WO2017053889A2 - Flt3 directed car cells for immunotherapy - Google Patents

Flt3 directed car cells for immunotherapy Download PDF

Info

Publication number
WO2017053889A2
WO2017053889A2 PCT/US2016/053577 US2016053577W WO2017053889A2 WO 2017053889 A2 WO2017053889 A2 WO 2017053889A2 US 2016053577 W US2016053577 W US 2016053577W WO 2017053889 A2 WO2017053889 A2 WO 2017053889A2
Authority
WO
WIPO (PCT)
Prior art keywords
flt3
cell
cells
car
isolated
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2016/053577
Other languages
English (en)
French (fr)
Other versions
WO2017053889A3 (en
Inventor
Steven Devine
Michael Caligiuri
Jianhua Yu
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Precision Immunotherapy Inc
Original Assignee
Precision Immunotherapy Inc
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to AU2016326721A priority Critical patent/AU2016326721C1/en
Application filed by Precision Immunotherapy Inc filed Critical Precision Immunotherapy Inc
Priority to CA2999037A priority patent/CA2999037A1/en
Priority to JP2018534523A priority patent/JP7054924B2/ja
Priority to CN201680065509.1A priority patent/CN109310744A/zh
Priority to KR1020187011302A priority patent/KR20180053744A/ko
Priority to HK19101399.4A priority patent/HK1258921A1/zh
Priority to EP19170050.9A priority patent/EP3569244A1/en
Priority to EP16849810.3A priority patent/EP3352784A4/en
Publication of WO2017053889A2 publication Critical patent/WO2017053889A2/en
Publication of WO2017053889A3 publication Critical patent/WO2017053889A3/en
Priority to US15/811,608 priority patent/US10961312B2/en
Anticipated expiration legal-status Critical
Priority to AU2021201329A priority patent/AU2021201329A1/en
Priority to US17/199,332 priority patent/US20210269534A1/en
Priority to JP2021189789A priority patent/JP2022046461A/ja
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2863Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • A61K35/12Materials from mammals; Compositions comprising non-specified tissues or cells; Compositions comprising non-embryonic stem cells; Genetically modified cells
    • A61K35/14Blood; Artificial blood
    • A61K35/17Lymphocytes; B-cells; T-cells; Natural killer cells; Interferon-activated or cytokine-activated lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/11T-cells, e.g. tumour infiltrating lymphocytes [TIL] or regulatory T [Treg] cells; Lymphokine-activated killer [LAK] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/10Cellular immunotherapy characterised by the cell type used
    • A61K40/15Natural-killer [NK] cells; Natural-killer T [NKT] cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/30Cellular immunotherapy characterised by the recombinant expression of specific molecules in the cells of the immune system
    • A61K40/31Chimeric antigen receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K40/00Cellular immunotherapy
    • A61K40/40Cellular immunotherapy characterised by antigens that are targeted or presented by cells of the immune system
    • A61K40/41Vertebrate antigens
    • A61K40/42Cancer antigens
    • A61K40/4202Receptors, cell surface antigens or cell surface determinants
    • A61K40/421Immunoglobulin superfamily
    • A61K40/4211CD19 or B4
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/70521CD28, CD152
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70578NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N9/00Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
    • C12N9/14Hydrolases (3)
    • C12N9/48Hydrolases (3) acting on peptide bonds (3.4)
    • C12N9/50Proteinases, e.g. Endopeptidases (3.4.21-3.4.25)
    • C12N9/64Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue
    • C12N9/6421Proteinases, e.g. Endopeptidases (3.4.21-3.4.25) derived from animal tissue from mammals
    • C12N9/6472Cysteine endopeptidases (3.4.22)
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5156Animal cells expressing foreign proteins
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/51Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
    • A61K2039/515Animal cells
    • A61K2039/5158Antigen-pulsed cells, e.g. T-cells
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/31Indexing codes associated with cellular immunotherapy of group A61K40/00 characterized by the route of administration
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/38Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the dose, timing or administration schedule
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2239/00Indexing codes associated with cellular immunotherapy of group A61K40/00
    • A61K2239/46Indexing codes associated with cellular immunotherapy of group A61K40/00 characterised by the cancer treated
    • A61K2239/48Blood cells, e.g. leukemia or lymphoma
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K35/00Medicinal preparations containing materials or reaction products thereof with undetermined constitution
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/52Constant or Fc region; Isotype
    • C07K2317/53Hinge
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/565Complementarity determining region [CDR]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/60Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
    • C07K2317/62Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
    • C07K2317/622Single chain antibody (scFv)
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/02Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/33Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/50Fusion polypeptide containing protease site
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/60Fusion polypeptide containing spectroscopic/fluorescent detection, e.g. green fluorescent protein [GFP]
    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N2740/00Reverse transcribing RNA viruses
    • C12N2740/00011Details
    • C12N2740/10011Retroviridae
    • C12N2740/16011Human Immunodeficiency Virus, HIV
    • C12N2740/16041Use of virus, viral particle or viral elements as a vector
    • C12N2740/16043Use of virus, viral particle or viral elements as a vector viral genome or elements thereof as genetic vector

Definitions

  • the present disclosure relates generally to the field of human immunology, specifically immunotherapy.
  • leukemia is comprehensive cancer of early blood-forming cells which initiates from many types of cells including white blood cells.
  • leukemia comprises many categories: acute or chronic; myeloid or lymphatics (2016). Different types of leukemia have different treatments and outlooks.
  • Chemotherapy and allogeneic hematological stem cell transplantation (HSCT) have been applied on leukemia successfully.
  • HSCT is limited by transplant related morbidity and mortality attributed to immune rejection, infection and graft versus host disease (GVHD).
  • GVHD graft versus host disease
  • Chemotherapy will also lead to refractory cancer. Therefore, development of novel and effective therapies is urgently needed.
  • AML Acute myeloid leukemia
  • HSC hematopoietic stem cell
  • HSC hematopoietic stem cell
  • HSCT hematopoietic stem cell transplant
  • CARs chimeric antigen receptors
  • ALL acute lymphoblastic leukemia
  • CLL chronic lymphocytic leukemia
  • hematological malignancies such as multiple myeloma (MM) and AML has proven to be very challenging.
  • CAR chimeric antigen receptor
  • CAR T cells treatment of leukemia patients can result in cytokine storms. Morgan et al. (2010) Mol Ther 18:843-851; Porter et al. (2011) NJEM 365:725-733.
  • CAR natural killer (NK) cells may have a lower risk of inducing cytokine storms, tumor lysis syndrome, as well as graft-versus-host disease (GVHD) in the allogeneic settings in patients, since CAR NK cells lack a clonal expansion.
  • GVHD graft-versus-host disease
  • FMS-like tyrosine kinase 3 is a highly expressed surface protein in leukemia especially in acute myeloid leukemia (AML) whereas it normally maintains in a low level since its mutations cause ligand-independent activation of the receptor and activation of downstream signaling pathways during the development of leukemia.
  • AML acute myeloid leukemia
  • CD19-CAR cannot be used for treatment of AML, as AML cells have no surface expression of CD19.
  • CD33, CD44v6, LeY, and CD123 have been proposed to be AML- associated antigens to be targeted by CAR T cells for AML treatment. See, e.g., Dinndorf et al. (1986) Blood 67(4): 1048-1053; Griffin et al. (1984) Leuk Res. 8(4):521-534; Casucci et al. (2013) Blood. 122(20):3461-3472; Peinert et al. (2010) Gene Therapy 17(5):678-686.
  • CD33 (SIGLEC-3) is expressed on leukemic blasts from 85% to 90% of patients with AML. See, e.g., Dinndorf et al. (1986) and Griffin et al. (1984). However, CD33 is expressed on a subset of T cells and K cells, and broadly expressed on myeloid cells and long-term normal HSCs. See Hernandez-Caselles et al. (2006).
  • CD44v6 which is absent in HSCs, has also been targeted by CAR T cells; however, it has expression on activated T cells, monocytes, and keratinocytes, and infusion of CD44v6 has resulted in monocytopenia. See Casucci et al. (2013). LeY was also targeted by CAR T cells for AML treatment, but clinical data did not show promising results. See, e.g., Peinert et al. (2010) and Ritchie et al. (2013).
  • CD 123 -CAR T cells effectively eradicate AML, but these CAR T cells also cause myeloablation and recent clinical data indicated that they are highly toxic, which may be due to the fact that CD123 is expressed by normal HSCs, various mature immune cells, and even endothelial cells.
  • CAR T cells also cause myeloablation and recent clinical data indicated that they are highly toxic, which may be due to the fact that CD123 is expressed by normal HSCs, various mature immune cells, and even endothelial cells.
  • CAR chimeric antigen receptor
  • a chimeric antigen receptor comprising: (a) an antigen binding domain of a FLT3 antibody; (b) a hinge domain; (c) a transmembrane domain; and (d) an intracellular domain.
  • a chimeric antigen receptor comprising: (a) an antigen binding domain of a FLT3 antibody; (b) a hinge domain; (c) a CD28 transmembrane domain; (d) one or more costimulatory regions selected from a CD28 costimulatory signaling region, a 4-1BB costimulatory signaling region, an ICOS costimulatory signaling region, and an OX40 costimulatory region; and (e) a CD3 zeta signaling domain.
  • CAR chimeric antigen receptor
  • the antigen binding domain of the FLT3 antibody comprises, or alternatively consists essentially thereof, or further comprises a FLT3 heavy chain variable region and a FLT3 light chain variable region.
  • the FLT3 heavy chain variable region comprises, or alternatively consists essentially thereof, or further comprises a CDR region comprising any one of SEQ ID NOs: 21-23, SEQ ID NOs: 29-31, or an equivalent of each thereof.
  • the FLT3 heavy chain variable region comprises, or alternatively consists essentially thereof, or further comprises an amino acid sequence encoded by any one of SEQ ID NO: 19, SEQ ID NO: 27, or an equivalent of each thereof.
  • the FLT3 light chain variable region comprises a CDR region comprising any one of SEQ ID NOs: 24-26, SEQ ID NOs: 32-34, or an equivalent of each thereof .
  • the FLT3 light chain variable region comprises, or alternatively consists essentially thereof, or further comprises an amino acid sequence encoded by any one of SEQ ID NO: 20, SEQ ID NO: 28, or an equivalent of each thereof.
  • the CAR further comprises, or alternatively further consists of, a linker polypeptide located between the FLT3 heavy chain variable region and the FLT3 light chain variable region.
  • the linker is a glycine-serine linker.
  • the linker polypeptide comprises, or alternatively consists essentially thereof, or further comprises the sequence of glycine and serine, e.g., (GGGGS)n, also recited (G4S)n, wherein n is an integer from 1 to 6, such as 1, 2, 3, 4, 5, or 6.
  • the CAR further comprises, or alternatively further consists of, a detectable marker or a purification marker attached to the CAR.
  • Additional aspects of the disclosure relate to an isolated nucleic acid sequence encoding a CAR, as described above, or its complement, or an equivalent of each thereof.
  • the isolated nucleic acid sequence further comprises, or further consists essentially of, or yet further consists of, a polynucleotide promoter sequence located upstream of the polynucleotide encoding the antigen binding domain of the FLT3 antigen binding domain of the FLT3 antibody.
  • the isolated nucleic acid sequence further comprises, or further consists essentially of, or yet further consists of, an inducible caspase ("iCasp") or other "suicide gene” encoding polynucleotide sequence located upstream or downstream of the polynucleotide encoding the antigen binding domain of the FLT3 antigen binding domain of the FLT3 antibody.
  • iCasp inducible caspase
  • other "suicide gene” encoding polynucleotide sequence located upstream or downstream of the polynucleotide encoding the antigen binding domain of the FLT3 antigen binding domain of the FLT3 antibody.
  • the isolated nucleic acid sequence further comprises, or further consists essentially of, or yet further consists of, a 2A peptide (T2A) encoding polynucleotide sequence located upstream or downstream of the polynucleotide encoding the antigen binding domain of the FLT3 antigen binding domain of the FLT3 antibody.
  • T2A 2A peptide
  • the isolated nucleic acid sequence further comprises, or further consists essentially of, or yet further consists of, a signal peptide encoding
  • the isolated nucleic acid further comprises, or alternatively consists essentially thereof, or further comprises a polynucleotide encoding an antibiotic resistance polypeptide operatively coupled to the isolated nucleic acid.
  • aspects of the disclosure relate to a vector comprising one or more of the isolated nucleic acids described above.
  • the vector is a plasmid or a viral vector selected from the group of a retroviral vector, a lentiviral vector, an adenoviral vector, and an adeno-associated viral vector.
  • the isolated nucleic acids and vectors containing them are useful to prepare the CARs as described herein.
  • the isolated cell may be a prokaryotic cell such as a bacteria cell, e.g., an E. coli, or a eukaryotic cell.
  • the isolated eukaryotic cell is selected from an animal cell, a mammalian cell, a bovine cell, a feline cell, a canine cell, a murine cell, an equine cell or a human cell.
  • the isolated cell is an immune cell.
  • the isolated immune cell is a T-cell, a B cell, an NK cell, a dendritic cell, a myeloid cell, or any other immune cell.
  • compositions comprising, or alternatively consisting essentially of, or further comprising of one or more of the above described compositions, e.g., a CAR, an isolated nucleic acid, a cell, or a vector and a carrier.
  • aspects of the disclosure relate to an isolated complex comprising a CAR or a cell comprising the CAR bound to FLT3 or a fragment thereof, and/or a cell expressing FLT3 relevant antigen.
  • the antigen binding domain is expressed on the surface of the cell.
  • the FLT3 relevant antigen is expressed in a cancer/tumor.
  • a non- limiting example of a cancer is acute myeloid leukemia.
  • the cell containing or expressing the FLT3 CAR is an immune cell.
  • the immune cell containing or expressing the FLT3 CAR is an NK cell, a B cell, a T cell, a dendritic cell, a myeloid cell, or any other immune cell.
  • the cells may be genetically or otherwise modified.
  • T cells may comprise T cell receptors (TCRs) that are modified for use as allogenic T cells for patients.
  • Some aspects of the disclosure relate to a method of producing a FLT3 CAR expressing cell, the method comprising, or alternatively consisting essentially thereof, or yet further consisting of transducing an isolated cell with a nucleic acid sequence encoding a CAR as described herein.
  • the method further comprises selecting and isolating the cell expressing the CAR.
  • the cell is a eukaryotic cell such as a mammalian cell, e.g., a human cell such as an immune cell - non-limiting examples include an NK cell, a B cell, a T cell, a dendritic cell, a myeloid cell, or any other immune cell.
  • the cells can be transduced using the viral vectors as described herein or alternatively using technology described in Riet et al. (2013) Meth. Mol. Biol. 969: 187-201 entitled "Nonviral RNA transfection to transiently modify T cell with chimeric antigen receptors for adoptive therapy.”
  • the method of producing a FLT3 CAR expressing cell further comprises, or alternatively consists essentially of, or yet further consists of activating and expanding the population of FLT3 CAR expressing cells.
  • Certain aspects of the present disclosure relate to an isolated, activated population of cells comprising, or alternatively consisting essentially of, or yet further consisting of a FLT3 CAR.
  • the cells are immune cells.
  • the immune cells are one or more of NK cells, B cells, T cells, dendritic cells, myeloid cells, or any other immune cells.
  • aspects of the disclosure relate to a method of inhibiting the growth of a
  • the tumor/cancer expressing FLT3 by contacting the tumor/cancer with an effective amount of the isolated cells or compositions disclosed above.
  • the contacting can be in vitro or in vivo.
  • the method can be used to test personalized therapy against a patient's tumor/cancer or to assay for combination therapies.
  • the contacting is in vivo, the method is useful to inhibit the growth of the tumor/cancer in a subject in need thereof, and the patient receives an effective amount of the cells.
  • the tumor/cancer expressing FLT3
  • tumor/cancer targeted is a cancer affecting the blood and/or bone marrow.
  • the isolated cells are autologous to the subject being treated.
  • the method further comprises, or consists essentially of, or yet further consists of, administering to the subject an effective amount of a cytoreductive therapy, e.g.,
  • the method further comprises the steps of isolating the cells to be administered to the subject, transducing the cells with an effective amount of an isolated nucleic acid encoding a CAR as described herein, culturing the cells to obtain a population of CAR encoding cells, that are optionally expanded and activated and then administering the cells to the patient.
  • kits comprising one or more of the above noted compositions and instructions for their use in the methods as disclosed herein.
  • FIG. 1 is a schematic diagram of a non-limiting exemplary CAR vector construct.
  • FIGS. 2A-2F show flow cytometric analyses of acute myeloid leukemia cell lines for cell surface FLT3 expression; for all graphs, the x-axis represents FLT3 surface expression based on flourescent intensity of a conjugated antibody against FLT3 and the y- axis represents cell count.
  • FIGS. 2A-2D are positive for enhanced FLT3 surface expression; while FIGS. 2E-2F do not demonstrate greater FLT3 expression than the isotype control.
  • FIG. 3 depicts the results of a standard 4 hour chromium release assay for lysis of AML MOLM-13 cells; empty vector controls and CD 19 CAR T-cells did not result in lysis of AML cells, while FLT3 CAR T-cells produced with FLT3-1 (CAR 1) and FLT3 (CAR2) appear to dramatically enhance eradication of AML cells.
  • FIGS. 4A-4C depict the generation of T cells expressing FLT3-CAR
  • FIG. 4A Schematic representation of the FLT3 CAR lentiviral construct.
  • iCasp9 inducible caspase 9
  • T2A a self-cleaving 2A gene
  • SP signal peptide
  • VH variable H chain
  • L linker
  • VL variable L chain
  • MyC MyC gene sequence
  • Hinge Hinge Chain
  • CD28 ⁇ 3 ⁇ , co- stimulatory domains.
  • FIG. 4B Primary T, Primary T-EV, Primary T-FLT3 cells were analyzed by flow cytometry after cells were stained with biotin-labeled goat anti-mouse Fab- specific or IgG control.
  • FIG. 4C Immunoblotting with anti-CD3 ⁇ exhibited the expression of chimeric FLT3 scFv on the surface of primary T and primary T cells transduced either with the FLT3-CAR construct (Primary T-FLT3) or the empty vector construct (EV).
  • FIGS. 5A-5C show that recognition of FLT3 + leukemia cell induces a strong response from FLT3-CAR T cells than from control T cells.
  • FIG. 5A Flow cytometric analysis of FLT3 expression on the surface of leukemia cell lines after cells were stained by anti-FLT3.
  • FIG. 5B Indirect ELISA assay analyzes IFN- ⁇ secretion of primary T, primary T cells transduced either with the FLT3-CAR construct (T-FLT3) or the empty vector construct (T-EV) in the presence of MOLM-13, EOL-1 or U937 or not.
  • FIG. 5C Real-time PCR shows the IFN- ⁇ release of primary T, primary T-EV and primary T-FLT3 in the presence to MOLM-13 and U937. Control means no co-culture with target cells.
  • FIGS. 6A-6B demonstrate that FLT3-CAR T cells enhance the eradication of primary human leukemia cells of patients.
  • FIG. 6A Indirect ELISA assay analyzes IFN- ⁇ and IL-2 secretion of primary T, primary T cells transduced either with the FLT3-CAR construct (T-FLT3) or the empty vector construct (T-EV) after co-culture with PBMCs (peripheral blood mononuclear cells) isolated from patients and normal Control. T-FLT3 induces a strong response in the presence of FLT3+ patient leukemia cells.
  • T-FLT3 induces a strong response in the presence of FLT3+ patient leukemia cells.
  • FIGS. 7A-7B demonstrate that FLT3-CAR T cells suppress in vivo growth leukemia, prolong the survival of leukemia-bearing mice.
  • FIG. 7A Ventral and dorsal bioluminescence imaging of mice bearing leukemia. NSG mice were inoculated with luciferase-expressing leukemia cells via tail vein injection (day 0). On day 9 and 16 after inoculation, mice were tail vein infused once with empty vector-transduced T cell (mock T cell, PCDH vector), FLT3-CAR- transduced primary T cells (T-FLT3, CAR) or PBS.
  • FIG. 7A Ventral and dorsal bioluminescence imaging of mice bearing leukemia. NSG mice were inoculated with luciferase-expressing leukemia cells via tail vein injection (day 0). On day 9 and 16 after inoculation, mice were tail vein infused once with empty vector-transduced T cell (mock T cell, PCDH vector), FLT3-
  • FIGS. 8A-8C depict the generation of a FLT3-CAR and test of its expression on CAR-transduced NK Cells.
  • FIG. 8A Schematic representation of the FLT3 CAR lentiviral construct. iCasp9, inducible caspase 9; T2A, a self-cleaving 2A gene; SP, signal peptide; VH, variable H chain; L, linker; VL, variable L chain.
  • MyC MyC gene sequence; Hinge, Hinge Chain; CD28, CD 3 ⁇ , co-stimulatory domains.
  • NK-92, NK-92-EV, NK-92-FLT3 cells were analyzed by flow cytometry after cells were stained with biotin- labeled goat anti-mouse Fab-specific or IgG control.
  • FIGS. 9A-9D demonstrate that FLT3 -C AR-NK-92 cells recognize and promotes killing FLT3 + leukemia cell lines.
  • FIG. 9A Flow cytometric analysis of FLT3 expression on the surface of leukemia cell lines.
  • FIG. 9B Cytotoxic activity of empty vector (EV)- transduced or FLT3 -CAR-transduced NK-92 cells against MOLM-13, EOL-1 or U937 cells using a chromium-51 release assay.
  • ELISA assay analyzes IFN- ⁇ secretion of NK- 92, NK-92 cells transduced either with the FLT3-CAR construct (NK-92-FLT3 -CAR) or the empty vector construct (EV) in the presence of MOLM-13, EOL-1 or U937 or not.
  • FIG. 9D Q-PCR shows the IFN- ⁇ release of NK-92, NK92-EV and NK92-FLT3 in the presence of MOLM-13, U937 and control.
  • FIGS. lOA-lOC show that FLT3-C AR-NK-92 cells enhance killing of primary human leukemia cells of patients.
  • FIG. 10A Cytotoxic activity of empty vector (EV)- transduced or FLT3 -CAR-transduced NK-92 cells against leukemia cells of patients using a chromium-51 release assay.
  • FIG. 10B ELISA assay analyzes IFN- ⁇ secretion of NK-92, NK-92 cells transduced either with the FLT3-CAR construct (NK-92-FLT3 -CAR) or the empty vector construct (EV) in the patient leukemia cells or PBMC of normal Control.
  • FIG. IOC Q-PCR shows the IFN- ⁇ release of NK-92, NK92-EV and NK92-FLT3 in the presence of patient leukemia cells and control.
  • FIGS. 11A-11B demonstrate that primary NK transduced with FLT3-CAR can effectively enhance killing leukemia cell line and tumor cells of patients.
  • FIG. 11 A Primary NK-FLT3 CAR cells kill FLT3 + leukemia cell line MOLM13 in vitro.
  • FIG. 11B Primary NK-FLT3 CAR cells kill tumor cells of patients.
  • FIGS. 12A-12D show that API 903 (drug) can effectively induces the apoptosis of NK92-FLT3 with iCasp9.
  • FIG. 12A iCasp9 expresses in NK-92-FLT3- transduced cells.
  • API 903 treatment induces cell death of NK-92-FLT3 after 48 hours of induction.
  • FIG. 12C Flow cytometry Annexin V analysis displays significant apoptosis of NK92- FLT3 after API 903 treatment.
  • FIG. 12D Immunoblotting assay shows an increase of cleaved caspase-3 ofNK-92-FLT3 after AP1903 (Drug) treatment.
  • FIG. 13 demonstrates that NK-92-FLT3 -CAR cells suppress in vivo growth leukemia, prolong the survival of leukemia-bearing mice.
  • Brain bioluminescence imaging of mice bearing leukemia NSG mice were inoculated with luciferase-expressing leukemia cells via tail vein injection (day 0). Seven days after inoculation, mice were tail vein infused once with empty vector-transduced NK-92 cells (NK-92-EV), FLT3-CAR- transduced NK-92 cells (NK-92-FLT3) or NK-92 cells.
  • FIG. 14 shows flow cytometric analysis of FLT3 expression on the surface of AML cells iaolated from patients.
  • a cell includes a plurality of cells, including mixtures thereof.
  • animal refers to living multi-cellular vertebrate organisms, a category that includes, for example, mammals and birds.
  • mammal includes both human and non-human mammals.
  • subject refers to human and veterinary subjects, for example, humans, animals, non-human primates, dogs, cats, sheep, mice, horses, and cows. In some embodiments, the subject is a human.
  • antibody collectively refers to immunoglobulins or immunoglobulin-like molecules including by way of example and without limitation, IgA, IgD, IgE, IgG and IgM, combinations thereof, and similar molecules produced during an immune response in any vertebrate, for example, in mammals such as humans, goats, rabbits and mice, as well as non-mammalian species, such as shark immunoglobulins.
  • the term “antibody” includes intact immunoglobulins and "antibody fragments” or "antigen binding fragments” that specifically bind to a molecule of interest (or a group of highly similar molecules of interest) to the substantial exclusion of binding to other molecules (for example, antibodies and antibody fragments that have a binding constant for the molecule of interest that is at least 10 3 M "1 greater, at least 10 4 ⁇ _1 greater or at least 10 5 M "1 greater than a binding constant for other molecules in a biological sample).
  • the term “antibody” also includes genetically engineered forms such as chimeric antibodies (for example, murine or humanized non-primate antibodies), heteroconjugate antibodies (such as, bispecific antibodies).
  • the term "monoclonal antibody” refers to an antibody produced by a single clone of B -lymphocytes or by a cell into which the light and heavy chain genes of a single antibody have been transfected.
  • Monoclonal antibodies are produced by methods known to those of skill in the art, for instance by making hybrid antibody-forming cells from a fusion of myeloma cells with immune spleen cells.
  • Monoclonal antibodies include humanized monoclonal antibodies.
  • an immunoglobulin has heavy (H) chains and light (L) chains interconnected by disulfide bonds.
  • Each heavy and light chain contains a constant region and a variable region, (the regions are also known as "domains").
  • the heavy and the light chain variable regions specifically bind the antigen.
  • Light and heavy chain variable regions contain a "framework" region interrupted by three hypervariable regions, also called “complementarity-determining regions" or "CDRs".
  • framework region and CDRs have been defined ⁇ see, Kabat et al., Sequences of Proteins of Immunological Interest, U.S. Department of Health and Human Services, 1991, which is hereby incorporated by reference).
  • the Kabat database is now maintained online.
  • the sequences of the framework regions of different light or heavy chains are relatively conserved within a species.
  • the framework region of an antibody that is the combined framework regions of the constituent light and heavy chains, largely adopts a ⁇ - sheet conformation and the CDRs form loops which connect, and in some cases form part of, the ⁇ -sheet structure.
  • framework regions act to form a scaffold that provides for positioning the CDRs in correct orientation by inter-chain, non-covalent interactions.
  • the CDRs are primarily responsible for binding to an epitope of an antigen.
  • CDRs of each chain are typically referred to as CDR1, CDR2, and CDR3, numbered sequentially starting from the N-terminus, and are also typically identified by the chain in which the particular CDR is located (heavy chain regions labeled CDHR and light chain regions labeled CDLR).
  • CDHR3 is the CDR3 from the variable domain of the heavy chain of the antibody in which it is found
  • CDLR1 is the CDR1 from the variable domain of the light chain of the antibody in which it is found.
  • a FLT3 antibody will have a specific V H region and the V L region sequence unique to the FLT3 relevant antigen, and thus specific CDR sequences.
  • Antibodies with different specificities have different CDRs. Although it is the CDRs that vary from antibody to antibody, only a limited number of amino acid positions within the CDRs are directly involved in antigen binding. These positions within the CDRs are called specificity determining residues (SDRs).
  • SDRs specificity determining residues
  • antigen refers to a compound, composition, or substance that may be specifically bound by the products of specific humoral or cellular immunity, such as an antibody molecule or T-cell receptor.
  • Antigens can be any type of molecule including, for example, haptens, simple intermediary metabolites, sugars (e.g., oligosaccharides), lipids, and hormones as well as macromolecules such as complex carbohydrates (e.g.,
  • antigens include, but are not limited to, viral antigens, bacterial antigens, fungal antigens, protozoa and other parasitic antigens, tumor antigens, antigens involved in autoimmune disease, allergy and graft rejection, toxins, and other miscellaneous antigens.
  • antigen binding domain refers to any protein or polypeptide domain that can specifically bind to an antigen target.
  • autologous in reference to cells refers to cells that are isolated and infused back into the same subject (recipient or host).
  • Allogeneic refers to non-autologous cells.
  • B cell refers to a type of lymphocyte in the humoral immunity of the adaptive immune system. B cells principally function to make antibodies, serve as antigen presenting cells, release cytokines, and develop memory B cells after activation by antigen interaction. B cells are distinguished from other lymphocytes, such as T cells, by the presence of a B-cell receptor on the cell surface. B cells may either be isolated or obtained from a commercially available source.
  • Non-limiting examples of commercially available B cell lines include lines AHH-1 (ATCC® CRL-8146TM), BC-1 (ATCC® CRL- 2230TM), BC-2 (ATCC® CRL-2231TM), BC-3 (ATCC® CRL-2277TM), CA46 (ATCC® CRL-1648TM), DG-75 [D.G.-75] (ATCC® CRL-2625TM), DS-1 (ATCC® CRL-11102TM), EB-3 [EB3] (ATCC® CCL-85TM), Z-138 (ATCC #CRL-3001), DB (ATCC CRL-2289), Toledo (ATCC CRL-2631), Pfiffer (ATCC CRL-2632), SR (ATCC CRL-2262), JM-1 (ATCC CRL-10421), FS-5 C-l (ATCC CRL-1693); NFS-70 CIO (ATCC CRL-1694), FS-25 C-3 (ATCC CRL-1695), AND SUP-B15 (ATCC CRL-1929).
  • AHH-1
  • Further examples include but are not limited to cell lines deived from anaplastic and large cell lymphomas, e.g., DEL, DL-40, FE-PD, JB6, Karpas 299, Ki-JK, Mac-2A Plyl, SR-786, SU-DHL-1, -2, -4,-5,- 6,-7,-8,-9,-10, and -16, DOHH-2, NU-DHL-1, U-937, Granda 519, USC-DHL-1, RL;
  • cell lines deived from anaplastic and large cell lymphomas e.g., DEL, DL-40, FE-PD, JB6, Karpas 299, Ki-JK, Mac-2A Plyl, SR-786, SU-DHL-1, -2, -4,-5,- 6,-7,-8,-9,-10, and -16, DOHH-2, NU-DHL-1, U-937, Granda 519, USC-DHL-1, RL;
  • Hodgkin's lymphomas e.g., DEV, HD-70, HDLM-2, HD-MyZ, HKB-1, KM-H2, L 428, L 540, LI 236, SBH-1, SUP-HD1, SU/RH-HD-1.
  • Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (www.atcc.org/) and the German Collection of Microorganisms and Cell Cultures
  • a "cancer” is a disease state characterized by the presence in a subject of cells demonstrating abnormal uncontrolled replication.
  • the cancer is a leukemia.
  • the cancer is acute myeloid leukemia.
  • a "leukemia” is a cancer of the blood or bone marrow characterized by an abnormal increase of immature white blood cells.
  • the specific condition of acute myeloid leukemia (AML) - also referred to as acute myelogenous leukemia or acute myeloblastic leukemia - is a cancer of the myeloid origin blood cells, characterized by the rapid growth of abnormal meyloid cells that accumulate in the bone marrow and interfere with the production of normal blood cells.
  • chimeric antigen receptor refers to a fused protein comprising an extracellular domain capable of binding to an antigen, a
  • transmembrane domain derived from a polypeptide different from a polypeptide from which the extracellular domain is derived, and at least one intracellular domain.
  • the "chimeric antigen receptor (CAR)" is sometimes called a “chimeric receptor", a "T-body”, or a
  • chimeric immune receptor CIR
  • the "extracellular domain capable of binding to an antigen” means any oligopeptide or polypeptide that can bind to a certain antigen.
  • the "intracellular domain” or “intracellular signaling domain” means any oligopeptide or polypeptide known to function as a domain that transmits a signal to cause activation or inhibition of a biological process in a cell.
  • the intracellular domain may comprise, alternatively consist essentially of, or yet further comprise one or more costimulatory signaling domains in addition to the primary signaling domain.
  • transmembrane domain means any oligopeptide or polypeptide known to span the cell membrane and that can function to link the extracellular and signaling domains.
  • a chimeric antigen receptor may optionally comprise a "hinge domain” which serves as a linker between the extracellular and transmembrane domains.
  • Non-limiting exemplary polynucleotide sequences that encode for components of each domain are disclosed herein, e.g.:
  • Hinge domain IgGl heavy chain hinge sequence, SEQ. ID NO: 1 :
  • Transmembrane domain CD28 transmembran region SEQ. ID NO: 2 :
  • Intracellular domain 4-1BB co-stimulatory signaling region, SEQ. ID NO: 3 :
  • Intracellular domain CD28 co-stimulatory signaling region, SEQ. ID NO: 4 :
  • Intracellular domain CD3 zeta signaling region, SEQ. ID NO: 5 :
  • each exemplary domain component includes other proteins that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the proteins encoded by the above disclosed nucleic acid sequences. Further, non limiting examples of such domains are provided herein.
  • CD8 a hinge domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD8 a hinge domain sequence as shown herein.
  • the example sequences of CD8 a hinge domain for human, mouse, and other species are provided in Pinto, R.D. et al. (2006) Vet. Immunol. Immunopathol. 1 10: 169-177.
  • the sequences associated with the CD8 a hinge domain are provided in Pinto, R.D. et al. (2006) Vet. Immunol. Immunopathol. 1 10: 169-177.
  • Non-limiting examples of such include:
  • CD8 a transmembrane domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the CD8 a transmembrane domain sequence as shown herein.
  • the fragment sequences associated with the amino acid positions 183 to 203 of the human T-cell surface glycoprotein CD8 alpha chain (GenBank Accession No: NP OO 1759.3), or the amino acid positions 197 to 217 of the mouse T-cell surface glycoprotein CD8 alpha chain (GenBank Accession No: NP 001074579.1), and the amino acid positions 190 to 210 of the rat T-cell surface glycoprotein CD8 alpha chain(GenBank Accession No: NP_ 1 13726.1) provide additional example sequences of the CD8 a transmembrane domain.
  • the sequences associated with each of the listed accession numbers are provided as follows:
  • Rat CD 8 alpha transmembrane domain SEQ. ID NO: 1 1 : IW APL AGIC AVLLL SL VITLI
  • the term "4- I BB costimulatory signaling region” refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80%> amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the 4- IBB costimulatory signaling region sequence as shown herein.
  • Non- limiting example sequences of the 4- IBB costimulatory signaling region are provided in U.S. Publication 20130266551 Al (filed as U.S. App. No. 13/826,258), such as the exemplary sequence provided below and the sequence encoded by SEQ ID NO: 3 :
  • SEQ ID NO: 12 4-1BB costimulatory signaling region, SEQ ID NO: 12 :
  • ICOS costimulatory signaling region refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with the ICOS costimulatory signaling region sequence as shown herein.
  • Non- limiting example sequences of the ICOS costimulatory signaling region are provided in U.S. Patent Application Publication No. 2015/0017141 Al the exemplary polynucleotide sequence provided below.
  • ICOS costimulatory signaling region SEQ ID NO: 13 :
  • OX40 costimulatory signaling region refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, or duley 90% sequence identity, or alternatively at least 95% sequence identity with the OX40 costimulatory signaling region sequence as shown herein.
  • Non-limiting example sequences of the OX40 costimulatory signaling region are disclosed in U.S. Patent Application Publication No. 2012/20148552A1 , and include the exemplary sequence provided below.
  • CD28 transmembrane domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80%> amino acid sequence identity, at least 90% sequence identity, or alternatively at least 95% sequence identity with the CD28 transmembrane domain sequence as shown herein.
  • fragment sequences associated with the GenBank Accession Nos: XM_006712862.2 and XM_009444056.1 provide additional, non-limiting, example sequences of the CD28 transmembrane domain.
  • the sequences associated with each of the listed accession numbers are provided as follows the sequence encoded by SEQ ID NO: 2.
  • CD28 costimulatory signaling region refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, or alternatively 90% sequence identity, or alternatively at least 95% sequence identity with the CD28 costimulatory signaling region sequence shown herein.
  • the example sequences CD28 costimulatory signaling domain are provided in U.S. Patent No. 5,686,281; Geiger, T.L. et al. (2001) Blood 98: 2364-2371; Hombach, A. et al. (2001) J Immunol 167: 6123-6131; Maher, J. et al.
  • Non- limiting examples include residues 114-220 of the below and the sequence encoded by SEQ ID NO: 4:
  • CD28 Sequence MLRLLLALNL FPSIQVTGNK ILVKQSPMLV AYDNAVNLSC
  • CD3 zeta signaling domain refers to a specific protein fragment associated with this name and any other molecules that have analogous biological function that share at least 70%, or alternatively at least 80% amino acid sequence identity, or alternatively 90% sequence identity, or alternatively at least 95% sequence identity with the CD3 zeta signaling domain sequence as shown herein.
  • Non-limiting example sequences of the CD3 zeta signaling domain are provided in U.S. Application No. 13/826,258, e.g. :
  • RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRK NPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDAL HMQALPPR SEQ ID NO: 16
  • SEQ ID NO: 5 the sequence encoded by SEQ ID NO: 5.
  • a "composition” typically intends a combination of the active agent, e.g., compound or composition, and a naturally-occurring or non-naturally-occurring carrier, inert (for example, a detectable agent or label) or active, such as an adjuvant, diluent, binder, stabilizer, buffers, salts, lipophilic solvents, preservative, adjuvant or the like and include
  • Carriers also include pharmaceutical excipients and additives proteins, peptides, amino acids, lipids, and carbohydrates (e.g., sugars, including monosaccharides, di-, tri-, tetra-oligosaccharides, and oligosaccharides; derivatized sugars such as alditols, aldonic acids, esterified sugars and the like; and polysaccharides or sugar polymers), which can be present singly or in combination, comprising alone or in
  • Exemplary protein excipients include serum albumin such as human serum albumin (HSA), recombinant human albumin (rHA), gelatin, casein, and the like.
  • Representative amino acid/antibody components which can also function in a buffering capacity, include alanine, arginine, glycine, arginine, betaine, histidine, glutamic acid, aspartic acid, cysteine, lysine, leucine, isoleucine, valine, methionine, phenylalanine, aspartame, and the like.
  • Carbohydrate excipients are also intended within the scope of this technology, examples of which include but are not limited to monosaccharides such as fructose, maltose, galactose, glucose, D-mannose, sorbose, and the like; disaccharides, such as lactose, sucrose, trehalose, cellobiose, and the like;
  • polysaccharides such as raffinose, melezitose, maltodextrins, dextrans, starches, and the like
  • alditols such as mannitol, xylitol, maltitol, lactitol, xylitol sorbitol (glucitol) and myoinositol.
  • compositions and methods include the recited elements, but do not exclude others.
  • Consisting essentially of when used to define compositions and methods shall mean excluding other elements of any essential significance to the combination for the intended use.
  • a composition consisting essentially of the elements as defined herein would not exclude trace contaminants from the isolation and purification method and pharmaceutically acceptable carriers, such as phosphate buffered saline, preservatives and the like.
  • Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps for administering the compositions disclosed herein. Aspects defined by each of these transition terms are within the scope of the present disclosure.
  • consensus sequence refers to an amino acid or nucleic acid sequence that is determined by aligning a series of multiple sequences and that defines an idealized sequence that represents the predominant choice of amino acid or base at each corresponding position of the multiple sequences.
  • the consensus sequence for the series can differ from each of the sequences by zero, one, a few, or more substitutions. Also, depending on the sequences of the series of multiple sequences, more than one consensus sequence may be determined for the series. The generation of consensus sequences has been subjected to intensive mathematical analysis. Various software programs can be used to determine a consensus sequence.
  • Cytoreductive therapy includes but is not limited to
  • Chemotherapy drugs that kill cancer cells only when they are dividing are termed cell-cycle specific. These drugs include agents that act in S-phase, including topoisomerase inhibitors and anti-metabolites.
  • Toposiomerase inhibitors are drugs that interfere with the action of topoisomerase enzymes (topoisomerase I and II). During the process of chemo treatments, topoisomerase enzymes control the manipulation of the structure of DNA necessary for replication, and are thus cell cycle specific. Examples of topoisomerase I inhibitors include the camptothecan analogs listed above, irinotecan and topotecan. Examples of topoisomerase II inhibitors include amsacrine, etoposide, etoposide phosphate, and teniposide.
  • Antimetabolites are usually analogs of normal metabolic substrates, often interfering with processes involved in chromosomal replication. They attack cells at very specific phases in the cycle. Antimetabolites include folic acid antagonists, e.g., methotrexate; pyrimidine antagonist, e.g., 5-fluorouracil, foxuridine, cytarabine, capecitabine, and gemcitabine; purine antagonist, e.g., 6-mercaptopurine and 6-thioguanine; adenosine deaminase inhibitor, e.g., cladribine, fludarabine, nelarabine and pentostatin; and the like.
  • folic acid antagonists e.g., methotrexate
  • pyrimidine antagonist e.g., 5-fluorouracil, foxuridine, cytarabine, capecitabine, and gemcitabine
  • purine antagonist e.g., 6-mercaptopurine and 6-thi
  • Plant alkaloids are derived from certain types of plants.
  • the vinca alkaloids are made from the periwinkle plant (Catharanthus rosea).
  • the taxanes are made from the bark of the Pacific Yew tree (taxus).
  • the vinca alkaloids and taxanes are also
  • the podophyllotoxins are derived from the May apple plant. Camptothecan analogs are derived from the Asian "Happy Tree” (Camptotheca acuminata). Podophyllotoxins and camptothecan analogs are also classified as topoisomerase inhibitors.
  • the plant alkaloids are generally cell-cycle specific.
  • Examples of these agents include vinca alkaloids, e.g., vincristine, vinblastine and vinorelbine; taxanes, e.g., paclitaxel and docetaxel; podophyllotoxins, e.g., etoposide and tenisopide; and camptothecan analogs, e.g., irinotecan and topotecan.
  • vinca alkaloids e.g., vincristine, vinblastine and vinorelbine
  • taxanes e.g., paclitaxel and docetaxel
  • podophyllotoxins e.g., etoposide and tenisopide
  • camptothecan analogs e.g., irinotecan and topotecan.
  • Cryotherapy includes, but is not limited to, therapies involving decreasing the temperature, for example, hypothermic therapy.
  • Radiation therapy includes, but is not limited to, exposure to radiation, e.g., ionizing radiation, UV radiation, as known in the art.
  • exemplary dosages include, but are not limited to, a dose of ionizing radiation at a range from at least about 2 Gy to not more than about 10 Gy and/or a dose of ultraviolet radiation at a range from at least about 5 J/m 2 to not more than about 50 J/m 2 , usually about 10 J/m 2 .
  • the term "detectable marker” refers to at least one marker capable of directly or indirectly, producing a detectable signal.
  • a non-exhaustive list of this marker includes enzymes which produce a detectable signal, for example by colorimetry,
  • luminescence such as horseradish peroxidase, alkaline phosphatase, ⁇ - galactosidase, glucose-6-phosphate dehydrogenase, chromophores such as fluorescent, luminescent dyes, groups with electron density detected by electron microscopy or by their electrical property such as conductivity, amperometry, voltammetry, impedance, detectable groups, for example whose molecules are of sufficient size to induce detectable modifications in their physical and/or chemical properties, such detection may be accomplished by optical methods such as diffraction, surface plasmon resonance, surface variation , the contact angle change or physical methods such as atomic force spectroscopy, tunnel effect, or radioactive
  • a detectable marker excludes naturraly fluorescent polynucleotides.
  • an “effective amount” or “efficacious amount” refers to the amount of an agent, or combined amounts of two or more agents, that, when administered for the treatment of a mammal or other subject, is sufficient to effect such treatment for the disease.
  • the “effective amount” will vary depending on the agent(s), the disease and its severity and the age, weight, etc., of the subject to be treated.
  • encode refers to a polynucleotide which is said to "encode” a polypeptide if, in its native state or when manipulated by methods well known to those skilled in the art, can be transcribed and/or translated to produce the mRNA for the polypeptide and/or a fragment thereof.
  • the antisense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.
  • the term “enhancer”, as used herein, denotes sequence elements that augment, improve or ameliorate transcription of a nucleic acid sequence irrespective of its location and orientation in relation to the nucleic acid sequence to be expressed.
  • An enhancer may enhance transcription from a single promoter or simultaneously from more than one promoter. As long as this functionality of improving transcription is retained or substantially retained (e.g., at least 70%, at least 80%, at least 90% or at least 95% of wild- type activity, that is, activity of a full-length sequence), any truncated, mutated or otherwise modified variants of a wild-type enhancer sequence are also within the above definition.
  • the term “equivalent” or “biological equivalent” of an antibody means the ability of the antibody to selectively bind its epitope protein or fragment thereof as measured by ELISA or other suitable methods.
  • Biologically equivalent antibodies include, but are not limited to, those antibodies, peptides, antibody fragments, antibody variant, antibody derivative and antibody mimetics that bind to the same epitope as the reference antibody.
  • an equivalent intends at least about 70% homology or identity, or at least 80 % homology or identity and alternatively, or at least about 85 %, or alternatively at least about 90 %, or alternatively at least about 95 %, or alternatively 98 % percent homology or identity and exhibits substantially equivalent biological activity to the reference protein, polypeptide or nucleic acid.
  • an equivalent thereof is a polynucleotide that hybridizes under stringent conditions to the reference polynucleotide or its complement.
  • a polynucleotide or polynucleotide region (or a polypeptide or polypeptide region) having a certain percentage (for example, 80%, 85%, 90%, or 95%) of "sequence identity" to another sequence means that, when aligned, that percentage of bases (or amino acids) are the same in comparing the two sequences.
  • the alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et al., eds. 1987) Supplement 30, section 7.7.18, Table 7.7.1.
  • default parameters are used for alignment.
  • a preferred alignment program is BLAST, using default parameters.
  • polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins.
  • expression may include splicing of the mRNA in a eukaryotic cell.
  • the expression level of a gene may be determined by measuring the amount of mRNA or protein in a cell or tissue sample.
  • the expression level of a gene from one sample may be directly compared to the expression level of that gene from a control or reference sample.
  • the expression level of a gene from one sample may be directly compared to the expression level of that gene from the same sample following administration of a compound.
  • FKBP FK506 binding protein
  • FKBPs have been identified in many eukaryotes from yeast to humans and function as protein folding chaperones for proteins containing proline residues. Along with cyclophilin, FKBPs belong to the immunophilin family.
  • a non-limiting exemplary FKBP is human FKBP 12 (also referred to as FKBP 1 A), UniProt Ref. No. P62942. Further non-limiting examples of FKBP include those provided by GenBank Accession Nos. AH002818, BC119732.1,
  • first line or second line or third line refers to the order of treatment received by a patient.
  • First line therapy regimens are treatments given first, whereas second or third line therapy are given after the first line therapy or after the second line therapy, respectively.
  • the National Cancer Institute defines first line therapy as "the first treatment for a disease or condition. In patients with cancer, primary treatment can be surgery, chemotherapy, radiation therapy, or a combination of these therapies. First line therapy is also referred to those skilled in the art as "primary therapy and primary treatment.” See National Cancer Institute website at www.cancer.gov, last visited on May 1, 2008.
  • a patient is given a subsequent chemotherapy regimen because the patient did not show a positive clinical or sub-clinical response to the first line therapy or the first line therapy has stopped.
  • FLT3 refers to a receptor-type tyrosine-protein kinase FLT3 associated with this name, any of its alternate names (Fms-Related Tyrosine Kinase, Stem Cell Tyrosine Kinase, Fms-Like Tyrosine Kinase, FL Cytokine Receptor, CD135 Antigen, EC 2.7.10.1, CD135, FLK-2, STK1, FLK2, Growth Factor Receptor Tyrosine Kinase Type III, Receptor-Type Tyrosine-Protein Kinase FLT3, Fetal Liver Kinase 2, Fetal Liver Kinase-2, EC 2.7.10 , FLT-3, STK-1) or UniProt Acession No. P36888 and any other molecules that have analogous biological function that share at least 80% amino acid sequence identity, preferably 90% sequence identity, or alternatively at least 95% sequence identity with FLT3 and any variant or isoform thereof.
  • FLT3-1 refers to an antibody comprising an amino acid sequence with CDRs that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with any one of the CDRs encoded in the heavy and light chain polynuclotide sequences disclosed herein below, preferably at least one of the CDR3 regions, most preferably both of the CDR3 regions, disclosed below.
  • the amino acid sequences of said CDR regions are also disclosed herein below.
  • FLT3-1 CDLR1, SEQ ID NO: 24
  • the term FLT3-2 refers to an antibody comprising an amino acid sequence with CDRs that share at least 70%, or alternatively at least 80% amino acid sequence identity, preferably 90% sequence identity, more preferably at least 95% sequence identity with any one of the CDRs encoded in the heavy and light chain polynuclotide sequences disclosed herein below, preferably at least one of the CDR3 regions, most preferably both of the CDR3 regions, disclosed below.
  • the amino acid sequences of said CDR regions are also disclosed herein below.
  • homology or “identical”, percent “identity” or “similarity”, when used in the context of two or more nucleic acids or polypeptide sequences, refers to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, e.g., at least 60% identity, preferably at least 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region (e.g., nucleotide sequence encoding an antibody described herein or amino acid sequence of an antibody described herein).
  • Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences.
  • the alignment and the percent homology or sequence identity can be determined using software programs known in the art, for example those described in Current Protocols in Molecular Biology (Ausubel et al., eds. 1987) Supplement 30, section 7.7.18, Table 7.7.1.
  • default parameters are used for alignment.
  • a preferred alignment program is BLAST, using default parameters.
  • the terms also include sequences that have deletions and/or additions, as well as those that have substitutions.
  • the preferred algorithms can account for gaps and the like.
  • identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is at least 50-100 amino acids or nucleotides in length.
  • An "unrelated” or “non-homologous” sequence shares less than 40% identity, or alternatively less than 25% identity, with one of the sequences disclosed herein.
  • Hybridization refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues.
  • the hydrogen bonding may occur by Watson-Crick base pairing, Hoogstein binding, or in any other sequence-specific manner.
  • the complex may comprise two strands forming a duplex structure, three or more strands forming a multi- stranded complex, a single self-hybridizing strand, or any combination of these.
  • a hybridization reaction may constitute a step in a more extensive process, such as the initiation of a PCR reaction, or the enzymatic cleavage of a polynucleotide by a ribozyme.
  • Examples of stringent hybridization conditions include: incubation temperatures of about 25°C to about 37°C; hybridization buffer concentrations of about 6x SSC to about lOx SSC; formamide concentrations of about 0% to about 25%; and wash solutions from about 4x SSC to about 8x SSC.
  • Examples of moderate hybridization conditions include: incubation temperatures of about 40°C to about 50°C; buffer concentrations of about 9x SSC to about 2x SSC; formamide concentrations of about 30% to about 50%; and wash solutions of about 5x SSC to about 2x SSC.
  • Examples of high stringency conditions include: incubation temperatures of about 55°C to about 68°C; buffer concentrations of about lx SSC to about O.
  • lx SSC formamide concentrations of about 55% to about 75%
  • wash solutions of about lx SSC, O. lx SSC, or deionized water.
  • hybridization incubation times are from 5 minutes to 24 hours, with 1, 2, or more washing steps, and wash incubation times are about 1, 2, or 15 minutes.
  • SSC is 0.15 M NaCl and 15 mM citrate buffer. It is understood that equivalents of SSC using other buffer systems can be employed.
  • isolated refers to molecules or biologicals or cellular materials being substantially free from other materials.
  • isolated refers to nucleic acid, such as DNA or RNA, or protein or polypeptide (e.g., an antibody or derivative thereof), or cell or cellular organelle, or tissue or organ, separated from other DNAs or RNAs, or proteins or polypeptides, or cells or cellular organelles, or tissues or organs, respectively, that are present in the natural source.
  • isolated also refers to a nucleic acid or peptide that is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized.
  • an "isolated nucleic acid” is meant to include nucleic acid fragments which are not naturally occurring as fragments and would not be found in the natural state.
  • isolated is also used herein to refer to polypeptides which are isolated from other cellular proteins and is meant to encompass both purified and recombinant polypeptides.
  • isolated is also used herein to refer to cells or tissues that are isolated from other cells or tissues and is meant to encompass both cultured and engineered cells or tissues.
  • isolated cell generally refers to a cell that is substantially separated from other cells of a tissue.
  • Immuno cells includes, e.g., white blood cells (leukocytes) which are derived from hematopoietic stem cells (HSC) produced in the bone marrow, lymphocytes (T cells, B cells, natural killer (NK) cells) and myeloid-derived cells (neutrophil, eosinophil, basophil, monocyte, macrophage, dendritic cells).
  • HSC hematopoietic stem cells
  • T cells lymphocytes
  • B cells natural killer cells
  • myeloid-derived cells neurotrophil, eosinophil, basophil, monocyte, macrophage, dendritic cells.
  • linker sequence relates to any amino acid sequence comprising from 1 to 10, or alternatively, 8 amino acids, or alternatively 6 amino acids, or alternatively 5 amino acids that may be repeated from 1 to 10, or alternatively to about 8, or alternatively to about 6, or alternatively about 5, or 4 or alternatively 3, or alternatively 2 times.
  • the linker may comprise up to 15 amino acid residues consisting of a pentapeptide repeated three times.
  • the linker sequence is a (Glycine4Serine)3 flexible polypeptide linker comprising three copies of gly-gly-gly-gly-ser - represented in single letter sequence notation as GGGGS.
  • a "normal cell corresponding to the cancer tissue type” refers to a normal cell from a same tissue type as the cancer tissue.
  • a non-limiting example is a normal leukocyte from a patient
  • NK cell also known as natural killer cell, refers to a type of lymphocyte that originates in the bone marrow and play a critical role in the innate immune system. NK cells provide rapid immune responses against viral-infected cells, tumor cells or other stressed cell, even in the absence of antibodies and major
  • NK cells may either be isolated or obtained from a commercially available source.
  • NK cell lines include lines NK-92 (ATCC® CRL-2407TM), NK-92MI (ATCC® CRL-2408TM). Further examples include but are not limited to NK lines HANKl, KHYG-1, NKL, NK-YS, NOI-90, and YT.
  • Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (http://www.atcc.org/) and the German Collection of Microorganisms and Cell Cultures (https://www.dsmz.de/).
  • operatively linked refers to an association between the regulatory polynucleotide and the polynucleotide sequence to which it is linked such that, when a specific protein binds to the regulatory polynucleotide, the linked polynucleotide is transcribed.
  • the term "overexpress" with respect to a cell, a tissue, or an organ expresses a protein to an amount that is greater than the amount that is produced in a control cell, a control issue, or an organ.
  • a protein that is overexpressed may be endogenous to the host cell or exogenous to the host cell.
  • polynucleotide and “oligonucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides or analogs thereof. Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown.
  • polynucleotides a gene or gene fragment (for example, a probe, primer, EST or SAGE tag), exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, RNAi, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes and primers.
  • a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs.
  • modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide.
  • the sequence of nucleotides can be interrupted by non-nucleotide components.
  • a polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component.
  • the term also refers to both double- and single-stranded molecules. Unless otherwise specified or required, any aspect of this technology that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.
  • nucleic acid sequence and “polynucleotide” are used interchangeably to refer to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides.
  • this term includes, but is not limited to, single-, double-, or multi-stranded DNA or RNA, genomic DNA, cDNA, DNA-RNA hybrids, or a polymer comprising purine and pyrimidine bases or other natural, chemically or biochemically modified, non-natural, or derivatized nucleotide bases.
  • promoter refers to any sequence that regulates the expression of a coding sequence, such as a gene. Promoters may be constitutive, inducible, repressible, or tissue-specific, for example.
  • a "promoter” is a control sequence that is a region of a polynucleotide sequence at which initiation and rate of transcription are controlled. It may contain genetic elements at which regulatory proteins and molecules may bind such as RNA polymerase and other transcription factors.
  • protein protein
  • peptide and “polypeptide” are used interchangeably and in their broadest sense to refer to a compound of two or more subunit amino acids, amino acid analogs or peptidomimetics.
  • the subunits may be linked by peptide bonds.
  • the subunit may be linked by other bonds, e.g., ester, ether, etc.
  • a protein or peptide must contain at least two amino acids and no limitation is placed on the maximum number of amino acids which may comprise a protein's or peptide's sequence.
  • amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and peptidomimetics.
  • a purified nucleic acid, peptide, protein, biological complexes or other active compound is one that is isolated in whole or in part from proteins or other contaminants.
  • substantially purified peptides, proteins, biological complexes, or other active compounds for use within the disclosure comprise more than 80% of all macromolecular species present in a preparation prior to admixture or formulation of the peptide, protein, biological complex or other active compound with a pharmaceutical carrier, excipient, buffer, absorption enhancing agent, stabilizer, preservative, adjuvant or other co-ingredient in a complete pharmaceutical formulation for therapeutic administration. More typically, the peptide, protein, biological complex or other active compound is purified to represent greater than 90%, often greater than 95% of all
  • the purified preparation may be essentially homogeneous, wherein other macromolecular species are not detectable by conventional techniques.
  • purification marker refers to at least one marker useful for purification or identification.
  • a non-exhaustive list of this marker includes His, lacZ, GST, maltose-binding protein, NusA, BCCP, c-myc, CaM, FLAG, GFP, YFP, cherry, thioredoxin, poly(NANP), V5, Snap, HA, chitin-binding protein, Softag 1, Softag 3,
  • Suitable direct or indirect fluorescence marker comprise FLAG, GFP, YFP, RFP, dTomato, cherry, Cy3, Cy 5, Cy 5.5, Cy 7, D P, AMCA, Biotin, Digoxigenin, Tamra, Texas Red, rhodamine, Alexa fluors, FITC, TRITC or any other fluorescent dye or hapten.
  • recombinant protein refers to a polypeptide which is produced by recombinant DNA techniques, wherein generally, DNA encoding the
  • polypeptide is inserted into a suitable expression vector which is in turn used to transform a host cell to produce the heterologous protein.
  • signal peptide refers to a peptide sequence that directs the transport and localization of the protein within a cell, e.g., to a certain cell organelle (such as the endoplasmic reticulum) and/or the cell surface.
  • a signal peptide are disclosed herein, e.g., the peptide encoded by the following nucleic acid sequence:
  • telomere binding affinity means the contact between an antibody and an antigen with a binding affinity of at least 10 ⁇ 6 M.
  • antibodies bind with affinities of at least about 10 "7 M, and preferably 10 "8 M, 10 "9 M, 10 "10 M, 10 "U M, or 10 "12 M.
  • a "solid tumor” is an abnormal mass of tissue that usually does not contain cysts or liquid areas. Solid tumors can be benign or malignant, metastatic or non-metastatic. Different types of solid tumors are named for the type of cells that form them. Examples of solid tumors include sarcomas, carcinomas, and lymphomas.
  • suicide gene is a gene capable of inducing cell apoptosis; non-limiting examples include HSV-TK (Herpes simplex virus thymidine kinase), cytosine deaminase, nitroreductase, carboxylesterase, cytochrome P450 or PNP (Purine nucleoside phosphorylase), truncated EGFR, or inducible caspase ("iCasp"). Suicide genes may function along a variety of pathways, and, in some cases, may be inducible by an inducing agent such as a small molecule.
  • HSV-TK Herpes simplex virus thymidine kinase
  • cytosine deaminase cytosine deaminase
  • nitroreductase carboxylesterase
  • cytochrome P450 or PNP Purine nucleoside phosphorylase
  • iCasp inducible caspase
  • Suicide genes may
  • the iCasp suicide gene comprises portion of a caspase protein operatively linked to a protein optimized to bind to an inducing agent; introduction of the inducing agent into a cell comprising the suicide gene results in the activation of caspase and the subsequent apoptosis of said cell.
  • T2A and 2A peptide are used interchangeably to refer to any 2A peptide or fragment thereof, any 2A-like peptide or fragment thereof, or an artificial peptide comprising the requisite amino acids in a relatively short peptide sequence (on the order of 20 amino acids long depdending on the virus of origin) containing the consensus polypeptide motif D-V/I-E-X-N-P-G-P (SEQ ID NO: 35 ), wherein X referes to any amino acid generally thought to be self-cleaving.
  • T cell refers to a type of lymphocyte that matures in the thymus. T cells play an important role in cell-mediated immunity and are distinguished from other lymphocytes, such as B cells, by the presence of a T-cell receptor on the cell surface. T- cells may either be isolated or obtained from a commercially available source. “T cell” includes all types of immune cells expressing CD3 including T-helper cells (CD4+ cells), cytotoxic T-cells (CD8+ cells), natural killer T-cells, T-regulatory cells (Treg) and gamma- delta T cells.
  • CD4+ cells T-helper cells
  • CD8+ cells cytotoxic T-cells
  • Reg T-regulatory cells
  • gamma- delta T cells gamma- delta T cells.
  • a "cytotoxic cell” includes CD8+ T cells, natural-killer (NK) cells, and neutrophils, which cells are capable of mediating cytotoxicity responses.
  • T-cell lines include lines BCL2 (AAA) Jurkat (ATCC® CRL-2902TM), BCL2 (S70A) Jurkat (ATCC® CRL-2900TM), BCL2 (S87A) Jurkat (ATCC® CRL-2901TM), BCL2 Jurkat (ATCC® CRL-2899TM), Neo Jurkat (ATCC® CRL-2898TM), TALL-104 cytotoxic human T cell line (ATCC # CRL-11386).
  • T-cell lines e.g., such as Deglis, EBT-8, HPB-MLp-W, HUT 78, HUT 102, Karpas 384, Ki 225, My-La, Se-Ax, SKW-3, SMZ-1 and T34; and immature T- cell lines, e.g., ALL-SIL, Bel3, CCRF-CEM, CML-T1, DND-41, DU.528, EU-9, HD- Mar, HPB-ALL, H-SB2, HT-1, JK-Tl, Jurkat, Karpas 45, KE-37, KOPT-Kl, K-Tl, L-KAW, Loucy, MAT, MOLT-1, MOLT 3, MOLT-4, MOLT 13, MOLT- 16, MT-1, MT-ALL, P12/Ichikawa, Peer, PER0117, PER-255, PF-382, PFI-285, RPMI-8402, ST-4, SUP-Tl
  • mature T-cell lines e
  • Null leukemia cell lines including but not limited to REH, NALL-1, KM-3, L92-221, are a another commercially available source of immune cells, as are cell lines derived from other leukemias and lymphomas, such as K562 erythroleukemia, THP-1 monocytic leukemia, U937 lymphoma, HEL erythroleukemia, HL60 leukemia, HMC-1 leukemia, KG-1 leukemia, U266 myeloma.
  • Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (http://www.atcc.org/) and the German Collection of Microorganisms and Cell Cultures (https://www.dsmz.de/).
  • transduce or “transduction” as it is applied to the production of chimeric antigen receptor cells refers to the process whereby a foreign nucleotide sequence is introduced into a cell. In some embodiments, this transduction is done via a vector.
  • treating or “treatment” of a disease in a subject refers to (1) preventing the symptoms or disease from occurring in a subject that is predisposed or does not yet display symptoms of the disease; (2) inhibiting the disease or arresting its
  • beneficial or desired results can include one or more, but are not limited to, alleviation or amelioration of one or more symptoms, diminishment of extent of a condition (including a disease), stabilized (i.e., not worsening) state of a condition (including disease), delay or slowing of condition (including disease), progression, amelioration or palliation of the condition (including disease), states and remission (whether partial or total), whether detectable or undetectable.
  • Treatments containing the disclosed compositions and methods can be first line, second line, third line, fourth line, fifth line therapy and are intended to be used as a sole therapy or in combination with other appropriate therapies.
  • the term "vector” refers to a nucleic acid construct deigned for transfer between different hosts, including but not limited to a plasmid, a virus, a cosmid, a phage, a BAC, a YAC, etc.
  • plasmid vectors may be prepared from commercially available vectors.
  • viral vectors may be produced from baculoviruses, retroviruses, adenoviruses, AAVs, etc. according to techniques known in the art.
  • the viral vector is a lentiviral vector.
  • AML acute myeloid leukemia
  • CAR chimeric antigen receptor iCasp: induced caspase MODES FOR CARRYING OUT THE DISCLOSURE
  • CAR modified T-cells combine the HLA-independent targeting specificity of a monoclonal antibody with the cytolytic activity, proliferation, and homing properties of activated T-cells, but do not respond to checkpoint suppression. Because of their ability to kill antigen expressing targets directly, CAR T-cells are highly toxic to any antigen positive cells or tissues making it a requirement to construct CARs with highly tumor specific antibodies. To date, CAR modified T-cells to human solid tumors have been constructed against the a-folate receptor, mesothelin, and MUC-CD, PSMA, and other targets but most have some off-target expression of antigen in normal tissues. These constructs have not shown the same exceptional results in patients emphasizing the need for additional studies to identify new targets and methods of CAR T-cell construction that can be used against solid tumors.
  • this disclosure provides a chimeric antigen receptor (CAR) comprising a binding domain specific to FLT3, that in some aspects, is the antigen binding domain of a FLT3 antibody and methods and compositions relating to the use and production thereof.
  • CAR chimeric antigen receptor
  • the present disclosure provides chimeric antigen receptors (CAR) that bind to FLT3, the CAR comprising, or consisting essentially of, or consisting of, a cell activation moiety comprising an extracellular, transmembrane, and intracellular domain.
  • the extracellular domain comprises a target-specific binding element otherwise referred to as the antigen binding domain.
  • the intracellular domain or cytoplasmic domain comprises a costimulatory signaling region and a zeta chain portion.
  • the CAR may optionally further comprise a spacer domain of up to 300 amino acids, preferably 10 to 100 amino acids, more preferably 25 to 50 amino acids.
  • the CAR may optionally further comprise a spacer domain of up to 300 amino acids, preferably 10 to 100 amino acids, more preferably 25 to 50 amino acids.
  • the spacer may be 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 amino acids.
  • a spacer domain may comprises, for example, a portion of a human Fc domain, a CH3 domain, or the hinge region of any immunoglobulin, such as IgA, IgD, IgE, IgG, or IgM, or variants thereof.
  • some embodiments may comprise an IgG4 hinge with or without a S228P, L235E, and/or N297Q mutation (according to Kabat numbering).
  • Additional spacers include, but are not limited to, CD4, CD8, and CD28 hinge regions.
  • the present disclosure provides a CAR that comprises, or alternatively consists essentially thereof, or yet further consists of an antigen binding domain specific to FLT3.
  • the antigen binding domain comprises, or alternatively consists essentially thereof, or yet consists of the antigen binding domain of a FLT3 antibody or an antibody that binds FLT3.
  • the antigen binding domain comprises the heavy chain variable region and the light chain variable region of a FLT3 antibody.
  • the heavy chain variable region and light chain variable region of a FLT3 antibody comprises, or alternatively consists essentially thereof, or yet consists of the antigen binding domain the FLT3 antibody.
  • the antigen binding domain comprises, consists, or consists essentially of a fragment of the target-specific antibody (i.e., an anti-FLT3 antibody), for example, an scFv.
  • An scFv region can comprise the variable regions of the heavy (V H ) and light chains (VL) of immunoglobulins, connected with a short linker peptide.
  • the linker peptide may be from 1 to 50 amino acids, for instance, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 amino acids.
  • the linker is glycine rich, although it may also contain serine or threonine.
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by polynucleotide sequence disclosed in SEQ ID NO: 19: CAGGTCCAACTGCAGCAGCCTGGGGCTGAGCTTGTGAAGCCTGGGGCTTCATTGA
  • the heavy chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by polynucleotide sequence disclosed in SEQ ID NO: 27:
  • the heavy chain variable region comprises a CDRH1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with SYWMH (SEQ ID NO: 21), NYGLH (SEQ ID NO: 29), or an equivalent each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the heavy chain variable region comprises a CDRH2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with EIDPSDSYKDYNQKFKD (SEQ ID NO: 22),
  • VIWSGGSTDYNAAFIS SEQ ID NO: 30
  • an additional 50 amino acids or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy -terminus.
  • the heavy chain variable region comprises a CDRH3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with AITTTPFDF (SEQ ID NO: 23),
  • GGIYYANHYYAMDY (SEQ ID NO: 31), or an equivalent each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy -terminus.
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by polynucleotide sequence disclosed in SEQ ID NO: 20:
  • the light chain variable region comprises, or alternatively consists essentially of, or yet further consists of, the polypeptide encoded by polynucleotide sequence disclosed in SEQ ID NO: 28:
  • the light chain variable region comprises a CDRL1 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with RASQSISNNLH (SEQ ID NO: 24),
  • KSSQSLLNSGNQKNYM (SEQ ID NO: 32), or an equivalent each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy -terminus.
  • the light chain variable region comprises a CDRL2 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with YASQSIS (SEQ ID NO: 25), GASTRES (SEQ ID NO: 33), or an equivalent each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the light chain variable region comprises a CDRL3 sequence comprising, or alternatively consisting essentially of, or yet further consisting of, an amino acid sequence beginning with QQSNTWPYT (SEQ ID NO: 26), QNDHSYPLT (SEQ ID NO: 34), or an equivalent each thereof, followed by an additional 50 amino acids, or alternatively about 40 amino acids, or alternatively about 30 amino acids, or alternatively about 20 amino acids, or alternatively about 10 amino acids, or alternatively about 5 amino acids, or alternatively about 4, or 3, or 2 or 1 amino acids at the carboxy-terminus.
  • the antigen binding domain of a FLT3 antibody includes one or more of the following characteristics:
  • the light chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 80% identical to a CDR of a light chain variable domain of any of the disclosed light chain sequences;
  • the heavy chain immunoglobulin variable domain sequence comprises one or more CDRs that are at least 80% identical to a CDR of a heavy chain variable domain of any of the disclosed heavy chain sequences;
  • the light chain immunoglobulin variable domain sequence is at least 80% identical to a light chain variable domain of any of the disclosed light chain sequences;
  • the HC immunoglobulin variable domain sequence is at least 80% identical to a heavy chain variable domain of any of the disclosed light chain sequences;
  • the antibody binds an epitope that overlaps with an epitope bound by any of the disclosed sequences.
  • Additional examples of equivalents include peptide having at least 85% , or alternatively at least 90%, or alternatively at least 95%, or alternatively at least 97% amino acid identity to the peptide or a polypeptide that is encoded by a polynucleotide that hybridizes under conditions of high stringency to the complement of a polynucleotide encoding the antigen binding domain, wherein conditions of high stringency comprises incubation temperatures of about 55°C to about 68°C; buffer concentrations of about lx SSC to about O. lx SSC; formamide concentrations of about 55% to about 75%; and wash solutions of about lx SSC, O. lx SSC, or deionized water.
  • Exemplary antigen binding domains can comprise one or more of the below noted peptides, and in one aspect may comprise the all three CDRs of the noted HC and LC for a particular antigen disclosed in Table 1 and Table 2, respectively.
  • the present disclosure provides the antigen binding domain of an antibody that is at least 80%, or alternatively 85% , or alternatively 90%, or alternatively 95%), or alternatively at least 97%, identical to an FLT3-1.
  • Additional examples of equivalents include polypeptide that is encoded by a polynucleotide that hybridizes under conditions of high stringency to the complement of a polynucleotide encoding the antigen binding domain, wherein conditions of high stringency comprises incubation temperatures of about 55°C to about 68°C; buffer concentrations of about lx SSC to about O. lx SSC;
  • formamide concentrations of about 55% to about 75%; and wash solutions of about lx SSC, O. lx SSC, or deionized water.
  • the HC variable domain sequence comprises a variable domain sequence of FLT3-1 and the LC variable domain sequence comprises a variable domain sequence of FLT3-1.
  • the present disclosure provides the antigen binding domain of an antibody comprising the CDRs of FLT3-1. In one aspect, the present disclosure provides the antigen binding domain of antibody that is at least 85% , or alternatively 80%, or
  • conditions of high stringency comprises incubation temperatures of about 55°C to about 68°C; buffer concentrations of about lx SSC to about O. lx SSC; formamide concentrations of about 55% to about 75%; and wash solutions of about lx SSC, O. lx SSC, or deionized water.
  • the present disclosure provides the antigen binding domain of an antibody that is at least 80%, or alternatively 85% , or alternatively 90%, or alternatively 95%), or alternatively at least 97%, identical to an FLT3-2.
  • Additional examples of equivalents include polypeptide that is encoded by a polynucleotide that hybridizes under conditions of high stringency to the complement of a polynucleotide encoding the antigen binding domain, wherein conditions of high stringency comprises incubation temperatures of about 55°C to about 68°C; buffer concentrations of about lx SSC to about O. lx SSC;
  • formamide concentrations of about 55% to about 75%; and wash solutions of about lx SSC, O. lx SSC, or deionized water.
  • the HC variable domain sequence comprises a variable domain sequence of FLT3-2 and the LC variable domain sequence comprises a variable domain sequence of FLT3-2.
  • the present disclosure provides the antigen binding domain of an antibody comprising the CDRs of FLT3-2. In one aspect, the present disclosure provides the antigen binding domain of antibody that is at least 85% , or alternatively 80%, or
  • conditions of high stringency comprises incubation temperatures of about 55°C to about 68°C; buffer concentrations of about lx SSC to about O. lx SSC; formamide concentrations of about 55% to about 75%; and wash solutions of about lx SSC, O. lx SSC, or deionized water.
  • Transmembrane Domain The transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. Transmembrane regions of particular use in this disclosure may be derived from CD8, CD28, CD3, CD45, CD4, CD5, CDS, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD137, CD 154, TCR.
  • the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine.
  • a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain.
  • a short oligo- or polypeptide linker preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the
  • a glycine-serine doublet provides a particularly suitable linker.
  • Cytoplasmic Domain The cytoplasmic domain or intracellular signaling domain of the CAR is responsible for activation of at least one of the traditional effector functions of an immune cell in which a CAR has been placed.
  • the intracellular signaling domain refers to a portion of a protein which transduces the effector function signal and directs the immune cell to perform its specific function. An entire signaling domain or a truncated portion thereof may be used so long as the truncated portion is sufficient to transduce the effector function signal.
  • Cytoplasmic sequences of the TCR and co-receptors as well as derivatives or variants thereof can function as intracellular signaling domains for use in a CAR.
  • Intracellular signaling domains of particular use in this disclosure may be derived from FcR, TCR, CD3, CDS, CD22, CD79a, CD79b, CD66d.
  • the signaling domain of the CAR can comprise a CD3 ⁇ signaling domain.
  • the intracellular region of a co-stimulatory signaling molecule including but not limited the intracellular domains of the proteins CD27, CD28, 4- IBB (CD 137), OX40, CD30, CD40, PD- 1, ICOS, lymphocyte function-associated antigen- 1 (LFA-1 ), CD2, CD7, LIGHT, KG2C, B7-H3, or a ligand that specifically binds with CD83, may also be included in the cytoplasmic domain of the CAR.
  • a CAR may comprise one, two, or more co-stimulatory domains, in addition to a signaling domain (e.g., a CD3 ⁇ signaling domain).
  • the cell activation moiety of the chimeric antigen receptor is a T-cell signaling domain comprising, or alternatively consisting essentially of, or yet further consisting of, one or more proteins or fragments thereof selected from the group consisting of CD 8 protein, CD28 protein, 4-1BB protein, OX40, CD30, CD40, PD-1, ICOS, LFA-1, CD2, CD7, CD27, LIGHT, KG2C, B7-H3, and CD3-zeta protein.
  • the CAR comprises, or alternatively consists essentially thereof, or yet consists of an antigen binding domain of an FLT3 antibody (e.g., an scFv), a hinge domain, a CD28 transmembrane domain, a costimulatory signaling region, and a CD3 zeta signaling domain.
  • the costimulatory signaling region comprises either or both a CD28 costimulatory signaling region and a 4- IBB costimulatory signaling region.
  • the CAR may also comprise a switch mechanism for controlling expression and/or activation of the CAR.
  • a CAR may be comprise, consist, or consist essentially of an extracellular, transmembrane, and intracellular domain, in which the extracellular domain comprises a target-specific binding element that binds a label, binding domain, or tag that is specific for a molecule other than the target antigen that is expressed on or by a target cell.
  • the specificity of the CAR is provided by a second construct that comprises, consists, or consists essentially of a target antigen binding domain (e.g., an anti-FLT3 antibody or fragment thereof or a bispecific antibody that binds FLT3 and the label or tag on the CAR) and a domain that is recognized by or binds to the label, binding domain, or tag on the CAR.
  • a target antigen binding domain e.g., an anti-FLT3 antibody or fragment thereof or a bispecific antibody that binds FLT3 and the label or tag on the CAR
  • a domain that is recognized by or binds to the label, binding domain, or tag on the CAR e.g., WO 2013/044225, WO 2016/000304, WO 2015/057834, WO 2015/057852, WO
  • CARs of the present disclosure may likewise require multimerization in order to active their function (see, e.g., US 2015/0368342, US 2016/0175359, US 2015/0368360) and/or an exogenous signal, such as a small molecule drug (US 2016/0166613, Yung et al., Science, 2015) in order to elicit a T-cell response.
  • the disclosed CARs can comprise a "suicide switch” (also referred to as a "suicide gene”) to induce cell death of the CAR cells following treatment (Buddee et al., PLoS One, 2013) or to downregulate expression of the CAR following binding to the target antigen (WO 2016/011210).
  • a suicide switch also referred to as a "suicide gene” to induce cell death of the CAR cells following treatment (Buddee et al., PLoS One, 2013) or to downregulate expression of the CAR following binding to the target antigen (WO 2016/011210).
  • a non-limiing exemplary suicide switch or suicide gene is iCasp.
  • the CAR can further comprise a detectable marker or purification marker.
  • the CARs as described herein are contained in a composition, e.g., a pharmaceutically acceptable carrier for diagnosis or therapy.
  • Antibodies for use in this disclosure can be purchased or prepared using methods known in the art and briefly described herein. Their manufacture and uses are well known and disclosed in, for example, Greenfield (2014) Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N. Y. The antibodies may be generated using standard methods known in the art. Examples of antibodies include (but are not limited to) monoclonal, single chain, and functional fragments of antibodies.
  • Antibodies may be produced in a range of hosts, for example goats, rabbits, rats, mice, humans, and others. They may be immunized by injection with a target antigen or a fragment or oligopeptide thereof which has immunogenic properties, such as a C-terminal fragment FLT3 or an isolated polypeptide.
  • a target antigen or a fragment or oligopeptide thereof which has immunogenic properties such as a C-terminal fragment FLT3 or an isolated polypeptide.
  • various adjuvants may be added and used to increase an immunological response.
  • adjuvants include, but are not limited to, Freund's, mineral gels such as aluminum hydroxide, and surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, and dinitrophenol.
  • BCG Bacille Calmette-Guerin
  • Coryne bacterium parvum are particularly useful. This this disclosure also
  • the antibodies of the present disclosure are polyclonal, i.e., a mixture of plural types of FLT3 antibodies having different amino acid sequences.
  • the polyclonal antibody comprises a mixture of plural types of FLT3 antibodies having different CDRs.
  • Monoclonal antibodies to FLT3 relevant antigen may be prepared using any technique which provides for the production of antibody molecules by continuous cell lines in culture. Such techniques include, but are not limited to, the hybridoma technique (see, e.g., Kohler & Milstein (1975) Nature 256: 495-497); the trioma technique; the human B-cell hybridoma technique (see, e.g., Kozbor et al. (1983) Immunol. Today 4: 72) and the EBV hybridoma technique to produce human monoclonal antibodies (see, e.g., Cole et al.
  • Human monoclonal antibodies can be utilized in the practice of the present technology and can be produced by using human hybridomas (see, e.g., Cote et al. (1983) Proc. Natl. Acad. Sci. 80: 2026-2030) or by transforming human B- cells with Epstein Barr Virus in vitro (see, e.g., Cole et al. (1985) in: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96).
  • a population of nucleic acids that encode regions of antibodies can be isolated. PCR utilizing primers derived from sequences encoding conserved regions of antibodies is used to amplify sequences encoding portions of antibodies from the population and then reconstruct DNAs encoding antibodies or fragments thereof, such as variable domains, from the amplified sequences. Such amplified sequences also can be fused to DNAs encoding other proteins— e.g., a bacteriophage coat, or a bacterial cell surface protein— for expression and display of the fusion polypeptides on phage or bacteria. Amplified sequences can then be expressed and further selected or isolated based, e.g., on the affinity of the expressed antibody or fragment thereof for an antigen or epitope present on the FLT3 relevant antigen polypeptide.
  • hybridomas expressing FLT3 monoclonal antibodies can be prepared by immunizing a subject, e.g., with an isolated polypeptide comprising, or alternatively consisting essentially of, or yet further consisting of, the amino acid sequence of the FLT3 relevant antigen or a fragment thereof, and then isolating hybridomas from the subject's spleen using routine methods. See, e.g., Milstein et al., (Galfre and Milstein (1981) Methods Enzymol 73 :3-46). Screening the hybridomas using standard methods will produce monoclonal antibodies of varying specificity (i.e., for different epitopes) and affinity.
  • a selected monoclonal antibody with the desired properties can be (i) used as expressed by the hybridoma, (ii) bound to a molecule such as polyethylene glycol (PEG) to alter its properties, or (iii) a cDNA encoding the monoclonal antibody can be isolated, sequenced and manipulated in various ways.
  • the FLT3 monoclonal antibody is produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g., a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene fused to an immortalized cell.
  • Hybridoma techniques include those known in the art and taught in Greenfield (2014) Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.; Hammerling et al. (1981) Monoclonal Antibodies And T-Cell Hybridomas:563-681.
  • the antibodies of the present disclosure can be produced through the application of recombinant DNA and phage display technology.
  • FLT3 antibodies can be prepared using various phage display methods known in the art.
  • phage display methods functional antibody domains are displayed on the surface of a phage particle which carries polynucleotide sequences encoding them.
  • Phage with a desired binding property is selected from a repertoire or combinatorial antibody library (e.g., human or murine) by selecting directly with an antigen, typically an antigen bound or captured to a solid surface or bead.
  • Phage used in these methods are typically filamentous phage including fd and Ml 3 with Fab, F v or disulfide stabilized F v antibody domains are recombinantly fused to either the phage gene III or gene VIII protein.
  • methods can be adapted for the construction of Fab expression libraries (see, e.g., Huse et al. (1989) Science 246: 1275-1281) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for FLT3 polypeptide, e.g., a polypeptide or derivatives, fragments, analogs or homologs thereof.
  • Other examples of phage display methods that can be used to make the isolated antibodies of the present disclosure include those disclosed in Huston et al. (1988) Proc. Natl. Acad. Sci. U.S.A. 85:5879-5883;
  • the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including human antibodies, or any other desired antigen binding fragment, and expressed in any desired host including mammalian cells, insect cells, plant cells, yeast, and bacteria.
  • techniques to recombinantly produce Fab, Fab' and F(ab') 2 fragments can also be employed using methods known in the art such as those disclosed in WO
  • hybrid antibodies or hybrid antibody fragments that are cloned into a display vector can be selected against the appropriate antigen in order to identify variants that maintained good binding activity, because the antibody or antibody fragment will be present on the surface of the phage or phagemid particle.
  • a display vector can be selected against the appropriate antigen in order to identify variants that maintained good binding activity, because the antibody or antibody fragment will be present on the surface of the phage or phagemid particle.
  • Barbas III et al. 2001
  • Phage Display A Laboratory Manual (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.).
  • other vector formats could be used for this process, such as cloning the antibody fragment library into a lytic phage vector (modified T7 or Lambda Zap systems) for selection and/or screening.
  • Antibodies may also be produced by inducing in vivo production in the lymphocyte population or by screening recombinant immunoglobulin libraries or panels of highly specific binding reagents (Orlandi et al. (1989) PNAS 86:3833-3837; Winter, G. et al. (1991) Nature 349:293-299).
  • Single chain antibodies comprise a heavy chain variable region and a light chain variable region connected with a linker peptide (typically around 5 to 25 amino acids in length).
  • linker peptide typically around 5 to 25 amino acids in length.
  • the variable regions of the heavy chain and the light chain may be derived from the same antibody or different antibodies.
  • scF v s may be synthesized using recombinant techniques, for example by expression of a vector encoding the scF v in a host organism such as E. coli.
  • DNA encoding scF v can be obtained by performing amplification using a partial DNA encoding the entire or a desired amino acid sequence of a DNA selected from a DNA encoding the heavy chain or the variable region of the heavy chain of the above- mentioned antibody and a DNA encoding the light chain or the variable region of the light chain thereof as a template, by PCR using a primer pair that defines both ends thereof, and further performing amplification combining a DNA encoding a polypeptide linker portion and a primer pair that defines both ends thereof, so as to ligate both ends of the linker to the heavy chain and the light chain, respectively.
  • An expression vector containing the DNA encoding scF v and a host transformed by the expression vector can be obtained according to conventional methods known in the art.
  • Antigen binding fragments may also be generated, for example the F(ab') 2 fragments which can be produced by pepsin digestion of the antibody molecule and the Fab fragments which can be generated by reducing the disulfide bridges of the F(ab') 2 fragments.
  • Fab expression libraries may be constructed to allow rapid and easy
  • Antibodies may also be purchased from commercially available sources.
  • Examples of commercially available FLT3 antibodies include, but are not limited to, those produced by suppliers such as Proteintech Group Inc., eBioscience, Abgent, Aviva Systems Biology, Becton Dickinson (Biosciences), Cell
  • Non-limiting examples of commercially available FLT3 antibodies include those from BV10 and 4G8 clones and biological equivalents or modified versions thereof, including, but not limited to the following commercially available antibodies listed by supplier and catalog number:
  • Further exemplary commercially available antibodies include all antibodies listed as reactive to human FLT3 on Biocompare or antoher database of commercially available antibodies; non-limiting examples include those disclosed herein, listed by supplier and catalog number Proteintech Group Inc. 21049-1-AP, Proteintech Group Inc. 15827-1 -AP, Proteintech Group Inc. 15826-1-AP, eBioscience 17-1357-41, eBioscience 12-1357-41, eBioscience 14-1357-80, eBioscience 17-1357-42, eBioscience 12-1357-42, eBioscience 14-1357-82, Abgent AP7644a, Abgent AP3068a, Aviva Systems Biology OAAB17159, Aviva Systems Biology OAAF00442, Aviva Systems Biology
  • ARP30009_T100 Aviva Systems Biology ARP30010_P050, Cell Signaling Technology 3462S, Cell Signaling Technology 3464S, Cell Signaling Technology 3474S, Cell Signaling Technology 3466S, Cell Signaling Technology 3461 S, Cell Signaling Technology 3461L, Cell Signaling Technology 3463 S, Cell Signaling Technology 4577S, Fitzgerald Industries International 20R-2351, Fitzgerald Industries International 70R-12259, Fitzgerald Industries International 70R- 17325.
  • Antibody Equivalents The present disclosure provides for "equivalents" or
  • “biological equivalents” of the above disclosed antibodies wherein an antigen binding domain of an antibody that is at least 80%, or alternatively 85% , or alternatively 90%, or alternatively 95%, or alternatively at least 97%, identical to the antigen binding domain of any of the above disclosed antibodies renders it the above disclosed antibody's biological equivalent.
  • Additional examples of equivalents include polypeptide that is encoded by a polynucleotide that hybridizes under conditions of high stringency to the complement of a polynucleotide encoding the antigen binding domain of any one of the above disclosed antibodies, wherein conditions of high stringency comprises incubation temperatures of about 55°C to about 68°C; buffer concentrations of about lx SSC to about O. lx SSC; formamide concentrations of about 55% to about 75%; and wash solutions of about lx SSC, O. lx SSC, or deionized water.
  • the antibodies of the present disclosure may be any antibodies of the present disclosure.
  • the antibodies of the present disclosure may be any antibodies of the present disclosure.
  • the antibody to be multimerized may be one type of antibody or a plurality of antibodies which recognize a plurality of epitopes of the same antigen.
  • binding of the IgG CH3 domain to two scF v molecules, binding to streptavidin, introduction of a helix-turn-helix motif and the like can be exemplified.
  • the antibody compositions disclosed herein may be in the form of a conjugate formed between any of these antibodies and another agent (immunoconjugate).
  • the antibodies disclosed herein are conjugated to radioactive material.
  • the antibodies disclosed herein can be bound to various types of molecules such as polyethylene glycol (PEG).
  • Antibody Screening Various immunoassays may be used for screening to identify antibodies having the desired specificity. Numerous protocols for competitive binding or immunoradiometric assays using either polyclonal or monoclonal antibodies with established specificities are well known in the art. Such immunoassays typically involve the
  • a two-site, monoclonal-based immunoassay utilizing monoclonal antibodies specific to two non-interfering FLT3 relevant antigen epitopes may be used, but a competitive binding assay may also be employed (Maddox et al. (1983) J. Exp. Med. 158: 1211-1216).
  • the antibodies disclosed herein can be purified to homogeneity.
  • the separation and purification of the antibodies can be performed by employing conventional protein separation and purification methods.
  • the antibody can be separated and purified by
  • chromatography examples include affinity chromatography, ion exchange chromatography, hydrophobic chromatography, gel filtration chromatography, reverse phase chromatography, and adsorption chromatography.
  • chromatography can be performed by employing liquid chromatography such as HPLC or FPLC.
  • a Protein A column or a Protein G column may be used in affinity chromatography.
  • Other exemplary columns include a Protein A column, Hyper D, POROS, Sepharose F. F. (Pharmacia) and the like.
  • the cell is a prokaryotic or a eukaryotic cell.
  • the cell is a T cell, B cell, or an NK cell.
  • the eukaryotic cell can be from any preferred species, e.g., an animal cell, a mammalian cell such as a human, a feline or a canine cell.
  • the isolated cell comprises, or alternatively consists essentially of, or yet further consists of an exogenous CAR comprising, or alternatively consisting essentially of, or yet further consisting of, an antigen binding domain of an FLT3 antibody; a hinge domain; a transmembrane domain - for example, a CD28 transmembrane domain; one or more costimulatory regions - for example, selected from a CD28
  • the isolated cell is a T-cell, e.g., an animal T-cell, a mammalian T-cell, a feline T-cell, a canine T-cell or a human T-cell.
  • a T-cell e.g., an animal T-cell, a mammalian T-cell, a feline T-cell, a canine T-cell or a human T-cell.
  • the isolated cell is an K-cell, e.g., an animal K-cell, a mammalian K-cell, a feline NK-cell, a canine NK-cell or a human NK-cell.
  • K-cell e.g., an animal K-cell, a mammalian K-cell, a feline NK-cell, a canine NK-cell or a human NK-cell.
  • methods of producing FLT3 CAR expressing cells comprising, or alternatively consisting essentially of or yet further consisting of transducing a population of isolated cells with a nucleic acid sequence encoding a FLT3 CAR. In some embodiments, this is achieved through the use of a vector encoding the FLT3 CAR construct. In some embodiments, this is achieved through the use of mRNA encoding the FLT3 CAR construct, which in turn may be introduced into cells via electroporation. See, e.g., Choi et al. (2010) Biomed Microdevices 12(5):855-863.
  • the isolated cells are T-cells, an animal T-cell, a mammalian T-cell, a feline T-cell, a canine T-cell or a human T-cell, thereby producing FLT3 CAR T-cells.
  • the isolated cell is an NK-cell, e.g., an animal NK-cell, a mammalian NK-cell, a feline NK-cell, a canine NK-cell or a human NK-cell, thereby producing FLT3 CAR NK-cells.
  • the isolated cells are B-cells, an animal B-cell, a mammalian B-cell, a feline B-cell, a canine B-cell or a human B-cell, thereby producing FLT3 CAR B-cells.
  • T-cells expressing the disclosed CARs may be further modified to reduce or eliminate expression of endogenous TCRs. Reduction or elimination of endogenous TCRs can reduce off-target effects and increase the effectiveness of the T cells. T cells stably lacking expression of a functional TCR may be produced using a variety of approaches.
  • T cells internalize, sort, and degrade the entire T cell receptor as a complex, with a half-life of about 10 hours in resting T cells and 3 hours in stimulated T cells (von Essen, M. et al. (2004) J. Immunol. 173 :384-393).
  • Proper functioning of the TCR complex requires the proper stoichiometric ratio of the proteins that compose the TCR complex.
  • TCR function also requires two functioning TCR zeta proteins with ITAM motifs.
  • the activation of the TCR upon engagement of its MHC-peptide ligand requires the engagement of several TCRs on the same T cell, which all must signal properly. Thus, if a TCR complex is destabilized with proteins that do not associate properly or cannot signal optimally, the T cell will not become activated sufficiently to begin a cellular response.
  • TCR expression may eliminated using RNA interference (e.g., shRNA, siRNA, miRNA, etc.), CRISPR, or other methods that target the nucleic acids encoding specific TCRs (e.g., TCR-a and TCR- ⁇ ) and/or CD3 chains in primary T cells.
  • RNA interference e.g., shRNA, siRNA, miRNA, etc.
  • CRISPR CRISPR
  • TCR-a and TCR- ⁇ CD3 chains in primary T cells.
  • the RNA e.g., shRNA, siRNA, miRNA, etc.
  • shRNA siRNA
  • miRNA miRNA
  • RNAs e.g., shRNA, siRNA, miRNA, etc.
  • expression of inhibitory RNAs in primary T cells can be achieved using any conventional expression system, e.g., a lentiviral expression system.
  • lentiviruses are useful for targeting resting primary T cells, not all T cells will express the shRNAs. Some of these T cells may not express sufficient amounts of the RNAs to allow enough inhibition of TCR expression to alter the functional activity of the T cell.
  • T cells that retain moderate to high TCR expression after viral transduction can be removed, e.g., by cell sorting or separation techniques, so that the remaining T cells are deficient in cell surface TCR or CD3, enabling the expansion of an isolated population of T cells deficient in expression of functional TCR or CD3.
  • Sources of Isolated Cells Prior to expansion and genetic modification of the cells disclosed herein, cells may be obtained from a subject - for instance, in embodiments involving autologous therapy - or a commercially available culture.
  • Cells can be obtained from a number of sources in a subject, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors.
  • Isolation methods for use in relation to this disclosure include, but are not limited to Life Technologies Dynabeads® system; STEMcell Technologies EasySepTM, RoboSepTM, RosetteSepTM, SepMateTM; Miltenyi Biotec MACSTM cell separation kits, and other commercially available cell separation and isolation kits.
  • Particular subpopulations of immune cells may be isolated through the use of beads or other binding agents available in such kits specific to unique cell surface markers.
  • MACSTM CD4+ and CD8+ MicroBeads may be used to isolate CD4+ and CD8+ T-cells.
  • cells may be obtained through commercially available cell cultures, including but not limited to, for T-cells, lines BCL2 (AAA) Jurkat (ATCC® CRL-2902TM), BCL2 (S70A) Jurkat (ATCC® CRL-2900TM), BCL2 (S87A) Jurkat (ATCC® CRL-2901TM), BCL2 Jurkat (ATCC® CRL-2899TM), Neo Jurkat (ATCC® CRL-2898TM); for B cells, lines AHH-1 (ATCC® CRL-8146TM), BC-1 (ATCC® CRL-2230TM), BC-2 (ATCC® CRL- 2231TM), BC-3 (ATCC® CRL-2277TM), CA46 (ATCC® CRL-1648TM), DG-75 [D.G.-75] (ATCC® CRL-2625TM), DS-1 (ATCC® CRL-11102TM), EB-3 [EB3] (ATCC® CCL-85TM), Z-138 (ATCC #CRL-3001),
  • T-cell lines e.g., Deglis, EBT-8, HPB-MLp-W, HUT 78, HUT 102, Karpas 384, Ki 225, My-La, Se-Ax, SKW-3, SMZ-1 and T34; immature T- cell lines, e.g., ALL-SIL, Bel3, CCRF-CEM, CML- Tl, DND-41, DU.528, EU-9, HD-Mar, HPB-ALL, H-SB2, HT-1, JK-T1, Jurkat, Karpas 45, KE-37, KOPT-K1, K-Tl, L-KAW, Loucy, MAT, MOLT-1, MOLT 3, MOLT-4, MOLT 13, MOLT-16, MT-1, MT-ALL, P12/Ichikawa, Peer, PER0117, PER-255, PF-382, PFI-285,
  • immature T- cell lines e.g., ALL-SIL, Bel3, CCRF-C
  • Null leukemia cell lines including but not limited to REH, NALL-1, KM-3, L92-221, are a another commercially available source of immune cells, as are cell lines derived from other leukemias and lymphomas, such as K562 erythroleukemia, TFIP-1 monocytic leukemia, U937 lymphoma, HEL erythroleukemia, HL60 leukemia, HMC- 1 leukemia, KG-1 leukemia, U266 myeloma.
  • leukemias and lymphomas such as K562 erythroleukemia, TFIP-1 monocytic leukemia, U937 lymphoma, HEL erythroleukemia, HL60 leukemia, HMC- 1 leukemia, KG-1 leukemia, U266 myeloma.
  • Non-limiting exemplary sources for such commercially available cell lines include the American Type Culture Collection, or ATCC, (http://www.atcc.org/) and the German Collection of Microorganisms and Cell Cultures (https://www.dsmz.de/).
  • CAR cells may be prepared using vectors. Aspects of the present disclosure relate to an isolated nucleic acid sequence encoding a FLT3 CAR or a complement or equivalent thereof.
  • the isolated nucleic acid sequence encodes for a CAR comprising, or alternatively consisting essentially of, or yet further consisting of an antigen binding domain of an FLT3 antibody, a hinge domain, a CD28 transmembrane domain, one or more costimulatory regions selected from a CD28 costimulatory signaling region, a 4- IBB costimulatory signaling region, an ICOS costimulatory signaling region, and an OX40 costimulatory region, and a CD3 zeta signaling domain.
  • the isolated nucleic acid sequence comprises, or alternatively consisting essentially thereof, or yet further consisting of, sequences encoding (a) an antigen binding domain of an FLT3 antibody followed by (b) a hinge domain, (c) a CD28 transmembrane domain followed by (d) one or more costimulatory regions selected from a CD28 costimulatory signaling region, a 4- 1BB costimulatory signaling region, an ICOS costimulatory signaling region, and an OX40 costimulatory region followed by (e) a CD3 zeta signaling domain.
  • the isolated nucleic acid sequence further comprises, or further consists essentially of, or yet further consists of, a polynucleotide promoter sequence located upstream of the polynucleotide encoding the antigen binding domain of the FLT3 antigen binding domain of the FLT3 antibody.
  • this promoter is a cytomegalovirus (CMV) promoter sequence, a myeloproliferative sarcoma virus enhancer (MND) promoter, or an EF1 alpha promoter.
  • CMV cytomegalovirus
  • MND myeloproliferative sarcoma virus enhancer
  • EF1 alpha promoter Non-limiting exemplary sequences of said promoters are provided herein:
  • MND promoter sequence SEQ. ID NO: 38 :
  • EF1 alpha promoter sequence SEQ. ID NO: 39 :
  • the isolated nucleic acid sequence further comprises, or further consists essentially of, or yet further consists of, an inducible caspase ("iCasp”) or other "suicide gene” encoding polynucleotide sequence located upstream of the
  • iCasp sequence SEQ. ID NO: 40 :
  • the dimerization can be induced by any small molecule known to facilitate dimerization of caspase 9. Administration of this small molecule results in cross-linking and activation of Caspase 9, which in turn induces apoptosis of cells expressing the iCasp gene.
  • the isolated nucleic acid sequence further comprises, or further consists essentially of, or yet further consists of, a 2A peptide (T2A) encoding polynucleotide sequence located upstream of the polynucleotide encoding the antigen binding domain of the FLT3 antigen binding domain of the FLT3 antibody; a encoding a non-limiting exemplary sequence of said T2A polynucleotide is provided herein:
  • T2A 2A peptide
  • T2A sequence SEQ. ID NO: 41 :
  • T2A-mediated "self-cleavage" may give rise to a 1 : 1 ratio of the two separate proteins.
  • the isolated nucleic acid sequence further comprises, or further consists essentially of, or yet further consists of, a signal peptide encoding
  • the isolated nucleic acid comprises a detectable label and/or a polynucleotide conferring antibiotic resistance.
  • the label or polynucleotide are useful to select cells successfully transduced with the isolated nucleic acids.
  • this detectable label is a protein tag derived from the c-myc gene known as a "myc tag.” A non-limiting exemplary sequence encoding said myc tag is disclosed herein below:
  • the isolated nucleic acid sequence is comprised within a vector.
  • the vector is a plasmid.
  • the vector is a viral vector. Non-limiting examples of such include without limitation a retroviral vector, a lentiviral vector, an adenoviral vector, and an adeno-associated viral vector.
  • the vector is a lentiviral vector.
  • nucleic acid encoding CARs or immunoregulatory molecules is typically achieved by operably linking a nucleic acid encoding the CAR polypeptide or portions thereof to a promoter, and incorporating the construct into an expression vector.
  • a similar method may be used to construct the isolated nucleic acid sequence comprising a polynucleotide encoding an immunoregulatory molecule.
  • the vectors can be suitable for replication and integration eukaryotes. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al.
  • the term "vector” intends a recombinant vector that retains the ability to infect and transduce non-dividing and/or slowly-dividing cells and integrate into the target cell's genome.
  • the vector is derived from or based on a wild-type virus.
  • the vector is derived from or based on a wild-type lentivirus. Examples of such include without limitation, human immunodeficiency virus (HIV), equine infectious anemia virus (EIAV), simian immunodeficiency virus (SIV) and feline immunodeficiency virus (FIV).
  • retrovirus can be used as a basis for a vector backbone such murine leukemia virus (MLV).
  • MLV murine leukemia virus
  • a viral vector according to the disclosure need not be confined to the components of a particular virus.
  • the viral vector may comprise components derived from two or more different viruses, and may also comprise synthetic components. Vector components can be manipulated to obtain desired characteristics, such as target cell specificity.
  • the recombinant vectors of this disclosure are derived from primates and non- primates.
  • primate lentiviruses include the human immunodeficiency virus (HIV), the causative agent of human acquired immunodeficiency syndrome (AIDS), and the simian immunodeficiency virus (SIV).
  • the non-primate lentiviral group includes the prototype "slow virus” visna/maedi virus (VMV), as well as the related caprine arthritis- encephalitis virus (CAEV), equine infectious anemia virus (EIAV) and the more recently described feline immunodeficiency virus (FIV) and bovine immunodeficiency virus (BIV).
  • VMV visna/maedi virus
  • CAEV caprine arthritis- encephalitis virus
  • EIAV equine infectious anemia virus
  • FV feline immunodeficiency virus
  • BIV bovine immunodeficiency virus
  • U.S. Patent No. 6,924,123 discloses that certain retroviral sequence facilitate integration into the target cell genome.
  • each retroviral genome comprises genes called gag, pol and env which code for virion proteins and enzymes. These genes are flanked at both ends by regions called long terminal repeats (LTRs).
  • LTRs are responsible for proviral integration, and transcription. They also serve as enhancer-promoter sequences. In other words, the LTRs can control the expression of the viral genes.
  • Encapsidation of the retroviral RNAs occurs by virtue of a psi sequence located at the 5' end of the viral genome.
  • the LTRs themselves are identical sequences that can be divided into three elements, which are called U3, R and U5.
  • U3 is derived from the sequence unique to the 3' end of the RNA.
  • R is derived from a sequence repeated at both ends of the RNA
  • U5 is derived from the sequence unique to the 5'end of the RNA.
  • the sizes of the three elements can vary considerably among different retroviruses.
  • the site of poly (A) addition (termination) is at the boundary between R and U5 in the right hand side LTR.
  • U3 contains most of the transcriptional control elements of the provirus, which include the promoter and multiple enhancer sequences responsive to cellular and in some cases, viral transcriptional activator proteins.
  • gag encodes the internal structural protein of the virus.
  • Gag protein is proteolytically processed into the mature proteins MA (matrix), CA (capsid) and NC (nucleocapsid).
  • the pol gene encodes the reverse transcriptase (RT), which contains DNA polymerase, associated RNase H and integrase (IN), which mediate replication of the genome.
  • RT reverse transcriptase
  • I integrase
  • the vector RNA genome is expressed from a DNA construct encoding it, in a host cell.
  • the components of the particles not encoded by the vector genome are provided in trans by additional nucleic acid sequences (the "packaging system", which usually includes either or both of the gag/pol and env genes) expressed in the host cell.
  • the set of sequences required for the production of the viral vector particles may be introduced into the host cell by transient transfection, or they may be integrated into the host cell genome, or they may be provided in a mixture of ways. The techniques involved are known to those skilled in the art.
  • Retroviral vectors for use in this disclosure include, but are not limited to
  • assays include, for example, "molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR;
  • biochemical assays such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELI S As and Western blots) or by assays described herein to identify agents falling within the scope of the disclosure.
  • Packaging vector and cell lines The isolated nucleic acids can be packaged into a retroviral packaging system by using a packaging vector and cell lines.
  • the packaging vector includes, but is not limited to retroviral vector, lentiviral vector, adenoviral vector, and adeno-associated viral vector.
  • the packaging vector contains elements and sequences that facilitate the delivery of genetic materials into cells.
  • the retroviral constructs are packaging vectors comprising at least one retroviral helper DNA sequence derived from a replication-incompetent retroviral genome encoding in trans all virion proteins required to package a replication incompetent retroviral vector, and for producing virion proteins capable of packaging the replication-incompetent retroviral vector at high titer, without the production of replication-competent helper virus.
  • the retroviral DNA sequence lacks the region encoding the native enhancer and/or promoter of the viral 5' LTR of the virus, and lacks both the psi function sequence responsible for packaging helper genome and the 3' LTR, but encodes a foreign polyadenylation site, for example the SV40 polyadenylation site, and a foreign enhancer and/or promoter which directs efficient transcription in a cell type where virus production is desired.
  • the retrovirus is a leukemia virus such as a Moloney Murine Leukemia Virus (MMLV), the Human Immunodeficiency Virus (HIV), or the Gibbon Ape Leukemia virus (GALV).
  • the foreign enhancer and promoter may be the human cytomegalovirus (HCMV) immediate early (IE) enhancer and promoter, the enhancer and promoter (U3 region) of the Moloney Murine Sarcoma Virus (MMSV), the U3 region of Rous Sarcoma Virus (RSV), the U3 region of Spleen Focus Forming Virus (SFFV), or the HCMV IE enhancer joined to the native Moloney Murine Leukemia Virus (MMLV) promoter.
  • HCMV human cytomegalovirus
  • IE immediate early
  • IE Enhancr and promoter
  • U3 region of the Moloney Murine Sarcoma Virus
  • RSV Rous Sarcoma Virus
  • SFFV Spleen Focus Forming Virus
  • HCMV IE enhancer joined to the native Moloney Murine Leukemia Virus
  • the retroviral packaging vector may consist of two retroviral helper DNA sequences encoded by plasmid based expression vectors, for example where a first helper sequence contains a cDNA encoding the gag and pol proteins of ecotropic MMLV or GALV and a second helper sequence contains a cDNA encoding the env protein.
  • the Env gene which determines the host range, may be derived from the genes encoding xenotropic, amphotropic, ecotropic, polytropic (mink focus forming) or 10A1 murine leukemia virus env proteins, or the Gibbon Ape Leukemia Virus (GALV env protein, the Human
  • Immunodeficiency Virus env (gpl60) protein the Vesicular Stomatitus Virus (VSV) G protein, the Human T cell leukemia (HTLV) type I and II env gene products, chimeric envelope gene derived from combinations of one or more of the aforementioned env genes or chimeric envelope genes encoding the cytoplasmic and transmembrane of the aforementioned env gene products and a monoclonal antibody directed against a specific surface molecule on a desired target cell.
  • VSV Vesicular Stomatitus Virus
  • HTLV Human T cell leukemia
  • the packaging vectors and retroviral vectors are transiently cotransfected into a first population of mammalian cells that are capable of producing virus, such as human embryonic kidney cells, for example 293 cells (ATCC No. CRL1573, ATCC, Rockville, Md.) to produce high titer recombinant retrovirus-containing supernatants.
  • virus such as human embryonic kidney cells, for example 293 cells (ATCC No. CRL1573, ATCC, Rockville, Md.) to produce high titer recombinant retrovirus-containing supernatants.
  • this transiently transfected first population of cells is then cocultivated with mammalian target cells, for example human lymphocytes, to transduce the target cells with the foreign gene at high efficiencies.
  • mammalian target cells for example human lymphocytes
  • the supernatants from the above described transiently transfected first population of cells are incubated with mammalian target cells, for example human lymphocytes or hematopoietic stem cells, to transduce the target cells with the foreign gene at high efficiencies.
  • mammalian target cells for example human lymphocytes or hematopoietic stem cells
  • the packaging vectors are stably expressed in a first population of mammalian cells that are capable of producing virus, such as human embryonic kidney cells, for example 293 cells.
  • Retroviral or lentiviral vectors are introduced into cells by either cotransfection with a selectable marker or infection with pseudotyped virus. In both cases, the vectors integrate.
  • vectors can be introduced in an episomally
  • Stimulation with the FLT3 relevant antigen ex vivo can activate and expand the selected CAR expressing cell subpopulation.
  • the cells may be activated in vivo by interaction with FLT3 relevant antigen.
  • soluble CD-40 ligand may be helpful in activating and expanding certain B-cell populations; similarly, irradiated feeder cells may be used in the procedure for activation and expansion of NK cells.
  • irradiated feeder cells may be used in the procedure for activation and expansion of NK cells.
  • PhosflowTM activation kits Miltenyi Biotec MACSTM activation/expansion kits, and other commercially available cell kits specific to activation moieties of the relevant cell.
  • Particular subpopulations of immune cells may be activated or expanded through the use of beads or other agents available in such kits .
  • a-CD3/a-CD28 Dynabeads® may be used to activate and expand a population of isolated T-cells
  • Method aspects of the present disclosure relate to methods for inhibiting tumor/cancer in a subject in need thereof and/or for treating a cancer patient in need thereof.
  • the cancer is a cancer affecting blood and/or bone marrow; in some embodiments, the cancer is acute myeloid leukemia.
  • the tumor/cancer cell expresses or overexpresses FLT3. In certain embodiments, these methods comprise, or alternatively consist essentially of, or yet further consist of,
  • this isolated cell comprises a FLT3 CAR.
  • the isolated cell is a T-cell or an NK cell.
  • the isolated cell is autologous to the subject or patient being treated.
  • the tumor/cancer expresses FLT3 and the subject has been selected for the therapy by a diagnostic, such as the one described herein.
  • the subject is an animal, a mammal, a canine, a feline, a bovine, an equine, a murine or a human patient.
  • the FLT3 CAR cells as disclosed herein may be administered either alone or in combination with diluents, known anti-cancer therapeutics, and/or with other components such as cytokines or other cell populations that are immunoregulatory. They can be administered as a first line therapy, a second line therapy, a third line therapy, or further therapy.
  • additional therapies include cytoreductive therapy, such as radiation therapy, cryotherapy, or chemotherapy, or biologies, such as hematopoetic stem cell transplantation.
  • the FLT3 CAR cells may be administered before or after any one of these non-limiting exemplary therapies, e.g., before hematopoietic stem cell transplantation or after radiation therapy or chemotherapy.
  • Non-limiting examples include other relevant cell types, such as unmodified immune cells, modified immune cells comprising vectors expressing one or more immunoregulatory molecules, or CAR cells specific to a different antigen than those disclosed herein. As with the CAR cells of the present disclosure, in some embodiments, these cells may be autologous or allogenic. Appropriate treatment regimens will be determined by the treating physician or veterinarian.
  • compositions of the present disclosure may be administered in a manner appropriate to the disease to be treated or prevented.
  • the quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.
  • they are administered directly by direct injection or systemically such as intravenous injection or infusion.
  • the total dose of CAR expressing cells may vary depending on, for example, the above disclosed factors.
  • the doses may be on the order of between 1 to 10 10 cells, e.g. at least 10, at least 10 1 , at least 10 2 , at least 10 3 , at least 10 4 , at least 10 5 , at least 10 6 , at least 10 7 , at most 10 8 , at most 10 9 , at most 10 10 , between 10 2 and 10 10 , between 10 3 and 10 9 , between 10 4 and 10 8 .
  • the dose may be further limited by an integer coefficient to the order of magnitude, e.g. 1, 2, 3, 4, 5, 6, 7, 8, or 9, resulting a dose range listed according to the following non-limiting example: between 5 x 10 4 and 1 x 10 8 .
  • the suicide gene may be utilized to terminate CAR expressing cells at the end of therapy.
  • the suicide gene may be induced through the introduction of the inducer molecule at the point at which the FLT3 specific CAR cell response is no longer needed. The induction of the suicide gene results in apoptosis of the CAR cells. It is thus contemplated that the use of CAR constructs comprising an inducible suicide gene may enhance the safety of CAR cell application by removing the CAR expressing cells through induced apoptosis.
  • the dose of the inducing agent applied to induce suicide expression may range anywhere between 0.001 to 10.0 mg/kg body weight, or alternatively from 0.01 to 1.0 mg/kg, and ranges in between.
  • diagnostic Application Aspects of the disclosure provide an exemplary method for determining if a patient is likely to respond to, or is not likely to respond to, FLT3 CAR therapy.
  • this method comprises contacting a biological sample isolated from the patient with an effective amount of an anti-FLT3 antibody and detecting the presence of any antibody bound to the tumor sample.
  • the presence of antibody bound to the tumor sample indicates that the patient is likely to respond to the FLT3 CAR therapy and the absence of antibody bound to the tumor sample indicates that the patient is not likely to respond to the FLT3 CAR therapy.
  • the method involves the use diagnostic markers or gene expression profile associated with a tumor or cancer - a non-limiting exemplary is the used of marker CD45 dim SSC medium for AML.
  • the method comprises the additional step of administering an effective amount of the FLT3 CAR expressing cells to a patient that is determined likely to respond to the FLT3 CAR therapy.
  • the patient has and/or is diagnosed with a FLT3 expressing cancer/tumor.
  • the cancer/tumor is AML.
  • compositions comprising, or alternatively consisting essentially of, or yet further consisting of, a carrier and one or more of the products - e.g., a FLT3 CAR, an isolated cell comprising a FLT3 CAR, an isolated nucleic acid, a vector, an isolated cell containing the FLT3 CAR and the immunomodulatory molecule and/or nucleic acids encoding such - described in the embodiments disclosed herein.
  • a carrier e.g., a FLT3 CAR, an isolated cell comprising a FLT3 CAR, an isolated nucleic acid, a vector, an isolated cell containing the FLT3 CAR and the immunomodulatory molecule and/or nucleic acids encoding such - described in the embodiments disclosed herein.
  • compositions of the present disclosure including but not limited to any one of the claimed compositions as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.
  • Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol;
  • proteins proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives.
  • chelating agents such as EDTA or glutathione
  • adjuvants e.g., aluminum hydroxide
  • compositions of the present disclosure may be formulated for oral, intravenous, topical, enteral, and/or parenteral administration. In certain embodiments, the compositions of the present disclosure are formulated for intravenous administration.
  • Administration of the cells or compositions can be effected in one dose
  • the cells and populations of cell are administered to the host using methods known in the art and described, for example, in PCT International Application No.
  • PCT/US201 1/064191 This administration of the cells or compositions of the disclosure can be done to generate an animal model of the desired disease, disorder, or condition for experimental and screening assays.
  • the present disclosure provides methods for producing and administering FLT3 CAR cells.
  • the present disclosure provides kits for performing these methods as well as instructions for carrying out the methods of the present disclosure such as collecting cells and/or tissues, and/or performing the
  • the kit comprises, or alternatively consists essentially of, or yet further consists of, any one of the isolated nucleic acids disclosed herein and/or a vector comprising said nucleic acid and/or isolated allogenic cells, preferably T cells or NK cells, and/or instructions on the procuring of autologous cells from a patient.
  • a kit may also comprise, or alternatively consist essentially of, or yet further comprise media and other reagents appropriate for the transduction and/or selection and/or activation and/or expansion of FLT3 CAR expressing cells, such as those disclosed herein.
  • the kit comprises, or alternatively consists essentially of, or yet further consists of, an isolated CAR expressing cell or population thereof.
  • the cells of this kit may require activation and/or expansion prior to administration to a subject in need thereof.
  • the kit may further comprise, or consist essentially thereof, media and reagents, such as those covered in the disclosure above, to activate and/or expand the isolated CAR expressing cell.
  • the cell is to be used for FLT3 CAR therapy.
  • the kit comprises instructions on the administration of the isolated cell to a patient in need of FLT3 CAR therapy.
  • kits of his disclosure can also comprise, e.g., a buffering agent, a preservative or a protein-stabilizing agent.
  • the kits can further comprise components necessary for detecting the detectable-label, e.g., an enzyme or a substrate.
  • the kits can also contain a control sample or a series of control samples, which can be assayed and compared to the test sample.
  • Each component of a kit can be enclosed within an individual container and all of the various containers can be within a single package, along with instructions for interpreting the results of the assays performed using the kit.
  • the kits of the present disclosure may contain a written product on or in the kit container. The written product describes how to use the reagents contained in the kit.
  • these suggested kit components may be packaged in a manner customary for use by those of skill in the art.
  • these suggested kit components may be provided in solution or as a liquid dispersion or the like.
  • lentiviral vectors encoding FLT3 CARs were produced. Each of the CARs were designed according to the construct in FIG. 1.
  • CAR-expressing T cells were isolated by FACSAria II.
  • EXAMPLE 2 FLT3 CAR expressing T-cells target Acute Myeloid Leukemia cells in vitro
  • 1 x 10 7 AML cells (taken from a cell line, e.g. MOLM-13 AML, or an AML patient) are injected into NOD SCID Gamma (NSG) mice.
  • the mice are monitored for AML cell growth using diagnostic methods such as in vivo imaging.
  • the mice are divided into treatment groups and administered doses of the FLT3 CAR expressing cells between 1 x 10 6 and 1 x 10 8 cells infused at a single time or over multiple time intervals. Tumor inhibition is monitored and survival data is collected.
  • the FLT3 CAR expressing cells are found to have a therapeutic effect on the AML positive mice.
  • Cell culture All cell lines were purchased from the American Type Culture Collection (ATCC) and have been validated with DNA profiling.
  • mice Six- to 8-week-old male NOD-scid IL-2R gamma null (NSG) mice were purchased from The Jackson Laboratory. Mice were monitored frequently for leukemia. All animal work was approved by The Ohio State University Animal Care and Use Committee.
  • T lymphocytes The primary T lymphocytes were isolated from human peripheral blood mononuclear cells (PBMC) as described in our previous report; the lentiviral transfection and infection protocol was modified from our previous report. Chu et al. (2014) Leukemia 28:917-927; Han et al. (2015) Scientific Reports 5: 11483.
  • PBMC peripheral blood mononuclear cells
  • Immunoblotting was performed following the modified protocol in our lab. In detail, cells were firstly lysed in laemmli buffer. Then, lysates were separated by SDS-PAGE gel and transferred to PVDF membrane (Millipore). The membrane was probed with mouse anti-human ⁇ 3 ⁇ mAb (BD Pharmingen) and then with a horseradish peroxidase-conjugated goat anti-mouse IgG antibody. Antibody binding was revealed by using an enhanced chemiluminescence reagent (Thermo scientific Inc.).
  • Cytotoxicity assay A standard 4-hour 51 Cr release assay was performed as described previously. Yu et al. Blood 115:274-281 (2010). Briefly, target cells were labeled with 51 Cr and co-cultured with primary T cells or T cells transduced with FLT3-CAR or T cells transduced with mock vector at various effector/target ratios (E/T) in the wells of 96- well V-bottom plate at 37°C for 4 hours. Supernatants were harvested and transferred into scintillation vials containing a liquid scintillation cocktail (Fisher Scientific), and the release of 51 Cr was measured on TopCount counter (Canberra Packard).
  • E/T effector/target ratios
  • Target cells incubated in complete medium or 1% SDS were used to determine spontaneous or maximal 51 Cr release.
  • the percentage of specific lysis was calculated using the standard formula: 100 ⁇ (cpm experimental release - cpm spontaneous release)/(cpm maximal release - cpm spontaneous release).
  • Cytokine release assays Target cells were co-cultured with an equal number of effector cells in 96-well V-bottom plates at 37 °C for 24 hours. Cell-free supernatants were harvested and assessed for IFN-gamma and interleukin (IL)-2 secretion by ELISA using corresponding ELISA kits from R&D system following the manufacturer's protocol.
  • IL interleukin
  • MOLM13 cells were retrovirally transduced with Pinco-pGL3-luc/GFP virus expressing firefly luciferase, and GFP-positive cells were sorted using the aforementioned method, yielding MOLM13-GL3 cells.
  • Male NSG mice were intravenously injected with 8 x 10 6 MOLM13-GL3 cells in 400 mL of PBS via tail vein on day 0 to establish a xenograft orthotopic leukemia model. On days 9 and 16, the mice were intravenously administered with 1.0 x l O 6 effector cells, i.e., FLT3-CAR-transduced T cells or mock-transduced control cells, in 400 mL of PBS via tail vein injection. Five weeks after inoculation with leukemia cells, the mice were intraperitoneally infused with D-luciferin (150 mg/kg body weight; Gold
  • NK cells were manipulated to express a FLT3-specific CAR incorporating a CD28- ⁇ 3 ⁇ so-stimulatory signaling domain.
  • iCasp9-T2A cassette was incorporated into the FLT3-specific CAR to eradicate CAR modified NK cells after killing cancer.
  • the anti-leukemia skill of the FLT3-specific CAR engineered NK cells were evaluated in vitro and in vivo in an orthotopic xenograft mouse model of leukemia.
  • Cell culture All cell lines were purchased from the American Type Culture Collection (ATCC) and have been validated with DNA profiling.
  • mice Six- to 8-week-old male NOD-scid IL-2R gamma null (NSG) mice were purchased from The Jackson Laboratory. Mice were monitored frequently for leukemia. All animal work was approved by The Ohio State University Animal Care and Use Committee.
  • transduced NK cells were washed with PBS containing 4% bovine serum albumin, and incubated with biotin labeled goat anti-mouse (Fab)2 polyclonal antibody or normal polyclonal goat immunoglobulin G (IgG) antibody (Jackson ImmunoResearch) as an isotype control. Then cells were stained with allophycocyanin (APC)-conjugated streptavidin (Jackson ImmunoResearch) and anti-CD3 antibody conjugated to V450 (BD Biosciences).
  • Fab goat anti-mouse
  • IgG normal polyclonal goat immunoglobulin G
  • Immunoblotting Cells were lysed in laemmli buffer. Lysates were separated by SDS-PAGE gel and transferred to PVDF membrane (Millipore). The membrane was probed with mouse anti-human CD3 ⁇ mAb (BD Pharmingen) and then with a horseradish peroxidase-conjugated goat anti-mouse IgG antibody. Antibody binding was revealed by using an enhanced chemiluminescence reagent (Thermo scientific Inc.).
  • Cytotoxicity assay A standard 4-hour 51 Cr release assay was performed as described previously. Yu et al. Blood 115:274-281 (2010). Briefly, target cells were labeled with 51 Cr and co-cultured with NK cells at various effector/target ratios (E/T) in the wells of 96-well V-bottom plate at 37°C for 4 hours. Supematants were harvested and transferred into scintillation vials containing a liquid scintillation cocktail (Fisher Scientific), and the release of 51 Cr was measured on TopCount counter (Canberra Packard). Target cells incubated in complete medium or 1% SDS were used to determine spontaneous or maximal 51 Cr release. The percentage of specific lysis was calculated using the standard formula: 100 ⁇ (cpm experimental release - cpm spontaneous release)/(cpm maximal release - cpm spontaneous release).
  • Cytokine release assays Target cells were co-cultured with an equal number of effector cells in 96-well V-bottom plates at 37 °C for 24 hours. Cell-free supernatants were harvested and assessed for IFN-gamma and interleukin (TL)-2 secretion by ELISA using corresponding ELISA kits from R&D system following the manufacturer's protocol.
  • TL interleukin
  • MOLM13 cells were retrovirally transduced with Pinco-pGL3-luc/GFP virus expressing firefly luciferase, and GFP-positive cells were sorted using the aforementioned method, yielding MOLM13-GL3 cells.
  • Male NSG mice were intravenously injected with 8 x 10 6 MOLM13-GL3 cells in 400 mL of PBS via tail vein on day 0 to establish a xenograft orthotopic leukemia model. On days 7 and 14, the mice were intravenously administered with 10 x l O 6 effector cells, FLT3-CAR-transduced NK cells or mock-transduced control cells, in 400 mL of PBS via tail vein injection. Five weeks after inoculation with leukemia cells, the mice were intraperitoneally infused with D-luciferin (150 mg/kg body weight; Gold
  • a specific FLT3-CAR construct containing an iCasp9-T2A cassette, a signal peptide (SP), a heavy chain variable region(VH), a linker, a light chain variable region (VL), a Myc tag, a hinge, CD28 and ⁇ 3 ⁇ was built.
  • SP signal peptide
  • VH heavy chain variable region
  • VL light chain variable region
  • Myc tag a Myc tag
  • FIG. 8A a specific FLT3-CAR construct containing an iCasp9-T2A cassette, a signal peptide (SP), a heavy chain variable region(VH), a linker, a light chain variable region (VL), a Myc tag, a hinge, CD28 and ⁇ 3 ⁇
  • NK-92 cell line were transduced with the CAR construct and control empty vector.
  • the transduced NK-92 cell lines were sorted for the expression of GFP, a fluorescence marker expressed by the vector.
  • FLT3-CAR modified NK-92cells recognize and more effectively kill FLT3 + leukemia cells than mock-transduced NK-92 cells: To determine whether FLT3-CAR NK- 92 cells specifically eradicate FLT3 + better than FLT3 " leukemia cells, it was validated that the leukemia cell lines MOLM13 and EOL-1 consistently expressed FLT3 whereas the express of FLT3 remained undetectable on the surface of U937 (FIG. 9A). Then, a chromium-51 release assay which demonstrated that NK-92 cells transduced with FLT3-CAR significantly got improvement in their ability to eradicate FLT3 + leukemia cell lines
  • MOLM13 and EOL-1 compared with original and mock-transduced NK-92 cells was performed.
  • the enhancement in killing leukemia cells is FLT3 + dependent.
  • NK-92 cells transduced with FLT3-CAR did not show detectable difference in the ability to kill FLT3 " cell line U937 (FIG. 9B).
  • the recognition of FLT3 + leukemia cell lines by NK-92 transduced with CAR-FLT3 induced a strong IFN- ⁇ release compared to original and mock-transduced NK-92 cells.
  • FLT3-CAR engineered NK-92 cells more effectively eradicate primary leukemia ex vivo: To determine whether NK-92 cells transduced with FLT3-CAR induce a stronger anti-tumor response than original and mock-transduced NK-92 cells, leukemia cells from patients were isolated, and the expression of FLT3 on these tumor cells was confirmed (FIG. 10A). Then, a chromium-51 release assay was applied on FLT3 + tumor cells isolated from two patients. FLT3-CAR modified NK-92 cells showed a stronger ability of tumor cell lysis with the expression of FLT3 compared to original and mock-transduced NK-92 cells (FIG. 10B).
  • FLT3-CAR K-92 cells could only show slightly augmented cytolytic activity against normal peripheral blood mononuclear cells (PBMC) from normal control people (FIG. 10B).
  • PBMC peripheral blood mononuclear cells
  • the cytokine release assay was performed to test the secretion of IFN- ⁇ which was measured by ELISA. Consistent with data about cytolytic activity, FLT3-CAR modified NK-92 cells released more IFN- ⁇ compared to original or mock- transduced NK-92 cells when they co-culture with FLT3 + PBMCs from patients.
  • FLT3- CAR-transduced primary NK cells could efficiently recognize and kill leukemia cell lines, especially, FLT3 + leukemia cell line, and tumor cells freshly isolated from patient with leukemia were investigated.
  • Primary NKs from three donors designated Dl, D2 and D3 were isolated. Then, FLT3-CAR was introduced and incorporated into these primary NKs using lentiviral transfection. After expansion, these genetically modified primary NKs were used to perform chromium-51 release assay.
  • the cytotoxicity assay demonstrated that FLT3 -CAR modified primary NKs could effectively killing FLT3 + leukemia cell line MOLM13 at the E/T ratio as equal as 5 compared with mock-modified ones (FIG. 11 A).
  • the cytotoxicity of the genetically modified primary NKs against leukemia cells freshly isolated from patient were also measured by chromium-51 release assay.
  • AP1903 intervention effectively eradicate FLT3-CAR-NK92 with iCasp9:
  • an inducible Caspase 9 iCasp9
  • iCasp9 into our FLT3-CAR (FIG. 8A) was also introduced.
  • API 903 intervention could be used to remove the CAR-modified NK-92 cells effectively during immunotherapy.
  • FLT3-CAR engineered NK-92 cells suppress leukemia tumor growth and prolong survival of tumor-bearing mice in orthotopic xenograft leukemia model: The potential therapeutic application of FLT3-CAR modified NK-92 cells was assessed in a leukemia-xenografted NSG mouse model.
  • the leukemia cell line was genetically modified to express firefly luciferase.
  • GFP-based sorting was performed to isolate genetically modified leukemia tumor cells and intravenously grafted the sorted cells into NSG mouse to initiate tumor growth. Then, these mice were intravenously infused with FLT3-CAR modified NK-92 cells, mock-transduced NK-92 cells or original NK-92 cells.
  • Bioluminescence imaging using IVIS showed that the infusion of FLT3-CAR transduced NK-92 cells dramatically reduced the tumor burden compared to original and mock- transduced NK-92 cells (FIG. 13A). Furthermore, the treatment of FLT3-CAR engineered NK-92 cells remarkably prolonged the survival of tumor-bearing mice as compared with the infusion of original and mock-transduced NK-92 cells (FIG. 13B).
  • a chromium release assay is performed with immune cells expressing FLT3 CARs comprising a CD28 costimulatory domain and immune cells expressing FLT3 CARs comprising a 4-1BB costimulatory domain to compare the anti-tumor efficacy of FLT3 CAR cells to those where CD28 costimulatory domain is used.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Immunology (AREA)
  • Medicinal Chemistry (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Genetics & Genomics (AREA)
  • Zoology (AREA)
  • Biochemistry (AREA)
  • Molecular Biology (AREA)
  • Epidemiology (AREA)
  • Biophysics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Engineering & Computer Science (AREA)
  • Toxicology (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biomedical Technology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Wood Science & Technology (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Hematology (AREA)
  • Biotechnology (AREA)
  • Oncology (AREA)
  • General Engineering & Computer Science (AREA)
  • Microbiology (AREA)
  • Developmental Biology & Embryology (AREA)
  • Virology (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)
  • Micro-Organisms Or Cultivation Processes Thereof (AREA)
  • Peptides Or Proteins (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
PCT/US2016/053577 2015-09-23 2016-09-23 Flt3 directed car cells for immunotherapy Ceased WO2017053889A2 (en)

Priority Applications (12)

Application Number Priority Date Filing Date Title
EP16849810.3A EP3352784A4 (en) 2015-09-23 2016-09-23 FLT3-FACED CAR CELLS FOR IMMUNOTHERAPY
CA2999037A CA2999037A1 (en) 2015-09-23 2016-09-23 Flt3 directed car cells for immunotherapy
JP2018534523A JP7054924B2 (ja) 2015-09-23 2016-09-23 免疫療法のためのflt3指向car細胞
CN201680065509.1A CN109310744A (zh) 2015-09-23 2016-09-23 用于免疫治疗的flt3定向car细胞
KR1020187011302A KR20180053744A (ko) 2015-09-23 2016-09-23 면역 요법을 위한 flt3 유도된 car 세포
HK19101399.4A HK1258921A1 (zh) 2015-09-23 2016-09-23 Flt3 定向 car 细胞免疫疗法
EP19170050.9A EP3569244A1 (en) 2015-09-23 2016-09-23 Flt3 directed car cells for immunotherapy
AU2016326721A AU2016326721C1 (en) 2015-09-23 2016-09-23 FLT3 directed car cells for immunotherapy
US15/811,608 US10961312B2 (en) 2015-09-23 2017-11-13 FLT3 directed car cells for immunotherapy
AU2021201329A AU2021201329A1 (en) 2015-09-23 2021-03-02 Flt3 directed car cells for immunotherapy
US17/199,332 US20210269534A1 (en) 2015-09-23 2021-03-11 Flt3 directed car cells for immunotherapy
JP2021189789A JP2022046461A (ja) 2015-09-23 2021-11-24 免疫療法のためのflt3指向car細胞

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
US201562222695P 2015-09-23 2015-09-23
US62/222,695 2015-09-23

Related Child Applications (1)

Application Number Title Priority Date Filing Date
US15/811,608 Continuation-In-Part US10961312B2 (en) 2015-09-23 2017-11-13 FLT3 directed car cells for immunotherapy

Publications (2)

Publication Number Publication Date
WO2017053889A2 true WO2017053889A2 (en) 2017-03-30
WO2017053889A3 WO2017053889A3 (en) 2017-05-26

Family

ID=58387435

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/US2016/053577 Ceased WO2017053889A2 (en) 2015-09-23 2016-09-23 Flt3 directed car cells for immunotherapy

Country Status (9)

Country Link
US (2) US10961312B2 (https=)
EP (2) EP3569244A1 (https=)
JP (2) JP7054924B2 (https=)
KR (1) KR20180053744A (https=)
CN (1) CN109310744A (https=)
AU (2) AU2016326721C1 (https=)
CA (1) CA2999037A1 (https=)
HK (1) HK1258921A1 (https=)
WO (1) WO2017053889A2 (https=)

Cited By (19)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2018119279A1 (en) * 2016-12-21 2018-06-28 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Human monoclonal antibodies specific for flt3 and uses thereof
WO2018222935A1 (en) * 2017-06-02 2018-12-06 Pfizer Inc. Chimeric antigen receptors targeting flt3
WO2018220584A1 (en) * 2017-06-02 2018-12-06 Pfizer Inc. Antibodies specific for flt3 and their uses
WO2019025484A1 (en) * 2017-08-01 2019-02-07 Julius-Maximilians-Universität Würzburg USE OF CAR-MODIFIED T LYMPHOCYTES FOR FLT3 AND FLT3 INHIBITORS FOR TREATING ACUTE MYELOID LEUKEMIA
US20190328785A1 (en) * 2018-04-30 2019-10-31 The Board Of Regents Of The University Of Oklahoma Flt3-binding chimeric antigen receptors, cells, and uses thereof
WO2020019983A1 (zh) * 2018-07-27 2020-01-30 赛诺生(深圳)基因产业发展有限公司 一种用于治疗肿瘤的基因工程细胞
CN111164203A (zh) * 2017-08-02 2020-05-15 奥托路斯有限公司 表达嵌合抗原受体或工程化tcr并包含选择性表达的核苷酸序列的细胞
KR20210039126A (ko) 2019-10-01 2021-04-09 충북대학교 산학협력단 Cd138에 특이적으로 결합하는 키메릭 항원 수용체, 이를 발현하는 면역세포 및 이의 항암 용도
US20210269534A1 (en) * 2015-09-23 2021-09-02 Cytoimmune Therapeutics, Inc. Flt3 directed car cells for immunotherapy
WO2021212069A1 (en) * 2020-04-17 2021-10-21 City Of Hope Flt3-targeted chimeric antigen receptor modified cells for treatment of flt3-positive malignancies
JP2021535756A (ja) * 2018-08-24 2021-12-23 シェンチェン プレジーン バイオファルマ カンパニー リミテッド 単一ドメイン抗体に基づくbcmaキメラ抗原受容体及びその使用
US20220088070A1 (en) * 2018-11-30 2022-03-24 Juno Therapeutics, Inc. Methods for treatment using adoptive cell therapy
US11299546B2 (en) 2016-05-27 2022-04-12 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services FLT3-specific chimeric antigen receptors and methods using same
RU2820859C2 (ru) * 2017-06-02 2024-06-11 Пфайзер Инк. Химерные антигенные рецепторы, нацеленные на flt3
EP4032972A4 (en) * 2019-09-18 2024-07-24 Slbigen Inc. GENETICALLY MODIFIED NK CELL LINE TRANSDUCED WITH A GENE ENCODING A NEW CHIMERIC ANTIGEN RECEPTOR AND ITS USE
US12163952B2 (en) 2017-02-27 2024-12-10 Juno Therapeutics, Inc. Determining toxicity risk in CAR T-cell therapy
US12258580B2 (en) 2017-11-01 2025-03-25 Juno Therapeutics, Inc. Process for generating therapeutic compositions of engineered cells
US12473365B2 (en) 2018-12-18 2025-11-18 Boehringer Ingelheim International Gmbh FLT3 agonist antibodies and uses thereof
US12583904B2 (en) 2017-06-02 2026-03-24 Juno Therapeutics, Inc. Articles of manufacture and methods for treatment using adoptive cell therapy

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20250067182A (ko) * 2017-11-10 2025-05-14 주라 바이오, 인크. 주 조직적합성 복합체-기반 키메라 수용체 및 자가면역 질병을 치료하기 위한 이의 용도
CN109988759A (zh) * 2017-12-29 2019-07-09 上海细胞治疗研究院 一种在t细胞中具有高转录活性的嵌合启动子
TW202110873A (zh) 2019-04-30 2021-03-16 美商聖堤生物科技股份有限公司 嵌合受體及其使用方法
JP7755597B2 (ja) * 2020-04-09 2025-10-16 オートラス リミテッド 細胞
CN111647071B (zh) * 2020-06-17 2023-05-05 深圳豪石生物科技有限公司 识别靶细胞表面抗原的t细胞受体及其组合物
CN116410315A (zh) * 2021-12-31 2023-07-11 博生吉医药科技(苏州)有限公司 一种新型靶向人flt3的嵌合抗原受体修饰的t细胞的构建及应用

Family Cites Families (66)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4683195A (en) 1986-01-30 1987-07-28 Cetus Corporation Process for amplifying, detecting, and/or-cloning nucleic acid sequences
EP0436597B1 (en) 1988-09-02 1997-04-02 Protein Engineering Corporation Generation and selection of recombinant varied binding proteins
US5223409A (en) 1988-09-02 1993-06-29 Protein Engineering Corp. Directed evolution of novel binding proteins
US6534055B1 (en) 1988-11-23 2003-03-18 Genetics Institute, Inc. Methods for selectively stimulating proliferation of T cells
US6905680B2 (en) 1988-11-23 2005-06-14 Genetics Institute, Inc. Methods of treating HIV infected subjects
US5858358A (en) 1992-04-07 1999-01-12 The United States Of America As Represented By The Secretary Of The Navy Methods for selectively stimulating proliferation of T cells
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
AU7247191A (en) 1990-01-11 1991-08-05 Molecular Affinities Corporation Production of antibodies using gene libraries
US5780225A (en) 1990-01-12 1998-07-14 Stratagene Method for generating libaries of antibody genes comprising amplification of diverse antibody DNAs and methods for using these libraries for the production of diverse antigen combining molecules
US5427908A (en) 1990-05-01 1995-06-27 Affymax Technologies N.V. Recombinant library screening methods
GB9015198D0 (en) 1990-07-10 1990-08-29 Brien Caroline J O Binding substance
US5698426A (en) 1990-09-28 1997-12-16 Ixsys, Incorporated Surface expression libraries of heteromeric receptors
CA2095633C (en) 1990-12-03 2003-02-04 Lisa J. Garrard Enrichment method for variant proteins with altered binding properties
ATE414768T1 (de) 1991-04-10 2008-12-15 Scripps Research Inst Bibliotheken heterodimerer rezeptoren mittels phagemiden
WO1992022324A1 (en) 1991-06-14 1992-12-23 Xoma Corporation Microbially-produced antibody fragments and their conjugates
PT1024191E (pt) 1991-12-02 2008-12-22 Medical Res Council Produção de auto-anticorpos a partir de reportórios de segmentos de anticorpo e exibidos em fagos
US5733743A (en) 1992-03-24 1998-03-31 Cambridge Antibody Technology Limited Methods for producing members of specific binding pairs
WO1995015982A2 (en) 1993-12-08 1995-06-15 Genzyme Corporation Process for generating specific antibodies
DE69534347T2 (de) 1994-01-31 2006-05-24 Trustees Of Boston University, Boston Bibliotheken aus Polyklonalen Antikörpern
US5635388A (en) 1994-04-04 1997-06-03 Genentech, Inc. Agonist antibodies against the flk2/flt3 receptor and uses thereof
US7175843B2 (en) 1994-06-03 2007-02-13 Genetics Institute, Llc Methods for selectively stimulating proliferation of T cells
US5516637A (en) 1994-06-10 1996-05-14 Dade International Inc. Method involving display of protein binding pairs on the surface of bacterial pili and bacteriophage
GB9416721D0 (en) 1994-08-18 1994-10-12 Short Brothers Plc A bias yarn assembly forming device
US5712149A (en) 1995-02-03 1998-01-27 Cell Genesys, Inc. Chimeric receptor molecules for delivery of co-stimulatory signals
US7067318B2 (en) 1995-06-07 2006-06-27 The Regents Of The University Of Michigan Methods for transfecting T cells
US6692964B1 (en) 1995-05-04 2004-02-17 The United States Of America As Represented By The Secretary Of The Navy Methods for transfecting T cells
ES2176484T3 (es) 1995-08-18 2002-12-01 Morphosys Ag Bancos de proteinas/(poli)peptidos.
JP2978435B2 (ja) 1996-01-24 1999-11-15 チッソ株式会社 アクリロキシプロピルシランの製造方法
DE19608769C1 (de) 1996-03-07 1997-04-10 Univ Eberhard Karls Antikörper BV10A4H2
US6924123B2 (en) 1996-10-29 2005-08-02 Oxford Biomedica (Uk) Limited Lentiviral LTR-deleted vector
ES2327382T3 (es) 1999-07-20 2009-10-29 Morphosys Ag Metodos para presentar (poli)peptidos/proteinas en particulas de bacteriofagos a traves de enlaces disulfuro.
US6867041B2 (en) 2000-02-24 2005-03-15 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
KR20030032922A (ko) 2000-02-24 2003-04-26 싸이트 테라피스 인코포레이티드 세포의 동시 자극 및 농축
US6797514B2 (en) 2000-02-24 2004-09-28 Xcyte Therapies, Inc. Simultaneous stimulation and concentration of cells
US7419829B2 (en) 2000-10-06 2008-09-02 Oxford Biomedica (Uk) Limited Vector system
IL157335A0 (en) 2001-03-13 2004-02-19 Novartis Ag Lentiviral packaging constructs
US8034904B2 (en) * 2002-06-14 2011-10-11 Immunogen Inc. Anti-IGF-I receptor antibody
SI1583830T1 (sl) 2003-01-07 2006-12-31 Symphogen As Postopek za pripravo rekombinantnih poliklonskih proteinov
US20130266551A1 (en) 2003-11-05 2013-10-10 St. Jude Children's Research Hospital, Inc. Chimeric receptors with 4-1bb stimulatory signaling domain
AR071891A1 (es) 2008-05-30 2010-07-21 Imclone Llc Anticuerpos humanos anti-flt3 (receptor tirosina cinasa 3 tipo fms humano)
DK2516468T3 (en) * 2009-12-23 2016-05-23 Synimmune Gmbh ANTI-FLT3 ANTIBODIES AND METHODS FOR USING THESE
US9089520B2 (en) * 2010-05-21 2015-07-28 Baylor College Of Medicine Methods for inducing selective apoptosis
US9233125B2 (en) 2010-12-14 2016-01-12 University Of Maryland, Baltimore Universal anti-tag chimeric antigen receptor-expressing T cells and methods of treating cancer
WO2013044225A1 (en) 2011-09-22 2013-03-28 The Trustees Of The University Of Pennsylvania A universal immune receptor expressed by t cells for the targeting of diverse and multiple antigens
EP2817330B1 (en) 2012-02-22 2020-07-08 The Trustees of the University of Pennsylvania Use of icos-based cars to enhance antitumor activity and car persistence
MX367730B (es) * 2012-09-04 2019-09-04 Cellectis Receptor de antigeno quimerico multi-cadena y usos del mismo.
CN113005091A (zh) 2013-02-06 2021-06-22 细胞基因公司 具有改进特异性的修饰的t淋巴细胞
DK2956175T3 (da) 2013-02-15 2017-11-27 Univ California Kimærisk antigenreceptor og fremgangsmåder til anvendelse deraf
ES2671004T3 (es) * 2013-03-07 2018-06-04 Baylor College Of Medicine Dirección a CD138 en cáncer
US9657105B2 (en) 2013-03-15 2017-05-23 City Of Hope CD123-specific chimeric antigen receptor redirected T cells and methods of their use
UY35468A (es) * 2013-03-16 2014-10-31 Novartis Ag Tratamiento de cáncer utilizando un receptor quimérico de antígeno anti-cd19
CN105814083A (zh) 2013-10-15 2016-07-27 加州生物医学研究所 嵌合抗原受体t细胞开关和其用途
CN105829349B (zh) 2013-10-15 2023-02-03 斯克利普斯研究所 肽嵌合抗原受体t细胞开关和其用途
WO2015112626A1 (en) * 2014-01-21 2015-07-30 June Carl H Enhanced antigen presenting ability of car t cells by co-introduction of costimulatory molecules
US20170335281A1 (en) * 2014-03-15 2017-11-23 Novartis Ag Treatment of cancer using chimeric antigen receptor
CN104091269A (zh) 2014-06-30 2014-10-08 京东方科技集团股份有限公司 一种虚拟试衣方法及虚拟试衣系统
KR20170032406A (ko) 2014-07-15 2017-03-22 주노 쎄러퓨티크스 인코퍼레이티드 입양 세포 치료를 위한 조작된 세포
CA2964958A1 (en) 2014-10-31 2016-05-06 The Trustees Of The University Of Pennsylvania Methods and compositions for modified t cells
EP3234144B1 (en) 2014-12-15 2020-08-26 Bellicum Pharmaceuticals, Inc. Methods for controlled elimination of therapeutic cells
HK1245827B (en) 2014-12-15 2020-06-19 Board Of Regents Of The University Of Texas System Methods for controlled activation or elimination of therapeutic cells
EP3268038B1 (en) 2015-03-09 2021-05-05 Agensys, Inc. Antibody drug conjugates (adc) that bind to flt3 proteins
TWI829617B (zh) 2015-07-31 2024-01-21 德商安美基研究(慕尼黑)公司 Flt3及cd3抗體構築體
US10286092B2 (en) * 2015-08-25 2019-05-14 Ucl Business Plc Detecting a therapeutic cell
EP3569244A1 (en) * 2015-09-23 2019-11-20 CytoImmune Therapeutics, LLC Flt3 directed car cells for immunotherapy
MY201312A (en) 2017-06-02 2024-02-16 Pfizer Antibodies specific for flt3 and their uses
WO2020010284A1 (en) 2018-07-04 2020-01-09 Cytoimmune Therapeutics, LLC Compositions and methods for immunotherapy targeting flt3, pd-1, and/or pd-l1

Cited By (37)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20210269534A1 (en) * 2015-09-23 2021-09-02 Cytoimmune Therapeutics, Inc. Flt3 directed car cells for immunotherapy
US12202902B2 (en) 2016-05-27 2025-01-21 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services FLT3-specific chimeric antigen receptors and methods using same
US11299546B2 (en) 2016-05-27 2022-04-12 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services FLT3-specific chimeric antigen receptors and methods using same
US12012455B2 (en) 2016-12-21 2024-06-18 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Human monoclonal antibodies specific for FLT3 and uses thereof
EP4219556A3 (en) * 2016-12-21 2023-10-11 The United States of America as represented by The Secretary Department of Health and Human Services Human monoclonal antibodies specific for flt3 and uses thereof
WO2018119279A1 (en) * 2016-12-21 2018-06-28 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Human monoclonal antibodies specific for flt3 and uses thereof
US11236171B2 (en) 2016-12-21 2022-02-01 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Human monoclonal antibodies specific for FLT3 and uses thereof
US12163952B2 (en) 2017-02-27 2024-12-10 Juno Therapeutics, Inc. Determining toxicity risk in CAR T-cell therapy
US11421040B2 (en) 2017-06-02 2022-08-23 Pfizer Inc. Antibodies specific for FLT3 and their uses
KR20200014777A (ko) * 2017-06-02 2020-02-11 화이자 인코포레이티드 Flt3을 표적으로 하는 키메라 항원 수용체
KR102725603B1 (ko) * 2017-06-02 2024-11-04 화이자 인코포레이티드 Flt3을 표적으로 하는 키메라 항원 수용체
US12583904B2 (en) 2017-06-02 2026-03-24 Juno Therapeutics, Inc. Articles of manufacture and methods for treatment using adoptive cell therapy
CN110831970B (zh) * 2017-06-02 2024-12-17 辉瑞公司 靶向flt3的嵌合抗原受体
US12296012B2 (en) 2017-06-02 2025-05-13 Pfizer Inc. Chimeric antigen receptors targeting FLT3
IL271110B2 (en) * 2017-06-02 2025-04-01 Pfizer FLT3-specific antibodies and their uses
CN110831970A (zh) * 2017-06-02 2020-02-21 辉瑞公司 靶向flt3的嵌合抗原受体
RU2820859C2 (ru) * 2017-06-02 2024-06-11 Пфайзер Инк. Химерные антигенные рецепторы, нацеленные на flt3
WO2018220584A1 (en) * 2017-06-02 2018-12-06 Pfizer Inc. Antibodies specific for flt3 and their uses
US12202910B2 (en) 2017-06-02 2025-01-21 Pfizer Inc. Antibodies specific for FLT3 and their uses
TWI778068B (zh) * 2017-06-02 2022-09-21 美商輝瑞大藥廠 靶向flt3之嵌合抗原受體
WO2018222935A1 (en) * 2017-06-02 2018-12-06 Pfizer Inc. Chimeric antigen receptors targeting flt3
JP7317718B2 (ja) 2017-06-02 2023-07-31 ファイザー・インク Flt3を標的にするキメラ抗原受容体
JP2023134419A (ja) * 2017-06-02 2023-09-27 ファイザー・インク Flt3を標的にするキメラ抗原受容体
JP2020522252A (ja) * 2017-06-02 2020-07-30 ファイザー・インク Flt3を標的にするキメラ抗原受容体
WO2019025484A1 (en) * 2017-08-01 2019-02-07 Julius-Maximilians-Universität Würzburg USE OF CAR-MODIFIED T LYMPHOCYTES FOR FLT3 AND FLT3 INHIBITORS FOR TREATING ACUTE MYELOID LEUKEMIA
CN111542323A (zh) * 2017-08-01 2020-08-14 尤利乌斯·马克西米利安维尔茨堡大学 Flt3 car-t细胞和flt3抑制剂在治疗急性髓细胞性白血病中的用途
CN111164203A (zh) * 2017-08-02 2020-05-15 奥托路斯有限公司 表达嵌合抗原受体或工程化tcr并包含选择性表达的核苷酸序列的细胞
US12258580B2 (en) 2017-11-01 2025-03-25 Juno Therapeutics, Inc. Process for generating therapeutic compositions of engineered cells
US20190328785A1 (en) * 2018-04-30 2019-10-31 The Board Of Regents Of The University Of Oklahoma Flt3-binding chimeric antigen receptors, cells, and uses thereof
WO2020019983A1 (zh) * 2018-07-27 2020-01-30 赛诺生(深圳)基因产业发展有限公司 一种用于治疗肿瘤的基因工程细胞
JP7237287B2 (ja) 2018-08-24 2023-03-13 シェンチェン プレジーン バイオファルマ カンパニー リミテッド 単一ドメイン抗体に基づくbcmaキメラ抗原受容体及びその使用
JP2021535756A (ja) * 2018-08-24 2021-12-23 シェンチェン プレジーン バイオファルマ カンパニー リミテッド 単一ドメイン抗体に基づくbcmaキメラ抗原受容体及びその使用
US20220088070A1 (en) * 2018-11-30 2022-03-24 Juno Therapeutics, Inc. Methods for treatment using adoptive cell therapy
US12473365B2 (en) 2018-12-18 2025-11-18 Boehringer Ingelheim International Gmbh FLT3 agonist antibodies and uses thereof
EP4032972A4 (en) * 2019-09-18 2024-07-24 Slbigen Inc. GENETICALLY MODIFIED NK CELL LINE TRANSDUCED WITH A GENE ENCODING A NEW CHIMERIC ANTIGEN RECEPTOR AND ITS USE
KR20210039126A (ko) 2019-10-01 2021-04-09 충북대학교 산학협력단 Cd138에 특이적으로 결합하는 키메릭 항원 수용체, 이를 발현하는 면역세포 및 이의 항암 용도
WO2021212069A1 (en) * 2020-04-17 2021-10-21 City Of Hope Flt3-targeted chimeric antigen receptor modified cells for treatment of flt3-positive malignancies

Also Published As

Publication number Publication date
JP7054924B2 (ja) 2022-04-15
AU2016326721A1 (en) 2018-04-12
AU2021201329A1 (en) 2021-03-18
EP3569244A1 (en) 2019-11-20
EP3352784A4 (en) 2019-06-26
US10961312B2 (en) 2021-03-30
HK1258921A1 (zh) 2019-11-22
CA2999037A1 (en) 2017-03-30
AU2016326721C1 (en) 2021-06-03
JP2022046461A (ja) 2022-03-23
CN109310744A (zh) 2019-02-05
JP2018529380A (ja) 2018-10-11
US20210269534A1 (en) 2021-09-02
EP3352784A2 (en) 2018-08-01
AU2016326721B2 (en) 2020-12-03
US20180118838A1 (en) 2018-05-03
KR20180053744A (ko) 2018-05-23
WO2017053889A3 (en) 2017-05-26

Similar Documents

Publication Publication Date Title
AU2016326721B2 (en) FLT3 directed car cells for immunotherapy
US20250179194A1 (en) Compositions and methods for immunotherapy targeting flt3, pd-1, and/or pd-l1
US20240336680A1 (en) Novel cldn 18.2-specific monoclonal antibodies and methods of use thereof
JP7202689B2 (ja) 二重特異性抗体car細胞免疫療法
JP6879932B2 (ja) 神経膠芽腫のためのegfr指向car療法
US20180291089A1 (en) Secretory tnt car cell immunotherapy
US20220281982A1 (en) Bispecific antibody car cell immunotherapy
AU2016270474A1 (en) Lym-1 and Lym-2 targeted CAR cell immunotherapy
WO2018057904A1 (en) Chimeric antigen receptors and compositions and methods of use thereof
US20240150470A1 (en) Lym-1 and lym-2 antibody compositions and improved car constructs
HK40016317A (en) Flt3 directed car cells for immunotherapy

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16849810

Country of ref document: EP

Kind code of ref document: A2

ENP Entry into the national phase

Ref document number: 2999037

Country of ref document: CA

ENP Entry into the national phase

Ref document number: 2018534523

Country of ref document: JP

Kind code of ref document: A

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2016326721

Country of ref document: AU

Date of ref document: 20160923

Kind code of ref document: A

ENP Entry into the national phase

Ref document number: 20187011302

Country of ref document: KR

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: 2016849810

Country of ref document: EP

121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 16849810

Country of ref document: EP

Kind code of ref document: A2