WO2017098322A1 - Modified nanopores, compositions comprising the same, and uses thereof - Google Patents
Modified nanopores, compositions comprising the same, and uses thereof Download PDFInfo
- Publication number
- WO2017098322A1 WO2017098322A1 PCT/IB2016/001841 IB2016001841W WO2017098322A1 WO 2017098322 A1 WO2017098322 A1 WO 2017098322A1 IB 2016001841 W IB2016001841 W IB 2016001841W WO 2017098322 A1 WO2017098322 A1 WO 2017098322A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- nanopore
- amino acid
- modified clya
- clya nanopore
- modified
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/68—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving nucleic acids
- C12Q1/6869—Methods for sequencing
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/001—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/483—Physical analysis of biological material
- G01N33/487—Physical analysis of biological material of liquid biological material
- G01N33/48707—Physical analysis of biological material of liquid biological material by electrical means
- G01N33/48721—Investigating individual macromolecules, e.g. by translocation through nanopores
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q2565/00—Nucleic acid analysis characterised by mode or means of detection
- C12Q2565/60—Detection means characterised by use of a special device
- C12Q2565/631—Detection means characterised by use of a special device being a biochannel or pore
Definitions
- ClyA cytolysin A
- compositions for example, for characterizing a target analyte, e.g. , a target polynucleotide, are also provided.
- Transmembrane pores have been used to identify small molecules or folded proteins and to monitor chemical or enzymatic reactions at the single molecule level.
- the electrophoretic translocation of DNA across nanopores reconstituted into artificial membranes holds great promise for practical applications such as DNA sequencing, and biomarker recognition.
- translocation of double- stranded or single- stranded DNA through nanopores having internal surface facing negatively charged amino acids are not efficient.
- the surface potential produced by the electric-double layer (EDL) on the inner nanopore walls overlaps, resulting in a large electrostatic barrier for the entry of
- the present disclosure is based, at least in part, on the unexpected discovery that while certain protein nanopores, for example, a cytolysin A (ClyA) nanopore, has a negatively-charged narrow constriction (or a region which inhibits or reduces efficiency of translocation), successful capture and translocation of a negatively-charged molecule or polymer (e.g. , double stranded or single stranded DNA) through such a protein nanopore having a negatively-charged narrow constriction in low ionic strength solutions can be achieved by introducing positive charges, for example, positively-charged amino acids (e.g. , arginines), within the luminal surface of the protein nanopore (e.g.
- positively-charged amino acids e.g. , arginines
- ClyA nanopore to capture and orient the negatively-charged molecule or polymer (e.g. , double stranded or single stranded DNA) within the nanopore.
- positive charges e.g., positively-charged amino acids (e.g. , arginines) can be introduced within the luminal surface of a protein nanopore having a negatively-charged narrow constriction (e.g., ClyA nanopore) near its opening (e.g., an opening for entry of a negatively-charged molecule or polymer) and within its midsection.
- ClyA- AS an engineered ClyA version selected for its advantageous properties in planar lipid bilayers, were used to create modified ClyA nanopores as described herein.
- the internal charges of ClyA-AS were rearranged to induce the capture of DNA by the nanopores at physiological ionic strengths.
- the modified ClyA nanopore comprises a cis opening, a mid-section, and a trans opening, wherein an internal surface of the cis opening comprises a first positively-charged amino acid substitution; an internal surface of the midsection comprises a second positively-charged amino acid substitution; and the trans opening comprises an electronegative constriction.
- the first positively-charged amino acid substitution e.g.
- substitution with arginine may be positioned within the cis opening so as to permit capture of a DNA into the modified ClyA nanopore and/or the second positively- charged amino acid substitution (e.g., substitution with arginine) may be positioned within the mid-section so as to permit translocation of the DNA through the modified ClyA nanopore.
- the first positively-charged amino acid substitution may correspond to a S 110R mutation in the amino acid sequence of ClyA-AS and/or the second positively-charged amino acid substitution may correspond to a D64R mutation in the amino acid sequence of ClyA-AS.
- one aspect of the present disclosure features a modified ClyA nanopore, for example, that permits capture of a negatively-charged polymer into the modified ClyA nanopore and/or translocation of the negatively-charged polymer through the modified ClyA nanopore.
- the modified ClyA nanopore comprises a first opening, a mid-section, a second opening, and a lumen extending from the first opening through the mid-section to the second opening, wherein a luminal surface of the first opening comprises a first positive charge modification (e.g., a first positively-charged amino acid substitution) and a luminal surface of the mid-section comprises a second positive charge modification (e.g. , a second positively charged amino acid substitution).
- the luminal surface of the second opening defines an electronegative constriction.
- the distance within the lumen from the first positive charge modification (e.g. , the first positively-charged amino acid substitution) to the second positive charge modification (e.g. , the second positively charged amino acid substitution) may vary within a range of about 0.5 nm to about 10 nm. In some embodiments, the distance within the lumen from the first positive charge modification (e.g. , the first positively-charged amino acid substitution) to the first opening surface may vary within a range of about 3 nm to about 7 nm.
- ClyA may be used to produce the modified ClyA nanopore described herein.
- the amino acid sequences of wild-type ClyA (ClyA-WT) and ClyA- AS, and nucleotide sequences encoding the same are known in the art. Accordingly, in some
- the modified ClyA nanopore may comprise a subunit polypeptide having an amino acid sequence that is at least about 80% (including, e.g. , at least about 85%, at least about 90%, at least about 95%, or higher) identical to the amino acid sequence as set forth in SEQ ID NO: 1 , which corresponds to the wild-type ClyA.
- the modified ClyA nanopore may comprise a subunit polypeptide having an amino acid sequence that is at least about 80% (including, e.g. , at least about 85%, at least about 90%, at least about 95%, or higher) identical to the amino acid sequence as set forth in SEQ ID NO: 1 , which corresponds to the wild-type ClyA.
- the modified ClyA nanopore may comprise a subunit polypeptide having an amino acid sequence that is at least about 80%
- the modified ClyA nanopore may comprise up to 15 substitutions compared to the amino acid sequences as set forth in SEQ ID NO: 1 or SEQ ID NO: 2 including the first and second positively-charged amino acid substitutions.
- the first positive charge modification (e.g. , the first positively-charged amino acid substitution) may be positioned within the first opening so as to permit capture of a negatively charged polymer (e.g. , but not limited to a deoxyribonucleic acid (DNA) such as double stranded DNA or single- stranded DNA) within a solution exposed to the first opening.
- a negatively charged polymer e.g. , but not limited to a deoxyribonucleic acid (DNA) such as double stranded DNA or single- stranded DNA
- substitution with a positive charge e.g.
- a positively-charged amino acid may take place at one of more of the following positions: E 106, D114, D 121 , D 122, E129, E85, E78, D268, D267, D265, E258 of SEQ ID NO: 1 or SEQ ID NO: 2.
- the second positive charge modification (e.g. , the second positively-charged amino acid substitution) may be positioned within the mid-section so as to permit translocation of the negatively charged polymer (e.g. , but not limited to a deoxyribonucleic acid (DNA) such as double stranded DNA or single- stranded DNA) through the lumen of the pore.
- the negatively charged polymer e.g. , but not limited to a deoxyribonucleic acid (DNA) such as double stranded DNA or single- stranded DNA
- substitution with a positive charge may take place at one of more of the following positions: D74, D71 , D64, E53, E161 , D158, E46, E42, D41 of SEQ NO: 1 or SEQ ID NO: 2.
- the distance between the first and second positive charge modifications is preferably from about 0.5nm to about 10 nm.
- the distance may be between from about 3 nm to about 7nm.
- the modified ClyA nanopore can be homo-multimeric (e.g. , all subunits within the nanopore are the same) or hetero-multimeric (e.g. , at least one subunit is different from others within the nanopore).
- the modified ClyA nanopore may comprise any number of subunit polypeptides that are sufficient to form a lumen large enough to permit a target polymer (e.g. , polynucleotide) pass through.
- the modified ClyA nanopore may comprise 12 subunit polypeptides or more, including, e.g. , 13 subunit polypeptides, and 14 subunit polypeptides, wherein at least one or more of the subunit polypeptides comprises the first and second positively-charged amino acid substitutions as described herein.
- the first and second positive charge modifications may take place in all the subunits of the nanopore.
- modified ClyA nanopore subunit polypeptide and polynucleotides comprising nucleotide sequences encoding the modified ClyA nanopore subunit polypeptides are also provided herein.
- the modified ClyA nanopore subunit polypeptide comprises an amino acid sequence that is at least about 80% (including, e.g. , at least about 85%, at least about 90%, at least about 95%, or higher) identical to the amino acid sequence as set forth in SEQ ID NO: 1 or SEQ ID NO: 2, and wherein the amino acid sequence comprises a first positive charge modification (e.g.
- the first positive charge modification (e.g. , the first positively-charged amino acid substitution) may be located at position 1 10 of SEQ ID NO: 1 or SEQ ID NO: 2; and/or the second positive charge modification (e.g. , the second positively-charged amino acid substitution) may be located at position 64 of SEQ ID NO: 1 or SEQ ID NO:2.
- the first and/or second positively-charged amino acid substitutions include, but are not limited to substitution with one of an arginine, a histidine, and a lysine.
- compositions for example, for use in characterizing a target polymer, e.g. , a target negative-charged polymer such as a target polynucleotide.
- the composition comprises any of the modified ClyA nanopores described herein.
- the composition may further comprise a membrane (e.g. , an artificial membrane) in which the modified ClyA nanopore is situated.
- the composition may further comprise a low ionic strength solution, for example, a salt solution having an ionic strength of about 100 mM to about 300 mM or about 150 mM to about 300 mM. More generally the salt solution may have an ionic strength of about 50mM to about 1M.
- the composition may further comprise a polynucleotide binding protein, which can be optionally coupled to the modified ClyA nanopore.
- the modified ClyA nanopores and compositions as described herein can be used for various biosensor or analyte detection applications, but not limited to polynucleotide sequencing.
- the analyte may be a protein.
- a method of translocating a DNA at a low ionic strength is described herein.
- the method comprises (a) providing, in a low ionic strength solution, any one of the modified ClyA nanopores described herein and a membrane (e.g., an artificial membrane), wherein the modified ClyA nanopore is present in the membrane such that the cis opening of the modified ClyA nanopore is present in a cis side of the low ionic strength solution and the trans opening of the modified ClyA nanopore is present in a trans side of the low ionic strength solution; (b) providing a DNA in the cis side of the low ionic strength solution; and (c) applying an electrical potential across the modified ClyA nanopore so that the DNA is translocated through the modified ClyA nanopore from the cis side to the trans side.
- a membrane e.g., an artificial membrane
- the low ionic strength solution may be a salt solution (e.g., a sodium chloride solution) having an ionic strength of about 150 mM to about 300 mM.
- a salt solution e.g., a sodium chloride solution
- Such a method may be used for characterizing a polynucleotide (e.g., DNA or RNA).
- a method of characterizing a target polynucleotide comprises (a) providing, in a low ionic strength solution (e.g., of about 150 mM to about 300 mM), any one of the modified ClyA nanopores described herein and a membrane, wherein the modified ClyA nanopore is present in the membrane; (b) adding in the low ionic strength solution of step (a) the target polynucleotide; and (c) measuring, during application of a potential across the nanopore, ion flow through the modified ClyA nanopore, wherein the ion flow measurements are indicative of one or more characteristics of the target polynucleotide.
- a low ionic strength solution e.g., of about 150 mM to about 300 mM
- Non-limiting examples of the characteristics of the target polynucleotides that can be determined using the methods described herein include (i) the length of the target polynucleotide, (ii) the identity of the target polynucleotide, (iii) the sequence of the target polynucleotide, (iv) the secondary structure of the target polynucleotide, (v) whether or not the target polynucleotide is modified, and thereby characterizing the target polynucleotide, and any combinations thereof.
- the target polynucleotide can be a single-stranded
- the method can further comprise adding a polynucleotide binding protein in the low ionic strength solution such that the polynucleotide binding protein binds to the target polynucleotide and controls the movement of the target polynucleotide through the modified ClyA nanopore.
- FIG. 1 Engineering ClyA nanopore for DNA translocation.
- Panel A Cross section for ClyA-AS and ClyA-RR nanopores imbedded into a lipid bilayer constructed by homology modeling from the E. coli ClyA structure (PDB: 2WCD, 90% sequence identity).
- the inner pore lumen is shown as surface representation and shaded according to the "z ' ra vacuo" electrostatics (darker shade for negative regions, and lighter shade for positive regions,
- Panel B Current versus voltage relationship for ClyA-AS and ClyA-RR.
- Panel C ssDNA (la, 1 ⁇ ) and (Panel D) dsDNA (1, 170 nM) translocation through ClyA-RR nanopores at physiological ionic strength at +70 mV.
- the bottom current traces show a magnification of the DNA translocation events.
- the current signal was acquired at 10 kHz applying a 2-kHz low- pass Bessel filter.
- the buffer was 150 mM NaCl, 15 niM Tris HC1, pH 7.5, and the temperature 22°C.
- FIG. 2 DNA rotaxane formation in 150 mM NaCl solutions.
- Panel A A dsDNA rotaxane was formed at +50 mV by adding a hybrid dsDNA/ssDNA thread la/lc (1.0 ⁇ ) complexed with neutravidin (1.2 ⁇ , monomer) to the cis compartment, la/lc contained a 31 bases single stranded overhang at the 5' that was used to hybridize with Id (1.0 ⁇ ), a biotinylated ssDNA molecule complementary to the ssDNA overhang of la/lc. Thus, a nanopore/DNA rotaxane is formed only if la/lc translocates the nanopore. When DNA occupied the lumen of ClyA the open pore current was reduced at positive applied potentials
- Panel B A ssDNA/dsDNA hybrid rotaxane was formed at +50 mV by adding a 5' biotinylated ssDNA thread 2a (1.0 ⁇ , black line) complexed with neutravidin (1.2 ⁇ , monomer) to the cis compartment of a ClyA-RR nanopore. A second 5' biotinylated ssDNA molecule 2b (1.0 ⁇ ) complementary to the 3' end of 2a and complexed with neutravidin (1.2 ⁇ , monomer) was added to the trans compartment.
- FIG. 3 Ionic strength dependency of DNA translocation and threading.
- Panel B Dependency of the residual current of dsDNA (triangles) and Neutravidin:dsDNA complex (circles) blockades on the solution Debye length. The lines represent linear regressions.
- Panel C Same as in Panel B but for ssDNA.
- Panel D Ionic strength dependency of DNA threading.
- the open pore was regenerated by manual reversal of the potential to -70mV. Spikes above and below the open pore current level represent capacitive transients following the potential reversal.
- the electrical recordings were carried out in 15 mM Tris HC1, pH 7.5, at 22°C. Data were by applying a 10-kHz low-pass Bessel filter and using a 20 ⁇ & (50 kHz) sampling rate and are listed in Table 7. At 150 mM NaCl and additional digital 2-kHz low-pass Bessel filter was applied to the current traces.
- FIG. 4 Unidirectional DNA translocation through ClyA-RR nanopores.
- Panel A) In 150 mM NaCl solutions, the addition of 3 ⁇ of dsDNA 1 to both the cis and trans sides of a ClyA-RR nanopores induced transient current blockades (grey vertical lines) only under positive applied potentials.
- Panel B) In 1.0 M NaCl solutions, the DNA blockades are observed under both applied potentials. DNA induced blockades are shown as grey vertical lines. The applied potential was automatically changed from +70 to -70 mV (Panel A) or from +100 to - 100 mV (Panel B) in 21 seconds. The electrical recordings were carried out in 15 mM Tris HC1, pH 7.5, at 22°C.
- FIG. 5 Mechanism of dsDNA and ssDNA translocation through ClyA nanopores.
- Panel A dsDNA translocation. (1) dsDNA initially interact with the charges at the cis entrance of the nanopore. (2) dsDNA penetrate inside the nanopore where it interacts with the second engineered charge. Both charges are important to align the DNA for productive translocation through the negatively charged trans constriction. (3) The dsDNA can then translocate and then (4) exit the pore.
- ssDNA In order to translocate the trans constriction, ssDNA needs to uncoil to then recoil outside the nanopore. (4) DNA exit the nanopore.
- the DNA molecules and the nanopore are drawn in scale.
- Rg indicates the gyration radius of ssDNA.
- dsDNA is a rigid rod and ssDNA is a coiled structure with a gyration radius of ⁇ 6 nm.
- FIG. 6 DNA translocation from the cis side of ClyA nanopores in 0.15 M NaCl solutions.
- Panels A-G the IV relationship (voltage ramp from +100 to - 100 mV in 21 s and 10 mV voltage steps) and a representative current trace under positive VG applied potential (Table 5) before and after adding 1 ⁇ of a biotinylated ssDNA (la, Table 3) to the cis compartment.
- a variety of current traces is also shown after the subsequent addition of 1.2 ⁇ neutravidin (monomer) and 1 ⁇ of the complementary ssDNA (lb Table 1) to the cis solution.
- the electrical recordings were carried out in 0.15 M NaCl, 15 mM Tris-HCl. pH 7.5 at 22°C. Data were recorded by applying a 2- kHz low-pass Bessel filter and using a 100 ⁇ & (10 kHz) sampling rate.
- FIG. 7. Ionic strength dependency of ssDNA translocation.
- Panels A-F show data for different salt concentrations or ionic strengths.
- (Left side) Representative current trace showing the open pore current of ClyA-RR nanopores before and after adding 1 ⁇ of a biotinylated ssDNA (la, Table 3) to the cis side of the pore under + 70 mV at different NaCl concentrations.
- the histograms on the right side represent the dwell times (t OFF , left histogram) and inter-event time (t ON , right histogram) of individual ssDNA translocation events.
- FIG. 8 Ionic strength dependency of dsDNA translocation.
- Panels A-E show data for different salt concentrations or ionic strengths.
- the current traces show the open pore current of ClyA-RR nanopores before (left) and after (right) the addition of 170 nM dsDNA (1, Table 3) added to the cis side of the pore under + 70 mV and at indicated NaCl concentrations.
- the histograms on the right side represent the dwell times (t OFF , left histogram) and inter-event time (t 0N , right histogram) of individual ssDNA translocation events.
- FIG. 9 Formation of a DNA rotaxane from the trans side at 1 M NaCl.
- Panel A The dsDNA rotaxane was formed under -70 mV applied potential by adding a hybrid
- dsDNA/ssDNA thread Tld (la and lc, 1.0 ⁇ , Table 3, shown as a black line above the current trace) complexed with neutravidin (1.2 uM, monomer) to the trans nanopore compartment.
- neutravidin 1.2 uM, monomer
- a 3 ' biotinylated ssDNA molecule, Id (1.0 ⁇ , Table 3, corresponding to the grey line above the current trace) complementary to the overhang of Tld was added to the cis compartment. Since the nanopore/DNA rotaxane can only formed if Tld translocates through the nanopore to hybridizes with 1, this experiments proves the translocation of DNA through ClyA from cis to trans.
- FIG. 10 Pore engineering for observing the translocation of DNA from the trans side in 0.15 M NaCl solutions. For each mutant indicated in Panels A-I, it is reported: the IV relationship (voltage ramp from +100 to -100 mV in 21 s and 10 mV voltage steps) and a representative current trace under positive VG applied potential before and after adding 1 ⁇ of a biotinylated ssDNA (la, Table 3) to the trans compartment. A variety of current traces are also shown after the subsequent addition of 1.2 ⁇ neutravidin (monomer) and 1 ⁇ of the complementary ssDNA (lb Table 1) to the trans solution.
- ClyA-3R-E7S showed current blockades following the addition of DNA to the trans chamber, a rotaxane could not be formed, suggesting the blockades are not due to the translocation of DNA.
- the electrical recordings were carried out in 0.15 M NaCl, 15 mM Tris-HCl. pH 7.5 at 22°C. Data were recorded by applying a 2-kHz low-pass Bessel filter and using a 100 ⁇ & (10 kHz) sampling rate.
- FIG. 11 Engineering the ClyA nanopore for DNA translocation.
- Panel A Cross sections of the ClyA- AS (left) and ClyA-RR (right) nanopores imbedded into a lipid bilayer constructed by homology modeling from the Escherichia coli ClyA structure using VMD and NAMD (PDB: 2WCD, 90% sequence identity).
- the inner pore lumen is shown using the solvent-accessible surface area as calculated by PyMOL (version 1.8 Schrodinger, LLC) and shaded according to the electrostatic potential in a 150 mM NaCl solution as calculated by the adaptive Poisson-Boltzmann solver (APBS).
- PyMOL version 1.8 Schrodinger, LLC
- APBS adaptive Poisson-Boltzmann solver
- Panel B Electrostatic potential at the center of ClyA- AS and ClyA-RR nanopores at 150 mM NaCl concentration.
- FIG. 12 DNA rotaxane formation in 150 mM NaCl solutions at +50 mV.
- Panel A dsDNA rotaxane was formed by adding la/lc (1.0 ⁇ , black lines) and Id (1.0 ⁇ , grey line) to the cis and trans compartments, respectively.
- Neutravidin NA, 0.3 ⁇ , tetramer was also added in both solutions.
- Panel B ssDNA/dsDNA hybrid rotaxane was formed by addition of a 5 '-biotinylated ssDNA thread 2a (1.0 ⁇ , black line) to the cis compartment and a 5'- biotinylated ssDNA molecule complementary to the 3 ' end of 2a (2b, 1.0 ⁇ , grey line) to the trans compartment. NA (0.3 ⁇ , tetramer) was present on both sides.
- the graphs on the right- hand side of the current traces show the voltage relationship (I-V curve) for ClyA-RR and ClyA-RR in a rotaxane configuration. Experiments were carried out in a buffer containing 150 mM NaCl and 15 mM Tris-HCl (pH 7.5) at 22 °C.
- the DNA sequences are shown in Table 3.
- FIG. 13 Ionic strength dependence of DNA translocation and threading under +70 mV.
- Panels A-B Debye length dependence of the frequency of dsDNA (Panel A) and ssDNA (Panel B) translocation per 1 ⁇ DNA.
- the dotted line in (Panel A) depicts the theoretical prediction of translocation frequencies for a diffusion-limited process.
- the line in (Panel B) is an exponential regression indicating a barrier-limited process.
- FIG. 14 Mechanism of dsDNA and ssDNA translocation through ClyA-RR nanopores.
- ssDNA translocation is reaction-limited, (i) ssDNA has a coiled structure with a gyration radius (R g ⁇ 6 nm), which is about twice the radius of the nanopore. (ii) ssDNA is not yet in the pore, and it searches for the entry, (iii) One end of ssDNA finds the entry of the cis lumen and starts to uncoil. Because there is an entropic energy barrier to enter the nanopore, several attempts can be made before a successful translocation event, (iv) In order to translocate the constriction, ssDNA needs to fully uncoil, (v) DNA exits the nanopore and then recoils. The additional charges at the cis entry most likely mediate the efficient capture of the DNA inside the nanopore. The DNA molecules and the nanopore are drawn to scale.
- FIG. 15 Ionic strength dependency of DNA threading.
- ssDNA la, 1.0 ⁇
- Neutravidin NA, 0.3 ⁇ , cis
- complementary ssDNA lb, 1 ⁇ , cis
- the ssDNA:NA complex induced long-lasting current blockades, which are most likely due to the threading of ssDNA.
- 1.0 M NaCl solution or higher
- the ssDNA:NA blockades were transient, suggesting that ssDNA could not fully thread the pore.
- Spikes above and below the open pore current level represent capacitive transients following the manual potential reversal used to free the nanopore from the DNA.
- the electrical recordings were carried out in 15 mM Tris-HCl, pH 7.5, at 22 °C.
- FIG. 16 Ionic strength dependency of ssDNA translocation through ClyA-RR nanopores.
- Panels A-F show data for different salt concentrations or ionic strengths.
- the current traces show the open pore current of ClyA-RR before and after adding 1.0 ⁇ of a biotinylated ssDNA (la, Table 3) to the cis side of the pore under +70 mV at different NaCl concentrations.
- the histograms on the right side of the traces represent dwell times (left histogram, conventional binning single exponential fit) and inter-event times (right histogram, logarithmic base 10, exponential logarithmic probability fit) of the dsDNA translocation events.
- the scattered plots represent currents versus dwell times.
- the electrical recordings were carried out in 15 mM Tris-HCl. pH 7.5 at 22 °C. Data were recorded by applying a 10- kHz low-pass Bessel filter and using a 20 (50 kHz) sampling rate. An additional 2-kHz low- pass Bessel filter was used for the data collected at 0.15 M NaCl solutions.
- FIG. 17 Ionic strength dependency of dsDNA translocation through ClyA-RR nanopores.
- Panels A-E show data for different salt concentrations or ionic strengths.
- the current traces show the open pore current of ClyA-RR before and after adding 140- 170 nM of a biotinylated dsDNA (1, Table 3) to the cis side of the pore under +70 mV at different NaCl concentrations.
- the histograms on the right side of the traces represent dwell times (left histogram, conventional binning single exponential fit) and inter-event times (right histogram, logarithmic base 10, exponential logarithmic probability fit) of the dsDNA translocation events.
- the scattered plot represents currents versus dwell times.
- the electrical recordings were carried out in 15 mM Tris-HCl pH 7.5 at 22 °C. Data were recorded by applying a 10- kHz low-pass Bessel filter and using a 50 kHz sampling rate. An additional 2-kHz low-pass Bessel filter was used for the data collected at 0.15 M NaCl solutions.
- FIG. 18 Ionic strength dependency of the DNA translocation frequency filtered at 1 kHz. Salt dependency of the event frequencies for (Panel A) dsDNA and (Panel B) ssDNA as determined from current traces filtered using a 1 kHz digital Gaussian filter (Clampfit, Molecular Devices). The lines show linear (Panel A) and exponential (Panel B) regression fits.
- FIG. 19 Entropic and electrophoretic forces acting on ssDNA near a nanopore.
- ssDNA has a coiled shape and is expected to be captured by the pore via a barrier crossing (reaction- limited process).
- the barrier originates from a repulsive force of entropic origin in the vicinity of the pore which acts on top of the attractive electrophoretic force.
- the free energies for these two contributions are indicated with thin lines, while the thick line is the sum of the two (Eq. (15)).
- the top part of the figure shows two characteristic configurations of the ssDNA characterized by reaction coordinates r a and r3 ⁇ 4, respectively.
- the configuration (b) has a lower entropy and corresponds to a state close to the top of the barrier.
- FIG. 20 shows the structure of ClyA and the cis section denoted as A, the mid-section, denoted as B and the trans section, denoted as C.
- the negatively charged amino-acids D and E are shown at the left hand side of the figure (along with the polar uncharged amino-acids S and Q). Substitution of one of more of the polar uncharged amino-acid or the negatively charged amino-acids can take place in A, substitution of one or more of the negatively charged amino- acids can take place in B. Region C which contains a number of negatively charged amino- acids can remain as it is, with no substitutions with neutral or positively charged amino-acids.
- transmembrane pores e.g. , protein nanopores or solid state nanopores
- translocation of a biopolymer, e.g., a polynucleotide through certain nanopores at low ionic strengths e.g. , about 150 mM to about 300 mM
- nanopores having a portion with a negative internal surface charge and radii comparable to the size of a negatively-charged biopolymer e.g.
- -2.2 nm for the B-form of dsDNA and ⁇ 1 nm for ssDNA can create a large electrostatic barrier for the entry of the negative-charged biopolymer into the nanopore at low ionic strengths. Accordingly, there is a need to engineer transmembrane nanopores that permit more efficient capture and/or translocation of a negatively-charged biopolymer, e.g., a polynucleotide, across the nanopores, which can be useful for practical applications such as polynucleotide mapping or sequencing.
- a negatively-charged biopolymer e.g., a polynucleotide
- the present disclosure is based, at least in part, on the unexpected discovery that positive charges can be introduced into the luminal surface of a transmembrane nanopore, for example, a cytolysin A (ClyA), at certain positions to overcome the entropic and electrostatic barriers for DNA translocation through the negatively charged narrow constriction (e.g. , with a dimension of about 3.3 nm).
- a transmembrane nanopore for example, a cytolysin A (ClyA)
- introduction of positive changes e.g., positively-charged amino acids such as arginines
- introduction of positive changes e.g., positively-charged amino acids such as arginines
- introduction of positive changes e.g., positively-charged amino acids such as arginines
- the wider entry the cis side
- midsection of the ClyA nanopore are sufficient to "grab” and orient the DNA (e.g. , double stranded or single stranded) for effective electrophoretic
- DNA translocation at low ionic strengths e.g., as low as 50 mM.
- the modifications allow the methods of any aspects described herein to be carried out at even lower ionic strengths than 50mM.
- lower ionic strengths may give rise to correspondingly lower ionic currents and therefore, in some circumstances, may not be desirable.
- the present disclosure provides modified ClyA nanopore subunit polypeptide (e.g., for forming a modified ClyA nanopore) and nanopores comprising the same.
- the modified ClyA nanopores as described herein can be used for various practical applications such as characterizing a polynucleotide.
- described herein are also methods and compositions for characterizing a polynucleotide such as a double stranded or single stranded polynucleotide.
- the methods and compositions described herein provide efficient translocation of doubled stranded or single stranded polynucleotide at physiological ionic strengths (e.g. , 50 mM-300 mM) or low ionic strengths (e.g., less than 2 M or less than 1 M).
- modified ClyA nanopores and methods described herein permit unidirectional translocation of a polynucleotide, namely the polynucleotide is unable to enter and transit the nanopore in the trans to cis direction.
- This enables for example the filtering of polynucleotide (e.g. , DNA) in the cis to trans direction.
- nanostructures having a similar nanopore structure as that of the ClyA nanopore can adopt similar modification strategy to allow DNA translocation in low ionic strength solutions.
- a modified ClyA nanopore subunit polypeptide is a polypeptide whose sequence varies from that of a reference ClyA amino acid sequence.
- the amino acid sequence of the modified ClyA nanopore subunit polypeptide comprises (i) a cis opening-forming amino acid sequence, (ii) a midsection-forming amino acid sequence, and (iii) a trans opening-forming amino acid sequence.
- the cis opening-forming amino acid sequence is a portion of the amino acid sequence that forms part of a cis opening of a nanopore when the modified ClyA nanopore subunit polypeptide interacts with other subunit polypeptides to form the nanopore in a membrane.
- the midsection-forming amino acid sequence is a portion of the amino acid sequence that forms part of a mid-section of the nanopore when the modified ClyA nanopore subunit polypeptides interacts with other subunit polypeptides to form the nanopore in a membrane.
- the trans opening-forming amino acid sequence is a portion of the amino acid sequence that forms part of a trans opening of a nanopore when the modified ClyA nanopore subunit polypeptide interacts with other subunit polypeptides to form the nanopore in a membrane.
- a nanopore a portion of which is embedded into a membrane can be constructed by homology modeling from a known ClyA structure using VMD, e.g. , as described in Humphrey et al., "VMD: Visual Molecular Dynamics” J. Mol.
- the term "reference ClyA amino acid sequence” refers to a known amino acid sequence of a ClyA nanopore subunit.
- ClyA nanopore subunits include, e.g., but not limited to ClyA wild-type (ClyA-WT), ClyA-SS, ClyA-CS, and ClyA -AS. See, e.g., Soskine et al. "Tuning the size and properties of ClyA nanopores assisted by directed evolution" J Am Chem Soc.
- any ClyA amino acid sequences described in WO 2016/166232 and WO 2014/153625 can also be used as a reference ClyA amino acid sequence.
- the reference ClyA amino acid sequence is an amino acid sequence of ClyA-WT as set forth in SEQ ID NO: 1.
- the reference amino acid is an amino acid sequence of ClyA-AS as set forth in SEQ ID NO: 2, which contains the following mutations: C87A, L99Q, E103G, F166Y, I203V, C285S, K294R, as compared to the amino sequence of ClyA-WT as set forth in SEQ ID NO: 1.
- the amino acid sequence of ClyA-AS can further include H307Y, as compared to the amino acid sequence of ClyA-WT.
- the modified ClyA nanopore subunit polypeptide comprises an amino acid sequence that is at least about 80% (including, e.g. , at least about 85%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99% or higher) identical to a reference ClyA amino acid sequence.
- Standard methods in the art may be used to determine homology.
- the UWGCG Package provides the BESTFIT program which can be used to calculate homology, for example used on its default settings (Devereux et al (1984) Nucleic Acids Research 12, p387-395).
- the PILEUP and BLAST algorithms can be used to calculate homology or line up sequences (such as identifying equivalent residues or corresponding sequences (typically on their default settings)), for example as described in Altschul S. F. (1993) J Mol Evol 36:290-300; Altschul, S.F et al (1990) J Mol Biol 215:403-10.
- Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlm.nih.gov/).
- the amino acid sequence of the modified ClyA nanopore subunit polypeptide comprises (i) a first positive charge modification ⁇ e.g., a first positively-charged amino acid substitution) at a position within the cis opening-forming amino acid sequence; and (ii) a second positive charge modification ⁇ e.g., a second positively-charged amino acid substitution) at a position within the midsection-forming amino acid sequence.
- the first and second positive charge modifications ⁇ e.g. , the first and second positively-charged substitutions) are selected to provide higher frequency of capture and/or translocation of a negatively-charged polymer ⁇ e.g. , a polynucleotide such as double stranded or single stranded DNA) through the nanopore, as compared to a reference ClyA amino acid sequence.
- the first positive charge modification ⁇ e.g., the first positively- charged amino acid substitution may be at position 110 of the amino acid sequence as set forth in SEQ ID NO: 1 or SEQ ID NO: 2.
- substitution with a positive charge ⁇ e.g. , a positively-charged amino acid may take place at one of more of the following positions: E106, Dl 14, D121, D122, E129, E85, E78, D268, D267, D265, E258 of SEQ ID NO: 1 or SEQ ID NO: 2.
- a ClyA amino acid sequence e.g., as set forth in SEQ ID NO 1 or 2 may be modified or engineered to include additional amino acids "MI" at its N-terminus.
- the first positive charge modification ⁇ e.g., the first positively- charged amino acid substitution may be at position 64 of the amino acid sequence as set forth in SEQ ID NO: 1 or SEQ ID NO: 2.
- substitution with a positive charge ⁇ e.g. , a positively-charged amino acid may take place at one of more of the following positions: D74, D71, D64, E53, E161, D158, E46, E42, D41 of SEQ NO: 1 or SEQ ID NO: 2.
- the term "positively-charged amino acid substitution" as used herein refers to a modification to a reference amino acid that increases the net positive charge, or decreases the net negative charge, of the reference amino acid, e.g.
- a positively-charged amino acid substitution can include, but is not limited to, (i) replacement of a negatively-charged amino acid with a less negatively charged amino acid, neutral amino acid, or positively-charged amino acid, (ii) replacement of a neutral amino acid with a positively-charged amino acid, or (iii) replacement of a positively charged amino acid with a more positively-charged amino acid.
- a positively-charged amino acid substitution may include deletion of a negatively-charged amino acid or addition of a positively-charged amino acid.
- a positively-charged amino acid substitution may include one or more chemical modifications of one or more negatively charged amino acids which neutralize their negative charge. For instance, the one or more negatively charged amino acids may be reacted with a carbodiimide.
- a positively-charged amino acid is an amino acid having an isoelectric point (pi) that is higher than the pH of a solution so that the amino acid in the solution carries a net positive charge.
- examples of a positively-charged amino acid as detected at pH 7.0-8.0 (e.g. , at pH 8.0) and at room temperature, e.g. , at 20-25°C include, but are not limited to arginine (R), histidine (H), and lysine (K).
- a negatively-charged amino acid is an amino acid having a pi that is lower than the pH of a solution so that the amino acid in the solution carries a net negative charge. Examples of a negatively-charged amino acid as detected at pH 7.0-8.0 (e.g.
- a neutral amino acid is an amino acid having an isoelectric point (pi) that is same as the pH of a solution so that the amino acid in the solution carries no net charge.
- the pi values of amino acids are known in the art. By comparing the pi value of an amino acid of interest to the pH of a solution, one of ordinary skill in the art will readily determine whether the amino acid present in the solution is a positively charged amino acid, a neutral amino acid, or a negatively-charged amino acid.
- amino acid can be an naturally-occurring or synthetic amino acid.
- first and/or second positively-charged amino acid substitutions e.g. , as detected at pH 7.0-8.0 (e.g. , at pH 8.0) and at room temperature, e.g. , at 20-25°C, include, but are not limited to substitution of a reference amino acid with one of an arginine, a histidine, and a lysine.
- the first positively-charged amino acid substitution is S I 10R, wherein position 110 corresponds to amino acid 110 of SEQ ID NO: 1 or SEQ ID NO: 2.
- the second positively-charged amino acid substitution is D64R, wherein position 64 corresponds to amino acid 64 of SEQ ID NO: 1 or SEQ ID NO: 2.
- amino acid substitutions may be made to a reference ClyA amino acid sequence, for example up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 30 substitutions.
- Conservative substitutions replace amino acids with other amino acids of similar chemical structure, similar chemical properties or similar side-chain volume.
- the amino acids introduced may have similar polarity, hydrophilicity, hydrophobicity, basicity, acidity, neutrality or charge to the amino acids they replace.
- the conservative substitution may introduce another amino acid that is aromatic or aliphatic in the place of a pre-existing aromatic or aliphatic amino acid.
- amino acids are well-known in the art and may be selected in accordance with the properties of the 20 main amino acids as defined in Table A below. Where amino acids have similar polarity, this can also be determined by reference to the hydropathy scale for amino acid side chains in Table A.
- One or more amino acid residues of the amino acid sequence of SEQ ID NO: 1 or 2 may additionally be deleted from the polypeptides described above. Up to 1, 2, 3, 4, 5, 10, 20 or 30 residues may be deleted, or more.
- One or more amino acids may be alternatively or additionally added to the polypeptides described above.
- An extension may be provided at the amino terminal or carboxy terminal of the amino acid sequence of SEQ ID NO: 1 or 2 or polypeptide variant or fragment thereof.
- the extension may be quite short, for example from 1 to 10 amino acids in length. Alternatively, the extension may be longer, for example up to 50 or 100 amino acids.
- a carrier protein may be fused to an amino acid sequence, e.g. , an amino acid sequence of a modified ClyA nanopore subunit polypeptide. Other fusion proteins are discussed in more detail below.
- a reference amino acid may be substituted with a target amino acid by replacing the codon for the reference amino acid with a codon for the target amino acid at the relevant position in a polynucleotide encoding the modified ClyA nanopore subunit polypeptide.
- the polynucleotide can then be expressed as discussed below.
- the amino acid is a non-naturally-occurring amino acid, it may be introduced by including synthetic aminoacyl- tRNAs in the IVTT system used to express the modified ClyA nanopore subunit polypeptide.
- modified ClyA nanopore subunit polypeptide may be introduced by expressing the modified ClyA nanopore subunit polypeptide in E. coli that are auxotrophic for specific amino acids in the presence of synthetic (i.e., non-naturally-occurring) analogues of those specific amino acids. They may also be produced by naked ligation if the modified ClyA nanopore subunit polypeptide is produced using partial peptide synthesis.
- the trans opening-forming amino acid sequence of the modified ClyA nanopore subunit polypeptide may carry a net negative charge, e.g., as detected at pH 7.0- 8.0 (e.g., at pH 8.0) and room temperature (e.g. , at 20-25°C), which is comparable to (e.g., within 10%, within 5%, within 4%, within 3%, within 2%, within 1%, or lower) the net negative charge of the corresponding trans opening-forming portion of a reference ClyA amino acid sequence.
- the trans opening forming amino acid sequence of the modified ClyA nanopore subunit polypeptide can be at least about 95% or higher (including, e.g., at least about 96%, at least about 97%, at least about 98%, at least about 99% or up to 100%) identical to the corresponding trans opening-forming portion of a reference ClyA amino acid sequence, e.g. , as set forth in SEQ ID NO: 1 or SEQ ID NO: 2.
- the trans opening-forming amino acid sequence of the modified ClyA nanopore subunit polypeptide is 100% identical to the corresponding trans opening-forming portion of the amino acid sequence as set forth in SEQ ID NO: 2.
- the modified ClyA nanopore subunit polypeptides described herein may be used to form a homo-multimeric nanopore or hetero-multimeric nanopore as described herein.
- the modified ClyA nanopore subunit polypeptide retains the ability to form a nanopore with other subunit polypeptides.
- Methods for assessing the ability of modified monomers to form nanopores are well-known in the art.
- a modified ClyA nanopore subunit polypeptide may be inserted into an amphiphilic layer along with other appropriate subunits and its ability to oligomerize to form a pore may be determined. Methods are known in the art for inserting subunits into membranes, such as amphiphilic layers.
- subunits may be suspended in a purified form in a solution containing a triblock copolymer membrane such that it diffuses to the membrane and is inserted by binding to the membrane and assembling into a functional state.
- subunits may be directly inserted into the membrane using the "pick and place" method described in M.A. Holden, H. Bayley. J. Am. Chem. Soc. 2005, 127, 6502-6503 and International Application No.
- the modified ClyA nanopore subunit polypeptides may contain non-specific modifications as long as they do not interfere with nanopore formation.
- a number of nonspecific side chain modifications are known in the art and may be made to the side chains of the amino acids. Such modifications include, for example, reductive alkylation of amino acids by reaction with an aldehyde followed by reduction with NaBH4, amidination with
- the modified ClyA nanopore subunit polypeptides can be produced using standard methods known in the art.
- the modified ClyA nanopore subunit polypeptides may be made synthetically or by recombinant means.
- the modified ClyA nanopore subunit polypeptides may be synthesized by in vitro translation and transcription (IVTT). Suitable methods for producing pores and modified ClyA nanopore subunit polypeptides are discussed in International Application Nos. PCT/GB09/001690 (published as WO 2010/004273), PCT/GB09/001679 (published as WO 2010/004265) or PCT/GB 10/000133 (published as WO 2010/086603).
- modified ClyA nanopore subunit polypeptides as described herein may be produced using D-amino acids.
- the modified ClyA nanopore subunit polypeptides as described herein may comprise a mixture of L-amino acids and D-amino acids. This is conventional in the art for producing such proteins or peptides.
- the modified ClyA nanopore subunit polypeptides may be chemically modified.
- the modified ClyA nanopore subunit polypeptides can be chemically modified in any way and at any site.
- the modified ClyA nanopore subunit polypeptides may be chemically modified by attachment of a dye or a fluorophore.
- the modified ClyA nanopore subunit polypeptide may be chemically modified by attachment of a molecule to one or more cysteines (cysteine linkage), attachment of a molecule to one or more lysines, attachment of a molecule to one or more non-natural amino acids, enzyme modification of an epitope or modification of a terminus. Suitable methods for carrying out such modifications are well-known in the art.
- the modified ClyA nanopore subunit polypeptide may be chemically modified with a molecular adaptor that facilitates the interaction between a nanopore comprising the modified ClyA nanopore subunit polypeptide and a target nucleotide or target polynucleotide sequence.
- the presence of the adaptor improves the host-guest chemistry of the nanopore and the nucleotide or polynucleotide sequence and thereby improves the sequencing ability of pores formed from the modified ClyA nanopore subunit polypeptides.
- the principles of host-guest chemistry are well-known in the art.
- the adaptor has an effect on the physical or chemical properties of the nanopore that improves its interaction with the nucleotide or polynucleotide sequence.
- the adaptor may alter the charge of the barrel or channel of the pore or specifically interact with or bind to the nucleotide or polynucleotide sequence thereby facilitating its interaction with the pore.
- the molecular adaptor may be a cyclic molecule, a cyclodextrin, a species that is capable of hybridization, a DNA binder or interchelator, a peptide or peptide analogue, a synthetic polymer, an aromatic planar molecule, a small positively-charged molecule or a small molecule capable of hydrogen-bonding.
- the molecular adaptor can be covalently attached to the modified ClyA nanopore subunit polypeptide.
- the adaptor can be covalently attached to the nanopore using any method known in the art.
- the adaptor is typically attached via chemical linkage. If the molecular adaptor is attached via cysteine linkage, one or more cysteines can be introduced to the modified ClyA nanopore subunit polypeptide by substitution.
- the modified ClyA nanopore subunit polypeptide may be attached or coupled to a polynucleotide binding protein, e.g. , helicases, exonucleases, and polymerases.
- the modified ClyA nanopore subunit polypeptide may be attached or coupled to a helicase, e.g. , a DNA helicase. Examples of helicases, exonucleases, and polymerases that are suitable for use in nanopore sequencing are known in the art.
- the modified ClyA nanopore subunit polypeptide may be attached or coupled to a helicase, e.g.
- a DNA helicase e.g. , as described in WO 2013/057495
- a RecD helicase e.g. , as described in WO2013/098562
- a XPD helicase e.g. , as described in WO201/098561
- a Dda helicase e.g. , as described in WO2015/055981.
- Polynucleotide binding proteins are discussed below.
- the translocation speed control may be determined by the type of polynucleotide binding protein and/or amount of fuel (ATP) added to the system.
- ATP fuel
- the rate of translocation of the double stranded DNA analyte may be controlled by a double stranded DNA translocase such as Fts .
- Fts double stranded DNA translocase
- the translocation speed of a target polynucleotide can be between about 30 B/s and 1000 B/s.
- the polynucleotide binding protein can be covalently attached to the modified ClyA nanopore subunit polypeptide.
- the polynucleotide binding protein can be covalently attached to the modified ClyA nanopore subunit polypeptide using any method known in the art.
- the modified ClyA nanopore subunit polypeptide and the polynucleotide binding protein may be chemically fused or genetically fused.
- the modified ClyA nanopore subunit polypeptide and the polynucleotide binding protein are genetically fused if the whole construct is expressed from a single polynucleotide sequence. Genetic fusion of a modified ClyA nanopore subunit polypeptide to a polynucleotide binding protein is discussed in
- the modified ClyA nanopore subunit polypeptide may be chemically modified with a molecular adaptor and a polynucleotide binding protein.
- any of the proteins described herein may be modified to assist their identification or purification, for example by the addition of histidine residues (a his tag), aspartic acid residues (an asp tag), a streptavidin tag, a flag tag, a SUMO tag, a GST tag or a MBP tag, or by the addition of a signal sequence to promote their secretion from a cell where the polypeptide does not naturally contain such a sequence.
- His tag histidine residues
- asp tag aspartic acid residues
- streptavidin tag a flag tag
- SUMO tag a SUMO tag
- GST tag a GST tag
- MBP tag a MBP tag
- An alternative to introducing a genetic tag is to chemically react a tag onto a native or engineered position on the protein.
- any of the proteins described herein may be labelled with a detectable label.
- the detectable label may be any suitable label which allows the protein to be detected. Suitable labels include, but are not limited to, fluorescent molecules, radioisotopes, e.g., 1251, 35S, enzymes, antibodies, antigens, polynucleotides and ligands such as biotin.
- any of the proteins described herein, including the modified ClyA nanopore subunit polypeptide described herein, can be produced using standard methods known in the art.
- Polynucleotide sequences encoding a protein may be derived and replicated using standard methods in the art. Polynucleotide sequences encoding a protein may be expressed in a bacterial host cell using standard techniques in the art. The protein may be produced in a cell by in situ expression of the polypeptide from a recombinant expression vector. The expression vector optionally carries an inducible promoter to control the expression of the polypeptide. These methods are described in Sambrook, J. and Russell, D. (2001). Molecular Cloning: A Laboratory Manual, 3rd Edition. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY.
- Proteins may be produced in large scale following purification by any protein liquid chromatography system from protein producing organisms or after recombinant expression.
- Typical protein liquid chromatography systems include FPLC, AKTA systems, the Bio-Cad system, the Bio-Rad BioLogic system and the Gilson HPLC system.
- Polynucleotide sequences may be derived and replicated using standard methods in the art. Chromosomal DNA encoding wild-type ClyA may be extracted from a pore producing organism, such as Salmonella typhi. The gene encoding the pore subunit may be amplified using PCR involving specific primers. The amplified sequence may then undergo site-directed mutagenesis. Suitable methods of site-directed mutagenesis are known in the art and include, for example, combine chain reaction. Polynucleotides encoding any one of the modified ClyA nanopore subunit polypeptides can be made using well-known techniques, such as those described in Sambrook, J. and Russell, D. (2001). Molecular Cloning: A Laboratory Manual, 3rd Edition. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY.
- the resulting polynucleotide sequence may then be incorporated into a recombinant replicable vector such as a cloning vector.
- a recombinant replicable vector such as a cloning vector.
- the vector may be used to replicate the
- polynucleotide in a compatible host cell may be made by introducing a polynucleotide into a replicable vector, introducing the vector into a compatible host cell, and growing the host cell under conditions which bring about replication of the vector.
- the vector may be recovered from the host cell. Suitable host cells for cloning of
- polynucleotides are known in the art.
- Another aspect of the disclosure includes a method of producing a modified ClyA nanopore subunit polypeptide or a construct described herein.
- the method comprises expressing a polynucleotide encoding any embodiment of the modified ClyA nanopore subunit
- polypeptides in a suitable host cell are preferably part of a vector and is preferably operably linked to a promoter.
- modified ClyA nanopore for example, that permits capture of a negatively-charged polymer (e.g. , polynucleotide such as DNA or RNA) into the modified ClyA nanopore and/or translocation of the negatively-charged polymer through the modified ClyA nanopore.
- the modified ClyA nanopore comprises a first opening, a mid-section, a second opening, and a lumen extending from the first opening through the mid- section to the second opening, wherein a luminal surface of the first opening comprises a first positively-charged amino acid substitution and a luminal surface of the mid-section comprises a second positively charged amino acid substitution.
- the luminal surface of the second opening defines an electronegative constriction.
- the first positive-charged amino acid substitution and the second charged amino acid substation are described in detail in the section "Modified ClyA nanopore subunit polypeptide" above.
- FIG. 1 shows a modified ClyA nanopore according to one embodiment described herein.
- the modified ClyA nanopore comprises a first opening 102, a mid-section 104, and a second opening 106.
- the lumen 108 extends from the first opening 102 through the mid- section 104 to the second opening 106 and has a total length of about 13 nm to about 15 nm.
- the first opening 102 and the mid-section 104 have a diameter of about 5 nm to about 7 nm.
- the luminal surface of the second opening 106 defines an electronegative constriction 1 12, wherein the narrowest cross-section has a diameter of about 3 nm to about 4 nm.
- the second opening 106 (with a length of about 3 nm to about 5 nm) of the modified ClyA nanopore is inserted into a membrane (e.g. , a bilayer) 110 such that a solution in which the modified ClyA nanopore is present is separated into two sides and the first opening 102 is present in one side of the solution while the electronegative constriction 112 is present in another side of the solution.
- a target polymer e.g. , target polynucleotide
- the first opening 102 is a cis opening and the second opening 106 is a trans opening.
- luminal surface refers to the internal surface of a lumen that is exposed to a solution.
- electronegative constriction or “negatively- charged constriction” refers to a constriction having a net negative surface charge.
- the luminal surface of the second opening that defines an electronegative constriction has a net negative surface charge as shown in FIG. 1 (panel A).
- the distance within the lumen from the first positive charge modification (e.g. , the first positively-charged amino acid substitution) to the second positive charge modification (e.g. , the second positively charged amino acid substitution) may vary within a range of about 0.5 nm to about 10 nm, or about 3 nm to about 7 nm. In some embodiments, the distance within the lumen from the first positive charge modification (e.g. , the first positively-charged amino acid substitution) to the second positive charge modification (e.g.
- the second positively charged amino acid substitution may be about 1 nm, about 2 nm, about 3 nm, about 4 nm, about 5 nm, about 6 nm, about 7 nm, about 8 nm, or about 9 nm.
- the modified ClyA nanopore may comprise a subunit polypeptide having an amino acid sequence that is at least about 80% (including, e.g., at least about 85%, at least about 90%, at least about 95%, or higher) identical to a reference ClyA amino acid sequence as described herein.
- the modified ClyA nanopore may comprise a subunit polypeptide having an amino acid sequence that is at least about 80% (including, e.g. , at least about 85%, at least about 90%, at least about 95%, or higher) identical to the amino acid sequence as set forth in SEQ ID NO: 1, which corresponds to the wild-type ClyA.
- the modified ClyA nanopore may comprise a subunit polypeptide having an amino acid sequence that is at least about 80% (including, e.g., at least about 85%, at least about 90%, at least about 95%, or higher) identical to the amino acid sequence as set forth in SEQ ID NO: 2, which corresponds to the amino acid sequence of ClyA-AS.
- the modified ClyA nanopore may comprise up to 15 substitutions (e.g. , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, or 15 substitutions) compared to the amino acid sequences as set forth in SEQ ID NO: 1 or SEQ ID NO: 2 including the first and second positive charge modifications (e.g. , the first and second positively-charged amino acid substitutions).
- the first positive charge modification (e.g. , the first positively-charged amino acid substitution) may be positioned within the first opening so as to permit capture of a negatively charged polymer (e.g. , but not limited to a deoxyribonucleic acid (DNA) such as double stranded DNA or single- stranded DNA) within a solution exposed to the first opening.
- a negatively charged polymer e.g. , but not limited to a deoxyribonucleic acid (DNA) such as double stranded DNA or single- stranded DNA
- the first positive charge modification e.g.
- the first positively-charged amino acid substitution may be located at position E106, S I 10, D 1 14, D 121, D122, E129, E85, E78, D268, D267, D265, E258, or combinations thereof in the amino acid sequence as set forth in SEQ ID NO: 1 or SEQ ID NO: 2.
- the second positive charge modification e.g. , the second positively-charged amino acid substitution
- the second positively-charged amino acid substitution may be positioned within the mid-section so as to permit translocation of the negatively charged polymer (e.g. , but not limited to a deoxyribonucleic acid (DNA) such as double stranded DNA or single- stranded DNA) through the lumen of the pore.
- DNA deoxyribonucleic acid
- the second positive charge modification (e.g. , the second positively-charged amino acid substitution) may be located at position D74, D71 , D64, E53, E161 , D158, E46, E42, D41 , or combinations thereof in the amino acid sequence as set forth in SEQ NO: 1 or SEQ ID NO: 2.
- the modified ClyA nanopore can be homo-multimeric (e.g. , all subunits within the nanopore are the same) or hetero-multimeric (e.g. , at least one subunit is different from others within the nanopore).
- the modified ClyA nanopore may comprise any number of subunit polypeptides that are sufficient to form a lumen large enough to permit a target polymer (e.g. , polynucleotide) pass through.
- the modified ClyA nanopore may comprise 12 subunit polypeptides or more, including, e.g. , 13 subunit polypeptides, and 14 subunit polypeptides, wherein at least one or more of the subunit polypeptides comprises the first and second positively-charged amino acid substitutions as described herein.
- the modified ClyA nanopores can be used for distinguishing double stranded polynucleotides from single stranded polynucleotides, e.g. , based on the dwell time in the nanopore and the current flowing through the pore.
- the modified ClyA nanopores can be used for characterizing, such as sequencing, polynucleotide sequences.
- the modified ClyA nanopores can also be used to distinguish modified bases, e.g., between methylated and unmethylated nucleotides.
- the modified ClyA nanopores described herein provide higher frequency of capture and/or translocation of a polynucleotide through the nanopores in low ionic strength solutions, as compared to a ClyA nanopore without the first and second positively-charged substitutions described herein.
- low ionic strength solution refers to a solution with an ionic strength of less than 2 M, including, e.g. , less than 1 M, less than 900 mM, less than 800 mM, less than 700 mM, less than 600 mM, less than 500 mM, less than 400 mM, less than 300 mM, less than 200 mM, less than 150 mM, or lower.
- a lower ionic strength solution has an ionic strength of at least about 50 mM, at least about 100 mM, at least about 150 mM, at least about 200 mM, at least about 300 mM, at least about 400 mM, at least about 500 mM, at least about 600 mM, at least about 700 mM, at least about 800 mM, at least about 900 mM, at least about 1 M, or higher. Combinations of the above-references ranges are also encompassed.
- a low ionic strength solution may have an ionic strength of about 100 mM to about 600 mM, or about 150 mM to about 300 mM. Any salt can be used to yield a solution with appropriate ionic strength.
- alkaline salt e.g., but not limited to potassium chloride or sodium chloride
- alkaline salt can be used in the low ionic strength solution.
- the modified ClyA nanopores can discriminate between different nucleotides under a range of conditions.
- the pores can discriminate between nucleotides under conditions that are favorable to the characterizing, such as sequencing, of nucleic acids.
- the extent to which the modified ClyA nanopores can discriminate between different nucleotides can be controlled by altering the applied potential, the salt concentration, the buffer, the temperature and the presence of additives, such as urea, betaine and DTT. This allows the function of the pores to be fine-tuned, particularly when sequencing. This is discussed in more detail below.
- the modified ClyA nanopores may also be used to identify polynucleotide polymers from the interaction with one or more monomers rather than on a nucleotide by nucleotide basis.
- modified ClyA nanopores may be used for characterizing nucleic acid-protein interactions.
- the nanopores can be used interrogate protein-nucleic acids using different sensing modes such as, for example, by scanning and mapping the locations of binding sites along a nucleic acid and/or by probing the strength of interactions between a protein and nucleic acid.
- native charges of a nucleic acid may be leveraged to apply an electrophoretic force to a nucleic acid- protein complex.
- DNA-protein interactions may be evaluated using voltage-driven threading of single DNA molecules through a protein nanopore.
- modified ClyA nanopores provided herein may be used for detection and characterization of nucleic acid-protein interactions involving nucleic acid and other nucleic acid binding proteins such as transcription factors, enzymes, DNA packaging proteins and others.
- the modified ClyA nanopores may be isolated, substantially isolated, purified or substantially purified.
- the modified ClyA nanopores can be isolated or purified if it is completely free of any other components, such as lipids or other pores.
- a pore is substantially isolated if it is mixed with carriers or diluents which will not interfere with its intended use.
- a pore is substantially isolated or substantially purified if it is present in a form that comprises less than 10%, less than 5%, less than 2% or less than 1% of other components, such as triblock copolymers, lipids or other pores.
- one or more of the modified ClyA nanopores may be present in a membrane. Suitable membranes are discussed below.
- the modified ClyA nanopore may be present as an individual or single pore.
- the modified ClyA nanopores may be present in a homologous or heterologous population of two or more pores.
- the modified ClyA nanopores may be arranged in an array of microwells, wherein each microwell contains at least one nanopore is in a membrane.
- homo-multimeric nanopores comprising identical modified ClyA nanopore subunit polypeptides are also provided herein.
- the homo-multimeric nanopore may comprise any embodiment of the modified ClyA nanopore subunit polypeptides described herein.
- the homo- multimeric nanopore can be used for characterizing, such as sequencing, polynucleotides, and/or detecting the presence or absence of single stranded polynucleotide vs double stranded polynucleotide.
- the homo-multimeric nanopore described herein may have any of the advantages discussed above.
- the homo-multimeric pore may contain any number of modified ClyA nanopore subunit polypeptides.
- the pore typically comprises at least 10, at least 11, at least 12, at least 13, or at least 14 identical modified ClyA nanopore subunit polypeptides, such as 12, 13, or 14 identical modified ClyA nanopore subunit polypeptides. Methods for making pores are discussed in more detail below.
- Hetero-multimeric nanopores comprising at least one modified ClyA nanopore subunit polypeptides are also provided herein.
- the hetero-multimeric nanopores can be used for characterizing, such as sequencing, polynucleotides, and/or detecting the presence or absence of single stranded polynucleotide vs double stranded polynucleotide.
- Hetero-multimeric nanopores can be made using methods known in the art (e.g., Protein Sci. 2002 Jul; 11(7): 1813-24).
- the hetero-multimeric pore contains sufficient subunit polypeptide to form the pore.
- the subunit polypeptides may be of any type.
- the pore typically comprises at least 10, at least 11, at least 12, at least 13, or at least 14 subunit polypeptides, such as 12, 13, or 14 subunit polypeptides.
- all of the subunit polypeptides are modified ClyA nanopore subunit polypeptides and at least one of them differs from the others.
- the pore comprises 12 or 13 modified ClyA nanopore subunit polypeptides and at least one of them differs from the others. They may all differ from one another.
- At least one of the subunit polypeptides is not a modified ClyA nanopore subunit polypeptide as described herein.
- the remaining monomers may be any one of the modified ClyA nanopore subunit polypeptides described herein.
- the pore may comprise 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 modified ClyA nanopore subunit polypeptide(s).
- the modified ClyA nanopore subunit polypeptide(s) that form the nanopore can be the same or different.
- Another aspect of the present disclosure provides a method of characterizing a target polynucleotide.
- the method comprises: (a) providing, in a low ionic strength solution of about 50 mM to about 1 M, a modified ClyA nanopore according to any embodiment described herein and a membrane, wherein the modified ClyA nanopore is present in the membrane; (b) adding in the low ionic strength solution of step (a) the target polynucleotide; and (c) measuring, during application of a potential across the nanopore, ion flow through the modified ClyA nanopore, wherein the ion flow measurements are indicative of one or more characteristics of the target polynucleotide.
- the target polynucleotide is added to the cis side of the low ionic strength solution.
- the low ionic strength solution may have an ionic strength of about 50 mM to about 300 mM, or about 150 mM to about 300 mM.
- the target polynucleotide may also be called the template polynucleotide or the polynucleotide of interest.
- a polynucleotide such as a nucleic acid, is a macromolecule comprising two or more nucleotides.
- the polynucleotide or nucleic acid may comprise any combination of any nucleotides.
- the nucleotides can be naturally occurring or artificial.
- One or more nucleotides in the polynucleotide can be oxidized or methylated.
- polynucleotide may be damaged.
- the polynucleotide may comprise a pyrimidine dimer.
- dimers are typically associated with damage by ultraviolet light and are the primary cause of skin melanomas.
- One or more nucleotides in the polynucleotide may be modified, for instance with a label or a tag. Suitable labels are described below.
- polynucleotide may comprise one or more spacers.
- a nucleotide typically contains a nucleobase, a sugar and at least one phosphate group.
- the nucleobase and sugar form a nucleoside.
- the nucleobase is typically heterocyclic. Nucleobases include, but are not limited to, purines and pynmidines and more specifically adenine (A), guanine (G), thymine (T), uracil (U) and cytosine (C).
- A adenine
- G guanine
- T thymine
- U uracil
- C cytosine
- the sugar is typically a pentose sugar.
- Nucleotide sugars include, but are not limited to, ribose and deoxyribose.
- the sugar is preferably a deoxyribose.
- the polynucleotide preferably comprises the following nucleosides: deoxyadenosine (dA), deoxyuridine (dU) and/or thymidine (dT), deoxyguanosine (dG) and deoxycytidine (dC).
- the nucleotide is typically a ribonucleotide or deoxyribonucleotide.
- the nucleotide typically contains a monophosphate, diphosphate or triphosphate.
- the nucleotide may comprise more than three phosphates, such as 4 or 5 phosphates. Phosphates may be attached on the 5' or 3' side of a nucleotide.
- Nucleotides include, but are not limited to, adenosine monophosphate (AMP), guanosine monophosphate (GMP), thymidine monophosphate (TMP), uridine monophosphate (UMP), 5-methylcytidine monophosphate, 5-hydroxymethylcytidine
- AMP adenosine monophosphate
- GMP guanosine monophosphate
- TMP thymidine monophosphate
- UMP uridine monophosphate
- 5-methylcytidine monophosphate 5-hydroxymethylcytidine
- nucleotides are preferably selected from AMP, TMP, GMP, CMP, UMP, dAMP, dTMP, dGMP, dCMP and dUMP.
- a nucleotide may be abasic (i.e., lack a nucleobase).
- a nucleotide may also lack a nucleobase and a sugar.
- the nucleotides in the polynucleotide may be attached to each other in any manner.
- the nucleotides are typically attached by their sugar and phosphate groups as in nucleic acids.
- the nucleotides may be connected via their nucleobases as in pyrimidine dimers.
- the polynucleotide may be single stranded or double stranded. At least a portion of the polynucleotide is preferably double stranded.
- the polynucleotide can be a nucleic acid, such as deoxyribonucleic acid (DNA) or ribonucleic acid (RNA).
- the polynucleotide can comprise one strand of RNA hybridized to one strand of DNA.
- the polynucleotide may be any synthetic nucleic acid known in the art, such as peptide nucleic acid (PNA), glycerol nucleic acid (GNA), threose nucleic acid (TNA), locked nucleic acid (LNA) or other synthetic polymers with nucleotide side chains.
- PNA backbone is composed of repeating N-(2-aminoethyl)-glycine units linked by peptide bonds.
- the GNA backbone is composed of repeating glycol units linked by phosphodiester bonds.
- the TNA backbone is composed of repeating threose sugars linked together by phosphodiester bonds.
- LNA is formed from ribonucleotides as discussed above having an extra bridge connecting the 2' oxygen and 4' carbon in the ribose moiety.
- the polynucleotide is most preferably ribonucleic nucleic acid (RNA) or
- DNA deoxyribonucleic acid
- the polynucleotide can be any length.
- the polynucleotide can be at least 10, at least 50, at least 100, at least 150, at least 200, at least 250, at least 300, at least 400 or at least 500 nucleotides or nucleotide pairs in length.
- the polynucleotide can be 1000 or more nucleotides or nucleotide pairs, 5000 or more nucleotides or nucleotide pairs in length or 100000 or more nucleotides or nucleotide pairs in length.
- any number of polynucleotides can be investigated.
- the method described herein may concern characterizing 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 50, 100 or more
- polynucleotides may be different polynucleotides or two instances of the same polynucleotide.
- the polynucleotide can be naturally occurring or artificial.
- the method may be used to verify the sequence of a manufactured oligonucleotide.
- the method is typically carried out in vitro.
- the polynucleotide may comprise an attached species such as a protein or analyte.
- the polynucleotide may comprise a hybridized probe.
- Each analyte is typically present in any suitable sample.
- the method can be carried out on two or more samples that are known to contain or suspected to contain the analytes.
- the method may be carried out on two or more samples to confirm the identity of two or more analytes whose presence in the samples is known or expected.
- the method may be carried out on samples to distinguish double stranded polynucleotides from single- stranded polynucleotides.
- the first sample and/or second sample may be a biological sample.
- the methods described herein may be carried out in vitro using at least one sample obtained from or extracted from any organism or microorganism.
- the first sample and/or second sample may be a non- biological sample.
- the non-biological sample can be a fluid sample. Examples of non- biological samples include surgical fluids, water such as drinking water, sea water or river water, and reagents for laboratory tests.
- the first sample and/or second sample is typically processed prior to being used in the methods described herein, for example by centrifugation or by passage through a membrane that filters out unwanted molecules or cells, such as red blood cells.
- the first sample and/or second sample may be measured immediately upon being taken.
- the first sample and/or second sample may also be typically stored prior to assay, preferably below -70°C.
- the method may involve measuring two, three, four or five or more characteristics of the polynucleotide.
- the one or more characteristics are preferably selected from (i) the length of the polynucleotide, (ii) the identity of the polynucleotide, (iii) the sequence of the
- the length of the polynucleotide may be measured for example by determining the number of interactions between the polynucleotide and the pore or the duration of interaction between the polynucleotide and the pore.
- the identity of the polynucleotide may be measured in a number of ways.
- the identity of the polynucleotide may be measured in conjunction with measurement of the sequence of the polynucleotide or without measurement of the sequence of the polynucleotide.
- the former is straightforward; the polynucleotide is sequenced and thereby identified.
- the latter may be done in several ways. For instance, the presence of a particular motif in the polynucleotide may be measured (without measuring the remaining sequence of the
- the measurement of a particular electrical and/or optical signal in the method may identify the polynucleotide as coming from a particular source.
- the sequence of the polynucleotide can be determined as described previously. Suitable sequencing methods, particularly those using electrical measurements, are described in Stoddart D et al., Proc Natl Acad Sci, 12;106(19):7702-7, Lieberman R et al, J Am Chem Soc. 2010;132(50): 17961-72, and International Application WO 2000/28312.
- the secondary structure may be measured in a variety of ways. For instance, if the method involves an electrical measurement, the secondary structure may be measured using a change in dwell time or a change in current flowing through the pore. This allows regions of single-stranded and double- stranded polynucleotide to be distinguished.
- the presence or absence of any modification may be measured.
- the method preferably comprises determining whether or not the polynucleotide is modified by methylation, by oxidation, by damage, with one or more proteins or with one or more labels, tags or spacers. Specific modifications will result in specific interactions with the pore which can be measured using the methods described below. For instance, methylcyotsine may be distinguished from cytosine on the basis of the current flowing through the pore during its interaction with each nucleotide.
- the target polynucleotide is contacted with any one of the modified ClyA nanopores described herein.
- the pore is typically present in a membrane. Suitable membranes are discussed below.
- the method may be carried out using any apparatus that is suitable for investigating a membrane/pore system in which a pore is present in a membrane.
- the method may be carried out using any apparatus that is suitable for transmembrane pore sensing.
- the apparatus comprises a chamber comprising an aqueous solution and a barrier that separates the chamber into two sections.
- the barrier typically has an aperture in which the membrane containing the pore is formed.
- the barrier forms the membrane in which the pore is present.
- the method may be carried out using the apparatus described in International
- a variety of different types of measurements may be made. This includes without limitation: electrical measurements and optical measurements. Possible electrical
- measurements include: current measurements, impedance measurements, tunneling
- Optical measurements may be combined with electrical measurements (Soni GV et al., Rev Sci Instrum. 2010 Jan;81(l):014301).
- the measurement may be a transmembrane current measurement such as measurement of ionic current flowing through the pore.
- the measurement may be a fluorescence measurement indicative of ion flow through the channel such as disclosed by Heron et al, J. Am. Chem. Soc, 2009, 131 (5), 1652-1653 or measurement of a voltage across the membrane using a FET.
- electrical measurements may be made using a multi-channel system, for example as described in International Application WO 2009/077734 and International Application WO 2011/067559.
- the method can be carried out with a potential applied across the membrane.
- the applied potential may be a voltage potential.
- the applied potential may be a chemical potential.
- An example of this is using a salt gradient across a membrane, such as an amphiphilic layer. A salt gradient is disclosed in Holden et al., J Am Chem Soc. 2007 Jul 11; 129(27):8650-5.
- the current passing through the pore as a polynucleotide moves with respect to the pore is used to estimate or determine the sequence of the
- polynucleotide This may be described as strand sequencing.
- the method may involve measuring the current passing through the pore as the polynucleotide moves with respect to the pore. Therefore the apparatus used in the method may also comprise an electrical circuit capable of applying a potential and measuring an electrical signal across the membrane and pore.
- the methods may be carried out using a patch clamp or a voltage clamp. The methods preferably involve the use of a voltage clamp.
- the method may involve the measuring of a current passing through the pore as the polynucleotide moves with respect to the pore. Suitable conditions for measuring ionic currents through transmembrane protein pores are known in the art and disclosed in the Example.
- the method is typically carried out with a voltage applied across the membrane and pore.
- the voltage used is typically from +5 V to -5 V, such as from +4 V to -4 V, +3 V to -3 V or +2 V to -2 V.
- the voltage used is typically from -600 mV to +600mV or -400 mV to +400 mV.
- the voltage used is preferably in a range having a lower limit selected from -400 mV, -300 mV, - 200 mV, - 150 mV, - 100 mV, -50 mV, -20mV and 0 mV and an upper limit independently selected from +10 mV, + 20 mV, +50 mV, +100 mV, +150 mV, +200 mV, +300 mV and +400 mV.
- the voltage used is more preferably in the range 100 mV to 240 mV and most preferably in the range of 120 mV to 220 mV. It is possible to increase discrimination between different nucleotides by a pore by using an increased applied potential.
- the method is typically carried out in the presence of any charge carriers, such as metal salts, for example alkali metal salt, halide salts, for example chloride salts, such as alkali metal chloride salt.
- Charge carriers may include ionic liquids or organic salts, for example tetramethyl ammonium chloride, trimethylphenyl ammonium chloride, phenyltrimethyl ammonium chloride, or l-ethyl-3 -methyl imidazolium chloride.
- the salt is present in the aqueous solution in the chamber.
- Potassium chloride (KCl), sodium chloride (NaCl), caesium chloride (CsCl) or a mixture of potassium ferrocyanide and potassium ferricyanide is typically used.
- the charge carriers may be asymmetric across the membrane. For instance, the type and/or concentration of the charge carriers may be different on each side of the membrane.
- the salt concentration may be at saturation.
- the salt concentration may be 3 M or lower and is typically from 0.1 to 2.5 M, from 0.3 to 1.9 M, from 0.5 to 1.8 M, from 0.7 to 1.7 M, from 0.9 to 1.6 M or from 1 M to 1.4 M.
- the salt concentration is preferably from 150 mM to 1 M.
- the method is preferably carried out using a salt concentration of at least 0.3 M, such as at least 0.4 M, at least 0.5 M, at least 0.6 M, at least 0.8 M, at least 1.0 M, at least 1.5 M, at least 2.0 M, at least 2.5 M or at least 3.0 M.
- High salt concentrations provide a high signal to noise ratio and allow for currents indicative of the presence of a nucleotide to be identified against the background of normal current fluctuations.
- the modified ClyA nanopores described herein can be used to characterize a polynucleotide at high salt solution, the modified ClyA nanopores can permit efficient capture and/or translocation of a polynucleotide (e.g. , double stranded DNA or single stranded DNA) through the nanopore even in low ionic strength solutions as described above.
- the method is typically carried out in the presence of a buffer.
- the buffer is present in the aqueous solution in the chamber. Any buffer may be used in the methods described herein.
- the buffer is phosphate buffer.
- Other suitable buffers are HEPES and Tris-HCl buffer.
- the methods are typically carried out at a pH of from 4.0 to 12.0, from 4.5 to 10.0, from 5.0 to 9.0, from 5.5 to 8.8, from 6.0 to 8.7 or from 7.0 to 8.8 or 7.5 to 8.5.
- the pH used is preferably about 7.5 or 8.0.
- the method may be carried out at from 0 °C to 100 °C, from 15 °C to 95 °C, from 16 °C to 90 °C, from 17 °C to 85 °C, from 18 °C to 80 °C, 19 °C to 70 °C, or from 20 °C to 60 °C.
- the methods are typically carried out at room temperature.
- the methods are optionally carried out at a temperature that supports enzyme function, such as about 37 °C.
- the method for characterizing a target polynucleotide may include adding a polynucleotide binding protein in the low ionic strength solution such that the polynucleotide binding protein binds to the target polynucleotide and controls the movement of the target polynucleotide through the modified ClyA nanopore.
- the polynucleotide binding protein may be any protein that is capable of binding to the polynucleotide and controlling its movement through the pore.
- the polynucleotide binding proteins include, but are not limited to helicases, polymerases, exonucleases, DNA clamps, etc.
- the polynucleotide may be contacted with the polynucleotide binding protein and the pore in any order. It is preferred that, when the polynucleotide is contacted with the polynucleotide binding protein, such as a helicase, and the pore, the polynucleotide firstly forms a complex with the protein. When the voltage is applied across the pore, the
- polynucleotide/protein complex then forms a complex with the pore and controls the movement of the polynucleotide through the pore.
- Any steps in the method using a polynucleotide binding protein are typically carried out in the presence of free nucleotides or free nucleotide analogues and an enzyme cofactor that facilitates the action of the polynucleotide binding protein.
- the method comprises:
- the modified ClyA nanopores described herein may be present in a membrane.
- the polynucleotide is typically contacted with a modified ClyA nanopore in a membrane.
- Any membrane may be used. Suitable membranes are well-known in the art.
- the membrane is preferably an amphiphilic layer.
- An amphiphilic layer is a layer formed from amphiphilic molecules, such as phospholipids, which have both hydrophilic and lipophilic properties. The amphiphilic molecules may be synthetic or naturally occurring.
- Non-naturally occurring amphiphiles and amphiphiles which form a monolayer are known in the art and include, for example, block copolymers (Gonzalez-Perez et al., Langmuir, 2009, 25, 10447-10450).
- Block copolymers are polymeric materials in which two or more monomer sub-units that are polymerized together to create a single polymer chain. Block copolymers typically have properties that are contributed by each monomer sub-unit. However, a block copolymer may have unique properties that polymers formed from the individual sub- units do not possess.
- Block copolymers can be engineered such that one of the monomer sub- units is hydrophobic or lipophilic, whilst the other sub-unit(s) are hydrophilic whilst in aqueous media.
- the block copolymer may possess amphiphilic properties and may form a structure that mimics a biological membrane.
- the block copolymer may be a diblock
- the copolymer may be a triblock, tetrablock or pentablock copolymer.
- the membrane is preferably a triblock copolymer membrane.
- Archaebacterial bipolar tetraether lipids are naturally occurring lipids that are constructed such that the lipid forms a monolayer membrane. These lipids are generally found in extremophiles that survive in harsh biological environments, thermophiles, halophiles and acidophiles. Their stability is believed to derive from the fused nature of the final bilayer. It is straightforward to construct block copolymer materials that mimic these biological entities by creating a triblock polymer that has the general motif hydrophilic -hydrophobic -hydrophilic.
- This material may form monomeric membranes that behave similarly to lipid bilayers and encompass a range of phase behaviors from vesicles through to laminar membranes.
- Membranes formed from these triblock copolymers hold several advantages over biological lipid membranes. Because the triblock copolymer is synthesized, the exact construction can be carefully controlled to provide the correct chain lengths and properties to form membranes and to interact with pores and other proteins.
- Block copolymers may also be constructed from sub-units that are not classed as lipid sub-materials; for example a hydrophobic polymer may be made from siloxane or other non- hydrocarbon based monomers.
- the hydrophilic sub-section of block copolymer can also possess low protein binding properties, which allows the creation of a membrane that is highly resistant when exposed to raw biological samples.
- This head group unit may also be derived from non-classical lipid head-groups.
- Triblock copolymer membranes also have increased mechanical and environmental stability compared with biological lipid membranes, for example a much higher operational temperature or pH range.
- the synthetic nature of the block copolymers provides a platform to customize polymer based membranes for a wide range of applications.
- the membrane is most preferably one of the membranes disclosed in International Application No. PCT/GB2013/052766 or PCT/GB2013/052767.
- amphiphilic molecules may be chemically-modified or functionalized to facilitate coupling of the polynucleotide.
- the amphiphilic layer may be a monolayer or a bilayer.
- the amphiphilic layer is typically planar.
- the amphiphilic layer may be curved.
- the amphiphilic layer may be supported.
- Amphiphilic membranes are typically naturally mobile, essentially acting as two dimensional fluids with lipid diffusion rates of approximately 10-8 cm s-1. This means that the pore and coupled polynucleotide can typically move within an amphiphilic membrane.
- the membrane may be a lipid bilayer.
- Lipid bilayers are models of cell membranes and serve as excellent platforms for a range of experimental studies.
- lipid bilayers can be used for in vitro investigation of membrane proteins by single-channel recording.
- lipid bilayers can be used as biosensors to detect the presence of a range of substances.
- the lipid bilayer may be any lipid bilayer. Suitable lipid bilayers include, but are not limited to, a planar lipid bilayer, a supported bilayer or a liposome.
- the lipid bilayer is preferably a planar lipid bilayer. Suitable lipid bilayers are disclosed in International
- the polynucleotide can be coupled to the membrane comprising any one of the modified ClyA nanopores described herein.
- the method may comprise coupling the polynucleotide to the membrane comprising any one of the modified ClyA nanopores described herein.
- the polynucleotide is preferably coupled to the membrane using one or more anchors.
- the polynucleotide may be coupled to the membrane using any known method.
- the polynucleotide may be double stranded. If the polynucleotide is double stranded, the method may further comprises before the contacting step ligating a hairpin adaptor to one end of the polynucleotide. The two strands of the polynucleotide may then be separated as or before the polynucleotide is contacted or interacted with a modified ClyA nanopore as described herein. The two strands may be separated as the polynucleotide movement through the pore is controlled by a polynucleotide binding protein, such as a helicase, or molecular brake. This is described in International Application No.
- a target double stranded polynucleotide is provided with a hairpin loop adaptor at one end and the method comprises contacting the polynucleotide with any one of the modified ClyA nanopores described herein such that both strands of the polynucleotide move through the pore and taking one or more measurements as the both strands of the polynucleotide move with respect to the pore wherein the measurements are indicative of one or more characteristics of the strands of the polynucleotide and thereby characterizing the target double stranded polynucleotide.
- the method preferably comprises attaching to the polynucleotide a leader sequence which preferentially threads into the pore.
- the leader sequence facilitates any of the methods described herein.
- the leader sequence is designed to preferentially thread into any one of the modified ClyA nanopores described herein and thereby facilitate the movement of polynucleotide through the nanopore.
- the leader sequence can also be used to link the polynucleotide to the one or more anchors as discussed above.
- a target polynucleotide Before characterization, a target polynucleotide may be modified by contacting the polynucleotide with a polymerase and a population of free nucleotides under conditions in which the polymerase forms a modified polynucleotide using the target polynucleotide as a template, wherein the polymerase replaces one or more of the nucleotide species in the target polynucleotide with a different nucleotide species when forming the modified polynucleotide.
- the modified polynucleotide may then be provided with one or more helicases attached to the polynucleotide and one or more molecular brakes attached to the polynucleotide. This type of modification is described in International Application No. PCT/GB2015/050483. Any of the polymerases discussed herein may be used.
- the template polynucleotide is contacted with the polymerase under conditions in which the polymerase forms a modified polynucleotide using the template polynucleotide as a template.
- Such conditions are known in the art.
- the polynucleotide is typically contacted with the polymerase in commercially available polymerase buffer, such as buffer from New England Biolabs®.
- a primer or a 3' hairpin is typically used as the nucleation point for polymerase extension.
- Characterization, such as sequencing, of a polynucleotide using a transmembrane pore typically involves analyzing polymer units made up of k nucleotides where k is a positive integer (i.e., 'k-mers'). This is discussed in International Application No. PCT/GB2012/052343 (published as WO 2013/041878). While it is desirable to have clear separation between current measurements for different k-mers, it is common for some of these measurements to overlap.
- the modified polynucleotide contains k-mers which differ from those in the target polynucleotide.
- the different k-mers in the modified polynucleotide are capable of producing different current measurements from the k-mers in the target polynucleotide and so the modified polynucleotide provides different information from the target polynucleotide.
- the additional information from the modified polynucleotide can make it easier to characterize the target polynucleotide. In some instances, the modified polynucleotide itself may be easier to characterize.
- the modified polynucleotide may be designed to include k-mers with an increased separation or a clear separation between their current measurements or k-mers which have a decreased noise.
- the polymerase preferably replaces two or more of the nucleotide species in the target polynucleotide with different nucleotide species when forming the modified polynucleotide.
- the polymerase may replace each of the two or more nucleotide species in the target polynucleotide with a distinct nucleotide species.
- the polymerase may replace each of the two or more nucleotide species in the target polynucleotide with the same nucleotide species.
- the different nucleotide species in the modified typically comprises a nucleobase which differs from adenine, guanine, thymine, cytosine or methylcytosine and/or comprises a nucleoside which differs from deoxyadenosine,
- the different nucleotide species in the modified polynucleotide typically comprises a nucleobase which differs from adenine, guanine, uracil, cytosine or methylcytosine and/or comprises a nucleoside which differs from adenosine, guanosine, uridine, cytidine or methylcytidine.
- the different nucleotide species may be any of the universal nucleotides discussed above.
- the polymerase may replace the one or more nucleotide species with a different nucleotide species which comprises a chemical group or atom absent from the one or more nucleotide species.
- the chemical group may be a propynyl group, a thio group, an oxo group, a methyl group, a hydroxymethyl group, a formyl group, a carboxy group, a carbonyl group, a benzyl group, a propargyl group or a propargylamine group.
- the polymerase may replace the one or more nucleotide species with a different nucleotide species which lacks a chemical group or atom present in the one or more nucleotide species.
- the polymerase may replace the one or more of the nucleotide species with a different nucleotide species having an altered electronegativity.
- the different nucleotide species having an altered electronegativity preferably comprises a halogen atom.
- the method preferably further comprises selectively removing the nucleobases from the one or more different nucleotides species in the modified polynucleotide.
- a polynucleotide is characterized by detecting labelled species that are released as a polymerase incorporates nucleotides into the polynucleotide.
- the polymerase uses the polynucleotide as a template. Each labelled species is specific for each nucleotide.
- the polynucleotide is contacted with a modified ClyA nanopore described herein, a polymerase and labelled nucleotides such that phosphate labelled species are sequentially released when nucleotides are added to the polynucleotide(s) by the polymerase, wherein the phosphate species contain a label specific for each nucleotide.
- the polymerase may be any of those discussed above.
- kits for characterizing a target polynucleotide comprises any one of the modified ClyA nanopores described herein and the components of a membrane.
- the membrane is preferably formed from the components.
- the pore is preferably present in the membrane.
- the kit may comprise components of any of the membranes disclosed above, such as an amphiphilic layer or a triblock copolymer membrane.
- the kit may further comprise a polynucleotide binding protein.
- the kit may further comprise one or more anchors for coupling the polynucleotide to the membrane.
- the kit may additionally comprise one or more other reagents or instruments which enable any of the embodiments mentioned above to be carried out.
- reagents or instruments include one or more of the following: suitable buffer(s) (aqueous solutions), means to obtain a sample from a subject (such as a vessel or an instrument comprising a needle), means to amplify and/or express polynucleotides or voltage or patch clamp apparatus.
- Reagents may be present in the kit in a dry state such that a fluid sample resuspends the reagents.
- the kit may also, optionally, comprise instructions to enable the kit to be used in any one of the methods described herein or details regarding for which organism the method may be used.
- the apparatus comprises a plurality of modified ClyA nanopores as described herein and a plurality of membranes.
- the plurality of the modified ClyA nanopores are present in the plurality of membranes.
- the numbers of modified ClyA nanopores and membranes are equal.
- a single modified ClyA nanopore is present in each membrane.
- the apparatus can further comprises instructions for carrying out any of the methods as described herein.
- the apparatus may be any conventional apparatus for polynucleotide analysis, such as an array or a chip. Any of the embodiments discussed above with reference to the methods, e.g., for characterizing a target polynucleotide, are equally applicable to the apparatus described herein.
- the apparatus may further comprise any of the features present in the kit described herein.
- the apparatus is set up to carry out any of the methods described herein, e.g., for characterizing a target polynucleotide.
- the apparatus comprises: (a) a sensor device that is capable of supporting the plurality of modified ClyA nanopores and membranes and that is operable to perform polynucleotide characterization using the nanopores and membranes; and (b) at least one port for delivery of material for performing the characterization.
- the apparatus may comprise: (a) a sensor device that is capable of supporting the plurality of modified ClyA nanopores and membranes and that is operable to perform polynucleotide characterization using the nanopores and membranes; and (b) at least one reservoir for holding material for performing the characterization.
- the apparatus may comprise: (a) a sensor device that is capable of supporting the membrane and plurality of modified ClyA nanopores and membranes and that is operable to perform polynucleotide characterizing using the pores and membranes; (b) at least one reservoir for holding material for performing the characterizing; (c) a fluidics system configured to controllably supply material from the at least one reservoir to the sensor device; and (d) one or more containers for receiving respective samples, the fluidics system being configured to supply the samples selectively from one or more containers to the sensor device.
- the apparatus may be any of those described in International Application No. No.
- PCT/GB08/004127 (published as WO 2009/077734), PCT/GB 10/000789 (published as WO 2010/122293), International Application No. PCT/GB 10/002206 (published as WO
- bacteriophage proteins revealed that during DNA packing and injection, dsDNA translocates across a narrow nanopore (-3.5 nm) with a strong negative surface that is decorated by rings of positive charges.
- the electronegative inner surface of the nanopore is proposed to facilitate the sliding of negatively charged DNA, while the role of the positive charges is thought to facilitate this process.
- the strongly electronegative 3.3 nm internal constriction of the nanopore did not require modifications.
- the ionic current flowing through biological nanopores reconstituted into lipid membranes has been used to identify small molecules or folded proteins and to monitor chemical or enzymatic reactions at the single-molecule level.
- the electrophoretic translocation of DNA across nanopores reconstituted into artificial membranes holds great promise for practical applications such as DNA sequencing, and biomarker recognition.
- ⁇ 29 portal protein which is not a membrane protein per se, was found to insert into black lipid bilayers and such nanopores electrophoretically translocated dsDNA at 1.0/0.5 mM NaCl.
- the exact hydrophobic modifications of the nanopore that allowed membrane insertion were not known. Indeed, ⁇ 29 nanopores occasionally released from the lipid membranes, thus posing limitations in practical applications.
- dsDNA has been shown to translocate through artificial nanopores prepared on solid-state membranes, which with the exception of atom-thin material such as graphene or bilayer of molybdenum disulfide, mostly have a negative internal surface charge.
- the surface potential produced by the electric -double layer (EDL) on the inner nanopore walls overlaps, resulting in a large electrostatic barrier for the entry of DNA into the nanopore.
- EDL electric -double layer
- the ClyA nanopore a dodecameric protein with an internal constriction of -3.3 nm (FIG. 1, Panel A) has been used as a tool to investigate folded proteins.
- dsDNA translocation across the nanopore was observed at 2.5 M NaCl solutions, the strong negative interior of the pore (FIG. 1, Panel A) prevented DNA translocation at lower ionic strengths.
- the ClyA nanopore was engineered, enabling it to translocate of DNA at physiological ionic strengths. This is useful in many applications where electrostatic interactions between molecules and DNA are important, for example in DNA sequencing or mapping where enzymes are used to control the translocation of DNA across the nanopore or to study DNA -protein interactions.
- the DNA translocation was observed after two rings of positive charges were added at wider cis side of the nanopore, while modification of the more constricted trans entry of the nanopore did not improve the efficiency of DNA translocation. In addition, the modifications did not change the ion selectivity of the nanopore and mirrored the charge distribution of ⁇ 29 portal protein. Further, the engineered pores allowed the translocation of DNA only from the wide- side of the nanopore. Interestingly, many proteins that slide on DNA display a surface charge similar to the engineered ClyA nanopores, indicating that the alternation of positive and negative charges might provide a general mechanism for improving the translocation of DNA across nanoscales. This Example shows that the precise engineering of the shape and internal surface charge of the nanopore is important for the translocation and sliding of DNA across nano-scale pores with diameter similar to that of DNA.
- ClyA-AS (FIG. 1, Panel A; FIG. 11, Panel A) is an engineered version of cytolysin A from Salmonella typhi selected for its favorable proprieties in planar lipid bilayers and in which the translocation of ssDNA or dsDNA is only observed above 2.0 M NaCl ionic strengths. Most likely, at low ionic strengths, the strong negative electrostatic potential inside the nanopore (FIG. 11, Panel B) prevents DNA entry and translocation, while at high ionic strengths, the charges of the nanopore surface are effectively screened. To induce the capture of DNA by the nanopores at physiological ionic strengths, the internal charges of the ClyA-AS nanopore were modified (Tables 1 and 2 and FIG. 1, Panel A; FIG.l l, Panel A).
- VG gating voltage
- ClyA-RR was the only ClyA mutant that showed DNA induced current events following the addition of either ssDNA or dsDNA to the cis side of the nanopore (+70 mV, FIGS. 1C-D and 6).
- the substitution of the first amino acid in Region A may have at least a delta 1 of added positive charge (namely substitution of a neutral amino acid by a positively charged amino acid) and the substitution in Region B may have at least a delta 2 of added positive charge (namely substitution of a negatively charged amino-acid by a positively charged amino acid).
- Table 1 Electrical properties of engineered ClyA nanopore variants. The activities of the nanopores were tested by adding ⁇ 0.1 ng of oligomeric proteins to the cis chamber. A negative activity indicates that no channel insertions were observed. VG is the gating voltage and represents the highest applied voltage at which no gating events were observed within a 30- second timespan. DNA translocation indicates that a dsDNA rotaxane could be formed. Each data point is the average of at least three experiments and the error is the standard deviation. Experiments were carried out in 0.15 M NaCl, 15 mM Tris HC1, pH 7.5 solutions.
- a rotaxane is a dumbbell shaped molecule formed by a macrocycle that encircles a thread locked by two stoppers.
- two nanopore/DNA rotaxanes were formed in 150 mM NaCl solutions to prove the translocation of ssDNA and dsDNA through the nanopore.
- the first rotaxane was formed using a 100 mer 5'-biotinylated ssDNA molecule as the initial thread (2a, Table 3) added to the cis compartment.
- the second rotaxane was formed using a 3'-biotinylated 59 base pairs dsDNA molecule extended with a 31 bases 3' biotin overhang (la/lc, Table 3).
- the rotaxanes were locked by adding on the opposite side of the nanopore another biotinylated ssDNA molecule, 2b (50 mer, 5 -biotinylated) or Id (31 mer, 3 '-biotinylated), designed to hybridize with the overhangs of 2a or la/lc, respectively.
- Both cis and trans solutions contained Neutravidin (NA, 0.3 ⁇ ), which complexed with biotin and prevented the full translocation of the DNA strands across the nanopore.
- the subsequent addition of the DNA: neutravidin stoppers to the trans solutions induced a permanent blockade at both potentials, indicating the assembly of a DNA rotaxane, and showing that both threads translocated the nanopore.
- the capture rate k on which is the inverse of the inter-event time inverse of the inter- event time ⁇ ⁇ (Table 7, +70 mV, 1 ⁇ DNA), increased with the Debye length of the solution ( ⁇ 0 ) for both ssDNA and dsDNA (FIG. 3, Panels B-C; FIG. 13, Panels A-B).
- ⁇ the Debye length of the solution
- ssDNA capture rate increased linearly with ⁇ (FIG. 13, Panel A)
- ssDNA capture rate increased exponentially with ⁇ (FIG. 13, Panel B). This indicate, therefore, different capture mechanisms for dsDNA and ssDNA.
- ClyA nanopores were engineered to allow the electrophoretic translocation of DNA at physiological ionic strengths.
- DNA translocation was observed when two sets of positive charges were introduced at the entry and in the midsection of the ClyA nanopore (FIG. 11, Panel A).
- the trans entry of the nanopore which provides the highest entropic and electrostatic barriers for DNA translocation (FIG. 11, Panels A-B) did not require modification.
- DNA translocation could be observed only when initiated from the wider cis entry of the nanopore.
- the frequency of dsDNA translocation through ClyA-RR nanopores increased with the Debye length of the solution (FIG.
- a DNA molecule translocating through a nanopore is subjected to the electrical driving force, and the hydrodynamic viscous drag force arising from the electroosmotic flow (EOF) inside the nanopore that opposes the translocation of DNA.
- ClyA and most solid-state nanopores have a negative surface charge that is electrostatically balanced by a layer of cations in the immediate contact with the surface usually called electric double layers (EDL).
- EDL electric double layers
- the EDL force decays in an exponential fashion over the diffuse layer.
- the range of this force is given by the Debye length and its strength by the surface potential.
- the thickness of the EDLs including the diffuse layer might be comparable to the size of the nanopores, yielding overlapped EDLs. Under this regime a DNA molecule (diameter 2.2 nm) approaching such nanopores will experience a strong surface potential that for nanopores with negative surface charge will oppose the entry of DNA into the nanopore.
- ClyA can be approximated by a cylindrical cis lumen (5.5 nm diameter and 10 nm length) followed by a smaller and negatively charged trans constriction (3.3 nm diameter and 3.0 nm length, FIG. 1), which is expected to oppose the main electrophoretic and entropic barrier for DNA translocation.
- the translocation of DNA through ClyA nanopores was observed when a set of positive charges was added to the cis lumen of the nanopore (ClyA- RR); while the constriction of the nanopore did not require any modification.
- ssDNA has a coiled structure (persistence length -1.5 nm) with a gyration radius, which is the average squared distance of any point in the polymer coil from its center of mass, of -6 nm. Since the gyration radius is similar to the diameter of the cis entrance of the nanopore (FIG. 5, Panel B), ssDNA most likely enters the cis side of the nanopore as a partially coiled structure (FIG. 5, Panel B). As the ssDNA moves from the cis reservoir to the trans side, it must then gradually uncoil in order to navigate through the trans constriction of the nanopore and then recoil on the opposite side (FIG. 5, Panel B).
- dsDNA Capture is Diffusion-Limited and ssDNA Capture is Reaction-Limited
- the DNA translocation experiments at different salt concentrations showed two different capture mechanisms for dsDNA and ssDNA (FIG. 13, Panels A-B, and FIG. 14, Panels A-B, respectively).
- the behavior of dsDNA is consistent with a diffusion-limited capture process. This is because the dsDNA used in this work is shorter than its persistence length (150 bp) and behaves as a rigid uniformly charged rod.
- the electric field attracts the DNA toward the pore and aligns it along the field lines so that it hits the pore entry with one end (FIG. 14, Panel A, i).
- the capture frequency can be estimated by the following:
- AF b is the barrier height and ⁇ is a characteristic attempt rate for barrier crossing.
- the exponential factor gives the probability of a successful crossing event.
- ClyA-RR can be used to study protein-DNA interactions at the single-molecule level and can be employed in DNA mapping and sequencing applications, where an enzyme controls the translocation of the nucleic acid through the nanopore. It was found that the introduction of rings of positive charges, attractive interactions, at the wider entry (the cis side) of the nanopore is important to induce DNA translocation through the narrow and negatively charged trans constriction. Surprisingly, the constriction itself did not require modifications. These results indicate that attractive interactions at the entry and in the middle of the nanopore are important to "grab” and orient the DNA for effective electrophoretic-driven sliding through the narrow and negatively charged trans constriction.
- a nano-scale chamber with a favorable surface charge and a diameter similar to the gyration radius of DNA placed above the nanopore should favor the translocation of DNA, especially at low ionic strengths.
- modifications to the ClyA nanopore that allow DNA translocation are mirrored in viral portal proteins, indicating that the precise engineering of biological nanopores is important for the efficient packing and ejection of DNA in and out the viral capsid.
- DNA was purchased from Integrated DNA Technologies (IDT). Neutravidin was acquired from Thermo Fisher and l,2-diphytanoyl-s «-glycero-3-phosphocholine from Avanti Polar Lipids, ⁇ - Dodecyl maltoside (DDM) was purchased from GLYCON Biochemicals GmbH. Enzymes were bought from Fermentas and all other materials from Sigma, unless otherwise specified.
- ClyA was expressed in E. cloni® EXPRESS BL21 (DE3) cells by using a pT7 plasmid.
- Monomers were purified by using Ni-NTA affinity chromatography and oligomerized in the presence of 0.5% ?-dodecyl maltoside (GLYCON Biochemicals GmbH) as described in Waduge et al., ACS Nano (2015) 9: 7352-7359. Monomers (containing a C-terminal oligo-histidine tag) were expressed in E. coli BL21 cells and the soluble fraction purified using Ni-NTA affinity buffer (150 mM NaCl, 15 mM Tris HC1, pH 7.5, 0.2% DDM and 1 mM EDTA) and stored at 4°C.
- Ni-NTA affinity buffer 150 mM NaCl, 15 mM Tris HC1, pH 7.5, 0.2% DDM and 1 mM EDTA
- dsDNA 1 was prepared by first mixing equimolar concentrations of la and lb (Table 3). The mix was brought to 95 °C and the temperature stepped down at regular intervals. The DNA was purified from the excess of ssDNA with affinity chromatography using a biotin- binding column containing monomeric avidin immobilized on agarose beads (Thermo Scientific Pierce). The ds DNA was then eluted from the column according to the manufacturer's protocol. The elution fraction was concentrated and further purified using a PCR quick purification kit (QIAGEN). Typically, a DNA concentration of O ⁇ g/mL was obtained, la/lc duplex was annealed as explained for 1 but not purified. Ion permeability.
- I- V curves under asymmetric conditions were collected by adding ClyA to the cis chamber under symmetric conditions (150 mM NaCl, 15 mM Tris-HCl pH 7.5 in both cis and trans solutions). The electrodes were then balanced, and the electrolyte concentration in cis was increased up to 1 M by adding aliquots of 5 M NaCl stock solutions to the cis compartment. The volume of the trans chamber was adjusted by adding the same volume added to the cis side using the same buffer of the cis solution (150 mM NaCl).
- Permeability ratios (P Na+ /Pci-, Table 4) were calculated using the Goldman-Hodgkin-Katz equation (below) using the measured reverse potential (Vr) values, which were extrapolated from the /- V curves .
- R is the universal gas constant (8.314 J mol )
- T the temperature in Kelvin
- F the Faraday' s constant (96 485 C mol )
- P + and PQ- are the relative membrane permeability for the ions
- Na + or Cl ⁇ and a ⁇ &+ and AQ- are their respective activities.
- the cis chamber was the ground.
- Ag/AgCl electrodes with 2.5% agarose bridges containing 2.5 M NaCl were used to perform all of the experiments.
- Ionic currents were measured by recording from planar bilayers formed from diphytanoyl-5n-glycero-3-phosphocholine (Avanti Polar Lipids, Alabaster, AL). Currents were measured with Ag/AgCl electrodes submerged in agar bridges (3% w/v low-melt agarose in 2.5 M NaCl buffer) using a patch-clamp amplifier (Axopatch 200B, Axon Instruments, Foster City, CA) as described in Ho et al., Sci. Adv. (2015) 1, el500905; and Maglia et al., Methods Enzymol. (2010) 475: 591-623.
- Single channels were characterized by measuring the current versus applied voltage relationship (I-V curve, the potential was applied in 10 mV steps from -100 to +100 mV in 21s , FIGs. 6, 10 and Table 5).
- I-V curve the potential was applied in 10 mV steps from -100 to +100 mV in 21s , FIGs. 6, 10 and Table 5.
- ionic currents were recorded by applying a 2 kHz low-pass Bessel filter and using a 10 kHz sampling rate. At higher salt concentrations, ionic currents were sampled at 50 kHz and the low-pass Bessel filter was set at 10 kHz.
- Current traces at 0.3 and 0.5 M NaCl were filtered post-acquisition with a 4 kHz Bessel digital filter (FIGs. 16, 17). The use of different filtering frequencies influences the overall number of detected events.
- Single point mutations to the ClyA- AS gene were performed by using the "mega primer” method. Typically, two PCR cycles were performed to prepare a new DNA construct: In the first PCR reaction the plasmid DNA was amplified with two primers: the forward primer was a oligonucleotide 20-30 bases in length that carried the base substitution, the reverse primer was either the T7 promoter or T7 terminator. For mutations at the transmembrane region the reverse primer was a 25 mer oligo complementary to a stretch in the middle of protein sequence (Table 3).
- the PCR product containing the mega primers (200-300 bp), was loaded into an agarose gel (2% agarose/ TAE and crystal violet), the megaprimer cut out and purified using a PCR quick purification kit (QIAGEN). 5 iL of purified mega primers were loaded on 2% agarose/TAE gel to check for purity and 5- 10 ⁇ . of the megaprimer were employed for a 2 nd PCR reaction.
- the 2 nd PCR product was then first digested with Dpnl (1-2 h, 37°C, fast digest Dpnl, Fermenthas) to eliminate the ClyA- AS template DNA and then ⁇ 1 ⁇ . used for transformation with electrocompetent cells E. cloni® EXPRESS BL21 (DE3) (maker).
- dsDNA 1 was formed by incubating la, 3 '-biotinylated ssDNA molecule (Table 3), with a 20% excess of complementary ssDNA lb (Table 3). The temperature was brought to 95°C for 1 min and then decreased stepwise to room temperature. At around the estimated annealing temperature of 70°C, the temperature was decreased in 2°C steps to 21°C. Each step lasted for 1 minute. The DNA was then purified from the excess of ssDNA with affinity chromatography using a biotin-binding column containing monomeric avidin immobilized on agarose beads (Thermo Scientific Pierce). The dsDNA was then eluted with Biotin Blocking/Elution Buffer according to the manufacturer protocol.
- the elution fraction was concentrated and further purified using a PCR quick purification kit (QIAGEN). Typically, a DNA concentration of 0.2 ⁇ g/mL was obtained.
- the size and purity of the dsDNA was checked by using a 2% agarose gel in TAE buffer and quantified spectroscopically.
- the purified dsDNA was stored at -20°C in the presence of 1 mM EDTA.
- Artificial planar lipid bilayers were prepared as described above. If not otherwise specified, the signal was collected at a sampling rate of 50 kHz after processing with a 10-kHz Bessel filter.
- the lipid bilayer was formed by pretreating a small aperture ( ⁇ 100 ⁇ ) on a Teflon film (Goodfellow, UK) with 1-2 ⁇ of a 10% solution of 1 ,2-diphytanoylsn- glycero-3- phosphocholine in pentane.
- the electrical potential was applied by using Ag/AgCl electrodes submerged in agar bridges (3% w/v low melt agarose in 2.5 M NaCl buffer). The applied potential refers to the potential of the working electrode connected to the trans compartment of the apparatus.
- ClyA nanopore solutions (0.01-0.1 ng/mL) were added to the cis compartment, which was connected to the ground electrode. After the insertion of a single pore, excess protein was removed by several cycles of perfusion. Electrical recordings were carried out in 0.15-2.5 M NaCl, 15 mM Tris HC1, pH 8.0, at 22°C. In 0.15 M NaCl data were recorded by applying a 2-kHz low-pass Bessel filter and using a 10 kHz sampling rate. While at higher salt
- concentration data were sampled at 50 kHz and the low-pass Bessel filter was set at 10 kHz.
- Current traces at 0.3 and 0.5 M NaCl were filtered post-acquisition with a 4-kHz Bessel digital filter.
- Current blockade events were collected individually by using the "single channel search" function of the Clampfit software (Molecular devices) using a data acquisition threshold of 0.05 ms.
- Io and IB values were calculated from Gaussian fitting to all-point histograms of the open and blocked pore currents, respectively.
- the DNA translocation dwell time x 0 ff was calculated by a single exponential standard fits from an event histogram of the block pore current events (toff).
- the inter-event time ⁇ ⁇ was calculated by using an exponential logarithmic probability fit from the logarithmic histogram of the inter-event times (ton) between block pore current events.
- the errors indicate the standard deviation from the average from at least three independent repeats, the number of which is indicated by "n.”
- Pores inserted from the cis chamber showed higher conductance at positive applied potential, helping to assess the orientation of the inserted channel.
- Single channels were characterized by measuring the current versus applied voltage relationship, (I-V curve, the potential was applied in 10 mV steps from -100 to +100 mV in 21 seconds).
- the pore rectification was obtained from the ratio of the open pore current at +100 mV and that at -100 mV (Io + ioomv/Io-ioomv ).
- the propensity for gating of the nanopores was assessed by the continuous measurement of the open pores current at a given applied potential.
- VMAX was then given by the applied potential at which no gating events were observed within a 30 second timespan.
- Permeability ratios for ClyA nanopores were calculated by measurement of the reversal potential in asymmetric salt condition: 150 mM NaCl trans, 1 M NaCl cis.
- the protein nanopores were added to the cis chamber and a single channel was first characterized in symmetric condition (150 mM NaCl, 15 mM Tris HC1 pH 7.5 in both cis and trans solutions). After the electrodes were balanced, the electrolyte concentration in cis was increased up to 1 M, by adding aliquots of 5 M NaCl stock solutions to the cis compartment. The volume of the trans chamber was adjusted by adding the same volume added to the cis side using the same buffer of the cis solution (150 mM NaCl).
- V r The reversal potential (V r , Table 3), which is the electrical potential used to obtain a zero current, was obtained by current-voltage (IV) curve (Table 6).
- Ion selectivities (PNa + /Pci) were calculated from the V r by using the Goldman- Hodgkin-Kats (GHK) equation. According both to the GHK equation positive value for V r observed for the ClyA nanopores show a preferential movement of the cations through the pore, indicating that the pores are cationic selective channels.
- the cis chamber was at ground and Ag/AgCl electrodes with 2.5% agarose bridges containing 2.5 M NaCl were used to perform all the experiments.
- V r is the membrane potential
- R the universal gas constant (8.314 J.K-l .mol-1)
- T the temperature in Kelvin
- F the Faraday's constant (96485 C.mol-1)
- P x the relative membrane permeability for Na + and CI " , [ax] i the activity of Na+ and CI " in the cis compartment, [ax] ira n* the concentration of Na+ and CI " in the trans compartment, and a x the activity of Na+ and CI " (J.F. Zemaitis, Handbook of aqueous electrolyte thermodynamics: theory and application, 1986; Ludwig Molecular Microbiology 1999; Li-Qun Gu PNAS 2000; Petr G. Merzlyak Biophysics 2005).
- the approach relates to one developed by Grosberg and Rabin.
- AV AV to represent the potential difference between the cis and trans side of the membrane, it can be shown that the electric potential in the cis side is given by: which decays as lr/ far from the pore at the cis side (by convention the potential at the electrode in the cis side was set to zero).
- the dsDNA is approximated as a charged point particle performing a diffusive motion with diffusion constant D and with an electrophoretic drift characterized by an electrophoretic mobility ⁇ .
- the resulting drift-diffusion equation in radial coordinates for the dsDNA concentration c(r,t) is given by:
- RH is the hydrodynamic radius.
- dsDNA as a cylinder of radius 1 nm and length 34 nm (lOObp)
- LOObp the expression given by Hansen et al. J. Chem. Phys. (2004) 121: 9111-9115
- D - 0.5 nm and keT ⁇ 25 meV.
- the capture radius is two orders of magnitude larger than the Debye length and much larger than the pore radius, hence the approximation used in Eq. (7) is justified.
- the ssDNA coil reduces its configurational entropy when the end is forced to get closer to the pore entry. If the strand is sufficiently long, the entropic repulsion dominates over the electrostatic attraction resulting in a barrier (FIG. 19).
- this potential contains also kinetic parameters as the electrophoretic mobility ⁇ and the solvent viscosity ⁇ from ⁇ ⁇ ⁇ ⁇ .
- the potential has a minimum close to distance R g and a maximum close to the pore entry defining a barrier height: AF3 ⁇ 4 ⁇ 3 ⁇ 4 max -F3 ⁇ 4 mm .
- the barrier can be lowered by increasing the applied voltage AV so to strengthen the electrostatic attraction towards the pore.
- Eq. (15) implies that a similar effect can be obtained by increasing ⁇ , the electrophoretic mobility of the ssDNA.
- One obvious way to modify ⁇ is through a change of the ionic strength of the solution as this modifies the Debye length.
- the electrophoretic mobility is proportional to D- Note that the salt concentration has also an effect on the ssDNA persistence length and thus on the entropic contribution to the barrier U(r), however this effect is expected to be weaker.
- the main effect of a change in the salt concentration on the barrier height is expected to contain a term linear in AD:
- Table 3 DNA molecules used in this work. 1 was formed by incubating la with 20% excess of lb and purified by affinity chromatography as described in Methods. 1* formed by incubating la with a 20% excess of lb without further purification. The complementary sequences in the two DNA strands are shown in italics. The suffix bio indicates a bio tin moiety.
- Table 4 Ionic selectivity of selected ClyA nanopores. Permeability ratio (PNa + / Pci ) and reversal potential (Vr) for ClyA variant nanopores reported as average + standard deviation. Four or more single channels were measured for each variant. The buffer used were: 15 mM TRIS.HC1 pH 7.5, with 1 M NaCl in the cis chamber and 150 mM in the trans chamber.
- Table 5 IV curves for ClyA mutants. The electrical recordings were carried out in 0.15 M NaCl, 15 mM Tris HCl, pH 7.5, at 22°C. Each data point is the average of at least three experiments and the error is the standard deviation. Table 5
- Table 6 IV curves of ClyA variants under asymmetric salt concentrations. Four or more single channels were measured for each variant. Each data is reported as the average + standard deviation.
- the buffer used was 15 mM TRIS.HC1 pH 7.5, while the cis chamber contained 1 M NaCl and the trans chamber 150 mM.
- the electrical recordings were carried out in 0.15 M NaCl, 15 mM Tris HCl, pH 7.5, at 22°C. Data were recorded by applying a 2-kHz low-pass Bessel filter and using a 100 ⁇ 8 (10 kHz) sampling rate.
- Table 7 ssDNA (la) and dsDNA (1) translocation through ClyA-RR nanopores. Three or more single channels were measured for each condition. Data are reported as the average ⁇ standard deviation. The electrical recordings were carried out in 15 mM Tris- HCl. pH 7.5 at 22°C. Data were recorded by applying a 10-kHz low-pass Bessel filter and using a 20 (50 kHz) sampling rate.
- SEQ ID NO: 2 SEKSSYYQSQVDRIRKEAYAGAAAGIVAGPFGLIISYSIAAGWEGKLIPELN
- SEQ ID NO: 4 TACAGTCAAGAAGCGTCCGTCCTAGTGGGCGATATCAAAGTGCTGCTGATGGA
- inventive embodiments are presented by way of example only and that, within the scope of the appended claims and equivalents thereto, inventive embodiments may be practiced otherwise than as specifically described and claimed.
- inventive embodiments of the present disclosure are directed to each individual feature, system, article, material, kit, and/or method described herein.
- a reference to "A and/or B", when used in conjunction with open-ended language such as “comprising” can refer, in one embodiment, to A only (optionally including elements other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
- the phrase "at least one,” in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements.
- This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase "at least one" refers, whether related or unrelated to those elements specifically identified.
- At least one of A and B can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.
Landscapes
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Physics & Mathematics (AREA)
- Organic Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Analytical Chemistry (AREA)
- Immunology (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- General Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Physics & Mathematics (AREA)
- Nanotechnology (AREA)
- Urology & Nephrology (AREA)
- Pathology (AREA)
- Spectroscopy & Molecular Physics (AREA)
- Hematology (AREA)
- Food Science & Technology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Gastroenterology & Hepatology (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
- Peptides Or Proteins (AREA)
- Investigating Or Analyzing Materials By The Use Of Electric Means (AREA)
- Investigating Or Analysing Biological Materials (AREA)
- Compositions Of Macromolecular Compounds (AREA)
- Apparatus Associated With Microorganisms And Enzymes (AREA)
Priority Applications (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA3011830A CA3011830C (en) | 2015-12-08 | 2016-12-08 | Modified nanopores, compositions comprising the same, and uses thereof |
| AU2016369071A AU2016369071B2 (en) | 2015-12-08 | 2016-12-08 | Modified nanopores, compositions comprising the same, and uses thereof |
| KR1020187019163A KR102837999B1 (ko) | 2015-12-08 | 2016-12-08 | 변형된 나노세공, 그를 포함하는 조성물, 및 그의 용도 |
| CN201680081416.8A CN109072295B (zh) | 2015-12-08 | 2016-12-08 | 修饰的纳米孔,包含其的组合物及其应用 |
| JP2018530754A JP7237586B2 (ja) | 2015-12-08 | 2016-12-08 | 修飾ナノポア、それを含む組成物およびその使用 |
| EP16838062.4A EP3387432B1 (en) | 2015-12-08 | 2016-12-08 | Modified nanopores, compositions comprising the same, and uses thereof |
| US16/060,762 US10976300B2 (en) | 2015-12-08 | 2016-12-08 | Modified nanopores, compositions comprising the same, and uses thereof |
| JP2021198939A JP2022046503A (ja) | 2015-12-08 | 2021-12-08 | 修飾ナノポア、それを含む組成物およびその使用 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562264709P | 2015-12-08 | 2015-12-08 | |
| US62/264,709 | 2015-12-08 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2017098322A1 true WO2017098322A1 (en) | 2017-06-15 |
Family
ID=58098655
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/IB2016/001841 Ceased WO2017098322A1 (en) | 2015-12-08 | 2016-12-08 | Modified nanopores, compositions comprising the same, and uses thereof |
Country Status (8)
| Country | Link |
|---|---|
| US (1) | US10976300B2 (enExample) |
| EP (1) | EP3387432B1 (enExample) |
| JP (2) | JP7237586B2 (enExample) |
| KR (1) | KR102837999B1 (enExample) |
| CN (1) | CN109072295B (enExample) |
| AU (1) | AU2016369071B2 (enExample) |
| CA (1) | CA3011830C (enExample) |
| WO (1) | WO2017098322A1 (enExample) |
Cited By (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020010589A1 (en) * | 2018-07-12 | 2020-01-16 | Shenzhen Genorivision Technology Co., Ltd. | An apparatus for biopolymer sequencing |
| GB202113935D0 (en) | 2021-09-29 | 2021-11-10 | Cambridge Entpr Ltd | Nucleic acid characterisation |
| WO2023026039A1 (en) | 2021-08-23 | 2023-03-02 | Cambridge Enterprise Limited | Nucleic acid detection |
| WO2023118891A1 (en) | 2021-12-23 | 2023-06-29 | Oxford Nanopore Technologies Plc | Method of characterising polypeptides using a nanopore |
| WO2023118892A1 (en) | 2021-12-23 | 2023-06-29 | Oxford Nanopore Technologies Plc | Method |
| GB202307486D0 (en) | 2023-05-18 | 2023-07-05 | Oxford Nanopore Tech Plc | Method |
| WO2024094986A1 (en) | 2022-10-31 | 2024-05-10 | Oxford Nanopore Technologies Plc | Method |
| WO2025099094A1 (en) | 2023-11-06 | 2025-05-15 | Oxford Nanopore Technologies Plc | Method |
Families Citing this family (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| GB0905140D0 (en) | 2009-03-25 | 2009-05-06 | Isis Innovation | Method |
| CN112646019B (zh) | 2012-04-10 | 2022-08-16 | 牛津纳米孔科技公开有限公司 | 突变胞溶素孔 |
| GB201313477D0 (en) | 2013-07-29 | 2013-09-11 | Univ Leuven Kath | Nanopore biosensors for detection of proteins and nucleic acids |
| EP3097210B2 (en) | 2014-01-22 | 2022-04-20 | Oxford Nanopore Technologies Limited | Method for attaching one or more polynucleotide binding proteins to a target polynucleotide |
| EP3137490B1 (en) | 2014-05-02 | 2021-01-27 | Oxford Nanopore Technologies Limited | Mutant pores |
| US10400014B2 (en) | 2014-09-01 | 2019-09-03 | Oxford Nanopore Technologies Ltd. | Mutant CsgG pores |
| GB201502809D0 (en) | 2015-02-19 | 2015-04-08 | Oxford Nanopore Tech Ltd | Mutant pore |
| GB201502810D0 (en) | 2015-02-19 | 2015-04-08 | Oxford Nanopore Tech Ltd | Method |
| EP3283887B1 (en) | 2015-04-14 | 2021-07-21 | Katholieke Universiteit Leuven | Nanopores with internal protein adaptors |
| KR102222192B1 (ko) | 2016-03-02 | 2021-03-02 | 옥스포드 나노포어 테크놀로지즈 리미티드 | 돌연변이체 기공 |
| JP7364333B2 (ja) | 2016-04-06 | 2023-10-18 | オックスフォード ナノポール テクノロジーズ ピーエルシー | 変異体ポア |
| US11531020B2 (en) * | 2017-01-18 | 2022-12-20 | Youhealth Biotech, Limited | Methods and compositions for nanopore sequencing |
| GB201707122D0 (en) | 2017-05-04 | 2017-06-21 | Oxford Nanopore Tech Ltd | Pore |
| CN117106037B (zh) | 2017-06-30 | 2025-07-25 | 弗拉芒区生物技术研究所 | 新颖蛋白孔 |
| WO2020241752A1 (en) | 2019-05-28 | 2020-12-03 | The University Of Tokyo | Analyzing apparatus and method using a pore device |
| BR112022009402A2 (pt) * | 2019-11-19 | 2022-08-09 | Univ Groningen | Nanoporos artificiais e usos e métodos relacionados com os mesmos |
| CN118011004A (zh) * | 2019-12-02 | 2024-05-10 | 牛津纳米孔科技公开有限公司 | 使用纳米孔表征靶多肽的方法 |
| NL2024579B1 (en) * | 2019-12-24 | 2021-09-06 | Univ Delft Tech | Protein and peptide fingerprinting and sequencing by nanopore translocation of peptide-oligonucleotide complexes |
| US20230194499A1 (en) * | 2020-04-14 | 2023-06-22 | Geneus Technologies Chengdu ) Co., Ltd. | Nanopore preparation and detection method and detection apparatus thereof |
| CN112179955B (zh) * | 2020-09-27 | 2024-05-10 | 西北工业大学 | 基于聚精氨酸和聚谷氨酸逐层修饰的纳米孔制备pH响应的纳米流体二极管方法 |
| CN117255945A (zh) * | 2021-03-31 | 2023-12-19 | 伊鲁米纳公司 | 纳米孔传感器装置 |
| CN114768530B (zh) * | 2022-04-29 | 2023-03-28 | 中国工程物理研究院材料研究所 | 二硫化钼在电解分离氢同位素中的应用 |
Citations (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000028312A1 (en) | 1998-11-06 | 2000-05-18 | The Regents Of The University Of California | A miniature support for thin films containing single channels or nanopores and methods for using same |
| WO2005124888A1 (en) | 2004-06-08 | 2005-12-29 | President And Fellows Of Harvard College | Suspended carbon nanotube field effect transistor |
| WO2006100484A2 (en) | 2005-03-23 | 2006-09-28 | Isis Innovation Limited | Deliver of molecules to a li id bila |
| WO2008102120A1 (en) | 2007-02-20 | 2008-08-28 | Oxford Nanopore Technologies Limited | Lipid bilayer sensor system |
| WO2009077734A2 (en) | 2007-12-19 | 2009-06-25 | Oxford Nanopore Technologies Limited | Formation of layers of amphiphilic molecules |
| WO2010004265A1 (en) | 2008-07-07 | 2010-01-14 | Oxford Nanopore Technologies Limited | Enzyme-pore constructs |
| WO2010004273A1 (en) | 2008-07-07 | 2010-01-14 | Oxford Nanopore Technologies Limited | Base-detecting pore |
| WO2010086603A1 (en) | 2009-01-30 | 2010-08-05 | Oxford Nanopore Technologies Limited | Enzyme mutant |
| WO2010122293A1 (en) | 2009-04-20 | 2010-10-28 | Oxford Nanopore Technologies Limited | Lipid bilayer sensor array |
| WO2011067559A1 (en) | 2009-12-01 | 2011-06-09 | Oxford Nanopore Technologies Limited | Biochemical analysis instrument |
| WO2013014451A1 (en) | 2011-07-25 | 2013-01-31 | Oxford Nanopore Technologies Limited | Hairpin loop method for double strand polynucleotide sequencing using transmembrane pores |
| WO2013041878A1 (en) | 2011-09-23 | 2013-03-28 | Oxford Nanopore Technologies Limited | Analysis of a polymer comprising polymer units |
| WO2013057495A2 (en) | 2011-10-21 | 2013-04-25 | Oxford Nanopore Technologies Limited | Enzyme method |
| WO2013098561A1 (en) | 2011-12-29 | 2013-07-04 | Oxford Nanopore Technologies Limited | Method for characterising a polynucelotide by using a xpd helicase |
| WO2013098562A2 (en) | 2011-12-29 | 2013-07-04 | Oxford Nanopore Technologies Limited | Enzyme method |
| WO2014153625A1 (en) | 2013-03-25 | 2014-10-02 | Katholieke Universiteit Leuven | Nanopore biosensors for detection of proteins and nucleic acids |
| WO2015051378A1 (en) * | 2013-10-04 | 2015-04-09 | University Of Washington Through Its Center For Commercialization | Systems and methods for nanopore-based analysis of nucleic acids |
| WO2015055981A2 (en) | 2013-10-18 | 2015-04-23 | Oxford Nanopore Technologies Limited | Modified enzymes |
| WO2015166276A1 (en) * | 2014-05-02 | 2015-11-05 | Oxford Nanopore Technologies Limited | Method of improving the movement of a target polynucleotide with respect to a transmembrane pore |
| WO2016166232A1 (en) | 2015-04-14 | 2016-10-20 | Katholieke Universiteit Leuven | Nanopores with internal protein adaptors |
Family Cites Families (70)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5795782A (en) | 1995-03-17 | 1998-08-18 | President & Fellows Of Harvard College | Characterization of individual polymer molecules based on monomer-interface interactions |
| US6362002B1 (en) | 1995-03-17 | 2002-03-26 | President And Fellows Of Harvard College | Characterization of individual polymer molecules based on monomer-interface interactions |
| JP3891620B2 (ja) | 1996-11-14 | 2007-03-14 | 株式会社アイシン・コスモス研究所 | ヘアピン型構造の核酸プローブ分子、及び該核酸プローブ分子を利用した核酸検出方法 |
| US20020197614A1 (en) | 1997-05-16 | 2002-12-26 | Mosaic Technologies, Inc. | Electrophoretic analysis of target molecules using adapter molecules |
| WO1999005167A1 (en) | 1997-07-25 | 1999-02-04 | University Of Massachusetts | Designed protein pores as components for biosensors |
| US6743605B1 (en) | 1998-06-24 | 2004-06-01 | Enzo Life Sciences, Inc. | Linear amplification of specific nucleic acid sequences |
| US6426231B1 (en) | 1998-11-18 | 2002-07-30 | The Texas A&M University System | Analyte sensing mediated by adapter/carrier molecules |
| NO986133D0 (no) | 1998-12-23 | 1998-12-23 | Preben Lexow | FremgangsmÕte for DNA-sekvensering |
| JP2003502166A (ja) | 1999-06-22 | 2003-01-21 | プレジデント・アンド・フェローズ・オブ・ハーバード・カレッジ | 固体状態の次元的特徴の制御 |
| WO2001016327A2 (de) | 1999-08-31 | 2001-03-08 | Michael Niederweis | Verfahren zur herstellung eines kanalbildenden proteins |
| AU2001241474A1 (en) | 2000-02-11 | 2001-08-20 | The Texas A And M University System | Biosensor compositions and methods of use |
| US7001792B2 (en) | 2000-04-24 | 2006-02-21 | Eagle Research & Development, Llc | Ultra-fast nucleic acid sequencing device and a method for making and using the same |
| AU2002239284A1 (en) | 2000-11-27 | 2002-06-03 | The Regents Of The University Of California | Methods and devices for characterizing duplex nucleic acid molecules |
| US6863833B1 (en) | 2001-06-29 | 2005-03-08 | The Board Of Trustees Of The Leland Stanford Junior University | Microfabricated apertures for supporting bilayer lipid membranes |
| AU2003245272A1 (en) | 2002-05-10 | 2003-11-11 | The Texas A And M University System | Stochastic sensing through covalent interactions |
| EP2194123B1 (en) | 2003-03-25 | 2012-08-22 | Stratagene California | DNA polymerase fusions and uses thereof |
| US7163658B2 (en) | 2003-04-23 | 2007-01-16 | Rouvain Bension | Rapid sequencing of polymers |
| JP2005253427A (ja) | 2004-03-15 | 2005-09-22 | Aisin Seiki Co Ltd | 核酸検出方法及び核酸単離方法 |
| WO2006028508A2 (en) | 2004-03-23 | 2006-03-16 | President And Fellows Of Harvard College | Methods and apparatus for characterizing polynucleotides |
| US20060105461A1 (en) | 2004-10-22 | 2006-05-18 | May Tom-Moy | Nanopore analysis system |
| US7867716B2 (en) | 2004-12-21 | 2011-01-11 | The Texas A&M University System | High temperature ion channels and pores |
| KR100730350B1 (ko) | 2005-10-17 | 2007-06-19 | 삼성전자주식회사 | 표면처리된 나노포어를 이용한 dna 검출방법 및검출장치 |
| GB0523282D0 (en) | 2005-11-15 | 2005-12-21 | Isis Innovation | Methods using pores |
| AU2006331512B2 (en) | 2005-12-22 | 2012-02-23 | Pacific Biosciences Of California, Inc. | Active surface coupled polymerases |
| US7638034B2 (en) | 2006-09-21 | 2009-12-29 | Los Alamos National Security, Llc | Electrochemical detection of single molecules using abiotic nanopores having electrically tunable dimensions |
| AU2008236694B2 (en) | 2007-04-04 | 2014-01-23 | The Regents Of The University Of California | Compositions, devices, systems, and methods for using a nanopore |
| GB0716264D0 (en) | 2007-08-21 | 2007-09-26 | Isis Innovation | Bilayers |
| WO2009035647A1 (en) | 2007-09-12 | 2009-03-19 | President And Fellows Of Harvard College | High-resolution molecular graphene sensor comprising an aperture in the graphene layer |
| GB2453377A (en) | 2007-10-05 | 2009-04-08 | Isis Innovation | Transmembrane protein pores and molecular adapters therefore. |
| US8231969B2 (en) | 2008-03-26 | 2012-07-31 | University Of Utah Research Foundation | Asymmetrically functionalized nanoparticles |
| CN102084001B (zh) | 2008-03-28 | 2015-03-18 | 加利福尼亚太平洋生物科学股份有限公司 | 用于核酸测序的组合物和方法 |
| EP2293921A4 (en) | 2008-05-22 | 2013-05-22 | Univ California | MEMBRANE PROBLEMS AND MEMBRANES MADE FROM THESE |
| US8652771B2 (en) | 2008-05-28 | 2014-02-18 | University of Souther California | Measurement of succinate in urine samples as a biomarker of kidney damage in diabetic subjects |
| EP3029467B1 (en) | 2008-09-22 | 2020-01-08 | University of Washington | Msp nanopores and related methods |
| US9080211B2 (en) | 2008-10-24 | 2015-07-14 | Epicentre Technologies Corporation | Transposon end compositions and methods for modifying nucleic acids |
| GB0820927D0 (en) | 2008-11-14 | 2008-12-24 | Isis Innovation | Method |
| US20100148126A1 (en) | 2008-11-26 | 2010-06-17 | Board Of Regents, The University Of Texas System | Genomic sequencing using modified protein pores and ionic liquids |
| JP5843614B2 (ja) | 2009-01-30 | 2016-01-13 | オックスフォード ナノポア テクノロジーズ リミテッド | 膜貫通配列決定における核酸構築物のためのアダプター |
| GB0905140D0 (en) | 2009-03-25 | 2009-05-06 | Isis Innovation | Method |
| CA2790672C (en) | 2010-02-23 | 2018-05-29 | University Of Washington | Artificial mycolic acid membranes |
| US9073990B2 (en) * | 2010-04-05 | 2015-07-07 | Bar-Llan University | Protease-activatable pore-forming polypeptides |
| CN103370617B (zh) | 2010-10-01 | 2015-11-25 | 牛津纳米孔技术有限公司 | 生物化学分析设备和旋转阀 |
| CN102116783B (zh) | 2010-12-31 | 2013-05-29 | 北京普源精电科技有限公司 | 一种波形显示方法 |
| KR101939420B1 (ko) | 2011-02-11 | 2019-01-16 | 옥스포드 나노포어 테크놀로지즈 리미티드 | 돌연변이체 세공 |
| AU2012264497B2 (en) | 2011-05-27 | 2017-06-15 | Oxford Nanopore Technologies Limited | Coupling method |
| US9580480B2 (en) | 2011-05-31 | 2017-02-28 | Massachusetts Institute Of Technology | Cell-directed synthesis of multifunctional nanopatterns and nanomaterials |
| EP3415901A1 (en) | 2012-01-20 | 2018-12-19 | Genia Technologies, Inc. | Nanopore based molecular detection and sequencing |
| AU2013220156B2 (en) | 2012-02-15 | 2018-08-09 | Oxford Nanopore Technologies Limited | Aptamer method |
| CN112646019B (zh) | 2012-04-10 | 2022-08-16 | 牛津纳米孔科技公开有限公司 | 突变胞溶素孔 |
| TWI655213B (zh) | 2012-07-13 | 2019-04-01 | 目立康股份有限公司 | 自我組織化肽衍生物的製造方法 |
| EP2875154B1 (en) | 2012-07-19 | 2017-08-23 | Oxford Nanopore Technologies Limited | SSB method for characterising a nucleic acid |
| US9797009B2 (en) | 2012-07-19 | 2017-10-24 | Oxford Nanopore Technologies Limited | Enzyme construct |
| AU2013291763B2 (en) | 2012-07-19 | 2019-06-20 | Oxford Nanopore Technologies Limited | Modified helicases |
| GB201313121D0 (en) | 2013-07-23 | 2013-09-04 | Oxford Nanopore Tech Ltd | Array of volumes of polar medium |
| US9823235B2 (en) | 2012-10-26 | 2017-11-21 | Oxford Nanopre Technologies Ltd. | Droplet interfaces |
| WO2014122654A2 (en) | 2013-02-07 | 2014-08-14 | Yissum Research Development Company Of The Hebrew University Of Jerusalem Ltd. | Hybrid nanopores and uses thereof for detection of analytes |
| GB201314695D0 (en) | 2013-08-16 | 2013-10-02 | Oxford Nanopore Tech Ltd | Method |
| AU2014224432B2 (en) | 2013-03-08 | 2019-10-24 | Oxford Nanopore Technologies Limited | Enzyme stalling method |
| WO2014153047A1 (en) | 2013-03-14 | 2014-09-25 | The Trustees Of Boston University | Optoelectronic control of solid-state nanopores |
| GB201406151D0 (en) | 2014-04-04 | 2014-05-21 | Oxford Nanopore Tech Ltd | Method |
| EP3097210B2 (en) | 2014-01-22 | 2022-04-20 | Oxford Nanopore Technologies Limited | Method for attaching one or more polynucleotide binding proteins to a target polynucleotide |
| GB201406155D0 (en) | 2014-04-04 | 2014-05-21 | Oxford Nanopore Tech Ltd | Method |
| GB201403096D0 (en) | 2014-02-21 | 2014-04-09 | Oxford Nanopore Tech Ltd | Sample preparation method |
| EP3126515B1 (en) | 2014-04-04 | 2018-08-29 | Oxford Nanopore Technologies Limited | Method for characterising a double stranded nucleic acid using a nano-pore and anchor molecules at both ends of said nucleic acid |
| FR3023394B1 (fr) | 2014-07-02 | 2017-12-29 | Adn Access Data Networks | Dispositif permettant de faciliter l'enseignement de la langue amharique et d'en normaliser l'ecriture |
| US10400014B2 (en) | 2014-09-01 | 2019-09-03 | Oxford Nanopore Technologies Ltd. | Mutant CsgG pores |
| US10266885B2 (en) | 2014-10-07 | 2019-04-23 | Oxford Nanopore Technologies Ltd. | Mutant pores |
| GB201502810D0 (en) | 2015-02-19 | 2015-04-08 | Oxford Nanopore Tech Ltd | Method |
| GB201502809D0 (en) | 2015-02-19 | 2015-04-08 | Oxford Nanopore Tech Ltd | Mutant pore |
| KR102222192B1 (ko) | 2016-03-02 | 2021-03-02 | 옥스포드 나노포어 테크놀로지즈 리미티드 | 돌연변이체 기공 |
-
2016
- 2016-12-08 AU AU2016369071A patent/AU2016369071B2/en active Active
- 2016-12-08 EP EP16838062.4A patent/EP3387432B1/en active Active
- 2016-12-08 KR KR1020187019163A patent/KR102837999B1/ko active Active
- 2016-12-08 JP JP2018530754A patent/JP7237586B2/ja active Active
- 2016-12-08 WO PCT/IB2016/001841 patent/WO2017098322A1/en not_active Ceased
- 2016-12-08 CA CA3011830A patent/CA3011830C/en active Active
- 2016-12-08 CN CN201680081416.8A patent/CN109072295B/zh active Active
- 2016-12-08 US US16/060,762 patent/US10976300B2/en active Active
-
2021
- 2021-12-08 JP JP2021198939A patent/JP2022046503A/ja active Pending
Patent Citations (22)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2000028312A1 (en) | 1998-11-06 | 2000-05-18 | The Regents Of The University Of California | A miniature support for thin films containing single channels or nanopores and methods for using same |
| WO2005124888A1 (en) | 2004-06-08 | 2005-12-29 | President And Fellows Of Harvard College | Suspended carbon nanotube field effect transistor |
| WO2006100484A2 (en) | 2005-03-23 | 2006-09-28 | Isis Innovation Limited | Deliver of molecules to a li id bila |
| WO2008102120A1 (en) | 2007-02-20 | 2008-08-28 | Oxford Nanopore Technologies Limited | Lipid bilayer sensor system |
| WO2008102121A1 (en) | 2007-02-20 | 2008-08-28 | Oxford Nanopore Technologies Limited | Formation of lipid bilayers |
| WO2009077734A2 (en) | 2007-12-19 | 2009-06-25 | Oxford Nanopore Technologies Limited | Formation of layers of amphiphilic molecules |
| EP2682460A1 (en) | 2008-07-07 | 2014-01-08 | Oxford Nanopore Technologies Limited | Enzyme-pore constructs |
| WO2010004265A1 (en) | 2008-07-07 | 2010-01-14 | Oxford Nanopore Technologies Limited | Enzyme-pore constructs |
| WO2010004273A1 (en) | 2008-07-07 | 2010-01-14 | Oxford Nanopore Technologies Limited | Base-detecting pore |
| WO2010086603A1 (en) | 2009-01-30 | 2010-08-05 | Oxford Nanopore Technologies Limited | Enzyme mutant |
| WO2010122293A1 (en) | 2009-04-20 | 2010-10-28 | Oxford Nanopore Technologies Limited | Lipid bilayer sensor array |
| WO2011067559A1 (en) | 2009-12-01 | 2011-06-09 | Oxford Nanopore Technologies Limited | Biochemical analysis instrument |
| WO2013014451A1 (en) | 2011-07-25 | 2013-01-31 | Oxford Nanopore Technologies Limited | Hairpin loop method for double strand polynucleotide sequencing using transmembrane pores |
| WO2013041878A1 (en) | 2011-09-23 | 2013-03-28 | Oxford Nanopore Technologies Limited | Analysis of a polymer comprising polymer units |
| WO2013057495A2 (en) | 2011-10-21 | 2013-04-25 | Oxford Nanopore Technologies Limited | Enzyme method |
| WO2013098561A1 (en) | 2011-12-29 | 2013-07-04 | Oxford Nanopore Technologies Limited | Method for characterising a polynucelotide by using a xpd helicase |
| WO2013098562A2 (en) | 2011-12-29 | 2013-07-04 | Oxford Nanopore Technologies Limited | Enzyme method |
| WO2014153625A1 (en) | 2013-03-25 | 2014-10-02 | Katholieke Universiteit Leuven | Nanopore biosensors for detection of proteins and nucleic acids |
| WO2015051378A1 (en) * | 2013-10-04 | 2015-04-09 | University Of Washington Through Its Center For Commercialization | Systems and methods for nanopore-based analysis of nucleic acids |
| WO2015055981A2 (en) | 2013-10-18 | 2015-04-23 | Oxford Nanopore Technologies Limited | Modified enzymes |
| WO2015166276A1 (en) * | 2014-05-02 | 2015-11-05 | Oxford Nanopore Technologies Limited | Method of improving the movement of a target polynucleotide with respect to a transmembrane pore |
| WO2016166232A1 (en) | 2015-04-14 | 2016-10-20 | Katholieke Universiteit Leuven | Nanopores with internal protein adaptors |
Non-Patent Citations (35)
| Title |
|---|
| ALTSCHUL S. F., J MOL EVOL, vol. 36, 1993, pages 290 - 300 |
| ALTSCHUL, S.F ET AL., J MOL BIOL, vol. 215, 1990, pages 403 - 10 |
| BAKER ET AL., PNAS, vol. 98, 2001, pages 10037 - 10041 |
| CHEM BIOL., vol. 4, no. 7, July 1997 (1997-07-01), pages 497 - 505 |
| DEVEREUX ET AL., NUCLEIC ACIDS RESEARCH, vol. 12, 1984, pages 387 - 395 |
| DOLINSKY ET AL., NUCLEIC ACID RES., vol. 35, 2007, pages W522 - W525 |
| DOLINSKY ET AL., NUCLEIC ACIDS RES., vol. 32, 2004, pages W665 - W667 |
| GONZALEZ-PEREZ ET AL., LANGMUIR, vol. 25, 2009, pages 10447 - 10450 |
| GUASCH A ET AL: "Detailed architecture of a DNA translocating machine: the high-resolution structure of the bacteriophage phi29 connector particle", JOURNAL OF MOLECULAR BIOLOGY, ACADEMIC PRESS, UNITED KINGDOM, vol. 315, no. 4, 25 January 2002 (2002-01-25), pages 663 - 676, XP004486231, ISSN: 0022-2836, DOI: 10.1006/JMBI.2001.5278 * |
| HANSEN ET AL., J. CHEM. PHYS., vol. 121, 2004, pages 9111 - 9115 |
| HERON ET AL., J. AM. CHEM. SOC., vol. 131, no. 5, 2009, pages 1652 - 1653 |
| HO ET AL., SCI. ADV., vol. 1, 2015, pages E1500905 |
| HOLDEN ET AL., J AM CHEM SOC., vol. 129, no. 27, 11 July 2007 (2007-07-11), pages 8650 - 5 |
| HUMPHREY ET AL., J. MOL. GRAPHICS, vol. 14, 1996, pages 33 - 38 |
| HUMPHREY ET AL.: "VMD: Visual Molecular Dynamics", J. MOL. GRAPHICS, vol. 14, 1996, pages 33 - 38, XP055140690, DOI: doi:10.1016/0263-7855(96)00018-5 |
| IVANOV AP ET AL., NANO LETT., vol. 11, no. 1, 12 January 2011 (2011-01-12), pages 279 - 85 |
| J.F. ZEMAITIS: "Handbook of aqueous electrolyte thermodynamics: theory and application", 1986 |
| LIEBERMAN KR ET AL., J AM CHEM SOC., vol. 132, no. 50, 2010, pages 17961 - 72 |
| LI-QUN GU, PNAS, 2000 |
| LORENZO FRANCESCHINI ET AL: "A nanopore machine promotes the vectorial transport of DNA across membranes", NATURE COMMUNICATIONS, 1 September 2013 (2013-09-01), London, pages 2415, XP055372337, Retrieved from the Internet <URL:https://www.nature.com/articles/ncomms3415.pdf> [retrieved on 20170512], DOI: 10.1038/ncomms3415 * |
| LUDWIG, MOLECULAR MICROBIOLOGY, 1999 |
| M.A. HOLDEN; H. BAYLEY, J. AM. CHEM. SOC., vol. 127, 2005, pages 6502 - 6503 |
| MAGLIA ET AL., METHODS ENZYMOL., vol. 475, 2010, pages 591 - 623 |
| MIYAZAKI ET AL., METHODS ENZYMOL., vol. 498, 2011, pages 399 - 406 |
| PETR G. MERZLYAK, BIOPHYSICS, 2005 |
| PHILLIPS ET AL., J. COMPUT. CHEM., vol. 26, 2005, pages 1781 - 1802 |
| PHILLIPS ET AL.: "Scalable Molecular Dynamics with NAMD", J. COMPUT. CHEM., vol. 26, 2005, pages 1781 - 1802 |
| PROTEIN SCI., vol. 11, no. 7, July 2002 (2002-07-01), pages 1813 - 24 |
| ROWGHANIAN ET AL., PHYS. REV. E, vol. 87, 2013, pages 042723 |
| SAMBROOK, J.; RUSSELL, D.: "Molecular Cloning: A Laboratory Manual, 3rd ed.", 2001, COLD SPRING HARBOR LABORATORY PRESS |
| SONI GV ET AL., REV SCI INSTRUM., vol. 81, no. 1, January 2010 (2010-01-01), pages 014301 |
| SOSKINE ET AL., J. AM. CHEM. SOC., vol. 135, 2013, pages 13456 - 13463 |
| SOSKINE ET AL.: "Tuning the size and properties of ClyA nanopores assisted by directed evolution", J AM CHEM SOC., vol. 135, 2013, pages 13456 - 13463, XP002727574, DOI: doi:10.1021/ja4053398 |
| STODDART D ET AL., PROC NATL ACAD SCI, vol. 106, no. 19, pages 7702 - 7 |
| WADUGE ET AL., ACS NANO, vol. 9, 2015, pages 7352 - 7359 |
Cited By (11)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2020010589A1 (en) * | 2018-07-12 | 2020-01-16 | Shenzhen Genorivision Technology Co., Ltd. | An apparatus for biopolymer sequencing |
| WO2023026039A1 (en) | 2021-08-23 | 2023-03-02 | Cambridge Enterprise Limited | Nucleic acid detection |
| GB2610380A (en) | 2021-08-23 | 2023-03-08 | Cambridge Entpr Ltd | Nucleic acid detection |
| GB202113935D0 (en) | 2021-09-29 | 2021-11-10 | Cambridge Entpr Ltd | Nucleic acid characterisation |
| WO2023052769A1 (en) | 2021-09-29 | 2023-04-06 | Cambridge Enterprise Limited | Nucleic acid characterisation |
| WO2023118891A1 (en) | 2021-12-23 | 2023-06-29 | Oxford Nanopore Technologies Plc | Method of characterising polypeptides using a nanopore |
| WO2023118892A1 (en) | 2021-12-23 | 2023-06-29 | Oxford Nanopore Technologies Plc | Method |
| WO2024094986A1 (en) | 2022-10-31 | 2024-05-10 | Oxford Nanopore Technologies Plc | Method |
| GB202307486D0 (en) | 2023-05-18 | 2023-07-05 | Oxford Nanopore Tech Plc | Method |
| WO2024236325A1 (en) | 2023-05-18 | 2024-11-21 | Oxford Nanopore Technologies Plc | Method and products for characterizing a polynucleotide using a nanopore |
| WO2025099094A1 (en) | 2023-11-06 | 2025-05-15 | Oxford Nanopore Technologies Plc | Method |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2022046503A (ja) | 2022-03-23 |
| JP2019507583A (ja) | 2019-03-22 |
| CA3011830A1 (en) | 2017-06-15 |
| AU2016369071B2 (en) | 2022-05-19 |
| EP3387432B1 (en) | 2022-09-28 |
| AU2016369071A1 (en) | 2018-06-28 |
| CN109072295A (zh) | 2018-12-21 |
| CN109072295B (zh) | 2022-05-31 |
| US20180364214A1 (en) | 2018-12-20 |
| CA3011830C (en) | 2024-11-12 |
| EP3387432A1 (en) | 2018-10-17 |
| KR102837999B1 (ko) | 2025-07-24 |
| KR20180089499A (ko) | 2018-08-08 |
| US10976300B2 (en) | 2021-04-13 |
| JP7237586B2 (ja) | 2023-03-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10976300B2 (en) | Modified nanopores, compositions comprising the same, and uses thereof | |
| US11739377B2 (en) | Method of improving the movement of a target polynucleotide with respect to a transmembrane pore | |
| EP3259281B1 (en) | Hetero-pores | |
| KR102086182B1 (ko) | 효소 방법 | |
| JP6226869B2 (ja) | 酵素法 | |
| EP3204511B1 (en) | Mutant pores | |
| US20150008126A1 (en) | Methods of enhancing translocation of charged analytes through transmembrane protein pores | |
| EP2715343A1 (en) | Coupling method |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16838062 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3011830 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2018530754 Country of ref document: JP |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2016369071 Country of ref document: AU Date of ref document: 20161208 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20187019163 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020187019163 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2016838062 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2016838062 Country of ref document: EP Effective date: 20180709 |