-08-08 | 2025-04-15 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use |
| US12378318B2 (en) | 2018-08-08 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and a tumor-associated antigen |
| US12377144B2 (en) | 2021-03-03 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen |
| US12384851B2 (en) | 2018-08-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind BCMA, NKG2D and CD16, and methods of use |
| US12384847B2 (en) | 2018-02-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen |
| EP4405379A4 (en) * | 2021-09-24 | 2025-08-20 | Synergy Imt Inc | COMPOSITION OF RECOMBINANT ANTIGEN-BINDING MOLECULES AND METHOD OF MANUFACTURE AND USE THEREOF |
| EP4578507A3 (en) * | 2018-11-01 | 2025-11-12 | Gracell Biotechnologies (Shanghai) Co., Ltd. | Compositions and methods for t cell engineering |
| WO2025248134A1 (en) | 2024-05-31 | 2025-12-04 | Tonix Pharma Limited | Treatment methods comprising administration of modified cd154 antibodies |
Families Citing this family (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3802611A2 (en) | 2018-06-01 | 2021-04-14 | Novartis AG | Binding molecules against bcma and uses thereof |
| CU20210096A7 (es) | 2019-05-21 | 2022-06-06 | Novartis Ag | Moléculas de unión a cd19 |
| AU2020279224B2 (en) * | 2019-05-21 | 2024-12-05 | Novartis Ag | Trispecific binding molecules against BCMA and uses thereof |
| CN111235113A (zh) * | 2020-01-21 | 2020-06-05 | 南京北恒生物科技有限公司 | 包含嵌合抗原受体的免疫细胞及其用途 |
| CA3231174A1 (en) * | 2021-08-02 | 2023-02-09 | Innovent Biologics (Suzhou) Co., Ltd. | Anti-cd79bxcd3 bispecific antibody and use thereof |
| WO2023016505A1 (zh) * | 2021-08-12 | 2023-02-16 | 广东东阳光药业有限公司 | Il-11人源化抗体及其应用 |
| CN115368446B (zh) * | 2022-07-19 | 2025-08-08 | 合肥天港免疫药物有限公司 | 双特异性抗体及其应用 |
| WO2025194123A1 (en) * | 2024-03-15 | 2025-09-18 | Aarvik Therapeutics, Inc. | Muc16/napi-2b antibodies and methods of use |
| CN117965633A (zh) * | 2024-04-01 | 2024-05-03 | 北京双赢科创生物科技有限公司 | 一种IFNγ受体敲除的CAR-T细胞的制备方法与应用 |
Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014190273A1 (en) * | 2013-05-24 | 2014-11-27 | Board Of Regents, The University Of Texas System | Chimeric antigen receptor-targeting monoclonal antibodies |
Family Cites Families (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EA036225B1 (ru) * | 2012-03-14 | 2020-10-15 | Ридженерон Фармасьютикалз, Инк. | Мультиспецифические антигенсвязывающие молекулы и их применения |
| WO2013166604A1 (en) * | 2012-05-10 | 2013-11-14 | Zymeworks Inc. | Single-arm monovalent antibody constructs and uses thereof |
| CN111676196A (zh) * | 2012-05-25 | 2020-09-18 | 塞勒克提斯公司 | 工程化异体和免疫抑制耐受性t细胞的方法 |
| AU2013289883B2 (en) * | 2012-07-13 | 2018-11-01 | Zymeworks Bc Inc. | Bispecific asymmetric heterodimers comprising anti-CD3 constructs |
| PL2925350T3 (pl) * | 2012-12-03 | 2019-07-31 | Bristol-Myers Squibb Company | Zwiększenie aktywności przeciwnowotworowej immunomodulacyjnych białek fuzyjnych fc |
| PT3083671T (pt) * | 2013-12-20 | 2020-12-24 | Hutchinson Fred Cancer Res | Moléculas efetoras quiméricas etiquetadas e recetores destas |
| CA2937711C (en) * | 2014-02-14 | 2020-10-20 | Cellectis | Cells for immunotherapy engineered for targeting antigen present both on immune cells and pathological cells |
| HK1243333A1 (zh) * | 2014-10-31 | 2018-07-13 | The Trustees Of The University Of Pennsylvania | 用於修饰的t细胞的方法和组合物 |
| US10617720B2 (en) * | 2016-10-20 | 2020-04-14 | Miltenyi Biotech, GmbH | Chimeric antigen receptor specific for tumor cells |
-
2017
- 2017-04-13 CN CN201780027726.6A patent/CN109153727A/zh active Pending
- 2017-04-13 AU AU2017251116A patent/AU2017251116A1/en not_active Abandoned
- 2017-04-13 EP EP17781690.7A patent/EP3443014A4/en not_active Withdrawn
- 2017-04-13 CA CA3021634A patent/CA3021634A1/en not_active Abandoned
- 2017-04-13 JP JP2018553871A patent/JP2019513777A/ja active Pending
- 2017-04-13 US US16/088,760 patent/US20190111079A1/en not_active Abandoned
- 2017-04-13 BR BR112018070676A patent/BR112018070676A2/pt not_active IP Right Cessation
- 2017-04-13 WO PCT/CA2017/050463 patent/WO2017177337A1/en not_active Ceased
- 2017-04-13 MX MX2018012468A patent/MX2018012468A/es unknown
- 2017-04-13 RU RU2018139811A patent/RU2018139811A/ru not_active Application Discontinuation
- 2017-04-13 KR KR1020187031618A patent/KR20180135460A/ko not_active Ceased
Patent Citations (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2014190273A1 (en) * | 2013-05-24 | 2014-11-27 | Board Of Regents, The University Of Texas System | Chimeric antigen receptor-targeting monoclonal antibodies |
Non-Patent Citations (4)
| Title |
|---|
| GRADA, Z. ET AL.: "TanCAR: A Novel Bispecific Chimeric Antigen Receptor for Cancer Immunotherapy", MOL. THER. NUCLEIC ACIDS, vol. 2, 9 July 2013 (2013-07-09), pages e105-1 - e105-12, XP002736704, Retrieved from the Internet <URL:doi:10.1038/mtna.2013.32> * |
| HEDGE, M. ET AL.: "Combinatorial Targeting Offsets Antigen Escape and Enhances Effector Functions of Adoptively Transferred T Cells in Glioblastoma", MOL. THER., vol. 21, no. 11, 1 November 2013 (2013-11-01), pages 2087 - 2101, XP002725708, ISSN: 1525-0024, DOI: doi:10.1038/mt.2013.185 * |
| MA, Y. ET AL.: "Targeting of Antigens to B Lymphocytes via CD 19 as a Means for Tumor Vaccine Development", J. IMMUNOL., vol. 190, no. 11, 1 June 2013 (2013-06-01), pages 5588 - 99, XP055579523, ISSN: 0022-1767, DOI: 10.4049/jimmunol.1203216 * |
| See also references of EP3443014A4 * |
Cited By (58)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US11878995B2 (en) | 2016-05-06 | 2024-01-23 | Sage Therapeutics, Inc. | Oxysterols and methods of use thereof |
| US11834506B2 (en) | 2017-02-08 | 2023-12-05 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind NKG2D, CD16, and a tumor-associated antigen for activation of natural killer cells and therapeutic uses thereof to treat cancer |
| US11884732B2 (en) | 2017-02-20 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Proteins binding HER2, NKG2D and CD16 |
| JP2020508662A (ja) * | 2017-02-22 | 2020-03-26 | アレタ・バイオセラピューティクス・インコーポレイテッドAleta Biotherapeutics Inc. | 腫瘍形質導入のための組成物及び方法 |
| JP2020508663A (ja) * | 2017-02-22 | 2020-03-26 | アレタ・バイオセラピューティクス・インコーポレイテッドAleta Biotherapeutics Inc. | 癌の治療のための組成物及び方法 |
| EP3585817A4 (en) * | 2017-02-22 | 2020-12-02 | Aleta Biotherapeutics Inc. | COMPOSITIONS AND METHODS FOR THE TREATMENT OF CANCER |
| US12258581B2 (en) | 2017-11-08 | 2025-03-25 | Biontech Us Inc. | T cell manufacturing compositions and methods |
| JP2021502360A (ja) * | 2017-11-09 | 2021-01-28 | メディミューン,エルエルシー | 二重特異的融合ポリペプチド及びその使用方法 |
| WO2019094574A1 (en) * | 2017-11-09 | 2019-05-16 | Medimmune, Llc | Bispecific fusion polypeptides and methods of use thereof |
| US12384847B2 (en) | 2018-02-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Cancer therapy involving an anti-PD1 antibody and a multi-specific binding protein that binds NKG2D, CD16, and a tumor-associated antigen |
| US12129300B2 (en) | 2018-02-08 | 2024-10-29 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US12264200B2 (en) | 2018-02-08 | 2025-04-01 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US11939384B1 (en) | 2018-02-08 | 2024-03-26 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US11884733B2 (en) | 2018-02-08 | 2024-01-30 | Dragonfly Therapeutics, Inc. | Antibody variable domains targeting the NKG2D receptor |
| US12215157B2 (en) | 2018-02-20 | 2025-02-04 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind CD33, NKG2D, and CD16, and methods of use |
| EP4424710A3 (en) * | 2018-02-26 | 2025-01-15 | Medigene Immunotherapies GmbH | Nyeso tcr |
| US12103957B2 (en) | 2018-02-26 | 2024-10-01 | Medigene Immunotherapies Gmbh | Nyeso tcr |
| US11267864B2 (en) | 2018-02-26 | 2022-03-08 | Medigene Immunotherapies Gmbh | Nyeso tcr |
| AU2019225798B2 (en) * | 2018-02-26 | 2023-05-18 | Medigene Immunotherapies Gmbh | Nyeso tcr |
| WO2019162043A1 (en) * | 2018-02-26 | 2019-08-29 | Medigene Immunotherapies Gmbh | Nyeso tcr |
| JP2021523140A (ja) * | 2018-05-07 | 2021-09-02 | ドラゴンフライ セラピューティクス, インコーポレイテッド | Nkg2d、cd16、及び腫瘍関連抗原に結合するタンパク質 |
| WO2019217332A1 (en) * | 2018-05-07 | 2019-11-14 | Dragonfly Therapeutics, Inc. | A protein binding nkg2d, cd16 and a tumor-associated antigen |
| EP3695852A4 (en) * | 2018-05-21 | 2021-09-15 | RemeGen, Ltd. | ANTI-MESOTHELIN ANTIBODY AND ANTIBODY-ASSOCIATED DRUG CONJUGATE |
| JP2020533398A (ja) * | 2018-05-21 | 2020-11-19 | レメゲン, エルティーディー.Remegen, Ltd. | 抗体薬物複合体中間体の製造方法 |
| US12384851B2 (en) | 2018-08-08 | 2025-08-12 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind BCMA, NKG2D and CD16, and methods of use |
| US12275791B2 (en) | 2018-08-08 | 2025-04-15 | Dragonfly Therapeutics, Inc. | Multi-specific binding proteins that bind HER2, NKG2D, and CD16, and methods of use |
| US12378318B2 (en) | 2018-08-08 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and a tumor-associated antigen |
| WO2020084608A1 (en) * | 2018-10-22 | 2020-04-30 | Explore Bio 1 Ltd | Precursor bispecific antibody constructs and methods of use thereof |
| EP3877417A4 (en) * | 2018-10-30 | 2022-08-03 | Peter MacCallum Cancer Institute | Bispecific polypeptides for engagement of car expressing immune cells with antigen presenting cells and uses thereof |
| US11866504B2 (en) | 2018-10-30 | 2024-01-09 | Peter Maccallum Cancer Institute | Bispecific polypeptides for engagement of CAR expressing immune cells with antigen presenting cells and uses thereof |
| JP2022528024A (ja) * | 2018-10-30 | 2022-06-08 | ピーター・マッカラム・キャンサー・インスティテュート | Carを発現する免疫細胞に抗原提示細胞を係合させるための二重特異性ポリペプチド及びそれらの使用 |
| AU2019370618B2 (en) * | 2018-10-30 | 2022-08-11 | Peter Maccallum Cancer Institute | Bispecific polypeptides for engagement of CAR expressing immune cells with antigen presenting cells and uses thereof |
| JP7674243B2 (ja) | 2018-10-30 | 2025-05-09 | ピーター・マッカラム・キャンサー・インスティテュート | Carを発現する免疫細胞に抗原提示細胞を係合させるための二重特異性ポリペプチド及びそれらの使用 |
| AU2019370618C1 (en) * | 2018-10-30 | 2023-02-09 | Peter Maccallum Cancer Institute | Bispecific polypeptides for engagement of CAR expressing immune cells with antigen presenting cells and uses thereof |
| AU2022263573B2 (en) * | 2018-10-30 | 2025-04-10 | Peter Maccallum Cancer Institute | Bispecific polypeptides for engagement of CAR expressing immune cells with antigen presenting cells and uses thereof |
| WO2020087116A1 (en) * | 2018-10-30 | 2020-05-07 | Peter Maccallum Cancer Institute | Bispecific polypeptides for engagement of car expressing immune cells with antigen presenting cells and uses thereof |
| CN113195535A (zh) * | 2018-10-30 | 2021-07-30 | 彼得麦克卡勒姆癌症研究所 | 用于连接表达car的免疫细胞与抗原呈递细胞的双特异性多肽及其用途 |
| EP4578507A3 (en) * | 2018-11-01 | 2025-11-12 | Gracell Biotechnologies (Shanghai) Co., Ltd. | Compositions and methods for t cell engineering |
| JP2022517329A (ja) * | 2019-01-08 | 2022-03-08 | ラビアールエックス イミュノロジック セラピューティクス (ユーエスエー) リミテッド | ラビリンチン又はその一部を標的とする構築物及びその使用 |
| CN113646334A (zh) * | 2019-02-20 | 2021-11-12 | 国家儿童医院研究所 | 癌症靶向的、病毒编码的、可调节的t细胞(catvert)或nk细胞(catvern)接头 |
| EP3927750A4 (en) * | 2019-02-20 | 2022-11-02 | Research Institute at Nationwide Children's Hospital | Cancer-targeted, virus-encoded, regulatable t (catvert) or nk cell (catvern) linkers |
| RU2827779C2 (ru) * | 2019-02-20 | 2024-10-02 | Рисёрч Институт Эт Нейшнуайд Чилдрен'З Хоспитал | Вирус-кодируемые регулируемые агенты, связывающие T-клетки (CATVERT) или NK-клетки (CATVERN), нацеленные на рак |
| EP4491193A2 (en) | 2019-07-01 | 2025-01-15 | Tonix Pharma Limited | Anti-cd154 antibodies and uses thereof |
| WO2021001458A1 (en) | 2019-07-01 | 2021-01-07 | Tonix Pharma Holdings Limited | Anti-cd154 antibodies and uses thereof |
| WO2021057906A1 (zh) * | 2019-09-25 | 2021-04-01 | 科济生物医药(上海)有限公司 | 表达il-15的免疫效应细胞 |
| US12157771B2 (en) | 2020-05-06 | 2024-12-03 | Dragonfly Therapeutics, Inc. | Proteins binding NKG2D, CD16 and CLEC12A |
| WO2021250405A1 (en) * | 2020-06-09 | 2021-12-16 | Ucl Business Ltd | Chimeric antigen receptor cell |
| GB2621653A (en) * | 2020-09-22 | 2024-02-21 | World Biotech Regenerative Medical Group Ltd | Methods and compositions of car-expressing natural killer cells with bispecific antigen-binding molecules as cancer therapeutic agents |
| WO2022064397A1 (en) * | 2020-09-22 | 2022-03-31 | World Biotech Regenerative Medical Group Limited | Methods and compositions of car-expressing natural killer cells with bispecific antigen-binding molecules as cancer therapeutic agents |
| WO2022150452A1 (en) | 2021-01-06 | 2022-07-14 | Seth Lederman | Methods of inducing immune tolerance with modified anti-cd154 antibodies |
| US12377144B2 (en) | 2021-03-03 | 2025-08-05 | Dragonfly Therapeutics, Inc. | Methods of treating cancer using multi-specific binding proteins that bind NKG2D, CD16 and a tumor-associated antigen |
| WO2022261510A1 (en) | 2021-06-11 | 2022-12-15 | Sage Therapeutics, Inc. | Neuroactive steroid for the treatment of alzheimer's disease |
| EP4405379A4 (en) * | 2021-09-24 | 2025-08-20 | Synergy Imt Inc | COMPOSITION OF RECOMBINANT ANTIGEN-BINDING MOLECULES AND METHOD OF MANUFACTURE AND USE THEREOF |
| US12097259B2 (en) * | 2022-01-11 | 2024-09-24 | Shenzhen Frontiergate Biotechnology Co., Ltd | Dendritic cell tumor vaccine and uses thereof |
| WO2024092038A2 (en) | 2022-10-25 | 2024-05-02 | Ablexis, Llc | Anti-cd3 antibodies |
| WO2024107731A2 (en) | 2022-11-14 | 2024-05-23 | Ablexis, Llc | Anti-pd-l1 antibodies |
| WO2024182516A1 (en) * | 2023-02-28 | 2024-09-06 | Juno Therapeutics, Inc. | Cell therapy for treating systemic autoimmune diseases |
| WO2025248134A1 (en) | 2024-05-31 | 2025-12-04 | Tonix Pharma Limited | Treatment methods comprising administration of modified cd154 antibodies |
Also Published As
| Publication number | Publication date |
|---|---|
| CA3021634A1 (en) | 2017-10-19 |
| RU2018139811A (ru) | 2020-05-15 |
| KR20180135460A (ko) | 2018-12-20 |
| EP3443014A1 (en) | 2019-02-20 |
| RU2018139811A3 (enExample) | 2021-01-14 |
| BR112018070676A2 (pt) | 2019-02-05 |
| MX2018012468A (es) | 2019-06-06 |
| JP2019513777A (ja) | 2019-05-30 |
| CN109153727A (zh) | 2019-01-04 |
| US20190111079A1 (en) | 2019-04-18 |
| AU2017251116A1 (en) | 2018-12-06 |
| EP3443014A4 (en) | 2020-01-01 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US20190111079A1 (en) | Multi-specific antigen-binding constructs targeting immunotherapeutics | |
| JP7302990B2 (ja) | ヒト及び非ヒトcd3に結合可能なcd3結合分子 | |
| US20220135676A1 (en) | Multispecific antigen binding proteins | |
| EP3468586B1 (en) | Bispecific checkpoint inhibitor antibodies | |
| JP6840682B2 (ja) | 多重特異的抗原結合タンパク質 | |
| JP6971153B2 (ja) | 多重特異的nkエンゲイジャータンパク質 | |
| US20200048371A1 (en) | Tumor antigen presentation inducer constructs and uses thereof | |
| CN107428830A (zh) | 单体fc结构域 | |
| CN108699124A (zh) | 靶向表皮生长因子受体变体iii的嵌合抗原受体 | |
| US20200325232A1 (en) | Multispecific antigen binding proteins | |
| EP4240494A1 (en) | Anti-cd19 agent and b cell targeting agent combination therapy for treating b cell malignancies | |
| US20240132607A1 (en) | Antibodies binding to cd30 and cd3 | |
| WO2022026939A2 (en) | Single and dual targeting ligand induced t-cell engager compositions | |
| WO2020089437A1 (en) | Combination therapy |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| DPE1 | Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101) | ||
| ENP | Entry into the national phase |
Ref document number: 3021634 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2018553871 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112018070676 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20187031618 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2017781690 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2017781690 Country of ref document: EP Effective date: 20181115 |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 17781690 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2017251116 Country of ref document: AU Date of ref document: 20170413 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112018070676 Country of ref document: BR Kind code of ref document: A2 Effective date: 20181008 |