WO2017004026A1 - Anti-cd 123 antibodies and conjugates and derivatives thereof - Google Patents
Anti-cd 123 antibodies and conjugates and derivatives thereof Download PDFInfo
- Publication number
- WO2017004026A1 WO2017004026A1 PCT/US2016/039797 US2016039797W WO2017004026A1 WO 2017004026 A1 WO2017004026 A1 WO 2017004026A1 US 2016039797 W US2016039797 W US 2016039797W WO 2017004026 A1 WO2017004026 A1 WO 2017004026A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- ala
- antibody
- val
- seq
- antigen
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
- 0 CC(C)[C@@](CCC1=C2C3=C1C(*)=C2)(C(C=NOCCCNC(CCCCC(N[C@@](C)C(N[C@@](C)C(Nc1cc(COc(c(OC)c2)cc(NC[C@](C4)N5c6c4cccc6)c2C5=O)cc(COc(cc(c2c4)NC(C)[C@](Cc5ccccc55)N5C2=O)c4OC)c1)=O)=O)=O)=O)=O)C3=C Chemical compound CC(C)[C@@](CCC1=C2C3=C1C(*)=C2)(C(C=NOCCCNC(CCCCC(N[C@@](C)C(N[C@@](C)C(Nc1cc(COc(c(OC)c2)cc(NC[C@](C4)N5c6c4cccc6)c2C5=O)cc(COc(cc(c2c4)NC(C)[C@](Cc5ccccc55)N5C2=O)c4OC)c1)=O)=O)=O)=O)=O)C3=C 0.000 description 20
- MJEKMYYSIWOILD-FIVVQALRSA-N C[C@@H]([C@@H]1O[C@@]1(C)CCC(N(C)c1cc(C/C(/C)=C/C=C/[C@H]([C@@](C2)(N3)O)OC)cc(OC)c1Cl)=O)[C@H]2OC3=O Chemical compound C[C@@H]([C@@H]1O[C@@]1(C)CCC(N(C)c1cc(C/C(/C)=C/C=C/[C@H]([C@@](C2)(N3)O)OC)cc(OC)c1Cl)=O)[C@H]2OC3=O MJEKMYYSIWOILD-FIVVQALRSA-N 0.000 description 3
- SZVNORTXUATKNF-HWKANZROSA-N C/C=N/NC(C)=O Chemical compound C/C=N/NC(C)=O SZVNORTXUATKNF-HWKANZROSA-N 0.000 description 1
- BIIKMQCNWYYZOM-ZZXKWVIFSA-N CC1(N/N=C/C)OC1 Chemical compound CC1(N/N=C/C)OC1 BIIKMQCNWYYZOM-ZZXKWVIFSA-N 0.000 description 1
- UIPSGWFDMKDFEY-UHFFFAOYSA-N CC1(NNC)OC1 Chemical compound CC1(NNC)OC1 UIPSGWFDMKDFEY-UHFFFAOYSA-N 0.000 description 1
- XAZKFISIRYLAEE-UHFFFAOYSA-N CC1CC(C)CC1 Chemical compound CC1CC(C)CC1 XAZKFISIRYLAEE-UHFFFAOYSA-N 0.000 description 1
- PNLDTMJPZNCXNZ-COCZKOEFSA-N COCCOCCOCCN(CCCC(ON(C(CC1)=O)C1=O)=O)c1cc(COc(c(OC)c2)cc(N=C[C@H]3N4c5ccccc5C3)c2C4=O)cc(COc(c(OC)c2)cc(NC[C@H](C3)N4c5c3cccc5)c2C4=O)c1 Chemical compound COCCOCCOCCN(CCCC(ON(C(CC1)=O)C1=O)=O)c1cc(COc(c(OC)c2)cc(N=C[C@H]3N4c5ccccc5C3)c2C4=O)cc(COc(c(OC)c2)cc(NC[C@H](C3)N4c5c3cccc5)c2C4=O)c1 PNLDTMJPZNCXNZ-COCZKOEFSA-N 0.000 description 1
- BFOMGMZGGXNOAT-DVRNEFKISA-N C[C@@H](C(N[C@@H](C)C(Nc1cc(COc(c(OC)c2)cc(NC([C@H]3N4c5ccccc5C3)S(O)(=O)=O)c2C4=O)cc(COc(c(OC)c2)cc(NC[C@H]3N4c5ccccc5C3)c2C4=O)c1)=O)=O)NC(CCCCC(NCCCO)=O)=O Chemical compound C[C@@H](C(N[C@@H](C)C(Nc1cc(COc(c(OC)c2)cc(NC([C@H]3N4c5ccccc5C3)S(O)(=O)=O)c2C4=O)cc(COc(c(OC)c2)cc(NC[C@H]3N4c5ccccc5C3)c2C4=O)c1)=O)=O)NC(CCCCC(NCCCO)=O)=O BFOMGMZGGXNOAT-DVRNEFKISA-N 0.000 description 1
- FWWYSXFMMHJFCN-VKHMYHEASA-N C[C@@H](C([O-5])=O)N(C)I Chemical compound C[C@@H](C([O-5])=O)N(C)I FWWYSXFMMHJFCN-VKHMYHEASA-N 0.000 description 1
- QCYOIFVBYZNUNW-BYPYZUCNSA-M C[C@@H](C([O-])=O)N(C)C Chemical compound C[C@@H](C([O-])=O)N(C)C QCYOIFVBYZNUNW-BYPYZUCNSA-M 0.000 description 1
- KJDAWUUMIVKTLK-JFBFTVNYSA-N C[C@@H]([C@@H]1O[C@@]1(C)CCC(N(C)c1cc(C/C(/C)=C/C=C/C[C@@](C2)(N3)O)cc(OC)c1Cl)=O)[C@H]2OC3=O Chemical compound C[C@@H]([C@@H]1O[C@@]1(C)CCC(N(C)c1cc(C/C(/C)=C/C=C/C[C@@](C2)(N3)O)cc(OC)c1Cl)=O)[C@H]2OC3=O KJDAWUUMIVKTLK-JFBFTVNYSA-N 0.000 description 1
- ODVRLSOMTXGTMX-UHFFFAOYSA-N NCCN(C(C=C1)=O)C1=O Chemical compound NCCN(C(C=C1)=O)C1=O ODVRLSOMTXGTMX-UHFFFAOYSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2866—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for cytokines, lymphokines, interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/535—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines
- A61K31/5365—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with at least one nitrogen and one oxygen as the ring hetero atoms, e.g. 1,2-oxazines ortho- or peri-condensed with heterocyclic ring systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/55—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
- A61K31/551—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogen atoms, e.g. dilazep
- A61K31/5513—1,4-Benzodiazepines, e.g. diazepam or clozapine
- A61K31/5517—1,4-Benzodiazepines, e.g. diazepam or clozapine condensed with five-membered rings having nitrogen as a ring hetero atom, e.g. imidazobenzodiazepines, triazolam
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
- A61K39/001102—Receptors, cell surface antigens or cell surface determinants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/65—Peptidic linkers, binders or spacers, e.g. peptidic enzyme-labile linkers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68033—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a maytansine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68035—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a pyrrolobenzodiazepine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6883—Polymer-drug antibody conjugates, e.g. mitomycin-dextran-Ab; DNA-polylysine-antibody complex or conjugate used for therapy
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/24—Immunoglobulins specific features characterized by taxonomic origin containing regions, domains or residues from different species, e.g. chimeric, humanized or veneered
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention generally relates to antibodies, antigen-binding fragments thereof, polypeptides, and immunoconjugates that bind to CD 123 antigen (the a chain of the interleukin-3 receptor, or IL-3Ra).
- CD 123 antigen the a chain of the interleukin-3 receptor, or IL-3Ra.
- the present invention also relates to methods of using such CD123-binding molecules for diagnosing and treating diseases, such as B-cell malignancies.
- CD 123 (interleukin 3 receptor alpha, IL-3Ra) is a 40 kDa molecule that is part of the interleukin 3 receptor (IL-3R) complex.
- the cytokine Interleukin 3 (IL-3) drives early differentiation of multipotent stem cells into cells of the erythroid, myeloid and lymphoid progenitors.
- CD123 is expressed on CD34 + -committed progenitors, but not by CD34 + /CD38 normal hematopoietic stem cells (HSCs).
- CD123 is expressed by basophils, mast cells, plasmacytoid dendritic cells, some expression by monocytes, macrophages and eosinophils, and low or no expression by neutrophils and megakaryocytes.
- Some non-hematopoietic tissues such as placenta, Leydig cells of the testis, certain brain cell elements and some endothelial cells, also express CD 123. However, expression there is mostly cytoplasm
- CD 123 is reported to be expressed by leukemic blast cells ("leukemia blasts") and leukemia stem cells (LSC) (Jordan et al., Leukemia 14: 1777-1784, 2000; Jin et al., Blood 113:6603-6610, 2009). In human normal precursor populations, CD123 is expressed by a subset of hematopoietic progenitor cells (HPC), but not by normal HSCs. CD 123 is also reportedly expressed by plasmacytoid dendritic cells (pDC) and basophils, and, to a lesser extent, monocytes and eosinophils.
- HPC hematopoietic progenitor cells
- pDC plasmacytoid dendritic cells
- CD 123 has been reported to be overexpressed on malignant cells in a wide range of hematologic malignancies including acute myeloid leukemia (AML) and myelodysplastic syndrome (MDS) (Munoz et al., Haematologica 86(12): 1261-1269, 2001). Overexpression of CD123 is associated with poorer prognosis in AML (Tettamanti et al., Br. J. Haematol. 161:389-401, 2013).
- AML acute myeloid leukemia
- MDS myelodysplastic syndrome
- LSCs leukemic stem cells
- CD123 is not present in the corresponding normal hematopoietic stem cell population in normal human bone marrow (Jin et al., Blood 113:6603-6610, 2009; Jordan et al., Leukemia 14: 1777-1784, 2000).
- CD 123 expression is also associated with multiple other malignancies / pre-malignancies: chronic myeloid leukemia (CML) progenitor cells (including blast crisis CML); Hodgkin's Reed Sternberg (RS) cells; transformed non-Hodgkin's lymphoma (NHL); some chronic lymphocytic leukemia (CLL) (CDl lc + ); a subset of acute T lymphoblastic leukemia (T-ALL) (16%, most immature, mostly adult), plasmacytoid dendritic cell (pDC) (DC2) malignancies and CD34 + /CD38 " myelodysplastic syndrome (MDS) marrow cell malignancies.
- CML chronic myeloid leukemia
- RS Hodgkin's Reed Sternberg
- NDL transformed non-Hodgkin's lymphoma
- CLL chronic lymphocytic leukemia
- T-ALL acute T lymphoblastic leukemia
- DC2 plasmacytoid dendriti
- AML is a clonal disease characterized by the proliferation and accumulation of transformed myeloid progenitor cells in the bone marrow, which ultimately leads to hematopoietic failure.
- the incidence of AML increases with age, and older patients typically have worse treatment outcomes than do younger patients (Robak et al., Clin. Ther. 2:2349- 2370, 2009). Unfortunately, at present, most adults with AML die from their disease.
- Treatment for AML initially focuses in the induction of remission (induction therapy). Once remission is achieved, treatment shifts to focus on securing such remission (post- remission or consolidation therapy) and, in some instances, maintenance therapy.
- the standard remission induction paradigm for AML is chemotherapy with an anthracycline / cytarabine combination, followed by either consolidation chemotherapy, usually with higher doses of the same drugs as were used during the induction period, or human stem cell transplantation, depending on the patient's ability to tolerate intensive treatment and the likelihood of cure with chemotherapy alone (see Roboz, Curr. Opin. Oncol. 24:711-719, 2012).
- Agents frequently used in induction therapy include cytarabine and the
- anthracyclines Cytarabine, also known as AraC, kills cancer cells and other rapidly dividing normal cells by interfering with DNA synthesis.
- Side effects associated with AraC treatment include decreased resistance to infection, a result of decreased white blood cell production; bleeding, as a result of decreased platelet production; and anemia, due to a potential reduction in red blood cells.
- Other side effects include nausea and vomiting.
- Anthracyc lines e.g. , daunorubicin, doxorubicin, and idarubicin
- have several modes of action including inhibition of DNA and RNA synthesis, disruption of higher order structures of DNA, and production of cell damaging free oxygen radicals. The most consequential adverse effect of anthracyc lines is cardio toxicity, which considerably limits administered life-time dose and to some extent their usefulness.
- ADC Antibody-drug conjugates
- other cell binding agent-drug conjugates are emerging as a powerful class of anti-tumor agents with efficacy across a range of cancers.
- Cell binding agent-drug conjugates are commonly composed of three distinct elements: a cell-binding agent (e.g. , an antibody); a linker; and a cytotoxic moiety.
- the cytotoxic drug moiety is covalently attached to lysine residues on the antibody, or to cysteine residues, obtained through reduction of interchain disulfide bonds, resulting in ADCs that are heterogeneous mixtures bearing varying numbers of drugs attached at different positions on the antibody molecule.
- the present invention is based on the surprising findings that the conjugates of the present invention are highly potent against various CD123-expressing cancer cells, particularly leukemia with at least one negative prognostic factors.
- One aspect of the invention provides an antibody or antigen-binding fragment thereof that: (a) binds an epitope within amino acids 101 to 346 of human CD123 / IL3-Ra antigen, and (b) inhibits IL3 -dependent proliferation in antigen-positive TF- 1 cells.
- the antibody or antigen-binding fragment thereof binds an epitope within amino acids 101 to 204 of human CD 123 antigen. In another embodiment, the antibody or antigen-binding fragment thereof binds an epitope within amino acids 205 to 346 of human CD 123 antigen.
- a related aspect of the invention provides an antibody or antigen-binding fragment thereof that: (a) binds an epitope within amino acids 1 to 100 of human CD 123 antigen, and (b) inhibits IL3-dependent proliferation in antigen-positive TF-1 cells, with an IC 50 value of 0.1 nM or less ⁇ e.g. , 0.08 nM, 0.05 nM, 0.03 nM).
- the antibody or antigen-binding fragment thereof inhibits the proliferation of leukemic stem cells or leukemic blast cells but not hematopoietic stem cells.
- the antibody or antigen-binding fragment thereof binds to human CD 123 antigen-positive cells with a dissociation constant (K d ) of 0.3 nM or lower, such as between 0.01 nM and 0.3 nM, between 0.01 nM and 0.2 nM, between 0.01 nM and 0.19 nM, between 0.01 nM and 0.18 nM, between 0.01 nM and 0.15 nM, or between 0.01 nM and 0.1 nM.
- K d dissociation constant
- the antibody or antigen-binding fragment thereof binds to cynomolgus monkey CD 123.
- the antibody or antigen-binding fragment thereof may bind to cynomolgus monkey CD 123 with a K d of between 0.05 and 0.3 nM, between 0.05 and 0.2 nM, between 0.05 nM and 0.19 nM, between 0.05 nM and 0.18 nM, between 0.05 nM and 0.15 nM, or between 0.05 and 0.1 nM.
- the antibody or antigen-binding fragment thereof binds both human and cynomolgus monkey CD 123 with a substantially similar binding affinity.
- the antibody or antigen-binding fragment thereof may bind to human and cynomolgus monkey CD 123 with a IQ of between 0.05 and 0.3 nM, between 0.05 and 0.2 nM, or between 0.05 and 0.1 nM.
- the IQ may be measured by flow cytometry, surface plasmon resonance, or radioimmunoassay.
- the antibody or antigen-binding fragment thereof inhibits at least 50% of IL3 -dependent proliferation in antigen-positive TF-1 cells at a concentration of 0.5 nM or lower.
- the antibody or antigen-binding fragment thereof may comprise: a) at least one heavy chain variable region or fragment thereof comprising three sequential complementarity-determining regions (CDR) CDR1, CDR2, and CDR3, respectively, wherein, with the exception of 1, 2, or 3 conservative amino acid substitutions, CDR1 is selected from the group consisting of: SEQ ID NOs: 1, 5, and 12, CDR2 is selected from the group consisting of: SEQ ID NOs: 2, 3, 6-10, 13, and 14, and, optionally, CDR3 is selected from the group consisting of: SEQ ID NOs: 4, 11, 15 and 70; and b) at least one light chain variable region or fragment thereof comprising three sequential complementarity- determining regions (CDR) CDR1, CDR2, and CDR3, respectively, wherein, with the exception of 1, 2, or 3 conservative amino acid substitutions, CDR1 is selected from the group consisting of: SEQ ID NOs: 16, 19, 20, 23 and 72, CDR2 is selected from the group consisting of: SEQ ID NOs: 17, 21, 24
- the antibody or antigen-binding fragment thereof may comprise: a) at least one heavy chain variable region or fragment thereof comprising three sequential complementarity-determining regions (CDR) CDR1, CDR2, and CDR3, respectively, wherein, with the exception of 1, 2, or 3 conservative amino acid substitutions, CDR1 is selected from the group consisting of: SEQ ID NOs: 1, 5, and 12, CDR2 is selected from the group consisting of: SEQ ID NOs: 2, 3, 6- 10, 13, and 14, and, optionally, CDR3 is selected from the group consisting of: SEQ ID NOs: 4, 11 and 15; and b) at least one light chain variable region or fragment thereof comprising three sequential complementarity- determining regions (CDR) CDR1, CDR2, and CDR3, respectively, wherein, with the exception of 1, 2, or 3 conservative amino acid substitutions, CDR1 is selected from the group consisting of: SEQ ID NOs: 16, 19, 20 and 23, CDR2 is selected from the group consisting of: SEQ ID NOs: 17, 21, and 24, and, optional
- the conservative amino acid substitutions comprise a substitution of at least one Lys in a CDR by an Arg.
- the antibody is a CDR-grafted humanized antibody comprising mouse CDR regions, and wherein one or more (e.g. , 1, 2, 3, 4, 5, 6, 7, or 8) heavy chain and/or light chain framework region vernier zone residues of said antibody is of mouse origin.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 39 or 40; and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 41.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 34; and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 35.
- Xaa the second residue from the N-terminus of SEQ ID NO: 34, is Phe. In other embodiments, Xaa is Val.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 39 or 40, except that the N-terminal residue is Ser; and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 41.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 39 or 40; and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 41, except that the N-terminal residue is Ser.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 59 or 60, except that the N-terminal residue is Ser, and except that the residue corresponding to the 5 th to the last residue of SEQ ID NO: 54 is Cys (i.e., Cys at EU/OU numbering position 442); and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 41.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 59 or 60, except that the residue corresponding to the 5 th to the last residue of SEQ ID NO: 54 is Cys; and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 41, except that the N-terminal residue is Ser.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 38; and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 35.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 34; and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 37.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 56; and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 35.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 54; and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 37.
- Xaa the second residue from the N-terminus of SEQ ID NOS: 38, 34, 56, and 54, is Phe. In other embodiments, Xaa is Val.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 59 or 60, except that the residue corresponding to the 5 th to the last residue of SEQ ID NO: 54 is Cys; and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 41.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 54; and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 35.
- Xaa the second residue from the N-terminus of SEQ ID NO: 54 or 56, is Phe. In other embodiments, Xaa is Val.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain variable region comprising a CDR1 having an amino acid sequence set forth in SEQ ID NO: 1, a CDR2 having an amino acid sequence set forth in SEQ ID NO: 2 or 3, and a CDR3 having an amino acid sequence set forth in SEQ ID NO: 4; and b) an immunoglobulin light chain variable region comprising a CDR1 having an amino acid sequence set forth in SEQ ID NO: 16, a CDR2 having an amino acid sequence set forth in SEQ ID NO: 17, and a CDR3 having an amino acid sequence set forth in SEQ ID NO: 18.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain variable region comprising a CDR1 having an amino acid sequence set forth in SEQ ID NO: 5, a CDR2 having an amino acid sequence set forth in SEQ ID NO: 6, 7, 8, 9, or 10, and a CDR3 having an amino acid sequence set forth in SEQ ID NO: 11; and, b) an immunoglobulin light chain variable region comprising a CDR1 having an amino acid sequence set forth in SEQ ID NO: 19 or 20, a CDR2 having an amino acid sequence set forth in SEQ ID NO: 21, and a CDR3 having an amino acid sequence set forth in SEQ ID NO: 22.
- the antibody or antigen-binding fragment thereof may comprise: a) an immunoglobulin heavy chain variable region comprising a CDR1 having an amino acid sequence set forth in SEQ ID NO: 12, a CDR2 having an amino acid sequence set forth in SEQ ID NO: 13 or 14, and a CDR3 having an amino acid sequence set forth in SEQ ID NO: 15; and b) an immunoglobulin light chain variable region comprising a CDR1 having an amino acid sequence set forth in SEQ ID NO: 23, a CDR2 having an amino acid sequence set forth in SEQ ID NO: 24, and a CDR3 having an amino acid sequence set forth in SEQ ID NO: 25.
- the antibody or antigen-binding fragment thereof may comprise: a) a V H sequence at least 95% identical to a reference V H sequence selected from the group consisting of: SEQ ID NOs: 26, 28, 30, 32, 34, 38, 39, and 40 (preferably 26, 28, 30, 32, 34, and 38); and/or, b) a V L sequence at least 95% identical to a reference V L sequence selected from the group consisting of: SEQ ID NOs: 27, 29, 31, 33, 35, 37, and 41 (preferably 27, 29, 31, 35, and 37).
- the V H sequence is at least 99% identical to one of SEQ ID NOs: 26, 28, 30, 32, 34, 38, 39, and 40 (preferably 26, 28, 30, 32, 34, and 38), and/or wherein the V L sequence is at least 99% identical to one of SEQ ID NOs: 27, 29, 31, 33, 35, 37, and 41 (preferably 27, 29, 31, 35, and 37).
- the antibody or antigen-binding fragment thereof may comprise: a) a V H sequence selected from the group consisting of SEQ ID NOs: 26, 28, 30, 32, 34, 38, 39, and 40 (preferably 26, 28, 30, 32, 34, and 38); and/or, b) a V L sequence selected from the group consisting of SEQ ID NOs: 27, 29, 31, 33, 35, 37, and 41 (preferably 27, 29, 31, 35, and 37).
- a V H sequence selected from the group consisting of SEQ ID NOs: 26, 28, 30, 32, 34, 38, 39, and 40 (preferably 26, 28, 30, 32, 34, and 38)
- a V L sequence selected from the group consisting of SEQ ID NOs: 27, 29, 31, 33, 35, 37, and 41 (preferably 27, 29, 31, 35, and 37).
- the antibody or antigen-binding fragment thereof may comprise a V H sequence of SEQ ID NO: 26 and a V L sequence of SEQ ID NO: 27, or a V H sequence of SEQ ID NO: 28 and a V L sequence of SEQ ID NO: 29, or a V H sequence of SEQ ID NO: 30 and a V L sequence of SEQ ID NO: 31, or a V H sequence of SEQ ID NO: 34 and a V L sequence of SEQ ID NO: 35.
- the antibody is a murine, non-human mammal, chimeric, humanized, or human antibody.
- the humanized antibody may be a CDR- grafted antibody or resurfaced antibody.
- the antibody is a full-length antibody.
- the antigen-binding fragment thereof is an Fab, Fab', F(ab') 2 , Fd, single chain Fv or scFv, disulfide linked F v , V-NAR domain, IgNar, intrabody, IgGACH 2 , minibody, F(ab') 3 , tetrabody, triabody, diabody, single-domain antibody, DVD-Ig, Fcab, mAb 2 , (scFv) 2 , or scFv-Fc.
- polypeptide comprising the V H and V L sequences of any of the subject antibody or antigen-binding fragment thereof.
- the polypeptide may be a fusion with a protein that is not a pseudomonas toxin.
- Another aspect of the invention provides a cell producing the antibody or antigen- binding fragment thereof of the invention, or the polypeptide of the invention.
- Another aspect of the invention provides a method of producing the antibody or antigen-binding fragment thereof of the invention, or the polypeptide of the invention, comprising: (a) culturing the cell of the invention; and, (b) isolating the antibody, antigen- binding fragment thereof, or polypeptide from the cultured cell.
- the cell is eukaryotic cell.
- Another aspect of the invention provides an immunoconjugate having the following formula:
- CBA is an antibody or antigen-binding fragment thereof of the invention, or the polypeptide thereof of the invention, that is covalently linked through a lysine residue to Cy L1 ;
- W L is an integer from 1 to 20;
- C L1 is represented by the following formula:
- the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H or a (Ci- C4)alkyl; and when it is a single bond, X is -H or an amine protecting moiety, and Y is -OH or -SO 3 M;
- W is -NR e ,
- R e' is -(CH 2 -CH 2 -0) n -R k ;
- n is an integer from 2 to 6;
- R k is -H or -Me
- R x3 is a (Ci-C 6 )alkyl
- L' is represented by the following formula:
- R 5 is -H or a (Ci-C 3 )alkyl
- P is an amino acid residue or a peptide containing between 2 to 20 amino acid residues
- R a and R b are each independently -H, (Ci- C 3 )alkyl, or a charged substituent or an ionizable group Q;
- n is an integer from 1 to 6;
- Z sl is selected from any one of the following formulas:
- q is an integer from 1 to 5;
- M is H + or a cation.
- R a and R are both H; and R5 is H or Me.
- P is a peptide containing 2 to 5 amino acid residues.
- P may be selected from Gly-Gly-Gly, Ala-Val, Val-Ala, Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Ile-Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe-N 9 - nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, Ile-Ala-Leu, Val- Ala- Val, Ala-Leu-Ala-Leu (SEQ ID NO: 55), ⁇ -Ala-Leu-Ala-Leu (SEQ ID NO: 57), Gly-Phe- Leu-Gly (SEQ ID NO: 73),
- P is Gly-Gly-Gly, Ala-Val, Ala- Ala, Ala-D-Ala, D- Ala- Ala, or D-Ala-D-Ala.
- Q is -SO 3 M.
- the immunoconjugate is represented by the following formula:
- WL is an integer from 1 to 10; the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H; and when it is a single bond, X is -H, and Y is -OH or -SO 3 M.
- a related aspect provides an immunocon ugate having the formula:
- CBA is an antibody or antigen-binding fragment thereof of the invention, or
- polypeptide thereof of the invention that is covalently linked to Cy through a lysine residue
- WL is an integer from 1 to 20;
- the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H or a (Ci- C4)alkyl; and when it is a single bond, X is -H or an amine protecting moiety, and Y is -OH or -SO 3 M;
- R xl and R x2 are independently (Ci-C 6 )alkyl
- R e is -H or a (Ci-C 6 )alkyl
- W is -NR e ,
- R e' is -(CH 2 -CH 2 -0) n -R k ;
- n is an integer from 2 to 6;
- R k is -H or -Me
- Z sl is selected from any one of the following formulas:
- q is an integer from 1 to 5;
- M is -H + or a cation.
- R e is H or Me
- R xl and R x2 are independently -(CH 2 ) P - (CR f R g )-, wherein R f and R g are each independently -H or a and p is 0, 1, 2 or 3.
- R f and R g are the same or different, and are selected from -H and -Me.
- the immunoconjugate is represented by the following formula:
- W L is an integer from 1 to 10; the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H; and when it is a single bond, X is -H and Y is -OH or -SO 3 M.
- the double line ⁇ between N and C represents a double bond, X is absent and Y is -H.
- the double line ⁇ between N and C represents a single bond, X is -H, and Y is -SO 3 M.
- M is H + , Na + or
- Another related aspect of the invention provides an immunoconjugate having the formula:
- CBA is an antibody or antigen-binding fragment thereof of the invention, or the polypeptide of the invention, which is covalently linked to Cy L3 through a Lys residue;
- W L is an integer from 1 to 20;
- Cy L3 is represented by the following formula:
- n' is 1 or 2;
- Ri and R 2 are each independently H or a (Ci-C 3 )alkyl
- Z sl is selected from any one of the following formulas:
- q is an integer from 1 to 5;
- M is H + or a cation.
- n' is 1, and Ri and R 2 are both H. In certain other embodiments, m' is 2, and Ri and R 2 are both Me.
- the immunoconjugate is represented by the following formula:
- W L is an integer from 1 to 10.
- M is H + , Na + or K + .
- Another aspect of the invention provides an immunoconjugate having the following formula: wherein:
- CBA is an antibody or antigen-binding fragment thereof of the invention, or the polypeptide thereof of the invention, covalently linked to the J CB ' group;
- Ws is 1, 2, 3, or 4;
- J CB ' is a moiety formed by reacting an aldehyde group derived from oxidation of a 2-hydroxyethylamine moiety (wherein the 2-hydroxyethylamine moiety can be part of a serine, threonine, hydroxylysine, 4-hydroxyornithie or 2,4-diamino-5-hydroxy valeric acid residue) on an N-terminal of said antibody or antigen-binding fragment thereof of the invention, or the polypeptide thereof of the invention, and an aldehyde reactive group on Cy sl , and is represented by the following formula:
- si is the site covalently linked to the CBA; and s2 is the site covalently linked to Cy sl ;
- Cy sl is represented by the following formula:
- the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H or a (Ci-C4)alkyl; and when it is a single bond, X is -H or an amine protecting moiety, Y is -OH or -SO 3 M, and M is H + or a cation;
- R 5 is -H or a (Ci-C 3 )alkyl
- P is an amino acid residue or a peptide containing 2 to 20 amino acid residues;
- R 9 is -H or a (Ci-C 3 )alkyl
- R a and R are independently -H, (Ci-C 3 )alkyl, or a charged substituent or an ionizable group Q;
- r and r' are independently an integer from 1 to 6;
- W is -NR e ,
- R e' is -(CH 2 -CH 2 -0) n -R k ;
- n is an integer from 2 to 6;
- R k is -H or -Me;
- R x3 is a (Ci-C 6 )alkyl
- L is -NRcr(CRaRb)r" or absent
- r" is an integer from 0 to 6.
- R a and R are both H, and R 5 and R9 are both H or Me.
- P is a peptide containing 2 to 5 amino acid residues.
- P may be selected from the group consisting of: Gly-Gly-Gly, Ala-Val, Val-Ala, Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Ile-Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe-N 9 -nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu- Ala- Leu, He- Ala-Leu, Val- Ala-Val, Ala-Leu- Ala-Leu (SEQ ID NO: 55), ⁇ -Ala-Leu- Ala-Leu (SEQ ID NO: 57), Gly-Phe-Leu-Gly (SEQ ID NO:
- P is Gly-Gly-Gly, Ala-Val, Ala- Ala, Ala-D-Ala, D-Ala- Ala, or D-Ala-D-Ala.
- Q is -SO 3 M.
- the immunoconjugate is represented by the following formula:
- the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H, and when it is a single bond, X is -H, and Y is -OH or - S0 3 M.
- Another aspect of the invention provides an immunoconjugate having the following formula:
- CBA is the antibody or antigen-binding fragment thereof of the invention, or the polypeptide thereof of the invention, covalently linked to the J CB ' group,
- J CB ' is a moiety formed by reacting an aldehyde group derived from oxidation of a 2-hydroxyethylamine moiety on an N-terminal of said antibody or antigen- binding fragment thereof of the invention, or the polypeptide thereof of the invention, and an aldehyde reactive group on Cy s , and is represented by the following formula:
- si is the site covalently linked to the CBA; and s2 is the site covalently linked to Cy s2 ;
- Cy s2 is re resented by the following formula:
- M is H + or a cation
- R xl is a (Ci-C 6 )alkyl
- R e is -H or a (Ci-C 6 )alkyl
- W is -NR e ,
- R e' is -(CH 2 -CH 2 -0) n -R k ;
- n is an integer from 2 to 6;
- R k is -H or -Me
- R x2 is a (Ci-C 6 )alkyl
- Li is represented by the following formula:
- s3 is the site covalently linked to the group JCB' ;
- s4 is the site covalently linked to the -S- group on Cy s2 ;
- R 9 is -H or a (Ci-C 3 )alkyl
- Q is H, a charged substituent or an ionizable group
- Rai, R a2 , Ra?, Ra4, for each occurrence, are independently H or (Ci-C 3 )alkyl;
- ql and rl are each independently an integer from 0 to 10, provided that ql and rl are not both 0.
- -Li- is represented by the following formula:
- R is H or -S0 3 M.
- R e is H or Me; and R xl is -(CH 2 ) p -(CR f R g )-, and R x2 is - (CH 2 ) p -(CR f R g )-,wherein R f and R g are each independently -H or a and p is 0, 1, 2 or 3. In certain embodiments, R f and R g are the same or different, and are selected from -H and -Me.
- the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H; and when it is a single bond, X is -H; and Y is -OH or - S0 3 M.
- the double line ⁇ between N and C represents a double bond
- X is absent and Y is -H.
- the double line ⁇ between N and C represents a single bond
- X is -H and Y is -SO 3 M.
- M is H + , Na + or K + .
- Another aspect of the invention provides an immunoconjugate having the following formula:
- CBA is the antibody or antigen-binding fragment thereof of the invention, or the polypeptide thereof of the invention, covalently linked to the J CB ' group;
- J CB ' is a moiety formed by reacting an aldehyde group derived from oxidation of a 2-hydroxyethylamine moiety on an N-terminal of said antibody or antigen- binding fragment thereof of the invention, or the polypeptide thereof of the invention, and an aldehyde reactive group on Cy s3 , and is represented by the following formula:
- si is the site covalently linked to the CBA; and s2 is the site covalently linked to Cy s3 ;
- Cy s3 is represented by the following formula:
- n' is 1 or 2;
- Ri and R 2 are each independently H or a (Ci-C 3 )alkyl
- Li is represented by the following formula:
- s3 is the site covalently linked to the group JCB' ;
- s4 is the site covalently linked to the -S- group on Cy s3 ;
- R 9 is -H or a (Ci-C 3 )alkyl
- Q is H, a charged substituent or an ionizable group
- R a i, R a2 , Ra5, R A 4, for each occurrence, are independently H or a (Ci-C 3 )alkyl;
- ql and rl are each independently an integer from 0 to 10, provided that ql and rl are not both 0.
- m' is 1 and Ri and R 2 are both H. In certain embodiments, and Ri and R 2 are both Me.
- -Li- is represented by the following formula:
- the immunoconjugate is represented by the following formula:
- DM is represented by the following formula:
- Another aspect of the invention provides an immunoconjugate having the following formula:
- CBA is the antibody or antigen-binding fragment thereof of the invention, or the polypeptide thereof of the invention, covalently linked to the J CB ' group,
- JC B ' is a moiety formed by reacting an aldehyde group derived from oxidation of a 2-hydroxyethylamine moiety on an N-terminal of said antibody or antigen- binding fragment thereof of the invention, or the polypeptide thereof of the invention, and an aldehyde reactive group on Cy s4 and is represented by the following formula:
- si is the site covalently linked to the CBA; and s2 is the site covalently linked to Cy s4 ;
- Cy s4 is represented by the following formula:
- Li' is represented by the following formula:
- s3 is the site covalently linked to the group JCB' group
- s4 is the site covalently linked to -NMe- group on Cy s4 ;
- Z b i and Zb2 are both absent, or one of Z b i and Z b2 is absent and the other is - CH 2 -0- or -0-CH 2 -;
- R 9 is H or (Ci-C 3 )alkyl
- nl and ml are each independently an integer from 1 to 6;
- P is an amino acid residue or a peptide containing between 2 to 20 amino acid residues
- Rbi, Rb2, Rb 3 , Rb4, Rb5 and Rb6, for each occurrence, are each independently H or a (Ci-C 3 )alkyl.
- Rbi, Rb 2 , Rb 3 , Rb4, Rb5, and Rb 6 are all H. In certain embodiments, R9 is H.
- P is a peptide containing 2 to 5 amino acid residues.
- P may be selected from Gly-Gly-Gly, Ala-Val, Val-Ala, Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Ile-Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe-N 9 - nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, Ile-Ala-Leu, Val- Ala- Val, Ala-Leu-Ala-Leu (SEQ ID NO: 55), ⁇ -Ala-Leu-Ala-Leu (SEQ ID NO: 57), Gly-Phe- Leu-Gly (SEQ ID NO: 73),
- P is Gly-Gly-Gly, Ala-Val, Ala- Ala, Ala-D-Ala, D- Ala- Ala, and D-Ala-D-Ala.
- immunoconu ate is re resented by the following formula:
- DM is represented by the following structural formula:
- Another aspect of the invention provides an immunoconjugate represented by the following formula:
- CBA is an antibody or antigen-binding fragment thereof of the invention, or the polypeptide thereof of the invention, covalently linked to Cy CI through a cysteine residue;
- Wc is 1 or 2
- the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H or a (Ci-C4)alkyl; and when it is a single bond, X is -H or an amine protecting moiety, Y is -OH or -SO 3 M, and M is H + or a cation;
- R 5 is -H or a (Ci-C 3 )alkyl
- R a and R b are independently -H, (Ci-C 3 )alkyl, or a charged substituent or an ionizable group Q;
- W is -NR e ,
- R e' is -(CH 2 -CH 2 -0) n -R k ;
- n is an integer from 2 to 6;
- R k is -H or -Me
- R x3 is a Ci-C 6 )alkyl
- si is the site covalently linked to CBA
- R19 and R 2 o are independently -H or a (Ci-C 3 )alkyl; m" is an integer between 1 and 10; and
- R h is -H or a (Ci-C 3 )alkyl.
- R a and R are both H; and R5 is H or Me.
- P is a peptide containing 2 to 5 amino acid residues.
- P may be selected from Gly-Gly-Gly, Ala-Val, Val-Ala, Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Ile-Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe-N 9 - nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, Ile-Ala-Leu, Val- Ala- Val, Ala-Leu-Ala-Leu (SEQ ID NO: 55), ⁇ -Ala-Leu-Ala-Leu (SEQ ID NO: 57), Gly-Phe- Leu-Gly (SEQ ID NO: 73),
- P is Gly-Gly-Gly, Ala-Val, Ala- Ala, Ala-D-Ala, D- Ala- Ala, or D-Ala-D-Ala.
- Q is -SO 3 M.
- R19 and R 2 o are both H; and m" is an integer from 1 to 6.
- -Lc- is represented by the following formula:
- the immunoconjugate is represented by the following formula:
- the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H, and when it is a single bond, X is -H, and Y is -OH or - S0 3 M.
- Another aspect of the invention provides an immunoconjugate represented by the following formula:
- CBA is an antibody or antigen-binding fragment thereof of the invention, or the polypeptide thereof of the invention, covalently linked to Cy C2 through a cysteine residue;
- Wc is 1 or 2
- the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H or a (Ci- C 4 )alkyl; and when it is a single bond, X is -H or an amine protecting moiety, Y is - OH or -SO 3 M, and M is H + or a cation;
- R xl is a (Ci-C 6 )alkyl
- R e is -H or a (Ci-C 6 )alkyl
- W is -NR e ;
- R e' is -(CH 2 -CH 2 -0) n -R k ;
- n is an integer from 2 to 6;
- R k is -H or -Me
- R x2 is a (Ci-C 6 )alkyl
- Lc' is represented by the following formula:
- si is the site covalently linked to the CBA and s2 is the site covalently linked to -S- group on Cy C2 ;
- Q is -H, a charged substituent, or an ionizable group
- R9, Rio, R11, R12, Ri3, R19, R20, R21 and R 22 , for each occurrence, are independently -H or a (Ci-C3)alkyl
- R h is -H or a (Ci-C 3 )alkyl
- P' is an amino acid residue or a peptide containing 2 to 20 amino acid residues.
- P' is a peptide containing 2 to 5 amino acid residues.
- P' may be selected from Gly-Gly-Gly, Ala-Val, Val-Ala, Val-Cit, Val-Lys, Phe- Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Ile-Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe- N 9 -nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, He- Ala-Leu, Val- Ala- Val, Ala-Leu-Ala-Leu (SEQ ID NO: 55), ⁇ - Ala-Leu-Ala-Leu (SEQ ID NO: 57), Gly- Phe-Leu-Gly (SEQ ID NO: 73), Val
- R e is H or Me;
- R xl is -(CH 2 ) p -(CR f R g )-, and R x2 is -(CH 2 ) P - (CR f R g )-, wherein R f and R g are each independently -H or a and p is 0, 1, 2 or 3.
- R f and R g are the same or different, and are selected from -H and -Me.
- the immunoconjugate is represented by the following formula:
- the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H, and when it is a single bond, X is -H, and Y is -OH or - S0 3 M.
- the double line ⁇ between N and C represents a double bond, X is absent and Y is -H. In certain embodiments, the double line ⁇ between N and C represents a single bond, X is -H and Y is -SO 3 M. In certain embodiments, M is H + , Na + or K + .
- Another aspect of the invention provides an immunoconjugate having the following formula:
- CBA is an antibody or antigen-binding fragment thereof of the invention, or the polypeptide thereof of the invention, covalently linked to Cy C3 through a cysteine residue;
- Wc is 1 or 2
- Cy C3 is represented by the following formula:
- n' is 1 or 2;
- Ri and R 2 are each independently -H or a (Ci-C3)alkyl
- Lc' is represented by the following formula:
- si is the site covalently linked to the CBA and s2 is the site covalently linked to -S- group on Cy C3 ;
- Q is H, a charged substituent, or an ionizable group
- R9, Rio, R11, R12, Ri3, R19, R20, R21 and R 22 , for each occurrence, are independently -H or a (Ci-C3)alkyl
- R h is -H or a (Ci-C 3 )alkyl
- P' is an amino acid residue or a peptide containing 2 to 20 amino acid residues.
- P' is a peptide containing 2 to 5 amino acid residues.
- P' is selected from Gly-Gly-Gly, Ala-Val, Val-Ala, Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Lle-Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe-N 9 - nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, Ile-Ala-Leu, Val- Ala- Val, Ala-Leu-Ala-Leu (SEQ ID NO: 55), ⁇ -Ala-Leu-Ala-Leu (SEQ ID NO: 57), Gly-Phe- Leu-Gly (SEQ ID NO: 73
- P' is Gly-Gly-Gly, Ala-Val, Ala- Ala, Ala-D-Ala, D-Ala-Ala, or D-Ala-D-Ala.
- -Lc'- is represented by the following formula:
- M is H + or a cation.
- m' is 1 and Ri and R 2 are both H. In certain embodiments, m' is 2 and Ri and R 2 are both Me. In certain embodiments, the immunoconjugate is represented by the following formula:
- DM is a drug moiety represented by the following formula:
- Another aspect of the invention provides a pharmaceutical composition
- a pharmaceutical composition comprising the antibody or antigen-binding fragment thereof of the invention, or the polypeptide of the invention, or the immunoconjugate of the invention, and a pharmaceutically acceptable carrier.
- Another aspect of the invention provides a method for inhibiting the growth of a cell expressing CD 123, comprising contacting the cell with the antibody or antigen-binding fragment thereof of the invention, or the polypeptide of the invention, or the
- the cell is a tumor cell. In certain embodiments, the cell is a leukemia cell or a lymphoma cell.
- Another aspect of the invention provides a method for treating a subject having cancer, wherein cells of the cancer expresses CD123, the method comprising administering to said subject a therapeutically effective amount of the antibody or antigen-binding fragment thereof of the invention, or the polypeptide of the invention, or the immunoconjugate of the invention, or the pharmaceutical composition of the invention.
- the cancer or cell-pro lifer ative disorder is leukemia or lymphoma.
- the cancer or cell-proliferative disorder is selected from the group consisting of: acute myeloid leukemia (AML); chronic myeloid leukemia (CML); acute lymphoblastic leukemia (ALL), including B-cell lineage acute lymphoblastic leukemia (B-ALL); chronic lymphocytic leukemia (CLL); hairy cell leukemia (HCL); myelodysplastic syndrome; basic plasmacytoid DC neoplasm (BPDCN) leukemia; non-Hodgkin lymphomas (NHL), including mantle cell lymphoma; and Hodgkin's leukemia (HL).
- AML acute myeloid leukemia
- CML chronic myeloid leukemia
- ALL including B-cell lineage acute lymphoblastic leukemia (B-ALL); chronic lymphocytic leukemia (CLL); hairy cell leukemia (HCL); myelodysplastic
- Another aspect of the invention provides a method for treating a cell-proliferative disorder in a subject, wherein cells of the cell-proliferative disorder expresses CD123, the method comprising administering to said subject a therapeutically effective amount of the antibody or antigen-binding fragment thereof of the invention, or the polypeptide of the invention, or the immunoconjugate of the invention, or the pharmaceutical composition of the invention, in an amount sufficient to treat said cell-proliferative disorder.
- FIG. 1 shows inhibition of IL-3-dependent proliferation of TF-1 cells by chimeric CD 123-6 antibody (chCD 123-6) and its CDR-grafted huCD 123-6 antibodies (huCD123- 6Gv4.6 and huCD123-6Gv4.7).
- FIGs. 2A and 2B show that three murine anti-CD123 antibodies (muCD123-3, -6 and -14) inhibit IL-3 dependent proliferation of TF-1 cells at least as well as 7G3.
- FIG. 2A shows inhibition of TF-1 cells cultured in the presence of IL-3 (1 ng/mL) by the various anti-CD 123 antibodies, including CD123-binding control antibodies 7G3, 6H6, and 9F5.
- FIG. 2B shows inhibition of TF-1 cells cultured in the presence of GM-CSF (2 ng/mL) by the same anti- CD 123 antibodies.
- FIG. 3 shows that murine anti-CD123 antibodies muCD123-3, -6, and -14 inhibit IL-3 (1 ng/mL) dependent proliferation of TF-1 cells in a dose-dependent manner, and to a higher degree than the 7G3 antibody.
- muCD123-16 is a negative control anti-CD123 antibody that binds CD 123 but does not inhibit IL-3-dependent proliferation of TF-1 cells.
- FIGs. 4A and 4B show that the murine muCD123-3, -6, and -14 antibodies have higher binding affinity to CD 123 -positive AML cells than that of the 7G3 antibody in CD123-expressing TF-1 (FIG. 4A) and HNT-34 (FIG. 4B) cells.
- FIGs. 5A and 5B show that chimeric anti-CD-123 antibodies chCD123-3, -6, and -14 retain high binding affinity of their murine counterparts, using either HNT-34 cells (FIG. 5A) or the CD 123 -positive acute myeloid leukemia (AML) cell line MOLM-13 (FIG. 5B).
- HNT-34 cells FIG. 5A
- AML acute myeloid leukemia
- Chimeric antibody chKTI which does not bind CD 123, was included as negative control.
- FIG. 6 shows that the chimeric chCD123-3, -6, and -14 anti-CD-123 antibodies retain functional activity of their murine counterparts, as evidenced by their ability to inhibit IL-3 dependent proliferation of TF-1 cells.
- a non- functional chimeric anti-CD 123 antibody (chCD123-18) that binds CD 123 but does not inhibit IL-3-dependent proliferation of TF-1 cells was included as negative control.
- FIG. 7A shows that the murine (muCD 123-6), chimeric (chCD 123-6), and CDR- grafted huCD 123-6 antibodies (huCD123-6Gv4.7S2 and huCD123-6Gv4.7S3) all have higher affinity than 7G3 to CD123-expressing HNT-34 cells.
- Chimeric antibody chKTI which does not bind CD 123, was included as negative control.
- the unconjugated huCD123- 6Gv4.7 antibody has a heavy chain sequence of SEQ ID NO: 54, in which Xaa is Val.
- the conjugates with "S3-SeriMab” have cytotoxin (in this case, the indolinobenzodiazepine or "IGN” compounds herein after) linkage through oxidized N-terminal Ser on light chain.
- CysMab The conjugates with "CysMab” have cytotoxin (in this case, the IGN compounds) linkage through the engineered Cys in the heavy chain (i.e., the Cys corresponding to the 5 to the last Cys in SEQ ID NO: 54).
- FIG. 8A shows that the chimeric (chCD 123-6) and CDR-grafted (huCD123- 6Gv4.7S2 and huCD123-6Gv4.7S3) huCD 123-6 antibodies inhibit IL-3 dependent proliferation of TF-1 cells better than the 7G3 antibodies.
- the inhibition is IL-3 dependent, as these antibodies had no inhibitory effect when the cells were grown in the presence of GM-CSF (FIG. 8B).
- FIG. 9A shows expression constructs of IL-3Ra (CD123) extra-cellular domain and chimeric receptor proteins comprising IL-3Ra (gray) and GMRa domains (white).
- FIG. 9B shows that the CD 123-6 antibody binds primarily to the CRM domain of IL-3Ra (residues 101-306).
- FIG. 9C shows that the CD123-3 antibody binds primarily to the CRM domain of IL-3Ra (residues 101-306).
- FIG. 9D shows that the CD123-14 antibody binds exclusively to the N-terminal domain of IL-3Ra (residues 1-100).
- FIG. 9E shows that the 7G3 antibody binds exclusively to the N-terminal domain of IL-3Ra (residues 1-100).
- FIG. 9F shows that the 6H6 antibody binds exclusively to the N-terminal domain of IL-3Ra (residues 1-100).
- FIG. 9G shows that the 9F5 antibody binds exclusively to the N-terminal domain of IL-3Ra (residues 1-100).
- FIG. 10 demonstrates that maytansinoid DM1 conjugate of the resurfaced huCD123- 6Rvl. l antibody, huCD123-6Rvl. l-CXl-l-DMl, exhibits dose-dependent cytotoxicity on the growth factor- independent CD 123 -expressing AML cell line OCI-AML4.
- the cytotoxicity is CD 123 -dependent, as evidenced by the ability of excess unconjugated huCD 123-6 antibody (500 nM) to block the cytotoxicity.
- FIG. 11A shows in vitro cytotoxicity of the various resurfaced lysine-linked huCD123-6Rvl. l-IGN conjugates on multiple CD 123 -positive malignant cell lines of different origin.
- FIG. 11B shows in vitro cytotoxicity of the various lysine- or cysteine-linked huCD123-6-IGN conjugates on multiple CD 123 -positive B-ALL cell lines.
- the non-binding KTI antibody based conjugates are included as negative controls.
- FIG. 11C shows that the various Lys- or Cys-linked IGN compounds are highly active on P-gp (P-glycoprotein) positive AML cell lines Kasumi-3 and MOLM-1.
- the control curves with open data points are produced in the presence of excess unconjugated matching huCD123 antibodies.
- FIG. 1 ID shows that nearly all of the various Lys- or Cys-linked CD123-IGN conjugates of the invention kill 90% of the AML progenitor cells from 9 AML patient samples at nM or sub-nM concentrations.
- FIG. HE shows that the Cys-linked huCD123-6Gv4.7-CysMab-D5 conjugate kills normal blood cells at concentrations that are >100-fold higher than those needed to kill AML progenitors. In comparison, Mylotarg does not exhibit such preferential killing effect.
- FIGs. 12A and 12B show in vitro cytotoxicity of the various lysine-linked huCD123- 6Rvl .1-IGN conjugates on primary cells from AML patients.
- the result from a typical CFU assay for one primary patient sample is presented in FIG. 12A.
- FIG. 12B shows the IC 90 values for all AML patient samples treated with the conjugates.
- FIGs. 13A-13C show that the IGN conjugate of CysMab of huCD123-6 (huCD123- 6Gv4.6-CysMab-D5, filled black circle) is at least as active as the lysine-linked conjugate (huCD123-6Gv4.6-D2, filled black square) of the same antibody towards the AML cell line EOL-1 (FIG. 13A), the B-ALL cell line KOPN-8 (FIG. 13B), and the CML cell line MOLM- 1 (FIG. 13C).
- the dotted curves connecting open data points in each figure represent activity of the respective conjugates (i.e., open circle for huCD123-6Gv4.6-CysMab-D5, and open square for huCD123-6Gv4.6-D2) in the presence of blocking concentration (500 nM) of the unconjugated chCD 123-6 antibody.
- FIGs. 14A-14C show that SeriMab of huCD123-6 (huCD123-6Rvl. lS2-SeriMab-D8, filled black circle) is at least as active as the lysine-linked conjugate (huCD123-6Rvl. l-D2, filled downward black triangle) of the same antibody in AML cell lines SHI-1 (FIG. 14A) and HNT-34 (FIG. 14B), as well as the CML cell line MOLM-1 (FIG. 14C).
- the dotted curves connecting open data points in each figure represent activity of the respective conjugates (i.e., open circle for huCD123-6Rvl. lS2-SeriMab-D8, and open downward triangle for huCD123-6Rvl. l-D2) in the presence of blocking concentration (500 nM) of the unconjugated huCD 123-6 antibody.
- FIG. 15 shows a schematic drawing to show the general steps that can be used to synthesize a Ser-linkage conjugate of the invention.
- FIG. 16 shows a schematic drawing to show the general steps that can be used to synthesize a Ser-linkage conjugate of the invention.
- FIG. 17 shows a schematic drawing to show the general steps that can be used to synthesize a Ser-linkage conjugate of the invention.
- FIG. 18 shows that the Cys-linked huCD123-6Gv4.7-CysMab-D5 conjugate has higher activity than gemtuzumab ozogamicin (GO) (also known as Mylotarg) in unselected AML patient samples.
- GO gemtuzumab ozogamicin
- FIG. 19 shows that the Cys-linked huCD123-6Gv4.7-CysMab-D5 conjugate kills normal progenitor cells at concentrations that are >100-fold higher than those needed to kill AML progenitors.
- Mylotarg and huCD123-6G4.7-CysMab-D5' do not exhibit such preferential killing effect.
- FIG. 20 shows in vivo efficacy of CD123-IGN conjugates in the MV4-11 AML subcutaneous mice model.
- FIG. 21 shows that the Cys-linked huCD123-6Gv4.7-CysMab-D5 conjugate is highly active on various CD 123 -positive AML cell lines with poor prognostic factors.
- FIG. 22 shows in vivo bio luminescence imaging of mice treated with huCD123- 6Gv4.7-CysMab-D5 conjugate as compared to mice treated with vehicle and control on day 26. Treatment with the conjugate significantly reduces tumor burden in mice.
- FIG. 23 shows treatment with huCD123-6Gv4.7-CysMab-D5 conjugate extended survival in 6/6 mice as compared to mice treated with vehicle and control.
- FIG. 24 shows that the incubation of MV4-11 cells with huCD123-6Gv4.7-CysMab- D5 conjugate leads to DNA damage, arrest in S-phase of the cell cycle, and apoptosis- mediated cell death.
- FIG. 25 shows in vivo efficacy of CD123-IGN conjugates in the Molm-13 AML disseminated model.
- FIG. 26 shows in vivo efficacy of CD123-IGN conjugates in the EOL-1 subcutaneous model.
- FIG. 27 shows in vivo efficacy of huCD123-CysMab-D5 conjugate at various doses in the EOL-1 subcutaneous model.
- FIG. 28 shows in vivo efficacy of huCD123-CysMab-D5 conjugate compared to the corresponding free drug form of the payload (FGN849 or D5), naked antibody, control, cytarabine, and azacitidine in the EOL-1 subcutaenous model.
- FIG. 29 shows in vivo efficacy of CD123-IGN conjugates in the MV4-11 AML disseminated model.
- FIG. 30 shows in vivo efficacy of CD123-IGN conjugates in the MV4-11 AML subcutaneous model.
- FIG. 31 shows treatment with huCD123-CysMab-D5 conjugate extended survival in mice as compared to mice treated with vehicle and control.
- FIG. 32 shows in vivo tolerability of huCD123-CysMab-D5 and huCD123-SeriMab- sDl conjugates in mice.
- FIG. 33 shows in vivo tolerability of huCD123-lysine linked-D2 conjugate in mice.
- the CD 123 protein is an interleukin 3-specific subunit of a heterodimeric cytokine receptor (IL-3 Receptor, or IL-3R).
- the IL-3R is comprised of a ligand specific alpha subunit, and a signal transducing common beta subunit (also known as CD 131) shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2 / GM-CSF), and interleukin 5 (IL5).
- the binding of CD123/IL-3Ra to IL3 depends on the beta subunit.
- the beta subunit is activated by the ligand binding, and is required for the biological activities of IL3.
- CD123 can refer to either a protein or nucleic acid sequence as indicated herein.
- the term “CD123/IL-3Ra” encompasses "full-length,” unprocessed CD123/IL-3Ra, as well as any form of CD123/IL-3Ra that results from processing within the cell.
- the term also encompasses naturally occurring variants of CD123/IL-3Ra protein or nucleic acid, e.g., splice variants, allelic variants and isoforms.
- the CD123/IL-3Ra polypeptides and polynucleotides described herein can be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods.
- CD123/IL-3Ra sequences include, but are not limited to NCBI reference numbers NP_002174 & NM_002183 (protein and nucleic acid sequences for human CD123 variant 1), and NP_001254642 & NM_001267713 (protein and nucleic acid sequences for human CD 123 variant 2).
- antibody means an immunoglobulin molecule that recognizes and specifically binds to a target, such as a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing through at least one antigen recognition site within the variable region of the immunoglobulin molecule.
- antibody encompasses intact polyclonal antibodies, intact monoclonal antibodies, antibody fragments (such as Fab, Fab', F(ab') 2 , and Fv fragments), single chain Fv (scFv) mutants, multispecific antibodies such as bispecific antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antigen
- An antibody can be of any of the five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, or subclasses (isotypes) thereof (e.g. , IgGl, IgG2, IgG3, IgG4, IgAl and IgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively.
- the different classes of immunoglobulins have different and well known subunit structures and three-dimensional configurations.
- Antibodies can be naked or conjugated to other molecules such as toxins, radioisotopes, etc.
- an antibody is a non-naturally occurring antibody. In some embodiments, an antibody is purified from natural components. In some embodiments, an antibody is recombinantly produced. In some embodiments, an antibody is produced by a hybridoma.
- blocking antibody or an “antagonist” antibody is one which inhibits or reduces biological activity of the antigen it binds, such as CD123/IL-3Ra.
- blocking antibodies or antagonist antibodies substantially or completely inhibit the biological activity of the antigen. Desirably, the biological activity is reduced by 10%, 20%, 30%, 50%, 70%, 80%, 90%, 95%, or even 100%.
- anti-CD 123 antibody refers to an antibody that is capable of binding CD 123 / IL-3Ra with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting CD123/IL-3Ra.
- the extent of binding of an anti-CD 123/IL-3Ra antibody to an unrelated, non-CD 123/IL-3Ra protein is less than about 10% of the binding of the antibody to CD123/IL-3Ra as measured, e.g. , by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an antibody that binds to CD123/IL-3Ra has a dissociation constant (3 ⁇ 4) of ⁇ 0.5 nM, ⁇ 0.3 nM, ⁇ 0.1 nM, ⁇ 0.05 nM, or ⁇ 0.01 nM.
- the anti-CD 123/IL-3Ra antibody does not bind the common beta chain CD131.
- the anti-CD 123/IL-3Ra antibody does not bind to the same epitope of CD 123 that is bound by the known and commercially available CD 123 antibodies such as 7G3 (mouse IgG 2a ), 6H6 (mouse IgGi), and 9F5 (mouse IgGi) (Sun et al., Blood 87(1): 83-92, 1996).
- antibody fragment refers to a portion of an intact antibody and refers to the antigenic determining variable regions of an intact antibody.
- antibody fragments include, but are not limited to, Fab, Fab' , F(ab') 2 , and F v fragments, linear antibodies, single chain antibodies, and multispecific antibodies formed from antibody fragments.
- antigen-binding fragment of an antibody includes one or more fragments of an antibody that retain the ability to specifically bind to an antigen. It has been shown that the antigen-binding function of an antibody can be performed by certain fragments of a full-length antibody.
- binding fragments encompassed within the term "antigen-binding fragment" of an antibody include (without limitation): (i) an Fab fragment, a monovalent fragment consisting of the VL, VH, CL, and CHI domains (e.g. , an antibody digested by papain yields three fragments: two antigen-binding Fab fragments, and one Fc fragment that does not bind antigen); (ii) a F(ab') 2 fragment, a bivalent fragment comprising two Fab fragments linked by a disulfide bridge at the hinge region (e.g.
- an antibody digested by pepsin yields two fragments: a bivalent antigen-binding F(ab') 2 fragment, and a pFc' fragment that does not bind antigen) and its related F(ab') monovalent unit; (iii) a F d fragment consisting of the VH and CHI domains (i.e.
- a “monoclonal antibody” refers to a homogeneous antibody population involved in the highly specific recognition and binding of a single antigenic determinant, or epitope. This is in contrast to polyclonal antibodies that typically include different antibodies directed against different antigenic determinants.
- the term “monoclonal antibody” encompasses both intact and full-length monoclonal antibodies as well as antibody fragments (such as Fab, Fab', F(ab') 2 , F v ), single chain (scFv) mutants, fusion proteins comprising an antibody portion, and any other modified immunoglobulin molecule comprising an antigen recognition site.
- “monoclonal antibody” refers to such antibodies made in any number of manners including but not limited to by hybridoma, phage selection, recombinant expression, and transgenic animals.
- humanized antibody refers to forms of non- human (e.g., murine) antibodies that are specific immunoglobulin chains, chimeric immunoglobulins, or fragments thereof that contain minimal non- human (e.g., murine) sequences.
- humanized antibodies are human immunoglobulins in which residues from the complementary determining region (CDR) are replaced by residues from the CDR of a non-human species (e.g., mouse, rat, rabbit, hamster) that have the desired specificity, affinity, and capability (Jones et al, Nature 321:522-525, 1986; Riechmann et al, Nature 332:323-327, 1988;
- the immunoglobulin are replaced with the corresponding residues in an antibody from a non- human species that has the desired specificity, affinity, and capability.
- the humanized antibody can be further modified by the substitution of additional residues either in the F v framework region and/or within the replaced non-human residues to refine and optimize antibody specificity, affinity, and/or capability.
- the humanized antibody will comprise substantially all of at least one, and typically two or three, variable domains containing all or substantially all of the CDR regions that correspond to the non-human immunoglobulin whereas all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
- the humanized antibody can also comprise at least a portion of an immunoglobulin constant region or domain (F c ), typically that of a human immunoglobulin.
- F c immunoglobulin constant region or domain
- Examples of methods used to generate humanized antibodies are described in U.S. Pats. 5,225,539 and 5,639,641, Roguska et al, Proc. Natl. Acad. Sci. USA 91(3):969- 973, 1994; and Roguska et al, Protein Eng. 9(10):895-904, 1996 (all incorporated herein by reference).
- a "humanized antibody” is a resurfaced antibody.
- a "humanized antibody” is a CDR-grafted antibody.
- variable region of an antibody refers to the variable region of the antibody light chain or the variable region of the antibody heavy chain, either alone or in combination.
- the variable regions of the heavy and light chain each consist of four framework regions (FR) connected by three complementarity determining regions (CDRs) also known as hypervariable regions.
- the CDRs in each chain are held together in close proximity by the FRs and, with the CDRs from the other chain, contribute to the formation of the antigen- binding site of antibodies.
- CDRs complementarity determining regions
- the Kabat numbering system is generally used when referring to a residue in the variable domain (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain) (e.g., Kabat et al., Sequences of Immunological Interest, 5th Ed., Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
- amino acid position numbering refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed., Public Health Service, National Institutes of Health, Bethesda, Md. (1991) (incorporated herein by reference). Using this numbering system, the actual linear amino acid sequence can contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain.
- a heavy chain variable domain can include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g., residues 82a, 82b, and 82c, etc. according to Kabat) after heavy chain FR residue 82.
- the Kabat numbering of residues can be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard” Kabat numbered sequence. Chothia refers instead to the location of the structural loops (Chothia and Lesk, J. Mol. Biol. 196:901-917,1987).
- the end of the Chothia CDR-H1 loop when numbered using the Kabat numbering convention varies between H32 and H34 depending on the length of the loop. This is because the Kabat numbering scheme places the insertions at H35A and H35B - if neither 35A nor 35B is present, the loop ends at 32; if only 35A is present, the loop ends at 33; if both 35A and 35B are present, the loop ends at 34.
- the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular' s AbM antibody modeling software. Loop Kabat AbM Chiothia
- human antibody means an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human made using any technique known in the art. In certain embodiments, the human antibody does not have non-human sequence. This definition of a human antibody includes intact or full-length antibodies, or antigen-binding fragments thereof.
- chimeric antibodies refers to antibodies wherein the amino acid sequence of the immunoglobulin molecule is derived from two or more species.
- the variable region of both light and heavy chains corresponds to the variable region of antibodies derived from one species of mammals (e.g. , mouse, rat, rabbit, etc.) with the desired specificity, affinity, and capability while the constant regions are homologous to the sequences in antibodies derived from another (usually human) to avoid or reduce the chance of eliciting an immune response in that species (e.g. , human).
- chimeric antibody may include an antibody or antigen-binding fragment thereof comprising at least one human heavy and/or light chain polypeptide, such as, for example, an antibody comprising murine light chain and human heavy chain polypeptides.
- epitopes or “antigenic determinant” are used interchangeably herein and refer to that portion of an antigen capable of being recognized and specifically bound by a particular antibody.
- the antigen is a polypeptide
- epitopes can be formed both from contiguous amino acids and noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained upon protein denaturing, whereas epitopes formed by tertiary folding are typically lost upon protein denaturing.
- An epitope typically includes at least 3, and more usually, at least 5 or 8- 10 amino acids in a unique spatial conformation.
- Binding affinity generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g. , an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g. , antibody and antigen).
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (K d ) or the half-maximal effective concentration (EC 50 ). Affinity can be measured by common methods known in the art, including those described herein.
- Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high-affinity antibodies generally bind antigen faster and tend to remain bound longer.
- a variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present invention. Specific illustrative embodiments are described herein.
- binding affinity refers to a stronger binding between a molecule and its binding partner.
- “Or better” when used herein refers to a stronger binding, represented by a smaller numerical K d value.
- an antibody which has an affinity for an antigen of "0.3 nM or better” the antibody' s affinity for the antigen is ⁇ 0.3 nM, e.g. , 0.29 nM, 0.28 nM, 0.27 nM etc., or any value equal to or less than 0.3 nM.
- the antibody' s affinity as determined by a K d will be between about 10 " to about 10 "12 M, between about 10 "6 to about 10 "1 1 M, between about 10 "6 to about 10 “10 M, between about 10 "6 to about 10 “9 M, between about 10 "6 to about 10 “8 M, or between about 10 " 6 to about 10 "7 M.
- an antibody binds to an epitope via its antigen-binding domain, and that the binding entails some complementarity between the antigen-binding domain and the epitope. According to this definition, an antibody is said to "specifically bind” to an epitope when it binds to that epitope, via its antigen-binding domain more readily than it would bind to a random, unrelated epitope.
- the term "specificity” is used herein to qualify the relative affinity by which a certain antibody binds to a certain epitope.
- antibody “A” may be deemed to have a higher specificity for a given epitope than antibody "B,” or antibody “A” may be said to bind to epitope “C” with a higher specificity than it has for related epitope “D.”
- an antibody or antigen-binding fragment of the invention "specifically binds" to a CD 123 antigen, in that it has a higher binding specificity to the CD 123 antigen (from any species) than that to a non-CD 123 antigen.
- an antibody or antigen-binding fragment of the invention "specifically binds" to a human CD 123 antigen, in that it has a higher binding specificity to the human CD 123 antigen than that to a non-human CD123 antigen (e.g. , a mouse or a rat CD123).
- a non-human CD123 antigen e.g. , a mouse or a rat CD123.
- preferentially binds it is meant that the antibody specifically binds to an epitope more readily than it would bind to a related, similar, homologous, or analogous epitope.
- an antibody which "preferentially binds" to a given epitope would more likely bind to that epitope than to a related epitope, even though such an antibody may cross-react with the related epitope.
- an antibody or antigen-binding fragment of the invention "preferentially binds" to a human CD 123 antigen over a mouse CD 123.
- An antibody is said to "competitively inhibit" binding of a reference antibody to a given epitope if it preferentially binds to that epitope to the extent that it blocks, to some degree, binding of the reference antibody to the epitope.
- Competitive inhibition may be determined by any method known in the art, for example, competition ELISA assays.
- An antibody may be said to competitively inhibit binding of the reference antibody to a given epitope by at least 90%, at least 80%, at least 70%, at least 60%, or at least 50%.
- the difference between said two values is less than about 50%, less than about 40%, less than about 30%, less than about 20%, or less than about 10% as a function of the value for the reference/comparator antibody.
- a polypeptide, antibody, polynucleotide, vector, cell, or composition which is "isolated” is a polypeptide, antibody, polynucleotide, vector, cell, or composition which is in a form not found in nature.
- Isolated polypeptides, antibodies, polynucleotides, vectors, cells or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature.
- an antibody is an antibody,
- polynucleotide, vector, cell, or composition which is isolated is substantially pure.
- substantially pure refers to material which is at least 50% pure (i.e. , free from contaminants), at least 90% pure, at least 95% pure, at least 98% pure, or at least 99% pure.
- CBA cell binding agent
- Immunoconjugates can also be defined by the generic formula in reverse order: C-L-A.
- linker is any chemical moiety that is capable of linking a compound, usually a drug, such as a cytotoxic agent described herein (e.g. , maytansinoid or IGN
- Linkers can be susceptible to or be substantially resistant to acid-induced cleavage, light-induced cleavage, peptidase-induced cleavage, esterase-induced cleavage, and disulfide bond cleavage, at conditions under which the compound or the antibody remains active.
- Suitable linkers are well known in the art and include, for example, disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups and esterase labile groups.
- Linkers also include charged linkers, and hydrophilic forms thereof as described herein and know in the art.
- the terms “elevated” CD123/IL-3Ra, “increased expression” of CD123/IL-3Ra and “overexpression” of CD123/IL-3Ra refer to a sample which contains elevated levels of CD 123 expression.
- the CD 123 can be elevated, increased, or overexpressed as compared to a control value (e.g. , expression level in a biological sample, tissue, or cell from a subject without cancer, a sample or cancer known to express no or low CD123/IL-3Ra, a normal sample, or a cancer that does not have elevated CD123/IL-3Ra values).
- a sample e.g., one from a hematological cancer such as leukemia and lymphoma
- a sample with increased expression can contain an increase of at least 2-, 3-, 4-, 5-, 10-, 15-, 20-, 25-, 30-, or at least 50-fold relative to a control / normal values.
- a “reference sample” can be used to correlate and compare the results obtained in the methods of the invention from a test sample.
- Reference samples can be cells (e.g. , cell lines, cell pellets) or tissue.
- the CD123/IL-3Ra levels in the “reference sample” can be an absolute or relative amount, a range of amount, a minimum and/or maximum amount, a mean amount, and/or a median amount of CD123/IL-3Ra.
- a “reference sample” can also serve as a baseline of CD123/IL-3Ra expression to which the test sample is compared.
- the "reference sample” can include a prior sample or baseline sample from the same patient, a normal reference with a known level of CD123/IL-3Ra expression, or a reference from a relevant patient population with a known level of CD123/IL-3Ra expression.
- CD123/IL-3Ra levels can also be expressed as values in a standard curve.
- a standard curve is a quantitative method of plotting assay data to determine the concentration of CD123/IL-3Ra in a sample.
- a reference sample is an antigen standard comprising purified CD123/IL- 3Ra.
- the diagnostic methods of the invention can involve a comparison between expression levels of CD123/IL-3Ra in a test sample and a "reference value."
- the reference value is the expression level of the CD123/IL-3Ra in a reference sample.
- a reference value can be a predetermined value and can also be determined from reference samples (e.g. , control biological samples or reference samples) tested in parallel with the test samples.
- a reference value can be a single cut-off value, such as a median or mean or a range of values, such as a confidence interval. Reference values can be established for various subgroups of individuals.
- primary antibody refers to an antibody that binds specifically to the target protein antigen in a sample.
- a primary antibody is generally the first antibody used in an ELISA assay or IHC procedure. In one embodiment, the primary antibody is the only antibody used in an IHC procedure.
- secondary antibody herein refers to an antibody that binds specifically to a primary antibody, thereby forming a bridge or link between the primary antibody and a subsequent reagent, if any.
- the secondary antibody is generally the second antibody used in an immunohistochemical procedure.
- sample or “biological sample” of the present invention is of biological origin, in specific embodiments, such as from eukaryotic organisms.
- the sample is a human sample, but animal samples may also be used.
- Non-limiting sources of a sample for use in the present invention include solid tissue, biopsy aspirates, ascites, fluidic extracts, blood, plasma, serum, spinal fluid, lymph fluid, the external sections of the skin, respiratory, intestinal, and genitourinary tracts, tears, saliva, milk, tumors, organs, cell cultures and/or cell culture constituents, for example.
- a "cancerous sample” is a sample that contains a cancerous cell.
- the method can be used to examine an aspect of expression of CD123/IL- 3Ra or a state of a sample, including, but not limited to, comparing different types of cells or tissues, comparing different developmental stages, and detecting or determining the presence and/or type of disease or abnormality.
- capture reagent refers to a reagent capable of binding and capturing a target molecule in a sample such that under suitable condition, the capture reagent-target molecule complex can be separated from the rest of the sample.
- the capture reagent is immobilized.
- the capture reagent in a sandwich immunoassay is an antibody or a mixture of different antibodies against a target antigen.
- the term “detectable antibody” refers to an antibody that is capable of being detected either directly through a label amplified by a detection means, or indirectly through, e.g., another antibody that is labeled.
- the antibody is typically conjugated to a moiety that is detectable by some means.
- the detectable antibody is a biotinylated antibody.
- the term “detection means” refers to a moiety or technique used to detect the presence of the detectable antibody and includes detection agents that amplify the immobilized label such as label captured onto a microtiter plate.
- the detection means is a fluorimetric detection agent such as avidin or streptavidin.
- a "sandwich ELISA” employs the following steps: (1) microtiter plate is coated with a capture antibody; (2) sample is added, and any antigen present binds to capture antibody; (3) detecting antibody is added and binds to antigen; (4) enzyme-linked secondary antibody is added and binds to detecting antibody; and (5) substrate is added and is converted by enzyme to detectable form.
- label when used herein refers to a detectable compound or composition which is conjugated directly or indirectly to the antibody so as to generate a "labeled" antibody.
- the label can be detectable by itself (e.g. radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, can catalyze chemical alteration of a substrate compound or composition which is detectable.
- correlate or “correlating” is meant comparing, in any way, the performance and/or results of a first analysis with the performance and/or results of a second analysis. For example, one may use the results of a first analysis in carrying out the second analysis and/or one may use the results of a first analysis to determine whether a second analysis should be performed and/or one may compare the results of a first analysis with the results of a second analysis.
- increased expression of CD123/IL-3Ra correlates with increased likelihood of effectiveness of a CD123/IL-3Ra-targeting therapy.
- cancer and “cancerous” refer to or describe the physiological condition in mammals in which a population of cells are characterized by unregulated cell growth.
- Tumor and tumor refer to one or more cells that result from excessive cell growth or proliferation, either benign (noncancerous) or malignant (cancerous) including pre-cancerous lesions.
- cancer include lymphoma and leukemia.
- cancer or tumorigenic diseases which can be treated and/or prevented by the methods and reagents (e.g., anti-CD 123 antibody, antigen-binding fragment thereof, or immuno-conjugate thereof) of the invention include AML, CML, ALL (e.g.
- B-ALL basic plasmacytoid DC neoplasm
- BPDCN basic plasmacytoid DC neoplasm
- B-cell lymphomas including non- Hodgkin lymphomas (NHL), precursor B-cell lymphoblastic leukemia / lymphoma and mature B-cell neoplasms, such as B-cell chronic lymphocytic leukemia (B-CLL) / small lymphocytic lymphoma (SLL), B-cell prolymphocytic leukemia, lymphoplasmacytic lymphoma, mantle cell lymphoma (MCL), follicular lymphoma (FL), including low-grade, intermediate-grade and high-grade FL, cutaneous follicle center lymphoma, marginal zone B- cell lymphoma (MALT type, nodal and splenic type), hairy cell leukemia (HCL), diffuse large B-cell lymphoma, Burkitt's lymphoma, plasmacytoma, plasma cell
- Cancers also encompass cancers which contain cells having elevated CD123/IL-3Ra expression levels.
- Such CD123/IL-3Ra-elevated cancers include, but are not limited to, AML, CML, ALL (e.g., B-ALL), and CLL.
- cancer cell refers to the total population of cells derived from a tumor or a pre-cancerous lesion, including both non- tumorigenic cells, which comprise the bulk of the tumor cell population, and tumorigenic stem cells (cancer stem cells).
- tumorigenic stem cells cancer stem cells.
- tumorigenic stem cells cancer stem cells.
- tumorigenic stem cells will be modified by the term “non-tumorigenic” when referring solely to those tumor cells lacking the capacity to renew and differentiate to distinguish those tumor cells from cancer stem cells.
- subject refers to any animal (e.g. , a mammal), including, but not limited to humans, non-human primates, rodents, and the like, which is to be the recipient of a particular treatment.
- subject and patient are used interchangeably herein in reference to a human subject.
- Administration "in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and consecutive administration in any order.
- pharmaceutical formulation refers to a preparation which is in such form as to permit the biological activity of the active ingredient to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered. Such formulation can be sterile.
- An "effective amount” of an antibody or immunoconjugate as disclosed herein is an amount sufficient to carry out a specifically stated purpose. An “effective amount” can be determined empirically and in a routine manner, in relation to the stated purpose.
- therapeutically effective amount refers to an amount of an antibody or other drug effective to "treat” a disease or disorder in a subject or mammal.
- the therapeutically effective amount of the drug can reduce the number of cancer cells; reduce the tumor size; inhibit (i.e. , slow to some extent and in a certain embodiment, stop) cancer cell infiltration into peripheral organs; inhibit (i.e.
- PFS progression-free survival
- DFS disease-free survival
- OS overall survival
- CR complete response
- PR partial response
- SD stable disease
- PD progressive disease
- TTP reduced time to progression
- treating To the extent the drug can prevent growth and/or kill existing cancer cells, it can be cytostatic and/or cytotoxic.
- prophylactically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
- the term "respond favorably” generally refers to causing a beneficial state in a subject.
- cancer treatment the term refers to providing a therapeutic effect on the subject.
- Positive therapeutic effects in cancer can be measured in a number of ways (See, W.A. Weber, J. Nucl. Med. 50: 1S- 10S (2009)).
- tumor growth inhibition, molecular marker expression, serum marker expression, and molecular imaging techniques can all be used to assess therapeutic efficacy of an anti-cancer therapeutic.
- a T/C ⁇ 42% is the minimum level of anti-tumor activity.
- a favorable response can be assessed, for example, by increased progression-free survival (PFS), disease-free survival (DFS), or overall survival (OS), complete response (CR), partial response (PR), or, in some cases, stable disease (SD), a decrease in progressive disease (PD), a reduced time to progression (TTP), or any combination thereof.
- PFS, DFS, and OS can be measured by standards set by the National Cancer Institute and the U.S. Food and Drug Administration for the approval of new drugs. See Johnson et al, (2003) /. Clin. Oncol. 21(7): 1404-1411.
- PFS progression free survival
- progression free survival refers to the situation wherein a patient remains alive, without the cancer getting worse.
- a "complete response” or “complete remission” or “CR” indicates the disappearance of all signs of tumor or cancer in response to treatment. This does not always mean the cancer has been cured.
- a “partial response” or “PR” refers to a decrease in the size or volume of one or more tumors or lesions, or in the extent of cancer in the body, in response to treatment.
- Stable disease refers to disease without progression or relapse. In stable disease there is neither sufficient tumor shrinkage to qualify for partial response nor sufficient tumor increase to qualify as progressive disease.
- Progressive disease refers to the appearance of one more new lesions or tumors and/or the unequivocal progression of existing non-target lesions. Progressive disease can also refer to a tumor growth of more than 20 percent since treatment began, either due to an increases in mass or in spread of the tumor.
- Disease free survival refers to the length of time during and after treatment that the patient remains free of disease.
- OS “Overall Survival” refers to the time from patient enrollment to death or censored at the date last known alive. OS includes a prolongation in life expectancy as compared to naive or untreated individuals or patients. Overall survival refers to the situation wherein a patient remains alive for a defined period of time, such as one year, five years, etc., e.g., from the time of diagnosis or treatment.
- a “chemotherapeutic agent” is a chemical compound useful in the treatment of cancer, regardless of mechanism of action.
- Terms such as “treating” or “treatment” or “to treat” or “alleviating” or “to alleviate” refer to therapeutic measures that cure, slow down, lessen symptoms of, and/or halt progression of a diagnosed pathologic condition or disorder.
- those in need of treatment include those already diagnosed with the disorder, and may also include those who have minimal residual disease, or resistant disease, or replased disease.
- a subject is successfully "treated” for cancer according to the methods of the present invention if the patient shows one or more of the following: a reduction in the number of or complete absence of cancer cells; a reduction in the tumor size; inhibition of or an absence of cancer cell infiltration into peripheral organs including, for example, the spread of cancer into soft tissue and bone; inhibition of or an absence of tumor metastasis; inhibition or an absence of tumor growth; relief of one or more symptoms associated with the specific cancer; reduced morbidity and mortality; improvement in quality of life; reduction in tumorigenicity, tumorigenic frequency, or tumorigenic capacity, of a tumor; reduction in the number or frequency of cancer stem cells in a tumor; differentiation of tumorigenic cells to a non-tumorigenic state; increased progression-free survival (PFS), disease-free survival (DFS), or overall survival (OS), complete response (CR), partial response (PR), stable disease (SD), a decrease in progressive disease (PD), a reduced time to progression (TTP), or any combination thereof.
- PFS progression-free survival
- Prophylactic or preventative measures refer to measures that prevent and/or slow the development of a targeted pathologic condition or disorder. Thus, those in need of prophylactic or preventative measures include those prone to have the disorder and those in whom the disorder is to be prevented.
- Prophylactic or preventative measures refer to therapeutic measures that prevent and/or slow the development of a targeted pathologic condition or disorder.
- those in need of prophylactic or preventative measures include those prone to have the disorder and those in whom the disorder is to be prevented.
- healthcare provider refers to individuals or institutions which directly interact with and administer to living subjects, e.g., human patients.
- Non- limiting examples of healthcare providers include doctors, nurses, technicians, therapist, pharmacists, counselors, alternative medicine practitioners, medical facilities, doctor's offices, hospitals, emergency rooms, clinics, urgent care centers, alternative medicine clinics/facilities, and any other entity providing general and/or specialized treatment, assessment, maintenance, therapy, medication, and/or advice relating to all, or any portion of, a patient's state of health, including but not limited to general medical, specialized medical, surgical, and/or any other type of treatment, assessment, maintenance, therapy, medication and/or advice.
- a healthcare provider can administer or instruct another healthcare provider to administer a therapy to treat a cancer.
- administering includes prescribing a therapy to a subject as well as delivering, applying, or giving the therapy to a subject.
- a healthcare provider can implement or instruct another healthcare provider or patient to perform the following actions: obtain a sample, process a sample, submit a sample, receive a sample, transfer a sample, analyze or measure a sample, quantify a sample, provide the results obtained after analyzing/measuring/quantifying a sample, receive the results obtained after analyzing/measuring/quantifying a sample, compare/score the results obtained after analyzing/measuring/quantifying one or more samples, provide the comparison/score from one or more samples, obtain the comparison/score from one or more samples, administer a therapy or therapeutic agent (e.g., a CD123/IL-3Ra binding agent), commence the administration of a therapy, cease the administration of a therapy, continue the administration of a therapy, temporarily interrupt the administration of a therapy, increase the amount of an administered therapeutic agent, decrease the amount of an administered therapeutic agent, continue the administration of an amount of a therapeutic agent, increase the frequency of administration of a therapeutic agent, decrease the frequency of
- administration of a therapeutic agent maintain the same dosing frequency on a therapeutic agent, replace a therapy or therapeutic agent by at least another therapy or therapeutic agent, combine a therapy or therapeutic agent with at least another therapy or additional therapeutic agent.
- These actions can be performed by a healthcare provider automatically using a computer-implemented method (e.g. , via a web service or stand-alone computer system).
- Polynucleotide or “nucleic acid,” as used interchangeably herein, refer to polymers of nucleotides of any length, and include DNA and RNA.
- the nucleotides can be
- a polynucleotide can comprise modified nucleotides, such as methylated nucleotides and their analogs. If present, modification to the nucleotide structure can be imparted before or after assembly of the polymer.
- the sequence of nucleotides can be interrupted by non-nucleotide components.
- a polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component.
- modifications include, for example, "caps,” substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as, for example, those with uncharged linkages (e.g. , methyl phosphonates, phosphotriesters, phosphoamidates, cabamates, etc.) and with charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), those containing pendant moieties, such as, for example, proteins (e.g. , nucleases, toxins, antibodies, signal peptides, ply-L- lysine, etc.), those with intercalators (e.g.
- any of the hydro xyl groups ordinarily present in the sugars can be replaced, for example, by phosphonate groups, phosphate groups, protected by standard protecting groups, or activated to prepare additional linkages to additional nucleotides, or can be conjugated to solid supports.
- the 5' and 3' terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of from 1 to 20 carbon atoms. Other hydroxyls can also be derivatized to standard protecting groups.
- Polynucleotides can also contain analogous forms of ribose or deoxyribose sugars that are generally known in the art, including, for example, 2'-0-methyl-, 2'-0-allyl, 2'-fluoro- or 2'- azido-ribose, carbocyclic sugar analogs, alpha-anomeric sugars, epimeric sugars such as arabinose, xyloses or lyxoses, pyranose sugars, furanose sugars, sedoheptuloses, acyclic analogs and abasic nucleoside analogs such as methyl riboside.
- One or more phosphodiester linkages can be replaced by alternative linking groups. These alternative linking groups include, but are not limited to, embodiments
- each R or R is independently H or substituted or unsubstituted alkyl (1-20 C) optionally containing an ether (-0-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. The preceding description applies to all polynucleotides referred to herein, including RNA and DNA.
- vector means a construct, which is capable of delivering, and expressing, one or more gene(s) or sequence(s) of interest in a host cell.
- vectors include, but are not limited to, viral vectors, naked DNA or RNA expression vectors, plasmid, cosmid or phage vectors, DNA or RNA expression vectors associated with cationic condensing agents, DNA or RNA expression vectors encapsulated in liposomes, and certain eukaryotic cells, such as producer cells.
- polypeptide polypeptide
- peptide protein
- polymers of amino acids of any length can be linear or branched, it can comprise modified amino acids, and it can be interrupted by non-amino acids.
- the terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component.
- polypeptides containing one or more analogs of an amino acid including, for example, unnatural amino acids, etc.
- polypeptides of this invention are based upon antibodies, in certain embodiments, the polypeptides can occur as single chains or associated chains. In some embodiments, a polypeptide, peptide, or protein is non-naturally occurring. In some embodiments, a polypeptide, peptide, or protein is purified from other naturally occurring components. In some embodiments, the polypeptide, peptide, or protein is recombinantly produced.
- nucleic acids or polypeptides refer to two or more sequences or subsequences that are the same or have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned (introducing gaps, if necessary) for maximum correspondence, not considering any conservative amino acid substitutions as part of the sequence identity.
- the percent identity can be measured using sequence comparison software or algorithms or by visual inspection.
- sequence comparison software or algorithms or by visual inspection.
- Various algorithms and software are known in the art that can be used to obtain alignments of amino acid or nucleotide sequences.
- One such non- limiting example of a sequence alignment algorithm is the algorithm described in Karlin et al, Proc. Natl. Acad. Sci.
- Gapped BLAST can be used as described in Altschul et al, Nucleic Acids Res.
- BLAST-2 WU- BLAST-2 (Altschul et al, Methods in Enzymology 266:460-480, 1996), ALIGN, ALIGN-2 (Genentech, South San Francisco, California) or Megalign (DNASTAR) are additional publicly available software programs that can be used to align sequences.
- the percent identity between two nucleotide sequences is determined using the GAP program in GCG software ⁇ e.g., using a NWSgapdna.CMP matrix and a gap weight of 40, 50, 60, 70, or 90 and a length weight of 1, 2, 3, 4, 5, or 6).
- the GAP program in the GCG software package which incorporates the algorithm of Needleman and Wunsch (J. Mol. Biol. (48):444-453, 1970) can be used to determine the percent identity between two amino acid sequences (e.g., using either a Blossum 62 matrix or a PAM250 matrix, and a gap weight of 16, 14, 12, 10, 8, 6, or 4 and a length weight of 1, 2, 3, 4, 5).
- the percent identity between nucleotide or amino acid sequences is determined using the algorithm of Myers and Miller (CABIOS, 4: 11-17, 1989).
- the percent identity can be determined using the ALIGN program (version 2.0) and using a PAM120 with residue table, a gap length penalty of 12 and a gap penalty of 4. Appropriate parameters for maximal alignment by particular alignment software can be determined by one skilled in the art. In certain embodiments, the default parameters of the alignment software are used. In certain embodiments, the percentage identity "X" of a first amino acid sequence to a second sequence amino acid is calculated as 100 x (Y/Z), where Y is the number of amino acid residues scored as identical matches in the alignment of the first and second sequences (as aligned by visual inspection or a particular sequence alignment program) and Z is the total number of residues in the second sequence. If the length of a first sequence is longer than the second sequence, the percent identity of the first sequence to the second sequence will be longer than the percent identity of the second sequence to the first sequence.
- whether any particular polynucleotide has a certain percentage sequence identity can, in certain embodiments, be determined using the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, WI 53711). Bestfit uses the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2: 482-489, 1981, to find the best segment of homology between two sequences.
- the parameters are set such that the percentage of identity is calculated over the full length of the reference nucleotide sequence and that gaps in homology of up to 5% of the total number of nucleotides in the reference sequence are allowed.
- two nucleic acids or polypeptides of the invention are substantially identical, meaning they have at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, and in some embodiments at least 95%, 96%, 97%, 98%, 99% nucleotide or amino acid residue identity, when compared and aligned for maximum correspondence, as measured using a sequence comparison algorithm or by visual inspection.
- identity exists over a region of the sequences that is at least about 10, about 20, about 40-60 residues in length or any integral value therebetween, or over a longer region than 60-80 residues, at least about 90-100 residues, or the sequences are substantially identical over the full length of the sequences being compared, such as the coding region of a nucleotide sequence for example.
- a “conservative amino acid substitution” is one in which one amino acid residue is replaced with another amino acid residue having a similar side chain.
- Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).
- basic side chains e
- substitution of a phenylalanine for a tyrosine is a conservative substitution.
- conservative substitutions in the sequences of the polypeptides and antibodies of the invention do not abrogate the binding of the polypeptide or antibody containing the amino acid sequence, to the antigen(s), i.e., the CD123/IL-3Ra to which the polypeptide or antibody binds.
- P-glycoprotein 1 also known as “permeability glycoprotein,” “P-gp or Pgp,” “multidrug resistance protein 1 (MDR1),” “ATP-binding cassette sub-family B member 1 (ABCB 1),” or “cluster of differentiation 243 (CD243),” is an ABC-transporter of the MDR/TAP subfamily that transports a wide variety of substrates across extra- and intracellular membranes. It is an ATP-dependent efflux pump with broad substrate specificity.
- P-gp is extensively distributed and expressed in the intestinal epithelium where it pumps xenobiotics (such as toxins or drugs) back into the intestinal lumen, in liver cells where it pumps them into bile ducts, in the cells of the proximal tubule of the kidney where it pumps them into urine-conducting ducts, and in the capillary endothelial cells composing the blood-brain barrier and blood-testis barrier, where it pumps them back into the capillaries. Some cancer cells also express large amounts of P-gp, which renders these cancers multidrug resistant.
- Alkyl refers to a saturated linear or branched-chain monovalent hydrocarbon radical of one to twenty carbon atoms.
- alkyl include, but are not limited to, methyl, ethyl, 1-propyl, 2-propyl, 1-butyl, 2- methyl- 1 -propyl, -CH 2 CH(CH 3 ) 2 ), 2- butyl, 2-methyl-2-propyl, 1-pentyl, 2-pentyl 3-pentyl, 2-methyl-2-butyl, 3-methyl-2-butyl, 3- methyl- 1-butyl, 2-methyl- 1-butyl, 1-hexyl), 2-hexyl, 3-hexyl, 2-methyl-2-pentyl, 3-methyl-2- pentyl, 4-methyl-2-pentyl, 3 -methyl- 3-pentyl, 2- methyl- 3-pentyl, 2,3-dimethyl-2-butyl, 3,3- dimethyl-2-butyl, 1-heptyl
- the number of carbon atoms in a group can be specified herein by the prefix "C x-xx ", wherein x and xx are integers.
- C x-xx is an alkyl group having from 1 to 4 carbon atoms.
- compound or "cytotoxic compound,” are used interchangeably. They are intended to include compounds for which a structure or formula or any derivative thereof has been disclosed in the present invention or a structure or formula or any derivative thereof that has been incorporated by reference.
- the term also includes, stereoisomers, geometric isomers, tautomers, solvates, metabolites, and salts (e.g. , pharmaceutically acceptable salts) of a compound of all the formulae disclosed in the present invention.
- salts e.g. , pharmaceutically acceptable salts
- the term also includes any solvates, hydrates, and polymorphs of any of the foregoing.
- chiral refers to molecules that have the property of non-superimposability of the mirror image partner, while the term “achiral” refers to molecules that are
- stereoisomer refers to compounds that have identical chemical constitution and connectivity, but different orientations of their atoms in space that cannot be interconverted by rotation about single bonds.
- Diastereomer refers to a stereoisomer with two or more centers of chirality and whose molecules are not mirror images of one another. Diastereomers have different physical properties, e.g. melting points, boiling points, spectral properties, and reactivities. Mixtures of diastereomers can separate under high resolution analytical procedures such as crystallization, electrophoresis and chromatography.
- Enantiomers refer to two stereoisomers of a compound that are non-superimpo sable mirror images of one another.
- the compounds of the invention can contain asymmetric or chiral centers, and therefore exist in different stereoisomeric forms. It is intended that all stereoisomeric forms of the compounds of the invention, including but not limited to, diastereomers, enantiomers and atropisomers, as well as mixtures thereof such as racemic mixtures, form part of the present invention.
- optically active compounds i.e., they have the ability to rotate the plane of plane-polarized light.
- the prefixes D and L, or R and S are used to denote the absolute configuration of the molecule about its chiral center(s).
- the prefixes d and I or (+) and (-) are employed to designate the sign of rotation of plane-polarized light by the compound, with (-) or 1 meaning that the compound is levorotatory.
- a compound prefixed with (+) or d is dextrorotatory. For a given chemical structure, these stereoisomers are identical except that they are mirror images of one another.
- a specific stereoisomer can also be referred to as an enantiomer, and a mixture of such isomers is often called an enantiomeric mixture.
- a 50:50 mixture of enantiomers is referred to as a racemic mixture or a racemate, which can occur where there has been no stereo selection or stereo specificity in a chemical reaction or process.
- the terms “racemic mixture” and “racemate” refer to an equimolar mixture of two enantiomeric species, devoid of optical activity.
- tautomer or "tautomeric form” refers to structural isomers of different energies that are interconvertible via a low energy barrier.
- proton tautomers also known as prototropic tautomers
- Valence tautomers include
- imine reactive reagent refers to a reagent that is capable of reacting with an imine group.
- imine reactive reagent includes, but is not limited to, sulfites (H 2 SO 3 , H 2 SO 2 or a salt of HSO 3 " , SO 3 " or HSO 2 formed with a cation), metabisulfite (H 2 S 2 O 5 or a salt of S 2 O 5 " formed with a cation), mono, di, tri, and tetra- thiophosphates (PO3SH3, PO2S2H3, POS3H3, PS4H3 or a salt of P0 3 S 3 ⁇ P0 2 S 2 3" , POS 3 3” or PS 4 3" formed with a cation), thio phosphate esters ((R i O) 2 PS(OR i ), R'SH, R'SOH, R'SChH, R'SOSH), various amines (hydroxyl amine ⁇ e.g.,
- R k C( 0)NHOH or a salt formed with a cation
- hydrazide R k CONHNH 2
- formaldehyde sulfoxylate HOCH 2 S0 2 H or a salt of HOCH 2 S0 2 " formed with a cation, such as HOCH 2 S0 2 " Na +
- glycated nucleotide such as GDP-mannose
- fludarabine or a mixture thereof
- R 1 and R 1 are each independently a linear or branched alkyl having 1 to 10 carbon atoms and are substituted with at least one substituent selected from -N(R J ) 2 , -CO 2 H, -SO 3 H, and -PO 3 H
- R 1 and R 1 can be further optionally substituted with a substituent for an alkyl described herein
- R' is a linear or branched alkyl having 1 to 6 carbon atoms
- R k is a linear, branched or cyclic al
- the cation is a monovalent cation, such as Na + or K + .
- the imine reactive reagent is selected from sulfites, hydroxyl amine, urea and hydrazine. More preferably, the imine reactive reagent is NaHSC ⁇ or KHSO 3 .
- Exemplary salts include, but are not limited, to sulfate, citrate, acetate, oxalate, chloride, bromide, iodide, nitrate, bisulfate, phosphate, acid phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucuronate, saccharate, formate, benzoate, glutamate, methanesulfonate "mesylate,” ethanesulfonate, benzenesulfonate, p-toluenesulfonate, pamoate ⁇ i.e., l, l '-methylene-bis-(2-hydroxy-3-naphthoate)) salts, alkali metal (e.g.
- a pharmaceutically acceptable salt can involve the inclusion of another molecule such as an acetate ion, a succinate ion or other counter ion.
- the counter ion can be any organic or inorganic moiety that stabilizes the charge on the parent compound.
- a pharmaceutically acceptable salt can have more than one charged atom in its structure.
- a pharmaceutically acceptable salt can have one or more charged atoms and/or one or more counter ion.
- the desired pharmaceutically acceptable salt can be prepared by any suitable method available in the art, for example, treatment of the free base with an inorganic acid, such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, methanesulfonic acid, phosphoric acid and the like, or with an organic acid, such as acetic acid, maleic acid, succinic acid, mandelic acid, fumaric acid, malonic acid, pyruvic acid, oxalic acid, glycolic acid, salicylic acid, a pyranosidyl acid, such as glucuronic acid or galacturonic acid, an alpha hydroxy acid, such as citric acid or tartaric acid, an amino acid, such as aspartic acid or glutamic acid, an aromatic acid, such as benzoic acid or cinnamic acid, a sulfonic acid, such as p-toluenesulfonic acid or ethanesulfonic acid
- an inorganic acid such as hydro
- the desired pharmaceutically acceptable salt can be prepared by any suitable method, for example, treatment of the free acid with an inorganic or organic base, such as an amine (primary, secondary or tertiary), an alkali metal hydroxide or alkaline earth metal hydroxide, or the like.
- suitable salts include, but are not limited to, organic salts derived from amino acids, such as glycine and arginine, ammonia, primary, secondary, and tertiary amines, and cyclic amines, such as piperidine, morpholine and piperazine, and inorganic salts derived from sodium, calcium, potassium, magnesium, manganese, iron, copper, zinc, aluminum and lithium.
- solvate means a compound that further includes a stoichiometric or non-stoichiometric amount of solvent such as water, isopropanol, acetone, ethanol, methanol, DMSO, ethyl acetate, acetic acid, and ethanolamine dichloromethane, 2- propanol, or the like, bound by non-covalent intermolecular forces.
- Solvates or hydrates of the compounds are readily prepared by addition of at least one molar equivalent of a hydroxy lie solvent such as methanol, ethanol, 1-propanol, 2-propanol or water to the compound to result in solvation or hydration of the imine moiety.
- a “metabolite” or “catabolite” is a product produced through metabolism or catabolism in the body of a specified compound, a derivative thereof, or a conjugate thereof, or salt thereof. Metabolites of a compound, a derivative thereof, or a conjugate thereof, can be identified using routine techniques known in the art and their activities determined using tests such as those described herein. Such products can result for example from the oxidation, hydroxylation, reduction, hydrolysis, amidation, deamidation, esterification, deesterification, enzymatic cleavage, and the like, of the administered compound.
- the invention includes metabolites of compounds, a derivative thereof, or a conjugate thereof, of the invention, including compounds, a derivative thereof, or a conjugate thereof, produced by a process comprising contacting a compound, a derivative thereof, or a conjugate thereof, of this invention with a mammal for a period of time sufficient to yield a metabolic product thereof.
- phrases "pharmaceutically acceptable” indicates that the substance or composition must be compatible chemically and/or toxicologically, with the other ingredients comprising a formulation, and/or the mammal being treated therewith.
- protecting group refers to a substituent that is commonly employed to block or protect a particular functionality while reacting other functional groups on the compound, a derivative thereof, or a conjugate thereof.
- an "amine-protecting group” or an “amino -protecting moiety” is a substituent attached to an amino group that blocks or protects the amino functionality in the compound.
- Such groups are well known in the art (see for example P. Wuts and T. Greene, 2007, Protective Groups in Organic Synthesis, Chapter 7, J.
- carbamates such as methyl and ethyl carbamate, FMOC, substituted ethyl carbamates, carbamates cleaved by l,6-P-elimination (also termed "self immolative"), ureas, amides, peptides, alkyl and aryl derivatives.
- Suitable amino -protecting groups include acetyl, trifluoro acetyl, t-butoxycarbonyl (BOC), benzyloxycarbonyl (CBZ) and 9- fluorenylmethylenoxycarbonyl (Fmoc).
- amino acid refers to naturally occurring amino acids or non-naturally occurring amino acid.
- cation refers to an ion with positive charge.
- the cation can be monovalent ⁇ e.g., Na + , K + , NH 4 + eic), bi-valent ⁇ e.g., Ca 2+ , Mg 2+ , etc.) or multi-valent ⁇ e.g., Al 3+ etc.).
- the cation is monovalent.
- reactive ester group refers to a group an ester group that can readily react with an amine group to form amide bond.
- Exemplary reactive ester groups include, but are not limited to, N-hydroxysuccinimide esters, N-hydroxyphthalimide esters, N-hydroxy sulfo- succinimide esters, para-nitrophenyl esters, dinitrophenyl esters, pentafluorophenyl esters and their derivatives, wherein said derivatives facilitate amide bond formation.
- the reactive ester group is a N-hydroxysuccinimide ester or a N-hydroxy sulfo- succinimide ester.
- amine reactive group refers to a group that can react with an amine group to form a covalent bond.
- exemplary amine reactive groups include, but are not limited to, reactive ester groups, acyl halides, sulfonyl halide, imidoester, or a reactive thioester groups.
- the amine reactive group is a reactive ester group.
- the amine reactive group is a N-hydroxysuccinimide ester or a N-hydroxy sulfo-succinimide ester.
- thiol-reactive group refers to a group that can react with a thiol (-SH) group to form a covalent bond.
- exemplary thiol-reactive groups include, but are not limited to, maleimide, haloacetyl, aloacetamide, vinyl sulfone, vinyl sulfonamide or vinyal pyridine.
- the thiol-reactive group is maleimide.
- A, B, and C A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).
- the nomenclature used for the anti-CD 123 antibodies, cytotoxic compounds, and their immunoconjugates generally adopt the following meanings.
- CD123-3, -6, and -14 are three murine anti-CD123 monoclonal antibodies.
- the CDRl-3 sequences of the heavy and light chains (VH-CDRl-3, and VL-CDRl-3) are provided in Tables 1 and 2, with the associated SEQ ID NOs: 1-25.
- the heavy chain variable region (HCVR) sequences are provided in Table 3A with the associated SEQ ID NOs: 26, 28, and 30.
- Their light chain variable region (LCVR) sequences are provided in Table 4A with the associated SEQ ID NOs: 27, 29, and 31.
- HC full length heavy chain
- LC full length light chain
- chCD123-3, -6, and -14 are the corresponding murine-human chimeric antibodies having the murine heavy and light chain variable regions and the human constant region sequences.
- the chimeric antibody chCD 123-6 is comprised of the mouse HCVR and LCVR of SEQ ID NOs: 28 and 29, respectively, together with the human IgGl and Kappa constant sequences for the heavy and light chains, respectively. See Example 3.
- huCD123-3, -6, and -14 are the corresponding humanized antibodies.
- the letter "G” immediately follows the clone designation, which is in turn followed by a version number that designates the origin of the human light chain and heavy chain variable region sequences.
- huCD123-6Gv4.6 refers to the humanized CD 123 antibody based on grafting ("G") the 6 CDR regions from the corresponding muCDR123-6 antibody, onto the human light chain variable region Gv4 and the heavy chain variable region Gv6.
- -Gv4.7 comprises human light chain variable region Gv4 and heavy chain variable region Gv7; and -Gvl.
- l comprises human light chain variable region Gvl and heavy chain variable region Gvl.
- the three HCVR sequences, huCD123-6Gvl, -Gv6, and -Gv7 are provided in Table 3A (SEQ ID NOs: 32 and 34, with SEQ ID NO: 34 representing both -Gv6 and -Gv7 since they differ only at the 2 nd residue Xaa), and their DNA coding sequences in Table 3B (SEQ ID NOs: 62, 64, and 66).
- the three full length HC sequences, huCD123-6Gvl, -Gv6, and - Gv7 are provided in Table 5 (SEQ ID NOs: 48 and 50, with SEQ ID NO: 50 representing both full length -Gv6 and -Gv7 since they differ only at the 2 nd residue Xaa).
- the two LCVR sequences, huCD123-6Gvl and -Gv4, are provided in Table 4A (SEQ ID NOs: 33 and 35, and their DNA coding sequences in Table 4B (SEQ ID NOs: 63, and 65).
- the two full length LC sequences, huCD123-6Gvl and -Gv4, are provided in Table 6 (SEQ ID NOs: 49 and 51).
- the resurfaced heavy chain sequences are designated by "rh" immediately following the murine CD 123 antibody clone number, and are further designated by one of two version of the resurfaced sequences, vl.O or vl. l.
- huCD123-6rhvl.O and -rhvl. l are resurfaced heavy chain sequences with CDR regions corresponding to the muCD 123-6 antibody, with version designation of 1.0 and 1.1 respectively. See HCVR SEQ ID NOs: 39 and 40 in Table 3A, and SEQ ID NOs: 68 and 69 in Table 3B. Also see full length HC SEQ ID NOs: 59 and 60 in Table 5.
- LCVR SEQ ID NO: 41 in Table 4A the only version of the resurfaced light chain sequence, huCD123-6rlvl.O, has LCVR SEQ ID NO: 41 in Table 4A, and full length LC SEQ ID NO: 61 in Table 6.
- a resurfaced antibody having huCD123-6rhvl.O and huCD123-6rlvl.O is huCD123- 6Rvl.O; and a resurfaced antibody having huCD123-6rhvl. l and huCD123-6rlvl.O is huCD123-6Rvl. l.
- NTS2 or "S2" for short refers to an antibody having an engineered Ser at the N- terminus of heavy chain.
- the S2 variant of the huCD123-6Gv6/7 has HCVR sequence SEQ ID NO: 38 in Table 3A, and full length HC protein sequence SEQ ID NO: 53 in Table 5.
- NTS3 or “S3” for short refers to an antibody having an engineered Ser at the N-terminus of light chain.
- the S3 variant of the huCD123-6Gv4 has LCVR sequence SEQ ID NO: 37 in Table 4A, and full length LC protein sequence SEQ ID NO: 58 in Table 6.
- An antibody comprising an engineered N-terminal Ser may be conjugated with a cytotoxic drug / agent through either the oxidized N-terminal Ser, or through the "conventional" Lys linkage. If the drug linkage is through oxidized N-terminal Ser, the conjugate name contains a "SeriMab" designation. If the drug linkage is through Lys, then the conjugate name does not contain SeriMab (despite the fact that there is an S2 or S3 designation to signal the presence of engineered Ser at the N-terminus). The particular linkage type will also be apparent based on the cytotoxin reactive group.
- huCD123-6Gv4.7S3-SeriMab-D8 refers to conjugate between D8 and the humanized CD 123 antibody huCD123-6Gv4.7S3, through the oxidized N-terminal Ser on the light chain.
- the humanized CD 123 antibody has the grafted murine CD 123-6 CDR regions, the human LC Gv4 and heavy chain Gv7, and the N-terminal of the light chain has an engineered Ser (S3).
- huCD123-6Gv4.7S3-sSPDB-Dl refers to conjugate between Dl and the same humanized CD123 antibody huCD123-6Gv4.7S3, through Lys linkage via a sulfonated SPDB linker.
- both the light chain and heavy chain N-termini contain the engineered Ser, "S2S3" or "S2S3-SeriMab" may appear in the antibody name.
- Certain antibodies of the invention have an engineered Cys in the heavy chain CH3 domain, at a position corresponding to the same Kabat position of the 5 th to the last Cys in SEQ ID NO: 54.
- Such HCs or antibodies comprising such HCs contain the designation CysMab.
- CysMab is a humanized CD 123 antibody that has grafted muCD 123-6 CDR regions, is based on the human light chain Gv4 and heavy chain Gv6 sequences, wherein an engineered Cys is located in the HC CH3 region at a position corresponding to the 5 th to the last Cys in SEQ ID NO: 54.
- huCD123-6Gv6-CysMab its heavy chain sequence is huCD123-6Gv6-CysMab.
- huCD123-6Gv4.6S2-CysMab is otherwise identical, but has an engineered Ser at the N-terminus of the heavy chain, and its heavy chain sequence is huCD123-6Gv6S2-CysMab.
- the resurfaced antibody described above may be further engineered to contain N- terminal Ser at either the light chain (S3 variant of the resurfaced antibody) or the heavy chain (S2 variant of the resurfaced antibody), or both (see below).
- the resurfaced antibody may have an engineered Cys in the heavy chain CH3 domain at a position corresponding to the same Kabat position of the 5 th to the last Cys of SEQ ID NO: 54 (the CysMab version of the resurfaced antibody).
- a resurfaced antibody can have both engineered Cys and N-terminal Ser.
- the cytotoxin can be linked to the CysMab either through the Cys or through the conventional Lys.
- a conjugate with a CysMab designation refers to a conjugate between a CysMab and a cytotoxin though the Cys- linkage (not the Lys linkage). The particular linkage type will also be apparent based on the cytotoxin reactive group.
- huCD123- 6Rvl. l-CysMab is the resurfaced version of huCD 123-6 (vl. l) that has an engineered Cys located in the HC CH3 region at a position corresponding to the 5 th to the last Cys in SEQ ID NO: 54.
- the antibodies or antigen-binding fragments thereof of the invention may be conjugated to certain cytotoxic agents, either through linkage with the Lys side chain amino group, the Cys side chain thiol group, or an oxidized N-terminal Ser/Thr.
- Certain representative (non-limiting) cytotoxic agents described in the specification (including the examples) are listed below for illustration purpose. Note that most compounds such as Dl, D2, D4, DGN462, D3, D6, etc., may be sulfonated (not shown here, but see FIG. 17 compound sDl, FIG. 15 compound sDGN462, and the FIG. 16 compound sD8) at one of the indolinobenzodiazepine monomers in certain examples. For compound D5', both indolinobenzodiazepine monomers may be sulfonated.
- Conjugates of the subject antibodies and the cytotoxic agents generally follow the nomenclature of the antibodies and cytotoxic agents as described above.
- huCD123-6Gv4.6-sulfo-SPDB-Dl is a conjugate of the huCD123- 6Gv4.6 antibody to compound Dl through a sulfonated SPDB linker, at one or more Lys residues of the antibody.
- huCD123-6-CXl-l-DMl is a conjugate of the huCD123-6 antibody conjugated with the cytotoxic agent DM1 via a triglycyl linker named "CXl-1 linker," at one or more of the Lys residues of the antibody. See Example 9e.
- conjugate huCD123-6-SeriMab-sDl shown in FIGs. 7B and 17, in which the short linker sequence between the huCD123-6-SeriMab and the sDl cytotoxin is not explicitly recited in the conjugate name.
- conjugate huCD 123-6- SeriMab-sDGN462 in FIG. 15 is also an exception to the general rules above.
- the present invention provides agents that specifically bind
- CD123/IL-3Ra such as human CD123/IL-3Ra.
- CD123/IL-3Ra-binding agents are antibodies or antigen-binding fragments thereof (or “antibodies” for simplicity), immunoconjugates thereof or polypeptides thereof.
- the amino acid and nucleotide sequences for human and other species of CD123/IL- 3Ra are known in the art.
- the human CD123/IL-3Ra splicing variant 1 protein sequence as depicted in NCBI RefSeq NP_002174 is reproduced below:
- the above sequence shows the CD123/IL-3R alpha precursor chain protein, which is composed by 378 amino acids, containing the extracellular domain (residues 1-306, including an 18-residue N-terminal signal peptide), a 20 amino acid transmembrane domain, and a short cytoplasmic tail of 52 amino acids.
- Proteins and nucleic acid sequences of CD123/IL-3Ra from other non-human species can be readily retrieved from public database such as GenBank, using sequence search tools known in the art (such as NCBI BLASTp or BLASTn) and the above protein and nucleic acid sequences as query sequences, respectively.
- sequences from the non-human species can be aligned with the human sequences using any of many art-recognized sequence alignment tools, such as those described herein and above, such that any amino acid residues or nucleotides "corresponding to" any given human sequences or regions of sequences can be readily obtained.
- one aspect of the invention provides an antibody or antigen-binding fragment thereof that: (a) binds an epitope within amino acids 101 to 346 of human CD123 antigen, and (b) inhibits IL3 -dependent proliferation in antigen-positive TF- 1 cells.
- an anti-CD 123/IL-3Ra antibody or antigen-binding fragment thereof can specifically binds to an epitope of SEQ ID NO: 36.
- the epitope is within a region corresponding to residues 101-346 of human CD123/IL-3Ra.
- the epitope is within a region corresponding to residues 101-204 of SEQ ID NO: 36.
- the epitope is within a region corresponding to residues 205-346 of SEQ ID NO: 36.
- the epitope is not within a region corresponding to residues 1- 100 of human CD123/IL-3Ra.
- the CD123/IL-3Ra-binding agents e.g., antibodies
- inhibit IL3-dependent signaling such as IL-3-dependent proliferation of CD 123 -positive TF- 1 cells.
- the CD123/IL-3Ra-binding agents (e.g., antibodies) of the invention bind to CD 123, such as within a CD 123 region
- residues 101-346 e.g. , residues 101-204, or 205-346 of human CD123/IL- 3Ra, and prevents, reduces, diminishes, or otherwise inhibits productive binding between CD 123 and the IL-3 ligand, and/or productive binding between CD 123 and the common beta chain CD131, leading to reduced or abolished IL-3 dependent signaling.
- the invention provides an antibody or antigen-binding fragment thereof that: (a) binds an epitope within amino acids 1 to 100 of human CD 123 antigen, and (b) inhibits IL3-dependent proliferation in antigen-positive TF- 1 cells, with an IC 50 value of 0.1 nM or less (e.g. , 0.08 nM, 0.05 nM, 0.03 nM).
- binding by the CD123/IL-3Ra-binding agents (e.g. , antibodies) of the invention inhibits (e.g. , preferentially inhibits) the proliferation of leukemic stem cells (LSCs), leukemia progenitors (LPs), or leukemic blasts, but do not substantially inhibit the proliferation of the normal hematopoietic stem cells (HSCs).
- LSCs leukemic stem cells
- LPs leukemia progenitors
- HSCs normal hematopoietic stem cells
- Inhibition of cell proliferation can be conducted using any standard assays known in the art, including but are not limited to flow cytometry.
- normal HSCs, LSCs, LPs, and leukemia blasts can be separated using flow cytometry based on the difference on expression of cell surface markers, and the relative number of the surviving or remaining cells, after incubating with the testing agents, can be quantitatively measured and compared.
- Inhibition of cell proliferation of the LSCs, LPs, or leukemia blasts as compared to normal HSCs can also be assayed using in vitro potency assay on primary cancer cells, such as primary AML cells.
- primary cancer cells such as primary AML cells.
- AML cells or normal human bone marrow samples containing normal HSCs
- ADC immuno-conjugates
- Samples can be divided into a short-term liquid culture (STLC) assay to measure the cytotoxicity toward the LSCs, LPs, or leukemia blasts; and a long-term liquid culture (LTLC) assay to measure the effect on the LSCs and normal HSCs.
- STLC short-term liquid culture
- LTLC long-term liquid culture
- STLC can be used to measure colony forming units 10- 14 days in cells, e.g. , following plating in semi-solid MethoCult H4230 medium (Stemcell technologies).
- the LTLC assays can be performed similarly with the addition of growth factors for long-term culture 5-7 weeks. In both assays, colonies can be counted to determine colony forming units per number of cells initially plated. LTLC colonies can be further analyzed for the presence of cancer (e.g., AML) molecular markers using PCR or FISH or both.
- cancer e.g., AML
- the antibody or antigen-binding fragment thereof binds to human CD 123 antigen-positive cells with a dissociation constant (K d ) of 0.3 nM or lower. In certain embodiments, the antibodies or antigen-binding fragments thereof bind to human CD 123 with a K d between 0.05 and 0.3 nM, or between 0.05 and 0.2 nM, or between 0.05 and 0.1 nM, or between 0.01 nM and 0.3 nM, or between 0.01 nM and 0.2 nM, or between 0.01 nM and 0.1 nM.
- the antibodies or antigen-binding fragments thereof bind to cynomolgus monkey CD 123. In certain embodiments, the antibodies or antigen-binding fragments thereof bind to cynomolgus monkey CD 123 with a IQ between 0.05 and 0.3 nM, or between 0.05 and 0.2 nM, or between 0.05 and 0.1 nM.
- the antibodies or antigen-binding fragments thereof bind both human and cynomolgus monkey CD 123 with a substantially similar binding affinity. In certain embodiments, the antibodies or antigen-binding fragments thereof bind to both human and cynomolgus monkey CD 123 with K d between 0.05 and 0.3 nM, or between 0.05 and 0.2 nM, or between 0.05 and 0.1 nM.
- the K d value is based on cell-based binding assay. In certain embodiments, the K d value is measured by flow cytometry. In certain embodiments, the K d value is measured by surface plasmon resonance (such as by using the BIOCORETM surface plasmon resonance system). In certain embodiments, the K d value is measured by radioimmunoassay (RIA). In certain embodiments, the K d is measured by any other art- recognized methods.
- RIA radioimmunoassay
- the antibody or antigen-binding fragment thereof inhibits at least 50% of IL3 -dependent proliferation in antigen-positive TF- 1 cells at a concentration of 0.5 nM or lower.
- the CD123/IL-3Ra-binding agents are CD123/IL-3Ra antibodies or antigen-binding fragments thereof that comprise a heavy chain variable region (HCVR) and a light chain variable region (LCVR), each comprising three CDR regions (e.g. , CDR1-CDR3 for the HCVR, and CDR1-CDR3 for the LCVR), wherein the composite CDRs for the HCVR and LCVR are any of the sequences provided in Tables 1 and 2 below.
- HCVR heavy chain variable region
- LCVR light chain variable region
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprise: a) at least one heavy chain variable region or fragment thereof comprising three sequential complementarity-determining regions (CDR) CDRl, CDR2, and CDR3, respectively, wherein, with the exception of 1, 2, or 3 conservative amino acid
- CDRl is selected from the group consisting of: SEQ ID NOs: 1, 5, and 12
- CDR2 is selected from the group consisting of: SEQ ID NOs: 2-3, 6- 10, and 13- 14, and, optionally, CDR3 is selected from the group consisting of: SEQ ID NOs: 4, 11, 15 and 70; and b) at least one light chain variable region or fragment thereof comprising three sequential complementarity-determining regions (CDR) CDR1, CDR2, and CDR3, respectively, wherein, with the exception of 1, 2, or 3 conservative amino acid substitutions, CDR1 is selected from the group consisting of: SEQ ID NOs: 16, 19-20, 23 and 72, CDR2 is selected from the group consisting of: SEQ ID NOs: 17, 21, 24 and 71, and, optionally, CDR3 is selected from the group consisting of: SEQ ID NOs: 18, 22, and 25.
- CDR1 is selected from the group consisting of: SEQ ID NOs: 16, 19-20, 23 and 72
- CDR2 is selected from the group consisting
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprise: a) at least one heavy chain variable region or fragment thereof comprising three sequential complementarity-determining regions (CDR) CDR1, CDR2, and CDR3, respectively, wherein, with the exception of 1, 2, or 3 conservative amino acid substitutions, CDR1 is selected from the group consisting of: SEQ ID NOs: 1, 5, and 12, CDR2 is selected from the group consisting of: SEQ ID NOs: 2-3, 6- 10, and 13- 14, and, optionally, CDR3 is selected from the group consisting of: SEQ ID NOs: 4, 11, and 15; and b) at least one light chain variable region or fragment thereof comprising three sequential complementarity-determining regions (CDR) CDR1, CDR2, and CDR3, respectively, wherein, with the exception of 1, 2, or 3 conservative amino acid substitutions, CDR1 is selected from the group consisting of: SEQ ID NOs: 16, 19-20, and 23, CDR2 is selected from the group consisting of: SEQ ID NOs: S
- the conservative amino acid substitutions comprise a substitution of a Lys in a CDR by an Arg (such as the Lys-to-Arg substitutions in SEQ ID NOs: 6 and 7, 8 and 9, and 19 and 20).
- the antibody is a CDR- grafted humanized antibody comprising mouse CDR regions, and wherein one or more (e.g. , 1, 2, 3, 4, 5, 6, 7, or 8) heavy chain and/or light chain framework region vernier zone residues of the antibody is of mouse origin.
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprise: a) an immunoglobulin heavy chain variable region comprising a CDR1 having an amino acid sequence set forth in SEQ ID NO: 1, a CDR2 having an amino acid sequence set forth in SEQ ID NO: 2 or 3, and, optionally, a CDR3 having an amino acid sequence set forth in SEQ ID NO: 4; and 2) an immunoglobulin light chain variable region comprising a CDR1 having an amino acid sequence set forth in SEQ ID NO: 16, a CDR2 having an amino acid sequence set forth in SEQ ID NO: 17, and, optionally, a CDR3 having an amino acid sequence set forth in SEQ ID NO: 18.
- CDR2 of the heavy chain variable region is SEQ ID NO: 2.
- CDR2 of the heavy chain variable region is SEQ ID NO: 3.
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprise: a) an immunoglobulin heavy chain variable region comprising a CDRl having an amino acid sequence set forth in SEQ ID NO: 5, a CDR2 having an amino acid sequence set forth in SEQ ID NO: 6, 7, 8, 9, or 10, and, optionally, a CDR3 having an amino acid sequence set forth in SEQ ID NO: 11; and 2) an immunoglobulin light chain variable region comprising a CDRl having an amino acid sequence set forth in SEQ ID NO: 19 or 20, a CDR2 having an amino acid sequence set forth in SEQ ID NO: 21, and, optionally, a CDR3 having an amino acid sequence set forth in SEQ ID NO: 22.
- CDR2 of the heavy chain variable region is SEQ ID NO: 6, and CDRl of the light chain variable region is SEQ ID NO: 19.
- CDR2 of the heavy chain variable region is SEQ ID NO: 7 and CDRl of the light chain variable region is SEQ ID NO: 19.
- CDR2 of the heavy chain variable region is SEQ ID NO: 8 and CDRl of the light chain variable region is SEQ ID NO: 19.
- CDR2 of the heavy chain variable region is SEQ ID NO: 9
- CDRl of the light chain variable region is SEQ ID NO: 19.
- CDR2 of the heavy chain variable region is SEQ ID NO: 10 and CDRl of the light chain variable region is SEQ ID NO: 19.
- CDR2 of the heavy chain variable region is SEQ ID NO: 6, and CDRl of the light chain variable region is SEQ ID NO: 20.
- CDR2 of the heavy chain variable region is SEQ ID NO: 7 and CDRl of the light chain variable region is SEQ ID NO: 20.
- CDR2 of the heavy chain variable region is SEQ ID NO: 8 and CDRl of the light chain variable region is SEQ ID NO: 20.
- CDR2 of the heavy chain variable region is SEQ ID NO: 9, and CDRl of the light chain variable region is SEQ ID NO: 20.
- CDR2 of the heavy chain variable region is SEQ ID NO: 10
- CDRl of the light chain variable region is SEQ ID NO: 20.
- the heavy chain variable region CDRl and 3 are SEQ ID NOs: 5 and 11, respectively
- the light chain variable region CDR2 and 3 are SEQ ID NOs: 21 and 22, respectively.
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprise: a) an immunoglobulin heavy chain variable region comprising a CDRl having an amino acid sequence set forth in SEQ ID NO: 12, a CDR2 having an amino acid sequence set forth in SEQ ID NO: 13 or 14, and, optionally, a CDR3 having an amino acid sequence set forth in SEQ ID NO: 15; and 2) an immunoglobulin light chain variable region comprising a CDRl having an amino acid sequence set forth in SEQ ID NO: 23, a CDR2 having an amino acid sequence set forth in SEQ ID NO: 24, and, optionally, a CDR3 having an amino acid sequence set forth in SEQ ID NO: 25.
- CDR2 of the heavy chain variable region is SEQ ID NO: 13.
- CDR2 of the heavy chain variable region is SEQ ID NO: 14.
- CDRl sequences from the light chain and heavy chain of one antibody can be combined with CDR2 sequences from the light chain and heavy chain of another antibody (such as SEQ ID NOs: 2 and 17), and optionally can be combined with CDR3 sequences from the light chain and heavy chain of the same (e.g. , SEQ ID NOs: 4 and 18, or 11 and 22) or yet another antibody (e.g. , SEQ ID NOs: 15 and 25).
- All possible combinations based on SEQ ID NOs: 1-25 in Table 1, particularly those pertaining to the same antibody number are contemplated herein without exhaustively enumerating all the specific combinations.
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof have conserved amino acid substitutions over 1, 2, or 3 consecutive residues in any one or more CDR sequences above. That is, in some embodiments, the subject antibodies and antigen-binding fragments thereof may have conserved amino acid substitutions over 1, 2, or 3 consecutive residues, in any one or more of SEQ ID NOs: 1-25.
- the CD123/IL-3Ra-binding agents are CD123/IL-3Ra antibodies or antigen-binding fragments thereof that comprise a heavy chain variable region (HCVR) and a light chain variable region (LCVR), wherein the HCVR and LCVR are any of the sequences provided in Tables 3A and 4A below. Selected corresponding nucleic acid sequences encoding the HCVR and LCVR are in Tables 3B and 4B. Table 3A Heavy Chain Variable Region Amino Acid Sequences
- huCD123-6 AAGCTTGCCACCATGGGCTGGTCTTGTATTATTCTGTTTCT Varhvl. l GGTGGCCACCGCAACAGGCGTTCACAGTCAATTCCAGCTG
- the bolded bases mark the first codon of the mature variable region amino acid sequence.
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: (a) a V H sequence at least 95% identical to a reference V H sequence selected from a group having amino acid sequences represented by SEQ ID NOs: 26, 28, 30, 32, 34, 38, 39, and 40 (or SEQ ID NOs: 26, 28, 30, 32, 34, and 38); and/or (b) a V L sequence at least 95% identical to a reference V L sequence selected from the group having amino acid sequences represented by SEQ ID NOs: 27, 29, 31, 33, 35, 37, and 41 (or SEQ ID NOs: 27, 29, 31, 35, and 37).
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: (a) a V H sequence at least 96% identical to a reference V H
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: (a) a V H sequence at least 97% identical to a reference V H sequence selected from a group having amino acid sequences represented by SEQ ID NOs: 26, 28, 30, 32, 34, 38, 39, and 40 (or SEQ ID NOs: 26, 28, 30, 32, 34, and 38); and/or (b) a V L sequence at least 97% identical to a reference V L sequence selected from the group having amino acid sequences represented by SEQ ID NOs: 27, 29, 31, 33, 35, 37, and 41 (or SEQ ID NOs: 27, 29, 31, 35, and 37).
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: (a) a V H sequence at least 98% identical to a reference V H sequence selected from a group having amino acid sequences represented by SEQ ID NOs: 26, 28, 30, 32, 34, 38, 39, and 40 (or SEQ ID NOs: 26, 28, 30, 32, 34, and 38); and/or (b) a V L sequence at least 98% identical to a reference V L sequence selected from the group having amino acid sequences represented by SEQ ID NOs: 27, 29, 31, 33, 35, 37, and 41 (or SEQ ID NOs: 27, 29, 31, 35, and 37).
- the anti-CD 123 antibodies and antigen-binding fragments thereof comprises: (a) a V H sequence at least 99% identical to a reference V H sequence selected from a group having amino acid sequences represented by SEQ ID NOs: 26, 28, 30, 32, 34, 38, 39, and 40 (or SEQ ID NOs: 26, 28, 30, 32, 34, and 38); and/or (b) a V L sequence at least 99% identical to a reference V L sequence selected from the group having amino acid sequences represented by SEQ ID NOs: 27, 29, 31, 33, 35, 37, and 41 (or SEQ ID NOs: 27, 29, 31, 35, and 37).
- the CD123/IL-3Ra antibody / antigen-binding fragment thereof having a certain percentage of sequence identity to SEQ ID NOs: 26, 28, 30, 32, 34, 38, 39, and 40 (preferably SEQ ID NOs: 26, 28, 30, 32, 34, and 38) and/or 27, 29, 31, 33, 35, 37, and 41 (or SEQ ID NOs: 27, 29, 31, 35, and 37) differs from SEQ ID NOs: 26, 28, 30, 32, 34, 38, 39, and 40 (or SEQ ID NOs: 26, 28, 30, 32, 34, and 38) and/or 27, 29, 31, 33, 35, 37, and 41 (or SEQ ID NOs: 27, 29, 31, 35, and 37) by conservative amino acid substitutions only, such as 1, 2, or 3 conservative amino acid substitutions.
- the conservative amino acid substitutions are substitutions of 1, 2, or 3 consecutive amino acids in one or more CDR regions of the heavy and/or light chains.
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: (a) a V H sequence identical to a reference V H sequence selected from a group having amino acid sequences represented by SEQ ID NOs: 26, 28, 30, 32, 34, 38, 39, and 40 (or SEQ ID NOs: 26, 28, 30, 32, 34, and 38); and/or (b) a V L sequence identical to a reference V L sequence selected from the group having amino acid sequences represented by SEQ ID NOs: 27, 29, 31, 33, 35, 37, and 41 (or SEQ ID NOs: 27, 29, 31, 35, and 37).
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a V H sequence as set forth in SEQ ID NO: 26, and/or a V L sequence as set forth in SEQ ID NO: 27.
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a V H sequence as set forth in SEQ ID NO: 28, and/or a V L sequence as set forth in SEQ ID NO: 29.
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a V H sequence as set forth in SEQ ID NO: 30, and/or a V L sequence as set forth in SEQ ID NO: 31.
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a V H sequence as set forth in SEQ ID NO: 34, and/or a V L sequence as set forth in SEQ ID NO: 35.
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises a V H sequence and a V L sequence with a combination of SEQ ID NOs. selected from the group consisting of: 32/33, 34/33, 38/33, 39/33, 40/33, 32/35, 34/35, 38/35, 39/35, 40/35, 32/37, 34/37, 38/37, 39/37, 40/37, 39/33, 39/35, 39/37, 39/41, 40/33, 40/35, 40/37, and 40/41.
- the anti-CD 123/IL-3Ra antibodies and antigen- binding fragments thereof comprises: a) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 39 or 40; and, b) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 39 or 40; and, b) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 39 or 40; and, b) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 39 or 40; and, b) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 39 or 40; and, b) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 39 or 40; and, b) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 39 or 40; and, b) an immunoglobulin heavy chain variable region having the amino acid
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 34; and, b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 35.
- Xaa in SEQ ID NO: 34 is Phe (F). In certain embodiments, Xaa in SEQ ID NO: 34 is Val (V).
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 39 or 40, except that the first residue is replaced by Ser (S); and, b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 41.
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 39 or 40; and, b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 41, except that the first residue is replaced by Ser (S).
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a) an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 59 or 60, except that the N-terminal residue is Ser, and except that the residue corresponding to the 5 th to the last residue of SEQ ID NO: 54 is Cys; and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 41.
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a) an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 59 or 60, except that the residue corresponding to the 5 th to the last residue of SEQ ID NO: 54 is Cys; and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 41, except that the N-terminal residue is Ser.
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 38; and, b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 35.
- Xaa in SEQ ID NO: 38 is Phe (F).
- Xaa in SEQ ID NO: 38 is Val (V).
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a) an immunoglobulin heavy chain variable region having the amino acid sequence set forth in SEQ ID NO: 34; and, b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 37.
- Xaa in SEQ ID NO: 34 is Phe (F).
- Xaa in SEQ ID NO: 34 is Val (V).
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a) an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 56; and, b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 35.
- Xaa in SEQ ID NO: 56 is Phe (F).
- Xaa in SEQ ID NO: 56 is Val (V).
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a) an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 54; and, b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 37.
- Xaa in SEQ ID NO: 54 is Phe (F).
- Xaa in SEQ ID NO: 54 is Val (V).
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a) an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 59 or 60, except that the residue corresponding to the 5 th to the last residue of SEQ ID NO: 54 is Cys; and b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 41.
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a) an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 54; and, b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 35.
- Xaa in SEQ ID NO: 54 is Phe (F).
- Xaa in SEQ ID NO: 54 is Val (V).
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a) an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 56; and, b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 35.
- Xaa in SEQ ID NO: 56 is Phe (F).
- Xaa in SEQ ID NO: 56 is Val (V).
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof comprises: a) an immunoglobulin heavy chain region having the amino acid sequence set forth in SEQ ID NO: 54; and, b) an immunoglobulin light chain variable region having the amino acid sequence set forth in SEQ ID NO: 37.
- Xaa in SEQ ID NO: 54 is Phe (F).
- Xaa in SEQ ID NO: 54 is Val (V).
- the anti-CD 123/IL-3Ra antibodies and antigen-binding fragments thereof specifically binds CD123/IL-3Ra.
- the CD123/IL- 3Ra antibody or antigen-binding fragment thereof is a murine, chimeric, humanized, or human antibody or antigen-binding fragment thereof that specifically binds CD123/IL-3Ra.
- the humanized antibody or antigen-binding fragment thereof is a CDR-grafted or resurfaced antibody or antigen-binding fragment thereof.
- the anti-CD 123/IL-3Ra antibodies are full-length antibodies.
- the full-length antibodies may comprise any of the antibodies above defined by the 1-4 CDR (e.g., CDR1 and CDR2 of the heavy chain; CDR1 and CDR2 of the heavy and light chains), 1-6 CDR sequences (e.g. , CDR1-CDR3 of the heavy chain; CDR1-CDR3 of the heavy and light chains), or any of the antibodies above defined by the LCVR and/or the HCVR, or any of the full-length antibodies having a heavy chain sequence in Table 5, or any of the full- length antibodies having a light chain sequence in Table 6, or any of the full-length antibodies having a heavy chain sequence in Table 5 and a light chain sequence in Table 6.
- CD123-14 EVKLVESGGDLVKPGGSLKLSCAASGFTFSNYAMSWVRQNSEKRLEWVATI
- DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID NO:50) huCD123- SXQLVQSGAEVKKPGASVKVSCKASGYIFTSSIMHWVRQAPGQGLEWIGYIK 6 Gv6/7- PYNDGTKYNEKFKGRATLTSDRSTSTAYMELSSLRSEDTAVYYCAREGGND NTS2 YYDTMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP (or "S2") EPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNH
- DKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG (SEQ ID NO:53) huCD123- QXQLVQSGAEVKKPGASVKVSCKASGYIFTSSIMHWVRQAPGQGLEWIGYIK 6 Gv6/7- PYNDGTKYNEKFKGRATLTSDRSTSTAYMELSSLRSEDTAVYYCAREGGND CysMab YYDTMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP
- DKSRWQQGNVFSCSVMHEALHNHYTQKSLCLSPG (SEQ ID NO:54) huCD123- SXQLVQSGAEVKKPGASVKVSCKASGYIFTSSIMHWVRQAPGQGLEWIGYIK 6 Gv6/7S2- PYNDGTKYNEKFKGRATLTSDRSTSTAYMELSSLRSEDTAVYYCAREGGND CysMab YYDTMDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP
- DKSRWQQGNVFSCSVMHEALHNHYTQKSLCLSPG (SEQ ID NO:56) huCD123- QVQLVQSGAEVVKPGASVKMSCKASGYTFTSSIMHWMKQKPGQGLEWIGYI 6rhvl.O RPYNDGTRYNQKFQGKATLTSDRSSSTANMELNSLTSEDSAVYYCAREGGN
- X is F for Gv6 sequences
- X is V for Gv7 sequences.
- Met (bolded) in SEQ ID NO:44 is Pro.
- EIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQ SGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVT KSFNRGEC (SEQ ID NO:49) huCD123- DIQMTQSPSSLSASVGDRVTITCRASQDINSYLSWFQQKPGKAPKTLIYRVN 6Gv4 RLVDGVPSRFSGSGSGNDYTLTISSLQPEDFATYYCLQYDAFPYTFGQGTK
- the anti-CD 123/IL-3Ra antibodies are full-length antibodies comprising: (a) a heavy chain having at least about 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any of the full-length heavy chain sequences above, such as any of the full-length heavy chain sequences in Table 5; and/or (b) a light chain having at least about 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any of the full-length light chain sequences above, such as any of the full-length light chain sequences in Table 6.
- the anti-CD 123/IL-3Ra antibodies are full-length antibodies comprising a full- length heavy chain sequence and a full-length light chain sequence combination selected from the group consisting of SEQ ID NOs: 42/43, 44/45, 46/47, 48/49, 50/49, 53/49, 54/49, 56/49, 59/49, 60/49, 48/51, 50/51, 53/51, 54/51, 56/51, 59/51, 60/51, 48/58, 50/58, 53/58, 54/58, 56/58, 59/58, 60/58, 59/58, 60/58, 59/49, 59/51, 59/58, 59/61, 60/49, 60/51, 60/58, and 60/61, or antibodies with at least about 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any of the full-length heavy chain sequences and/or light chain sequences thereof.
- the anti-CD 123/IL-3Ra antibodies are full-length antibodies comprising a full-length heavy chain sequence and a full-length light chain sequence combination selected from the group consisting of SEQ ID NOs: 59/61, and 60/61, or antibodies with at least about 90%, 95%, 96%, 97%, 98%, or 99% sequence identity to any of the full-length heavy chain sequences and/or light chain sequences thereof.
- Such antibodies may further comprise engineered N-terminal Ser/Thr in the light chain, heavy chain, or both.
- Such antibodies may further comprise engineered Cys in the heavy chain CH3 domain in a position corresponding to the 5 th to the last Cys of SEQ ID NO: 54.
- the anti-CD 123/IL-3Ra antibody is a murine, chimeric, humanized, or human antibody that specifically binds CD123/IL-3Ra.
- the anti-CD 123/IL-3Ra antibody having a certain percentage of sequence identity to any of the full-length SEQ ID NOs differs from such SEQ ID NOs by conservative amino acid substitutions only, e.g. , by 1, 2, 3, 4, or 5 consecutive conservative amino acid substitutions only. In certain embodiments, the conservative amino acid substitutions are outside the CDRs.
- the antigen-binding fragment thereof is or comprises a Fab, Fd, Fab', F(ab') 2 , single chain Fv or scFv, disulfide linked Fv, V-NAR domain, IgNar, intrabody, IgGACH2, minibody, F(ab') 3 , tetrabody, triabody, diabody, single-domain antibody, DVD-Ig, Fcab, mAb2, (scFv) 2 , or scFv-Fc, of any one of the above antibodies.
- the invention also provides a polypeptide comprising any of the antibodies or antigen-binding fragments thereof, any of the VH and/or VL sequences above, any of the HCVR and/or LCVR above, or any of the CDR sequence(s) of the HCVR and/or LCVR above.
- the polypeptide maybe, for example, a fusion with a non-antibody protein or domain.
- the fusion protein is not a fusion with a pseudomonas toxin.
- the affinity or avidity of an antibody for an antigen can be determined experimentally using any suitable method well known in the art, e.g. , flow cytometry, enzyme-linked immunoabsorbent assay (ELISA), or radioimmunoassay (RIA), or kinetics (e.g. ,
- the measured affinity of a particular antibody-antigen interaction can vary if measured under different conditions (e.g. , salt concentration, pH, temperature).
- affinity and other antigen-binding parameters e.g. , KD or IQ, k on , k 0 g
- KD or IQ, k on , k 0 g are made with standardized solutions of antibody and antigen, and a standardized buffer, as known in the art and such as the buffer described herein.
- binding assays can be performed using flow cytometry on cells expressing the CD123/IL-3Ra antigen on the surface.
- CD123/IL-3Ra-positive cells can be incubated with varying concentrations of anti-CD 123/IL-3Ra antibodies using 1 x 10 5 cells per sample in 100 ⁇ ⁇ FACS buffer (e.g. , RPMI- 1640 medium supplemented with 2% normal goat serum).
- the cells can be pelleted, washed, and incubated for 1 hr with 100 ⁇ ⁇ of FITC-conjugated goat-anti-mouse or goat-anti-human IgG-antibody (such as is obtainable from, for example Jackson Laboratory, 6 ⁇ g/mL in FACS buffer).
- the cells are then pelleted again, washed with FACS buffer and resuspended in 200 ⁇ ⁇ of PBS containing 1% formaldehyde.
- Samples can be acquired, for example, using a FACSCalibur flow cytometer with the HTS multiwell sampler and analyzed using CellQuest Pro (all from BD Biosciences, San Diego, US).
- MFI mean fluorescence intensity for FL1
- EC 50 values are calculated using programs such as GraphPad Prism v4 with default parameters (GraphPad software, San Diego, CA). EC 50 values can be used as a measure for the apparent dissociation constant "K d " or "K D " for each antibody.
- Monoclonal antibodies can be prepared using hybridoma methods, such as those described by Kohler and Milstein (1975) Nature 256:495. Using the hybridoma method, a mouse, hamster, or other appropriate host animal, is immunized to elicit the production by lymphocytes of antibodies that will specifically bind to an immunizing antigen.
- Lymphocytes can also be immunized in vitro. Following immunization, the lymphocytes are isolated and fused with a suitable myeloma cell line using, for example, polyethylene glycol, to form hybridoma cells that can then be selected away from unfused lymphocytes and myeloma cells.
- Hybridomas that produce monoclonal antibodies directed specifically against a chosen antigen as determined by immunoprecipitation, immunoblotting, or by an in vitro binding assay (e.g., radioimmunoassay (RIA); enzyme-linked immunosorbent assay
- ELISA ELISA
- ELISA Monoclonal Antibodies: Principles and Practice, Academic Press, 1986
- the monoclonal antibodies can then be purified from the culture medium or ascites fluid as described for polyclonal antibodies.
- monoclonal antibodies can also be made using recombinant DNA methods as described in U.S. Patent 4,816,567.
- the polynucleotides encoding a monoclonal antibody are isolated from mature B-cells or hybridoma cells, such as by RT- PCR using oligonucleotide primers that specifically amplify the genes encoding the heavy and light chains of the antibody, and their sequence is determined using conventional procedures.
- the isolated polynucleotides encoding the heavy and light chains are then cloned into suitable expression vectors, which when transfected into host cells such as E.
- monoclonal antibodies are generated by the host cells.
- recombinant monoclonal antibodies or fragments thereof of the desired species can be isolated from phage display libraries expressing CDRs of the desired species as described (McCafferty et al, Nature 348:552-554, 1990; Clackson et al, Nature, 352:624-628, 1991; and Marks et al, J. Mol. Biol. 222:581-597, 1991).
- the polynucleotide(s) encoding a monoclonal antibody can further be modified in a number of different manners using recombinant DNA technology to generate alternative antibodies.
- the constant domains of the light and heavy chains of, for example, a mouse monoclonal antibody can be substituted 1) for those regions of, for example, a human antibody to generate a chimeric antibody, or, 2) for a non- immunoglobulin polypeptide to generate a fusion antibody.
- the constant regions are truncated or removed to generate the desired antibody fragment of a monoclonal antibody. Site-directed or high-density mutagenesis of the variable region can be used to optimize specificity, affinity, etc. of a monoclonal antibody.
- the monoclonal antibody against the human CD123/IL-3Ra is a humanized antibody.
- such antibodies are used therapeutically to reduce antigenicity and HAMA (human anti-mouse antibody) responses when administered to a human subject.
- a humanized, resurfaced or similarly engineered antibody can have one or more amino acid residues from a source that is non- human, e.g., but not limited to, mouse, rat, rabbit, non- human primate or other mammal. These non-human amino acid residues are replaced by residues that are often referred to as "import" residues, which are typically taken from an "import" variable, constant or other domain of a known human sequence.
- CDR residues are directly and most substantially involved in influencing CD123/IL-3Ra binding. Accordingly, part or all of the non-human or human CDR sequences are maintained while the non-human sequences of the variable and constant regions can be replaced with human or other amino acids.
- Antibodies can also optionally be humanized, resurfaced, engineered or human antibodies engineered with retention of high affinity for the antigen CD123/IL-3Ra and other favorable biological properties.
- humanized (or human) or engineered anti-CD 123/IL-3Ra antibodies and resurfaced antibodies can be optionally prepared by a process of analysis of the parental sequences and various conceptual humanized and engineered products using three-dimensional models of the parental, engineered, and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional conformational structures of selected candidate immunoglobulin sequences.
- Humanization, resurfacing or engineering of antibodies of the present invention can be performed using any known method, such as but not limited to those described in, Winter (Jones et al, Nature 321:522, 1986; Riechmann et al., Nature 332:323, 1988; Verhoeyen et al, Science 239: 1534, 1988, Sims et al, J. Immunol. 151:2296, 1993; Chothia and Lesk, J. Mol. Biol. 196:901, 1987, Carter et al, Proc. Natl. Acad. Sci. U.S.A. 89:4285, 1992; Presta et al, J. Immunol.
- the antibody to CD123/IL-3Ra is a human antibody.
- Human antibodies can be directly prepared using various techniques known in the art. Immortalized human B lymphocytes immunized in vitro or isolated from an immunized individual that produce an antibody directed against a target antigen can be generated (See, e.g., Cole et al, Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boemer et al, 1991, . Immunol, 147 (l):86-95; and U.S. Patent 5,750,373).
- the human antibody can be selected from a phage library, where that phage library expresses human antibodies, as described, for example, in Vaughan et al, Nat. Biotech. 14:309- 314, 1996, Sheets et al, Proc. Nat'l. Acad. Sci. 95:6157-6162, 1998, Hoogenboom and Winter, J. Mol. Biol. 227:381, 1991, and Marks et al, J. Mol. Biol. 222:581, 1991). Techniques for the generation and use of antibody phage libraries are also described in U.S. Patent Nos.
- Humanized antibodies can also be made in transgenic mice containing human immunoglobulin loci that are capable upon immunization of producing the full repertoire of human antibodies in the absence of endogenous immunoglobulin production. This approach is described in U.S. Patents 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; and 5,661,016.
- an antibody fragment to, for example, increase tumor penetration.
- Various techniques are known for the production of antibody fragments. Traditionally, these fragments are derived via proteolytic digestion of intact antibodies (for example Morimoto et al., Journal of Biochemical and Biophysical Methods 24: 107-117, 1993; Brennan et al., Science 229:81, 1985).
- antibody fragments are produced recombinantly. Fab, Fv, and scFv antibody fragments can all be expressed in and secreted from E. coli or other host cells, thus allowing the production of large amounts of these fragments.
- Such antibody fragments can also be isolated from antibody phage libraries.
- the antibody fragment can also be linear antibodies as described in U.S. Patent 5,641,870, for example, and can be monospecific or bispecific. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
- modified antibodies can comprise any type of variable region that provides for the association of the antibody with the polypeptides of a human CD123/IL-3Ra.
- the variable region can comprise or be derived from any type of mammal that can be induced to mount a humoral response and generate immunoglobulins against the desired tumor associated antigen.
- the variable region of the modified antibodies can be, for example, of human, murine, non-human primate ⁇ e.g., cynomolgus monkeys, macaques, etc.) or lupine origin.
- both the variable and constant regions of the modified immunoglobulins are human.
- variable regions of compatible antibodies can be engineered or specifically tailored to improve the binding properties or reduce the immunogenicity of the molecule.
- variable regions useful in the present invention can be humanized or otherwise altered through the inclusion of imported amino acid sequences.
- variable domains in both the heavy and light chains are altered by at least partial replacement of one or more CDRs and, if necessary, by partial framework region replacement and sequence changing.
- the CDRs can be derived from an antibody of the same class or even subclass as the antibody from which the framework regions are derived, it is envisaged that the CDRs will be derived from an antibody of different class and in certain embodiments from an antibody from a different species. It may not be necessary to replace all of the CDRs with the complete CDRs from the donor variable region to transfer the antigen-binding capacity of one variable domain to another. Rather, it may only be necessary to transfer those residues that are necessary to maintain the activity of the antigen-binding site. Given the explanations set forth in U.S. Pat. Nos. 5,585,089, 5,693,761 and 5,693,762, it will be well within the competence of those skilled in the art, either by carrying out routine experimentation or by trial and error testing to obtain a functional antibody with reduced immunogenicity.
- the modified antibodies of this invention will comprise antibodies (e.g. , full- length antibodies or immunoreactive fragments thereof) in which at least a fraction of one or more of the constant region domains has been deleted or otherwise altered so as to provide desired biochemical characteristics such as increased tumor localization or reduced serum half-life when compared with an antibody of approximately the same immunogenicity comprising a native or unaltered constant region.
- the constant region of the modified antibodies will comprise a human constant region.
- Modifications to the constant region compatible with this invention comprise additions, deletions or substitutions of one or more amino acids in one or more domains.
- the modified antibodies disclosed herein can comprise alterations or modifications to one or more of the three heavy chain constant domains (CHI, CH2, or CH3) and/or to the light chain constant domain (CL).
- modified constant regions wherein one or more domains are partially or entirely deleted are contemplated.
- the modified antibodies will comprise domain deleted constructs or variants wherein the entire CH2 domain has been removed (ACH2 constructs).
- the omitted constant region domain will be replaced by a short amino acid spacer (e.g. , 10 residues) that provides some of the molecular flexibility typically imparted by the absent constant region.
- the modified antibodies can be engineered to fuse the CH3 domain directly to the hinge region of the respective modified antibodies.
- compatible constructs could be expressed wherein the CH2 domain has been deleted and the remaining CH3 domain (modified or unmodified) is joined to the hinge region with a 5-20 amino acid spacer.
- Such a spacer can be added, for instance, to ensure that the regulatory elements of the constant domain remain free and accessible or that the hinge region remains flexible.
- amino acid spacers can, in some cases, prove to be immunogenic and elicit an unwanted immune response against the construct. Accordingly, in certain embodiments, any spacer added to the construct will be relatively non- immunogenic, or even omitted altogether, so as to maintain the desired biochemical qualities of the modified antibodies.
- the antibodies of the present invention can be provided by the partial deletion or substitution of a few or even a single amino acid.
- the mutation of a single amino acid in selected areas of the CH2 domain may be enough to substantially reduce Fc binding and thereby increase tumor localization.
- Such partial deletions of the constant regions can improve selected characteristics of the antibody (serum half-life) while leaving other desirable functions associated with the subject constant region domain intact.
- the constant regions of the disclosed antibodies can be modified, e.g.
- Certain embodiments can comprise the addition of one or more amino acids to the constant region to enhance desirable
- conservative substitution mutations i.e., the substitution of one or more amino acids by similar amino acids.
- conservative substitution refers to the substitution of an amino acid with another within the same general class such as, for example, one acidic amino acid with another acidic amino acid, one basic amino acid with another basic amino acid or one neutral amino acid by another neutral amino acid. What is intended by a conservative amino acid substitution is well known in the art, such as those defined hereinabove.
- polypeptides of the present invention can be recombinant polypeptides, natural polypeptides, or synthetic polypeptides comprising an antibody, or fragment thereof, against a human CD123/IL-3Ra. It will be recognized in the art that some amino acid sequences of the invention can be varied without significant effect of the structure or function of the protein. Thus, the invention further includes variations of the polypeptides which show substantial activity or which include regions of an antibody, or fragment thereof, against a CD 123 antigen, such as a human CD 123. Such mutants include deletions, insertions, inversions, repeats, and type substitutions.
- polypeptides and analogs can be further modified to contain additional chemical moieties not normally part of the protein.
- Those derivatized moieties may improve the solubility, the biological half life or absorption of the protein.
- the moieties can also reduce or eliminate any desirable side effects of the proteins and the like. An overview for those moieties can be found in REMINGTON'S PHARMACEUTICAL SCIENCES, 20th ed., Mack Publishing Co., Easton, PA (2000).
- the isolated polypeptides described herein can be produced by any suitable method known in the art. Such methods range from direct protein synthetic methods to constructing a DNA sequence encoding isolated polypeptide sequences and expressing those sequences in a suitable transformed host.
- a DNA sequence is constructed using recombinant technology by isolating or synthesizing a DNA sequence encoding a wild-type protein of interest.
- the sequence can be mutagenized by site-specific mutagenesis to provide functional analogs thereof. See, e.g., Zoeller et al., Proc. Nat'l. Acad. Sci. USA 81:5662-5066, 1984, and U.S. Pat. No. 4,588,585.
- a DNA sequence encoding a polypeptide of interest ⁇ e.g., antibody, antigen-binding fragment, or polypeptide of the invention
- oligonucleotide synthesizer Such oligonucleotides can be designed based on the amino acid sequence of the desired polypeptide and selecting those codons that are favored in the host cell in which the recombinant polypeptide of interest will be produced. Standard methods can be applied to synthesize an isolated polynucleotide sequence encoding an isolated polypeptide of interest. For example, a complete amino acid sequence can be used to construct a back-translated gene.
- a DNA oligomer containing a nucleotide sequence coding for the particular isolated polypeptide can be synthesized. For example, several small oligonucleotides coding for portions of the desired polypeptide can be synthesized and then ligated. The individual oligonucleotides typically contain 5' or 3' overhangs for complementary assembly.
- the polynucleotide sequences encoding a particular isolated polypeptide of interest will be inserted into an expression vector and operatively linked to an expression control sequence appropriate for expression of the protein in a desired host. Proper assembly can be confirmed by nucleotide sequencing, restriction mapping, and expression of a biologically active polypeptide in a suitable host. As is well known in the art, in order to obtain high expression levels of a transfected gene in a host, the gene must be operatively linked to transcriptional and translational expression control sequences that are functional in the chosen expression host.
- recombinant expression vectors are used to amplify and express DNA encoding antibodies, or fragments thereof, against human CD123/IL-3Ra.
- Recombinant expression vectors are replicable DNA constructs which have synthetic or cDNA-derived DNA fragments encoding a polypeptide chain of an anti-CD 123/IL-3Ra antibody, or fragment thereof, operatively linked to suitable transcriptional or translational regulatory elements derived from mammalian, microbial, viral or insect genes.
- transcriptional unit generally comprises an assembly of (1) a genetic element or elements having a regulatory role in gene expression, for example, transcriptional promoters or enhancers, (2) a structural or coding sequence which is transcribed into mRNA and translated into protein, and (3) appropriate transcription and translation initiation and termination sequences.
- a genetic element or elements having a regulatory role in gene expression for example, transcriptional promoters or enhancers
- Such regulatory elements can include an operator sequence to control transcription.
- the ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants can additionally be
- DNA regions are operatively linked when they are functionally related to each other.
- DNA for a signal peptide secretory leader
- DNA for a polypeptide is operatively linked to DNA for a polypeptide if it is expressed as a precursor which participates in the secretion of the polypeptide
- a promoter is operatively linked to a coding sequence if it controls the transcription of the sequence
- a ribosome binding site is operatively linked to a coding sequence if it is positioned so as to permit translation.
- Structural elements intended for use in yeast expression systems include a leader sequence enabling extracellular secretion of translated protein by a host cell.
- recombinant protein is expressed without a leader or transport sequence, it can include an N-terminal methionine residue. This residue can optionally be subsequently cleaved from the expressed recombinant protein to provide a final product.
- expression control sequence and expression vector will depend upon the choice of host.
- a wide variety of expression host/vector combinations can be employed.
- Useful expression vectors for eukaryotic hosts include, for example, vectors comprising expression control sequences from SV40, bovine papilloma virus, adenovirus and
- Useful expression vectors for bacterial hosts include known bacterial plasmids, such as plasmids from Escherichia coli, including pCR 1, pBR322, pMB9 and their derivatives, wider host range plasmids, such as M13 and filamentous single- stranded DNA phages.
- Suitable host cells for expression of a CD123/IL-3Ra-binding polypeptide or antibody (or a CD123/IL-3Ra protein to use as an antigen) include prokaryotes, yeast, insect or higher eukaryotic cells under the control of appropriate promoters.
- Prokaryotes include gram negative or gram positive organisms, for example E. coli or bacilli.
- Higher eukaryotic cells include established cell lines of mammalian origin, such as CHO cells. Cell-free translation systems could also be employed.
- Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described by Pouwels et al.
- mammalian or insect cell culture systems are also advantageously employed to express recombinant protein.
- Expression of recombinant proteins in mammalian cells can be performed because such proteins are generally correctly folded, appropriately modified and completely functional.
- suitable mammalian host cell lines include HEK- 293 and HEK-293T, the COS-7 lines of monkey kidney cells, described by Gluzman (Cell 23: 175, 1981), and other cell lines including, for example, L cells, CI 27, 3T3, Chinese hamster ovary (CHO), HeLa and BHK cell lines.
- Mammalian expression vectors can comprise nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5' or 3' flanking nontranscribed sequences, and 5' or 3' nontranslated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
- nontranscribed elements such as an origin of replication, a suitable promoter and enhancer linked to the gene to be expressed, and other 5' or 3' flanking nontranscribed sequences, and 5' or 3' nontranslated sequences, such as necessary ribosome binding sites, a polyadenylation site, splice donor and acceptor sites, and transcriptional termination sequences.
- one aspect of the invention also provides a cell producing any one of the subject antibody or antigen-binding fragment thereof, or any one of the subject polypeptide.
- the cell is a mammalian cell.
- the cell is a HEK-293 or HEK-293T cell, a COS-7 cell, an L cell, a CI 27 cell, a 3T3 cell, a Chinese hamster ovary (CHO) cell, a HeLa cell, or a BHK cell.
- the cell is a CHO cell.
- the proteins produced by a transformed host can be purified according to any suitable method.
- standard methods include chromatography ⁇ e.g., ion exchange, affinity and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for protein purification.
- Affinity tags such as hexahistidine, maltose binding domain, influenza coat sequence and glutathione-S-transferase can be attached to the protein to allow easy purification by passage over an appropriate affinity column.
- Isolated proteins can also be physically characterized using such techniques as proteolysis, nuclear magnetic resonance and x-ray crystallography.
- supernatants from systems which secrete recombinant protein into culture media can be first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. Following the concentration step, the concentrate can be applied to a suitable purification matrix.
- a commercially available protein concentration filter for example, an Amicon or Millipore Pellicon ultrafiltration unit.
- the concentrate can be applied to a suitable purification matrix.
- an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups.
- the matrices can be acrylamide, agarose, dextran, cellulose or other types commonly employed in protein purification.
- a cation exchange step can be employed. Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups.
- RP- HPLC reversed- phase high performance liquid chromatography
- silica gel having pendant methyl or other aliphatic groups can be employed to further purify a CD123/IL-3Ra-binding agent. Some or all of the foregoing purification steps, in various combinations, can also be employed to provide a homogeneous recombinant protein.
- Recombinant protein produced in bacterial culture can be isolated, for example, by initial extraction from cell pellets, followed by one or more concentration, salting-out, aqueous ion exchange or size exclusion chromatography steps. High performance liquid chromatography (HPLC) can be employed for final purification steps.
- Microbial cells employed in expression of a recombinant protein can be disrupted by any convenient method, including freeze-thaw cycling, sonication, mechanical disruption, or use of cell lysing agents.
- Methods known in the art for purifying antibodies and other proteins also include, for example, those described in U.S. Patent Publication Nos. 2008/0312425, 2008/0177048, and 2009/0187005, each of which is hereby incorporated by reference herein in its entirety.
- the CD123/IL-3Ra-binding agent of the present invention have a N-terminal serine, which can be oxidized with an oxidizing agent to form an oxidized CD123/IL-3Ra-binding agent having a N-terminal aldehyde group.
- any suitable oxidizing agent can be used in step (a) of the methods described above.
- the oxidizing agent is a periodate. More specifically, the oxidizing agent is sodium periodate.
- Excess molar equivalents of the oxidizing agent relative to the CD123/IL-3Ra- binding agent can be used. In certain embodiments, about 2- 100, 5-80, 10-50, 1- 10 or 5- 10 molar equivalents of the oxidizing agent can be used. In certain embodiments, about 10 or about 50 equivalents of the oxidizing agent can be used. When large amount of the oxidizing agent is used, short reaction time is used to avoid over-oxidation. For example, when 50 equivalents of the oxidizing agent is used, the oxidation reaction is carried out for about 5 to about 60 minutes. Alternatively, when 10 equivalents of the oxidizing agent is used, the reaction is carried out for about 30 minutes to about 24 hours.
- 5- 10 molar equivalents of the oxidizing agent is used and the oxidation reaction is carried out for about 5 to about 60 minutes (e.g. , about 10 to about 30 minutes, about 20 to about 30 minutes).
- the oxidation reaction does not lead to significant non- targeted oxidation.
- no signification extent e.g. , less than 20%, less than 10%, less than 5%, less than 3%, less than 2% or less than 1%) of methionine and/or glycans are oxidized during the oxidation process of N-terminal serine to generate the oxidized
- CD123/IL-3Ra-binding agent having a N-terminal aldehyde group.
- the CD123/IL-3Ra-binding agent of the present invention have a recombinantly engineered Cys residue, such as a Cys residue corresponding to the 5 th to the last Cys in, for example, SEQ ID NO: 54 or 56 (i.e, a Cys residue at EU/OU numbering position 442).
- Cys residue such as a Cys residue corresponding to the 5 th to the last Cys in, for example, SEQ ID NO: 54 or 56 (i.e, a Cys residue at EU/OU numbering position 442).
- Cys engineered antibody includes an antibody with at least one Cys that is not normally present at a given residue of the antibody light chain or heavy chain.
- Such Cys which may also be referred to as "engineered Cys,” can be engineered using any conventional molecular biology or recombinant DNA technology (e.g.
- the Cys engineered antibody of the invention has an engineered Cys in the heavy chain.
- the engineered Cys is in or near the CH3 domain of the heavy chain.
- the engineered antibody heavy (or light) chain sequence can be inserted into a suitable recombinant expression vector to produce the engineered antibody having the engineered Cys residue in place of the original Ser residue.
- the present invention also provides immunoconjugates comprising CD123/IL-3Ra-binding agents described herein covalently linked to one or more molecules of the cytototoxic agents described herein.
- the immuoconjugate of the present invention comprises a CD123/IL-3Ra-binding agents (including antibody, antigen-binding fragment thereof, or polypeptide comprising the antibody or antigen-binding fragment thereof) described herein covalently linked to a cytotoxic agent described herein through the ⁇ -amino group of one or more lysine residues located on the CD123/IL-3Ra-binding agents.
- the immunoconjugate of the present invention is represented by the following formula:
- CBA is a CD123/IL-3Ra-binding agent (e.g. a subject antibody or antigen-binding fragment thereof described herein above, or a subject polypeptide thereof described above), that is covalently linked through a lysine residue to Cy L1 ;
- a CD123/IL-3Ra-binding agent e.g. a subject antibody or antigen-binding fragment thereof described herein above, or a subject polypeptide thereof described above
- W L is an integer from 1 to 20;
- Cy L1 is a cytotoxic compound represented by the following formula:
- the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H or a (Ci-C4)alkyl; and when it is a single bond, X is -H or an amine protecting moiety, and Y is -OH or -SO 3 M; W is -NR e ,
- R e' is -(CH 2 -CH 2 -0) n -R k ;
- n is an integer from 2 to 6;
- R k is -H or -Me
- R x3 is a (Ci-C 6 )alkyl
- L' is represented by the following formula:
- R 5 is -H or a (Ci-C 3 )alkyl
- P is an amino acid residue or a peptide containing between 2 to 20 amino acid residues
- R a and R are each independently -H, (Ci-C 3 )alkyl, or a char substituent or an ionizable group Q;
- n is an integer from 1 to 6;
- Z sl is selected from any one of the following formulas:
- q is an integer from 1 to 5;
- M is H + or a cation.
- Cy is represented by formula (LI a) or (Llal); and the remaining variables are as described above in the 1 st specific embodiment.
- Cy L1 is represented by formula (Lib) or (Llbl); and the remaining variables are as described above in the 1 st specific embodiment. More specifically, R x3 is a (C2-C4)alkyl.
- Cy L1 is represented by formula (Lla); R a and R are both H; R 5 is H or Me, and the remaining variables are as described above in the 1 st specific embodiment.
- P is a peptide containing 2 to 5 amino acid residues; and the remaining variables are described above in the 1 st , 2 nd or 4 th specific embodiment.
- P is selected from the group consisting of Gly-Gly-Gly, Ala-Val, Val-Ala, Val-Cit, Val-Lys, Phe-Lys, Lys-Lys, Ala-Lys, Phe-Cit, Leu-Cit, Ile-Cit, Trp, Cit, Phe-Ala, Phe-N 9 -tosyl-Arg, Phe-N 9 -nitro-Arg, Phe-Phe-Lys, D-Phe-Phe-Lys, Gly-Phe-Lys, Leu-Ala-Leu, He- Ala-Leu, Val-Ala-Val, Ala-Leu- Ala-Leu (SEQ ID NO: 55), ⁇ - Ala-Leu
- Q is -SO 3 M; and the remaining variables are as described above in the 1 st , 2 nd , 4 th or 5 th specific embodiment or any more specific
- the immunoconjugate of the first embodiment is represented b the following formula:
- W L is an integer from 1 to 10; the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H; and when it is a single bond, X is -H, and Y is -OH or -SO 3 M.
- the double line ⁇ between N and C represents a double bond, X is absent and Y is -H.
- the double line ⁇ between N and C represents a single bond, X is -H and Y is -SO 3 M.
- the immunoconjugate of the first embodiment is represented by the following formula:
- CBA is a CD123/IL-3Ra-binding agent described in the first aspect of the present invention (e.g. a subject antibody or antigen-binding fragment thereof described herein above, or a subject polypeptide thereof described above), that is covalently linked to Cy L2 through a lysine residue;
- W L is an integer from 1 to 20;
- Cy is a c totoxic compound represented by the following formula:
- the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H or a (Ci-C4)alkyl; and when it is a single bond, X is -H or an amine protecting moiety, and Y is -OH or -SO 3 M;
- R xl and R x2 are independently (Ci-C 6 )alkyl
- R e is -H or a (Ci-C 6 )alkyl
- W is -NR e ,
- R e' is -(CH 2 -CH 2 -0) n -R k ;
- n is an integer from 2 to 6;
- R k is -H or -Me
- s l is selected from any one of the following formulas:
- q is an integer from 1 to 5;
- M is -H + or a cation.
- Cy 12 is represented by formula (L2a) or (L2al); and the remaining variables are as described above in the 8 th specific embodiment.
- Cy 12 is represented by formula (L2b) or (L2bl); and the remaining variables are as described above in the 8 th specific embodiment.
- R e is H or Me
- R xl and R x2 are independently -(CH 2 ) p -(CR f R 8 )-, wherein R f and R 8 are each independently -H or a (Q- C 4 )alkyl; and p is 0, 1, 2 or 3; and the remaining variables are as described above in the 8 th , 9 th or 10 th specific embodiment. More specifically, R f and R 8 are the same or different, and are selected from -H and -Me.
- the immunoconjugate of the first embodiment is represented by the following formu
- W L is an integer from 1 to 10; the double line ⁇ between N and C represents a single bond or a double bond, provided that when it is a double bond, X is absent and Y is -H; and when it is a single bond, X is -H and Y is -OH or -SO 3 M.
- the double line ⁇ between N and C represents a double bond.
- the double line ⁇ between N and C represents a single bond, X is -H and Y is -SO 3 M.
- the immunoconjugates of the first embodiment is represented by the following formula:
- CBA is a CD123/IL-3Ra-binding agents described in the first aspect of the present invention (e.g. a subject antibody or antigen-binding fragment thereof described herein above, or a subject polypeptide thereof described above), which is covalently linked to Cy through a Lys residue;
- W L is an integer from 1 to 20;
- n' is 1 or 2;
- Ri and R 2 are each independently H or a (Ci-C 3 )alkyl
- Z sl is selected from any one of the following formulas:
- q is an integer from 1 to 5;
- M is H + or a cation.
- m' is 1, and Ri and R 2 are both H; and the remaining variables are as described above in the 13 th specific embodiment.
- m' is 2, and Ri and R 2 are both Me; and the remaining variables are as described above in the 13 th specific embodiment.
- the immunoconjugates of the first embodiment is re resented by the following formula:
- WL is an integer from 1 to 10.
- M is H + , Na + or K + ; and the remaining variables are as described above in any one of the 1 st to 16 th specific embodiment or any more specific embodiments described therein.
- the subject antibody or antigen-binding fragment thereof may have one or more of (e.g. , substantially all of, or 100% of) the Lys residues in any of the six light chain and heavy chain CDR regions (if any) substituted by Arg.
- the subject antibody or antigen-binding fragment thereof may comprise an immunoglobulin heavy chain variable region (HCVR) having the amino acid sequence set forth in SEQ ID NO: 39 or 40; and an immunoglobulin light chain variable region (LCVR) having the amino acid sequence set forth in SEQ ID NO: 41.
- HCVR immunoglobulin heavy chain variable region
- LCVR immunoglobulin light chain variable region
- the subject antibody or antigen-binding fragment thereof may also comprise an Ig HCVR having the amino acid sequence set forth in SEQ ID NO: 34; and an Ig LCVR having the amino acid sequence set forth in SEQ ID NO: 35.
- the subject antibody or antigen-binding fragment thereof may further comprise an Ig HCVR having the amino acid sequence set forth in SEQ ID NO: 32, 34, 38, 39, or 40; and an Ig LCVR having the amino acid sequence set forth in SEQ ID NO: 33, 35, 37, or 41.
- the second residue from the N-terminus of SEQ ID NO: 34 is Phe, while in certain other embodiments, the second residue from the N-terminus of SEQ ID NO: 34 is Val.
- immunoconjugates described the first embodiment or any specific embodiments descried therein can be prepared according to any methods known in the art, see, for example, WO
- the immunoconjugates of the first embodiment can be prepared by a first method comprising the steps of reacting the CBA with a cytotoxic agent having an amine reactive group.
- the reaction is carried out in the presence of an imine reactive reagent, such as NaHS0 3 .
- the cytotoxic agent having an amine reactive rea ent is represented by the following formula:
- L c ' is represented by the following formula:
- nitrophenyl e.g. , 2 or 4-nitrophenyl
- dinitrophenyl e.g. , 2,4- dinitrophenyl
- sulfo-tetraflurophenyl e.g. , 4-sulfo-2,3,5,6-tetrafluorophenyl
- Z s is represented by the following formula:
- q is an integer fro 1 to 5;
- U is -H or S0 3 M
- the immunoconjugates of the first embodiment can be prepared by a second method comprising the steps of:
- the reaction in step (a) is carried out in the presence of an imine reactive reagent.
- the cytotoxic agent- linker compound is reacted with the CBA without purification.
- the cytotoxic agent-linker compound is first purified before reacting with the CBA.
- the immunoconjugates of the first embodiment can be prepared by a third method comprising the steps of:
- the reaction in step (b) is carried out in the presence of an imine reactive reagent.
- the immunoconjugates of the first embodiment can be prepared by a fourth method comprising the steps of reacting the CBA, a cytotoxic compound and a linker compound having an amine reactive group and a thiol reactive group.
- the reaction is carried out in the presence of an imine reactive agent.
- the linker compound having an amine reactive group and a thiol reactive group is represented by the following formula:
- R d is phenyl, nitrophenyl, dinitrophenyl, carboxynitrophenyl, pyridyl or nitropyridyl;
- R g is an alkyl; and the remaining variables are as described above for formula (al) - (a 10); and the cytotoxic agent is represented by the following formula:
- the linker compound having an amine reactive group and a thiol reactive group is represented by any one of the formula (alL) - (alOL) and the cytotoxic agent is represented by the following formula:
Landscapes
- Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Immunology (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Cell Biology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Oncology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Hematology (AREA)
- Endocrinology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Medicinal Preparation (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Nitrogen And Oxygen Or Sulfur-Condensed Heterocyclic Ring Systems (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Priority Applications (30)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DK16736718.4T DK3313884T3 (da) | 2015-06-29 | 2016-06-28 | Anti-cd123-antistoffer og konjugater og derivater deraf |
| CN202210033558.4A CN114672490A (zh) | 2015-06-29 | 2016-06-28 | 抗cd123抗体以及其缀合物和衍生物 |
| EP16736718.4A EP3313884B9 (en) | 2015-06-29 | 2016-06-28 | Anti-cd123 antibodies and conjugates and derivatives thereof |
| KR1020247014500A KR20240063203A (ko) | 2015-06-29 | 2016-06-28 | 항-cd123 항체 및 이들의 접합체와 유도체 |
| MDE20180449T MD3313884T2 (ro) | 2015-06-29 | 2016-06-28 | Anticorpi anti-CD123 şi conjugaţi şi derivaţi ai acestora |
| AU2016285552A AU2016285552B2 (en) | 2015-06-29 | 2016-06-28 | Anti-CD123 antibodies and conjugates and derivatives thereof |
| ES16736718T ES2887273T3 (es) | 2015-06-29 | 2016-06-28 | Anticuerpos anti-CD123 y conjugados y derivados de los mismos |
| JP2017568261A JP7203497B2 (ja) | 2015-06-29 | 2016-06-28 | 抗cd123抗体、ならびにその複合体及び誘導体 |
| LTEP16736718.4T LT3313884T (lt) | 2015-06-29 | 2016-06-28 | Anti-cd123 antikūnai, konjugatai ir jų dariniai |
| CA2989321A CA2989321A1 (en) | 2015-06-29 | 2016-06-28 | Anti-cd123 antibodies and conjugates and derivatives thereof |
| CN202210033457.7A CN114671951A (zh) | 2015-06-29 | 2016-06-28 | 抗cd123抗体以及其缀合物和衍生物 |
| HRP20210263TT HRP20210263T1 (hr) | 2015-06-29 | 2016-06-28 | Anti- cd123 antitijela i njihovi konjugati i derivati |
| CN201680038058.2A CN107889493B (zh) | 2015-06-29 | 2016-06-28 | 抗cd123抗体以及其缀合物和衍生物 |
| EP20208057.8A EP3842459A1 (en) | 2015-06-29 | 2016-06-28 | Anti-cd123 antibodies and conjugates and derivatives thereof |
| RS20210197A RS61452B9 (sr) | 2015-06-29 | 2016-06-28 | Anti-cd123 antitela i njihovi konjugati i derivati |
| MA42247A MA42247B1 (fr) | 2015-06-29 | 2016-06-28 | Anticorps anti-cd 123 et conjugués et dérivés correspondants |
| SM20210092T SMT202100092T1 (it) | 2015-06-29 | 2016-06-28 | Anticorpi anti-cd123 e loro coniugati e derivati |
| RU2017146345A RU2739612C2 (ru) | 2015-06-29 | 2016-06-28 | Анти-cd123 антитела и их конъюгаты и производные |
| BR112017027254-7A BR112017027254A2 (pt) | 2015-06-29 | 2016-06-28 | anticorpos anti-cd123 e conjugados e derivados dos mesmos |
| KR1020267007615A KR20260039810A (ko) | 2015-06-29 | 2016-06-28 | 항-cd123 항체 및 이들의 접합체와 유도체 |
| PL16736718T PL3313884T3 (pl) | 2015-06-29 | 2016-06-28 | Przeciwciała anty-cd123 oraz ich koniugaty i pochodne |
| SI201631099T SI3313884T1 (sl) | 2015-06-29 | 2016-06-28 | Protitelesa proti CD123 ter njihovi konjugati in derivati |
| KR1020187002732A KR102663480B1 (ko) | 2015-06-29 | 2016-06-28 | 항-cd123 항체 및 이들의 접합체와 유도체 |
| CN202510430627.9A CN120248124A (zh) | 2015-06-29 | 2016-06-28 | 抗cd123抗体以及其缀合物和衍生物 |
| IL256271A IL256271B (en) | 2015-06-29 | 2017-12-12 | Anti-cd123 antibodies and conjugates and derivatives thereof |
| CY20211100133T CY1123884T1 (el) | 2015-06-29 | 2021-02-17 | Αντισωματα enanti-cd123 και συζευγματα και παραγωγα αυτων |
| IL288391A IL288391A (en) | 2015-06-29 | 2021-11-25 | Anti-cd123 antibodies and conjugates and derivatives thereof |
| AU2022291603A AU2022291603B2 (en) | 2015-06-29 | 2022-12-23 | Anti-CD123 antibodies and conjugates and derivatives thereof |
| JP2022209445A JP7611218B2 (ja) | 2015-06-29 | 2022-12-27 | 抗cd123抗体、ならびにその複合体及び誘導体 |
| JP2024226350A JP2025041791A (ja) | 2015-06-29 | 2024-12-23 | 抗cd123抗体、ならびにその複合体及び誘導体 |
Applications Claiming Priority (6)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201562186161P | 2015-06-29 | 2015-06-29 | |
| US62/186,161 | 2015-06-29 | ||
| US201662338203P | 2016-05-18 | 2016-05-18 | |
| US62/338,203 | 2016-05-18 | ||
| US201662346730P | 2016-06-07 | 2016-06-07 | |
| US62/346,730 | 2016-06-07 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2017004026A1 true WO2017004026A1 (en) | 2017-01-05 |
| WO2017004026A8 WO2017004026A8 (en) | 2017-03-02 |
Family
ID=56373176
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2016/039797 Ceased WO2017004026A1 (en) | 2015-06-29 | 2016-06-28 | Anti-cd 123 antibodies and conjugates and derivatives thereof |
Country Status (27)
| Country | Link |
|---|---|
| US (6) | US10077313B2 (https=) |
| EP (2) | EP3842459A1 (https=) |
| JP (3) | JP7203497B2 (https=) |
| KR (3) | KR20240063203A (https=) |
| CN (4) | CN120248124A (https=) |
| AR (1) | AR105194A1 (https=) |
| AU (2) | AU2016285552B2 (https=) |
| BR (1) | BR112017027254A2 (https=) |
| CA (1) | CA2989321A1 (https=) |
| CY (1) | CY1123884T1 (https=) |
| DK (1) | DK3313884T3 (https=) |
| ES (1) | ES2887273T3 (https=) |
| HR (1) | HRP20210263T1 (https=) |
| HU (1) | HUE053619T2 (https=) |
| IL (2) | IL256271B (https=) |
| LT (1) | LT3313884T (https=) |
| MD (1) | MD3313884T2 (https=) |
| PL (1) | PL3313884T3 (https=) |
| PT (1) | PT3313884T (https=) |
| RS (1) | RS61452B9 (https=) |
| RU (1) | RU2739612C2 (https=) |
| SG (1) | SG10202005144TA (https=) |
| SI (1) | SI3313884T1 (https=) |
| SM (1) | SMT202100092T1 (https=) |
| TW (3) | TWI727958B (https=) |
| WO (1) | WO2017004026A1 (https=) |
| ZA (1) | ZA202007918B (https=) |
Cited By (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017091745A1 (en) | 2015-11-25 | 2017-06-01 | Immunogen, Inc. | Pharmaceutical formulations and methods of use thereof |
| WO2018140435A1 (en) * | 2017-01-25 | 2018-08-02 | Immunogen, Inc. | Methods of preparing cytotoxic benzodiazepine derivatives |
| WO2018160539A1 (en) | 2017-02-28 | 2018-09-07 | Immunogen, Inc. | Maytansinoid derivatives with self-immolative peptide linkers and conjugates thereof |
| WO2019060707A1 (en) | 2017-09-22 | 2019-03-28 | Immunogen, Inc. | METHODS FOR PREVENTING OXIDATION OF METHIONINE IN IMMUNOCONJUGATES |
| WO2019060718A1 (en) | 2017-09-22 | 2019-03-28 | Immunogen, Inc. | SEPARATION OF LIGHT TRIPLE CHAIN ANTIBODIES USING CATION EXCHANGE CHROMATOGRAPHY |
| WO2019082020A1 (en) * | 2017-10-27 | 2019-05-02 | Pfizer Inc. | ANTIBODIES AND CONJUGATES CD123-SPECIFIC ANTIBODIES AND USES THEREOF |
| WO2020092533A2 (en) | 2018-10-30 | 2020-05-07 | Immunogen, Inc. | Methods of treatment using anti-cd123 immunoconjugates |
| WO2020092344A1 (en) * | 2018-10-31 | 2020-05-07 | Health Research, Inc. | Combination treatment with anti-cd123 antibody drug conjugate and parp inhibitor |
| WO2020191306A1 (en) | 2019-03-21 | 2020-09-24 | Immunogen, Inc. | Methods of preparing cell-binding agent-drug conjugates |
| WO2020205564A1 (en) | 2019-03-29 | 2020-10-08 | Immunogen, Inc. | Cytotoxic bis-benzodiazepine derivatives and conjugates thereof with cell-binding agents for inhibiting abnormal cell growth or for treating proliferative diseases |
| US10898579B2 (en) | 2015-06-29 | 2021-01-26 | Immunogen, Inc. | Conjugates of cysteine engineered antibodies |
| JP2022512935A (ja) * | 2018-11-12 | 2022-02-07 | イミュノジェン・インコーポレーテッド | 細胞傷害性ベンゾジアゼピン誘導体の調製方法 |
| JP2022512936A (ja) * | 2018-11-12 | 2022-02-07 | イミュノジェン・インコーポレーテッド | 細胞傷害性ベンゾジアゼピン誘導体の調製方法 |
| US20220062339A1 (en) * | 2019-01-07 | 2022-03-03 | Magenta Therapeutics, Inc. | Use of an anti-cd45 antibody drug conjugate (adc) in cell therapy |
| US11274121B2 (en) | 2018-01-12 | 2022-03-15 | Immunogen, Inc. | Methods for antibody drug conjugation, purification, and formulation |
| RU2789150C2 (ru) * | 2017-10-27 | 2023-01-30 | Пфайзер Инк. | Антитела и конъюгаты антитела-лекарственного средства, специфичные к cd123, и их применения |
| US11583590B2 (en) | 2017-09-29 | 2023-02-21 | Daiichi Sankyo Company, Limited | Antibody-pyrrolobenzodiazepine derivative conjugate and method of use thereof for treating a tumor |
| WO2023051814A1 (zh) | 2021-09-30 | 2023-04-06 | 江苏恒瑞医药股份有限公司 | 吡咯并苯并二氮杂卓类衍生物及其偶联物、其制备方法及其应用 |
| US11701428B2 (en) * | 2019-04-29 | 2023-07-18 | Immunogen, Inc. | Therapeutic combinations comprising anti-CD123 immunoconjugates |
| US12201154B2 (en) | 2018-01-03 | 2025-01-21 | Cqens Technologies Inc. | Heat-not-burn device and method |
| US12251448B2 (en) | 2017-11-29 | 2025-03-18 | Heidelberg Pharma Research Gmbh | Compositions and methods for the depletion of CD5+ cells |
| WO2025235924A2 (en) | 2024-05-10 | 2025-11-13 | Immunogen, Inc. | Anti-cd123 immunoconjugates for the treatment of acute myeloid leukemia |
| WO2025235918A1 (en) | 2024-05-10 | 2025-11-13 | Immunogen, Inc. | Anti-cd123 immunoconjugates for the treatment of blastic plasmacytoid cell neoplasm |
Families Citing this family (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2982205A1 (en) | 2015-04-10 | 2016-10-13 | David W. Andrews | Methods and compositions for treating cancers and enhancing therapeutic immunity by selectively reducing immunomodulatory m2 monocytes |
| AU2016285552B2 (en) * | 2015-06-29 | 2022-10-13 | Immunogen, Inc. | Anti-CD123 antibodies and conjugates and derivatives thereof |
| WO2018098258A2 (en) | 2016-11-23 | 2018-05-31 | Immunogen, Inc. | Selective sulfonation of benzodiazepine derivatives |
| US20180230218A1 (en) * | 2017-01-04 | 2018-08-16 | Immunogen, Inc. | Met antibodies and immunoconjugates and uses thereof |
| CN111542537B (zh) * | 2018-06-15 | 2022-09-27 | 康源博创生物科技(北京)有限公司 | 抗cd123抗体及其制备方法和应用 |
| US20220306751A1 (en) * | 2019-09-13 | 2022-09-29 | Mythic Therapeutics, Inc. | Antigen-binding protein constructs and uses thereof |
| CN112646033B (zh) * | 2020-12-16 | 2022-04-12 | 北京艺妙神州医药科技有限公司 | 靶向cd123的嵌合抗原受体及其用途 |
| CN120957754A (zh) * | 2023-05-12 | 2025-11-14 | 四川科伦博泰生物医药股份有限公司 | 稠环化合物及其制备方法和用途 |
| AU2024318876A1 (en) | 2023-07-31 | 2026-03-19 | Astrazeneca Ab | Cd123 antibody-drug conjugates and methods of using the same |
Citations (50)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4588585A (en) | 1982-10-19 | 1986-05-13 | Cetus Corporation | Human recombinant cysteine depleted interferon-β muteins |
| EP0229246A2 (de) | 1986-01-15 | 1987-07-22 | ANT Nachrichtentechnik GmbH | Verfahren zum Dekodieren von Binärsignalen sowie Viterbi-Dekoder und Anwendungen |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| WO1990014443A1 (en) | 1989-05-16 | 1990-11-29 | Huse William D | Co-expression of heteromeric receptors |
| WO1990014424A1 (en) | 1989-05-16 | 1990-11-29 | Scripps Clinic And Research Foundation | Method for isolating receptors having a preselected specificity |
| WO1990014430A1 (en) | 1989-05-16 | 1990-11-29 | Scripps Clinic And Research Foundation | A new method for tapping the immunological repertoire |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5639641A (en) | 1992-09-09 | 1997-06-17 | Immunogen Inc. | Resurfacing of rodent antibodies |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5714352A (en) | 1996-03-20 | 1998-02-03 | Xenotech Incorporated | Directed switch-mediated DNA recombination |
| US5723323A (en) | 1985-03-30 | 1998-03-03 | Kauffman; Stuart Alan | Method of identifying a stochastically-generated peptide, polypeptide, or protein having ligand binding property and compositions thereof |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US5763192A (en) | 1986-11-20 | 1998-06-09 | Ixsys, Incorporated | Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6204023B1 (en) | 1985-11-01 | 2001-03-20 | Xoma Ltd. | Modular assembly of antibody genes, antibodies prepared thereby and use |
| US6300064B1 (en) | 1995-08-18 | 2001-10-09 | Morphosys Ag | Protein/(poly)peptide libraries |
| US6413746B1 (en) | 1986-03-14 | 2002-07-02 | Lonza Group, Ag | Production of proteins by cell culture |
| US6653068B2 (en) | 1999-07-02 | 2003-11-25 | Morphosys Ag | Generation of specific binding partners binding to (poly)peptides encoded by genomic DNA fragments or ESTs |
| WO2004009823A1 (en) | 2002-07-18 | 2004-01-29 | Lonza Biologics Plc. | Method of expressing recombinant protein in cho cells |
| US6706484B1 (en) | 1995-08-18 | 2004-03-16 | Morphosys Ag | Protein/(poly)peptide libraries |
| US7342110B2 (en) | 2002-11-07 | 2008-03-11 | Immunogen Inc. | Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same |
| US20080177048A1 (en) | 2007-01-09 | 2008-07-24 | Bio-Rad Laboratories, Inc. | Enhanced capacity and purification of antibodies by mixed mode chromatography in the presence of aqueous-soluble nonionic organic polymers |
| US20080187954A1 (en) | 2004-03-10 | 2008-08-07 | Lonza Ltd. | Method For Producing Antibodies |
| WO2008127735A1 (en) * | 2007-04-13 | 2008-10-23 | Stemline Therapeutics, Inc. | Il3ralpha antibody conjugates and uses thereof |
| US20080312425A1 (en) | 2004-08-30 | 2008-12-18 | Lonza Biologics Plc. | Ion Exchange Chromatography and Purification of Antibodies |
| US7538195B2 (en) | 2002-06-14 | 2009-05-26 | Immunogen Inc. | Anti-IGF-I receptor antibody |
| US20090187005A1 (en) | 2008-01-18 | 2009-07-23 | Gagnon Peter S | Enhanced purification of antibodies and antibody fragments by apatite chromatography |
| WO2012021934A1 (en) * | 2010-08-17 | 2012-02-23 | Csl Limited | Humanized anti-interleukin 3 receptor alpha chain antibodies |
| EP2426148A1 (en) * | 2009-04-27 | 2012-03-07 | Kyowa Hakko Kirin Co., Ltd. | Anti-il-3ra antibody for use in treatment of blood tumor |
| WO2012112687A1 (en) | 2011-02-15 | 2012-08-23 | Immunogen, Inc. | Methods of preparation of conjugates |
| WO2015026892A1 (en) * | 2013-08-23 | 2015-02-26 | Macrogenics, Inc. | Bi-specific monovalent diabodies that are capable of binding cd123 and cd3, and uses therof |
| WO2015044386A1 (en) * | 2013-09-26 | 2015-04-02 | Ablynx Nv | Bispecific nanobodies |
| US9105939B2 (en) | 2008-03-10 | 2015-08-11 | Nissan Motor Co., Ltd. | Battery with battery electrode and method of manufacturing same |
| US9109630B2 (en) | 2013-01-15 | 2015-08-18 | Jtekt Corporation | Rolling bearing unit |
| WO2016036801A1 (en) * | 2014-09-03 | 2016-03-10 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives |
| WO2016036937A1 (en) * | 2014-09-05 | 2016-03-10 | Janssen Pharmaceutica Nv | Cd123 binding agents and uses thereof |
| WO2016036794A1 (en) * | 2014-09-03 | 2016-03-10 | Immunogen, Inc. | Conjugates comprising cell-binding agents and cytotoxic agents |
| US9401234B2 (en) | 2013-03-22 | 2016-07-26 | Polytronics Technology Corp. | Over-current protection device |
| US9618978B2 (en) | 2013-10-03 | 2017-04-11 | Acer Incorporated | Methods for controlling a touch panel and portable computers using the same |
| US9816280B1 (en) | 2016-11-02 | 2017-11-14 | Matthew Reitnauer | Portable floor |
Family Cites Families (14)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NZ616992A (en) * | 2005-12-20 | 2015-07-31 | Sbi Biotech Co Ltd | Anti-ilt7 antibody |
| US20100209341A1 (en) | 2009-02-18 | 2010-08-19 | Csl Limited | Treatment of chronic inflammatory conditions |
| JP2013519689A (ja) | 2010-02-18 | 2013-05-30 | シーエスエル、リミテッド | 慢性炎症状態の治療 |
| TWI622402B (zh) | 2010-02-24 | 2018-05-01 | 免疫遺傳股份有限公司 | 葉酸受體1抗體類和免疫共軛物類及彼等之用途 |
| CA2799540A1 (en) | 2010-06-08 | 2011-12-15 | Genentech, Inc. | Cysteine engineered antibodies and conjugates |
| WO2014138805A1 (en) | 2013-03-14 | 2014-09-18 | Csl Limited | Anti il-3r alpha agents and uses thereof |
| EP3145542A4 (en) * | 2014-05-20 | 2018-01-17 | ImmunoGen, Inc. | Methods for characterizing and treating acute myeloid leukemia |
| SMT202000614T1 (it) | 2015-06-29 | 2021-01-05 | Immunogen Inc | Coniugati di anticorpi ingegnerizzati con cisteina |
| AU2016285552B2 (en) | 2015-06-29 | 2022-10-13 | Immunogen, Inc. | Anti-CD123 antibodies and conjugates and derivatives thereof |
| US20170189548A1 (en) * | 2015-11-25 | 2017-07-06 | Immunogen, Inc. | Pharmaceutical formulations and methods of use thereof |
| WO2018098258A2 (en) * | 2016-11-23 | 2018-05-31 | Immunogen, Inc. | Selective sulfonation of benzodiazepine derivatives |
| KR20200070254A (ko) * | 2017-09-22 | 2020-06-17 | 이뮤노젠 아이엔씨 | 면역접합체에서 메티오닌 산화를 방지하는 방법 |
| EP3684409A4 (en) * | 2017-09-22 | 2021-06-23 | Immunogen, Inc. | SEPARATION OF TRIPLE LIGHT CHAIN ANTIBODIES USING CATION EXCHANGE CHROMATOGRAPHY |
| US11274121B2 (en) | 2018-01-12 | 2022-03-15 | Immunogen, Inc. | Methods for antibody drug conjugation, purification, and formulation |
-
2016
- 2016-06-28 AU AU2016285552A patent/AU2016285552B2/en active Active
- 2016-06-28 SI SI201631099T patent/SI3313884T1/sl unknown
- 2016-06-28 HR HRP20210263TT patent/HRP20210263T1/hr unknown
- 2016-06-28 ES ES16736718T patent/ES2887273T3/es active Active
- 2016-06-28 PT PT167367184T patent/PT3313884T/pt unknown
- 2016-06-28 LT LTEP16736718.4T patent/LT3313884T/lt unknown
- 2016-06-28 SM SM20210092T patent/SMT202100092T1/it unknown
- 2016-06-28 CN CN202510430627.9A patent/CN120248124A/zh active Pending
- 2016-06-28 KR KR1020247014500A patent/KR20240063203A/ko not_active Ceased
- 2016-06-28 DK DK16736718.4T patent/DK3313884T3/da active
- 2016-06-28 EP EP20208057.8A patent/EP3842459A1/en active Pending
- 2016-06-28 KR KR1020267007615A patent/KR20260039810A/ko active Pending
- 2016-06-28 CA CA2989321A patent/CA2989321A1/en active Pending
- 2016-06-28 CN CN201680038058.2A patent/CN107889493B/zh active Active
- 2016-06-28 JP JP2017568261A patent/JP7203497B2/ja active Active
- 2016-06-28 HU HUE16736718A patent/HUE053619T2/hu unknown
- 2016-06-28 CN CN202210033558.4A patent/CN114672490A/zh active Pending
- 2016-06-28 EP EP16736718.4A patent/EP3313884B9/en active Active
- 2016-06-28 KR KR1020187002732A patent/KR102663480B1/ko active Active
- 2016-06-28 CN CN202210033457.7A patent/CN114671951A/zh active Pending
- 2016-06-28 WO PCT/US2016/039797 patent/WO2017004026A1/en not_active Ceased
- 2016-06-28 PL PL16736718T patent/PL3313884T3/pl unknown
- 2016-06-28 RS RS20210197A patent/RS61452B9/sr unknown
- 2016-06-28 SG SG10202005144TA patent/SG10202005144TA/en unknown
- 2016-06-28 US US15/195,401 patent/US10077313B2/en active Active
- 2016-06-28 RU RU2017146345A patent/RU2739612C2/ru active
- 2016-06-28 BR BR112017027254-7A patent/BR112017027254A2/pt active IP Right Grant
- 2016-06-28 MD MDE20180449T patent/MD3313884T2/ro unknown
- 2016-06-29 TW TW105120515A patent/TWI727958B/zh active
- 2016-06-29 TW TW110114906A patent/TW202134284A/zh unknown
- 2016-06-29 AR ARP160101974A patent/AR105194A1/es unknown
- 2016-06-29 TW TW112134213A patent/TW202423981A/zh unknown
-
2017
- 2017-08-03 US US15/667,697 patent/US10919969B2/en active Active
- 2017-12-12 IL IL256271A patent/IL256271B/en unknown
-
2018
- 2018-04-19 US US15/957,757 patent/US10442865B2/en active Active
-
2020
- 2020-01-31 US US16/778,988 patent/US10875925B2/en active Active
- 2020-10-22 US US17/077,877 patent/US11332535B2/en active Active
- 2020-12-18 ZA ZA2020/07918A patent/ZA202007918B/en unknown
-
2021
- 2021-02-17 CY CY20211100133T patent/CY1123884T1/el unknown
- 2021-11-25 IL IL288391A patent/IL288391A/en unknown
-
2022
- 2022-04-01 US US17/711,518 patent/US11897961B2/en active Active
- 2022-12-23 AU AU2022291603A patent/AU2022291603B2/en active Active
- 2022-12-27 JP JP2022209445A patent/JP7611218B2/ja active Active
-
2024
- 2024-12-23 JP JP2024226350A patent/JP2025041791A/ja active Pending
Patent Citations (67)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4588585A (en) | 1982-10-19 | 1986-05-13 | Cetus Corporation | Human recombinant cysteine depleted interferon-β muteins |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5824514A (en) | 1985-03-30 | 1998-10-20 | Stuart A. Kauffman | Process for the production of expression vectors comprising at least one stochastic sequence of polynucleotides |
| US5723323A (en) | 1985-03-30 | 1998-03-03 | Kauffman; Stuart Alan | Method of identifying a stochastically-generated peptide, polypeptide, or protein having ligand binding property and compositions thereof |
| US5817483A (en) | 1985-03-30 | 1998-10-06 | Stuart Kauffman | Process for the production of stochastically-generated peptides,polypeptides or proteins having a predetermined property |
| US5814476A (en) | 1985-03-30 | 1998-09-29 | Stuart Kauffman | Process for the production of stochastically-generated transcription or translation products |
| US5976862A (en) | 1985-03-30 | 1999-11-02 | Ixsys Corporation | Process for obtaining DNA, RNA, peptides, polypeptides, or proteins, by recombinant DNA technique |
| US6204023B1 (en) | 1985-11-01 | 2001-03-20 | Xoma Ltd. | Modular assembly of antibody genes, antibodies prepared thereby and use |
| EP0229246A2 (de) | 1986-01-15 | 1987-07-22 | ANT Nachrichtentechnik GmbH | Verfahren zum Dekodieren von Binärsignalen sowie Viterbi-Dekoder und Anwendungen |
| US6660501B2 (en) | 1986-03-14 | 2003-12-09 | Lonza Group, Ag | Production of proteins by cell culture |
| US6413746B1 (en) | 1986-03-14 | 2002-07-02 | Lonza Group, Ag | Production of proteins by cell culture |
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5763192A (en) | 1986-11-20 | 1998-06-09 | Ixsys, Incorporated | Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5585089A (en) | 1988-12-28 | 1996-12-17 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US6180370B1 (en) | 1988-12-28 | 2001-01-30 | Protein Design Labs, Inc. | Humanized immunoglobulins and methods of making the same |
| US5693762A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| US5693761A (en) | 1988-12-28 | 1997-12-02 | Protein Design Labs, Inc. | Polynucleotides encoding improved humanized immunoglobulins |
| WO1990014430A1 (en) | 1989-05-16 | 1990-11-29 | Scripps Clinic And Research Foundation | A new method for tapping the immunological repertoire |
| WO1990014424A1 (en) | 1989-05-16 | 1990-11-29 | Scripps Clinic And Research Foundation | Method for isolating receptors having a preselected specificity |
| WO1990014443A1 (en) | 1989-05-16 | 1990-11-29 | Huse William D | Co-expression of heteromeric receptors |
| US5969108A (en) | 1990-07-10 | 1999-10-19 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5750373A (en) | 1990-12-03 | 1998-05-12 | Genentech, Inc. | Enrichment method for variant proteins having altered binding properties, M13 phagemids, and growth hormone variants |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| US6593081B1 (en) | 1991-12-02 | 2003-07-15 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US5885793A (en) | 1991-12-02 | 1999-03-23 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6521404B1 (en) | 1991-12-02 | 2003-02-18 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6544731B1 (en) | 1991-12-02 | 2003-04-08 | Medical Research Council | Production of anti-self antibodies from antibody segment repertories and displayed on phage |
| US6555313B1 (en) | 1991-12-02 | 2003-04-29 | Medical Research Council | Production of anti-self antibodies from antibody segment repertoires and displayed on phage |
| US6582915B1 (en) | 1991-12-02 | 2003-06-24 | Medical Research Council | Production of anti-self bodies from antibody segment repertories and displayed on phage |
| US5766886A (en) | 1991-12-13 | 1998-06-16 | Xoma Corporation | Modified antibody variable domains |
| US5639641A (en) | 1992-09-09 | 1997-06-17 | Immunogen Inc. | Resurfacing of rodent antibodies |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US7264963B1 (en) | 1995-08-18 | 2007-09-04 | Morphosys Ag | Protein(poly)peptide libraries |
| US6300064B1 (en) | 1995-08-18 | 2001-10-09 | Morphosys Ag | Protein/(poly)peptide libraries |
| US6706484B1 (en) | 1995-08-18 | 2004-03-16 | Morphosys Ag | Protein/(poly)peptide libraries |
| US5714352A (en) | 1996-03-20 | 1998-02-03 | Xenotech Incorporated | Directed switch-mediated DNA recombination |
| US6653068B2 (en) | 1999-07-02 | 2003-11-25 | Morphosys Ag | Generation of specific binding partners binding to (poly)peptides encoded by genomic DNA fragments or ESTs |
| US7538195B2 (en) | 2002-06-14 | 2009-05-26 | Immunogen Inc. | Anti-IGF-I receptor antibody |
| WO2004009823A1 (en) | 2002-07-18 | 2004-01-29 | Lonza Biologics Plc. | Method of expressing recombinant protein in cho cells |
| US7342110B2 (en) | 2002-11-07 | 2008-03-11 | Immunogen Inc. | Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same |
| US7557189B2 (en) | 2002-11-07 | 2009-07-07 | Immunogen Inc. | Anti-CD33 antibodies and method for treatment of acute myeloid leukemia using the same |
| US20080187954A1 (en) | 2004-03-10 | 2008-08-07 | Lonza Ltd. | Method For Producing Antibodies |
| US20080312425A1 (en) | 2004-08-30 | 2008-12-18 | Lonza Biologics Plc. | Ion Exchange Chromatography and Purification of Antibodies |
| US20080177048A1 (en) | 2007-01-09 | 2008-07-24 | Bio-Rad Laboratories, Inc. | Enhanced capacity and purification of antibodies by mixed mode chromatography in the presence of aqueous-soluble nonionic organic polymers |
| WO2008127735A1 (en) * | 2007-04-13 | 2008-10-23 | Stemline Therapeutics, Inc. | Il3ralpha antibody conjugates and uses thereof |
| US20090187005A1 (en) | 2008-01-18 | 2009-07-23 | Gagnon Peter S | Enhanced purification of antibodies and antibody fragments by apatite chromatography |
| US9105939B2 (en) | 2008-03-10 | 2015-08-11 | Nissan Motor Co., Ltd. | Battery with battery electrode and method of manufacturing same |
| EP2426148A1 (en) * | 2009-04-27 | 2012-03-07 | Kyowa Hakko Kirin Co., Ltd. | Anti-il-3ra antibody for use in treatment of blood tumor |
| WO2012021934A1 (en) * | 2010-08-17 | 2012-02-23 | Csl Limited | Humanized anti-interleukin 3 receptor alpha chain antibodies |
| WO2012128868A1 (en) | 2011-02-15 | 2012-09-27 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives |
| WO2012112687A1 (en) | 2011-02-15 | 2012-08-23 | Immunogen, Inc. | Methods of preparation of conjugates |
| US9109630B2 (en) | 2013-01-15 | 2015-08-18 | Jtekt Corporation | Rolling bearing unit |
| US9401234B2 (en) | 2013-03-22 | 2016-07-26 | Polytronics Technology Corp. | Over-current protection device |
| WO2015026892A1 (en) * | 2013-08-23 | 2015-02-26 | Macrogenics, Inc. | Bi-specific monovalent diabodies that are capable of binding cd123 and cd3, and uses therof |
| WO2015044386A1 (en) * | 2013-09-26 | 2015-04-02 | Ablynx Nv | Bispecific nanobodies |
| US9618978B2 (en) | 2013-10-03 | 2017-04-11 | Acer Incorporated | Methods for controlling a touch panel and portable computers using the same |
| WO2016036801A1 (en) * | 2014-09-03 | 2016-03-10 | Immunogen, Inc. | Cytotoxic benzodiazepine derivatives |
| WO2016036794A1 (en) * | 2014-09-03 | 2016-03-10 | Immunogen, Inc. | Conjugates comprising cell-binding agents and cytotoxic agents |
| WO2016036937A1 (en) * | 2014-09-05 | 2016-03-10 | Janssen Pharmaceutica Nv | Cd123 binding agents and uses thereof |
| US9816280B1 (en) | 2016-11-02 | 2017-11-14 | Matthew Reitnauer | Portable floor |
Non-Patent Citations (78)
| Title |
|---|
| "REMINGTON'S PHARMACEUTICAL SCIENCES, 20th ed.,", 2000, MACK PUBLISHING CO. |
| AL-LAZIKANI ET AL., J. MOLEC. BIOL., vol. 273, 1997, pages 927 - 948 |
| ALTSCHUL ET AL., METHODS IN ENZYMOLOGY, vol. 266, 1996, pages 460 - 480 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1991, pages 3389 - 3402 |
| ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
| BISSERY ET AL., CANCER RES., vol. 51, 1991, pages 4845 - 52 |
| BOEMER ET AL., J. IMMUNOL, vol. 147, no. 1, 1991, pages 86 - 95 |
| BRENNAN ET AL., SCIENCE, vol. 229, 1985, pages 81 |
| BRUMMELL ET AL., BIOCHEM., vol. 32, 1993, pages 1180 - 1187 |
| BURKS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 94, 1997, pages 412 - 417 |
| CARTER ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 89, 1992, pages 4285 |
| CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 |
| CHOTHIA; LESK, J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CLACKSON ET AL., NATURE, vol. 352, 1991, pages 624 - 628 |
| CO ET AL., J IMMUNOL., vol. 148, 1992, pages 1149 - 54 |
| COLE ET AL.: "Monoclonal Antibodies and Cancer Therapy", 1985, ALAN R. LISS, pages: 77 |
| DU X ET AL: "New immunotoxins targeting CD123, a stem cell antigen on acute myeloid leukemia cells", JOURNAL OF IMMUNOTHERAPY, LIPPINCOTT WILLIAMS & WILKINGS INC, US, vol. 30, no. 6, 1 September 2007 (2007-09-01), pages 607 - 613, XP008116347, ISSN: 1524-9557, DOI: 10.1097/CJI.0B013E318053ED8E * |
| DUROCHER ET AL., NUCLEIC ACIDS RES., vol. 30, no. 2, 2002, pages E9 |
| E. HARLOW; D. LANE: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS |
| EHRENMANN ET AL., NUCLEIC ACIDS RES., vol. 38, 2010, pages D301 - 307 |
| ELIEL, E.; WILEN, S.: "Stereochemistry of Organic Compounds", 1994, JOHN WILEY & SONS, INC. |
| FOOTE; WINTER, J. MOL. BIOL., vol. 224, 1992, pages 487 - 499 |
| GODING: "Monoclonal Antibodies: Principles and Practice", 1986, ACADEMIC PRESS |
| HOOGENBOOM; WINTER, J. MOL. BIOL., vol. 227, 1991, pages 381 |
| HUANG LIANG: "Generation and Functional Assays of Acute Myeloid Leukemic Stem Cells Targeted Anti-CD123 Monoclonal Antibody", 1 May 2011 (2011-05-01), Huazhong University of Science and Technology, XP008181668, Retrieved from the Internet <URL:http://www.dissertationtopic.net/doc/1504548> * |
| J. F. KEARNEY ET AL., J. IMMUNOL, vol. 123, 1979, pages 1548 - 1550 |
| JIN ET AL., BLOOD, vol. 113, 2009, pages 6603 - 6610 |
| JOHNSON ET AL., J. CLIN. ONCOL, vol. 21, no. 7, 2003, pages 1404 - 1411 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 522 - 525 |
| JONES ET AL., NATURE, vol. 321, 1986, pages 604 - 608 |
| JORDAN ET AL., LEUKEMIA, vol. 14, 2000, pages 1777 - 1784 |
| KABAT ET AL.: "Sequences of Proteins of Immunological Interest, 5th ed.,", 1991, NATIONAL INSTITUTES OF HEALTH |
| KARLIN ET AL., PROC. NATL. ACAD. SCI., vol. 87, 1990, pages 2264 - 2268 |
| KARLIN ET AL., PROC. NATL. ACAD. SCI., vol. 90, 1993, pages 5873 - 5877 |
| KOBAYASHI ET AL., PROTEIN ENG., vol. 12, no. 10, 1999, pages 879 - 884 |
| KOHLER; MILSTEIN, NATURE, vol. 256, 1975, pages 495 |
| KUBY, JANIS: "Immunology", 1992, W. H. FREEMAN AND COMPANY |
| LUCKOW; SUMMERS, BIOLTECHNOLOGY, vol. 6, 1988, pages 47 |
| M. G. RETH ET AL., NATURE, vol. 317, 1985, pages 353 - 355 |
| MARKS ET AL., BIOLTECHNOLOGY, vol. 10, 1992, pages 779 - 783 |
| MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 |
| MARKS ET AL., J. MOL. BIOL., vol. 222, 1991, pages 581 - 597 |
| MCCAFFERTY ET AL., NATURE, vol. 348, 1990, pages 552 - 554 |
| MORIMOTO ET AL., JOURNAL OF BIOCHEMICAL AND BIOPHYSICAL METHODS, vol. 24, 1993, pages 107 - 117 |
| MUNOZ ET AL., HAEMATOLOGICA, vol. 86, no. 12, 2001, pages 1261 - 1269 |
| MYERS; MILLER, CABIOS, vol. 4, 1989, pages 11 - 17 |
| N J. LANGONE AND H. VUNAKIS: "Methods in Enzymology", vol. 121, ACADEMIC PRESS, article "Immunochemical Techniques" |
| NEEDLEMAN; WUNSCH, J. MOL. BIOL., 1970, pages 444 - 453 |
| P. G.M. WUTS; T. W. GREENE: "Protective Groups in Organic Synthesis", 2007, JOHN WILEY & SONS |
| P. WUTS; T. GREENE: "Protective Groups in Organic Synthesis", 2007, J. WILEY & SONS, article "Chapter 7," |
| PAUL, W. E.,: "Fundamental Immunology", 1984, RAVEN PRESS, article BERZOFSKY ET AL.: "Antibody-Antigen Interactions" |
| PEDERSEN ET AL., J. MOL. BIOL., vol. 235, 1994, pages 959 - 973 |
| POUWELS ET AL.: "Cloning Vectors: A Laboratory Manual,", 1985, ELSEVIER |
| PRESTA ET AL., J. IMMUNOL., vol. 151, 1993, pages 2623 |
| RAGUSKA ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 91, no. 3, 1994, pages 969 - 973 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 |
| RIECHMANN ET AL., NATURE, vol. 332, 1988, pages 323 - 327 |
| ROBAK ET AL., CLIN. THER., vol. 2, 2009, pages 2349 - 2370 |
| ROBOZ, CURR. OPIN. ONCOL., vol. 24, 2012, pages 711 - 719 |
| ROGUSKA ET AL., PROC. NATL. ACAD. SCI. USA, vol. 91, no. 3, 1994, pages 969 - 973 |
| ROGUSKA ET AL., PROC. NATL. ACAD. SCI., USA, vol. 91, no. 3, 1994, pages 969 - 973 |
| ROGUSKA ET AL., PROTEIN ENG., vol. 9, no. 10, 1996, pages 895 - 904 |
| ROTHE ET AL., J. MOL. BIO, 2007 |
| S. P. PARKER,: "McGraw-Hill, Dictionary of Chemical Terms", 1984, MCGRAW-HILL BOOK COMPANY |
| SHEETS ET AL., PROC. NAT'L. ACAD. SCI., vol. 95, 1998, pages 6157 - 6162 |
| SIMS ET AL., J. IMMUNOL., vol. 151, 1993, pages 2296 |
| SMITH; WATERMAN, ADVANCES IN APPLIED MATHEMATICS, vol. 2, 1981, pages 482 - 489 |
| SUN ET AL., BLOOD, vol. 87, no. 1, 1996, pages 83 - 92 |
| TETTAMANTI ET AL., BR. J. HAEMATOL., vol. 161, 2013, pages 389 - 401 |
| TOMAYKO; REYNOLDS, CANCER CHEMOTHER. PHARMACOL., vol. 24, 1989, pages 148 - 54 |
| VAUGHAN ET AL., NAT. BIOTECH, vol. 14, 1996, pages 309 - 314 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 |
| VERHOEYEN ET AL., SCIENCE, vol. 239, 1988, pages 1534 - 1536 |
| W.A. WEBER, J. NUCL. MED., vol. 50, 2009, pages 1S - 10S |
| WANG ET AL., J IMMUNOL METHODS., vol. 233, 2000, pages 167 - 77 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| ZOELLER ET AL., PROC. NAT'L. ACAD. SCI. USA, vol. 81, 1984, pages 5662 - 5066 |
Cited By (71)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US10898579B2 (en) | 2015-06-29 | 2021-01-26 | Immunogen, Inc. | Conjugates of cysteine engineered antibodies |
| WO2017091745A1 (en) | 2015-11-25 | 2017-06-01 | Immunogen, Inc. | Pharmaceutical formulations and methods of use thereof |
| US20170189548A1 (en) * | 2015-11-25 | 2017-07-06 | Immunogen, Inc. | Pharmaceutical formulations and methods of use thereof |
| US11278628B2 (en) | 2015-11-25 | 2022-03-22 | Immunogen, Inc. | Pharmaceutical formulations and methods of use thereof |
| JP2020505404A (ja) * | 2017-01-25 | 2020-02-20 | イミュノジェン・インコーポレーテッド | 細胞傷害性ベンゾジアゼピン誘導体の調製方法 |
| EP4148044A1 (en) * | 2017-01-25 | 2023-03-15 | ImmunoGen, Inc. | Methods of preparing cytotoxic benzodiazepine derivatives |
| US11981687B2 (en) | 2017-01-25 | 2024-05-14 | Immunogen, Inc. | Methods of preparing cytotoxic benzodiazepine derivatives |
| US10385071B2 (en) | 2017-01-25 | 2019-08-20 | Immunogen, Inc. | Methods of preparing cytotoxic benzodiazepine derivatives |
| CN110225904A (zh) * | 2017-01-25 | 2019-09-10 | 伊缪诺金公司 | 制备细胞毒性苯二氮卓衍生物的方法 |
| KR20190116331A (ko) * | 2017-01-25 | 2019-10-14 | 이뮤노젠 아이엔씨 | 세포독성 벤조디아제핀 유도체를 제조하는 방법 |
| RU2762891C2 (ru) * | 2017-01-25 | 2021-12-23 | Иммуноджен, Инк. | Способы получения цитотоксических производных бензодиазепина |
| CN110225904B (zh) * | 2017-01-25 | 2023-10-27 | 伊缪诺金公司 | 制备细胞毒性苯二氮䓬衍生物的方法 |
| TWI805325B (zh) * | 2017-01-25 | 2023-06-11 | 美商伊繆諾金公司 | 製備細胞毒性苯二氮平衍生物之方法 |
| JP7400005B2 (ja) | 2017-01-25 | 2023-12-18 | イミュノジェン・インコーポレーテッド | 細胞傷害性ベンゾジアゼピン誘導体の調製方法 |
| KR102480594B1 (ko) | 2017-01-25 | 2022-12-26 | 이뮤노젠 아이엔씨 | 세포독성 벤조디아제핀 유도체를 제조하는 방법 |
| US11390633B2 (en) | 2017-01-25 | 2022-07-19 | Immunogen, Inc. | Methods of preparing cytotoxic benzodiazepine derivatives |
| JP2022105096A (ja) * | 2017-01-25 | 2022-07-12 | イミュノジェン・インコーポレーテッド | 細胞傷害性ベンゾジアゼピン誘導体の調製方法 |
| JP7066725B2 (ja) | 2017-01-25 | 2022-05-13 | イミュノジェン・インコーポレーテッド | 細胞傷害性ベンゾジアゼピン誘導体の調製方法 |
| US10844078B2 (en) | 2017-01-25 | 2020-11-24 | Immunogen, Inc. | Methods of preparing cytotoxic benzodiazepine derivatives |
| TWI763771B (zh) * | 2017-01-25 | 2022-05-11 | 美商伊繆諾金公司 | 製備細胞毒性苯二氮平衍生物之方法 |
| AU2018213202B2 (en) * | 2017-01-25 | 2022-03-24 | Immunogen, Inc. | Methods of preparing cytotoxic benzodiazepine derivatives |
| WO2018140435A1 (en) * | 2017-01-25 | 2018-08-02 | Immunogen, Inc. | Methods of preparing cytotoxic benzodiazepine derivatives |
| WO2018160539A1 (en) | 2017-02-28 | 2018-09-07 | Immunogen, Inc. | Maytansinoid derivatives with self-immolative peptide linkers and conjugates thereof |
| IL273384B2 (en) * | 2017-09-22 | 2023-12-01 | Immunogen Inc | Methods of preventing methionine oxidation in immunoconjugates |
| WO2019060707A1 (en) | 2017-09-22 | 2019-03-28 | Immunogen, Inc. | METHODS FOR PREVENTING OXIDATION OF METHIONINE IN IMMUNOCONJUGATES |
| EP4374850A2 (en) | 2017-09-22 | 2024-05-29 | ImmunoGen, Inc. | Methods of preventing methionine oxidation in immunoconjugates |
| EP3684409A4 (en) * | 2017-09-22 | 2021-06-23 | Immunogen, Inc. | SEPARATION OF TRIPLE LIGHT CHAIN ANTIBODIES USING CATION EXCHANGE CHROMATOGRAPHY |
| TWI826393B (zh) * | 2017-09-22 | 2023-12-21 | 美商免疫遺傳股份有限公司 | 使用陽離子交換層析法分離三輕鏈抗體 |
| WO2019060718A1 (en) | 2017-09-22 | 2019-03-28 | Immunogen, Inc. | SEPARATION OF LIGHT TRIPLE CHAIN ANTIBODIES USING CATION EXCHANGE CHROMATOGRAPHY |
| RU2803119C2 (ru) * | 2017-09-22 | 2023-09-06 | Иммуноджен, Инк. | Способы предотвращения окисления метионина в иммуноконъюгатах |
| IL273384B1 (en) * | 2017-09-22 | 2023-08-01 | Immunogen Inc | Methods to prevent methionine oxidation in immune conjugates |
| CN111163804A (zh) * | 2017-09-22 | 2020-05-15 | 伊缪诺金公司 | 使用阳离子交换色谱法分离三轻链抗体 |
| JP2020534332A (ja) * | 2017-09-22 | 2020-11-26 | イミュノジェン, インコーポレイテッド | カチオン交換クロマトグラフィーを使用した三重軽鎖抗体の分離 |
| US11583590B2 (en) | 2017-09-29 | 2023-02-21 | Daiichi Sankyo Company, Limited | Antibody-pyrrolobenzodiazepine derivative conjugate and method of use thereof for treating a tumor |
| US12606634B2 (en) | 2017-09-29 | 2026-04-21 | Daiichi Sankyo Company, Limited | Antibody-pyrrolobenzodiazepine derivative conjugate which binds caludin-6 and claudin-9 |
| US12350344B2 (en) | 2017-09-29 | 2025-07-08 | Daiichi Sankyo Company, Limited | Methods of treating a tumor by administering a claudin-6 (CLDN6) or CLDN9 antibody-pyrrolobenzodiazepine derivative conjugate |
| US12246196B2 (en) | 2017-09-29 | 2025-03-11 | Daiichi Sankyo Company, Limited | Antibody-drug conjugates comprising substituted benzo[e]pyrrolo[1,2-a][1,4]diazepines |
| US11628223B2 (en) | 2017-09-29 | 2023-04-18 | Daiichi Sankyo Company, Limited | Antibody-drug conjugates comprising substituted benzo[e]pyrrolo[1,2-α][1,4]diazepines |
| IL274095B1 (en) * | 2017-10-27 | 2024-11-01 | Pfizer | Antibodies and antibody-drug conjugates specific for cd123 and uses thereof |
| IL274095B2 (en) * | 2017-10-27 | 2025-03-01 | Pfizer | Antibodies and antibody-drug conjugates specific for cd123 and uses thereof |
| JP2021500055A (ja) * | 2017-10-27 | 2021-01-07 | ファイザー・インク | Cd123に特異的な抗体および抗体−薬物コンジュゲートならびにその使用 |
| US11613581B2 (en) | 2017-10-27 | 2023-03-28 | Pfizer, Inc. | Antibodies and antibody-drug conjugates specific for CD123 and uses thereof |
| AU2018357221B2 (en) * | 2017-10-27 | 2025-08-28 | Pfizer Inc. | Antibodies and antibody-drug conjugates specific for CD123 and uses thereof |
| RU2789150C2 (ru) * | 2017-10-27 | 2023-01-30 | Пфайзер Инк. | Антитела и конъюгаты антитела-лекарственного средства, специфичные к cd123, и их применения |
| CN111556876A (zh) * | 2017-10-27 | 2020-08-18 | 辉瑞公司 | 对cd123具有特异性的抗体和抗体-药物缀合物及其用途 |
| KR20200070361A (ko) * | 2017-10-27 | 2020-06-17 | 화이자 인코포레이티드 | Cd123 특이적 항체 및 항체-약물 접합체 및 그의 용도 |
| TWI718427B (zh) * | 2017-10-27 | 2021-02-11 | 美商輝瑞股份有限公司 | 對cd123具專一性之抗體和抗體-藥物共軛體及彼等之用途 |
| JP7324749B2 (ja) | 2017-10-27 | 2023-08-10 | ファイザー・インク | Cd123に特異的な抗体および抗体-薬物コンジュゲートならびにその使用 |
| TWI793513B (zh) * | 2017-10-27 | 2023-02-21 | 美商輝瑞股份有限公司 | 對cd123具專一性之抗體和抗體-藥物共軛體及彼等之用途 |
| JP2023139267A (ja) * | 2017-10-27 | 2023-10-03 | ファイザー・インク | Cd123に特異的な抗体および抗体-薬物コンジュゲートならびにその使用 |
| JP2024177330A (ja) * | 2017-10-27 | 2024-12-19 | ファイザー・インク | Cd123に特異的な抗体および抗体-薬物コンジュゲートならびにその使用 |
| WO2019082020A1 (en) * | 2017-10-27 | 2019-05-02 | Pfizer Inc. | ANTIBODIES AND CONJUGATES CD123-SPECIFIC ANTIBODIES AND USES THEREOF |
| CN111556876B (zh) * | 2017-10-27 | 2024-10-18 | 辉瑞公司 | 对cd123具有特异性的抗体和抗体-药物缀合物及其用途 |
| KR102363746B1 (ko) * | 2017-10-27 | 2022-02-15 | 화이자 인코포레이티드 | Cd123 특이적 항체 및 항체-약물 접합체 및 그의 용도 |
| US12251448B2 (en) | 2017-11-29 | 2025-03-18 | Heidelberg Pharma Research Gmbh | Compositions and methods for the depletion of CD5+ cells |
| US12201154B2 (en) | 2018-01-03 | 2025-01-21 | Cqens Technologies Inc. | Heat-not-burn device and method |
| US11274121B2 (en) | 2018-01-12 | 2022-03-15 | Immunogen, Inc. | Methods for antibody drug conjugation, purification, and formulation |
| WO2020092533A2 (en) | 2018-10-30 | 2020-05-07 | Immunogen, Inc. | Methods of treatment using anti-cd123 immunoconjugates |
| WO2020092344A1 (en) * | 2018-10-31 | 2020-05-07 | Health Research, Inc. | Combination treatment with anti-cd123 antibody drug conjugate and parp inhibitor |
| JP2022512935A (ja) * | 2018-11-12 | 2022-02-07 | イミュノジェン・インコーポレーテッド | 細胞傷害性ベンゾジアゼピン誘導体の調製方法 |
| JP2022512936A (ja) * | 2018-11-12 | 2022-02-07 | イミュノジェン・インコーポレーテッド | 細胞傷害性ベンゾジアゼピン誘導体の調製方法 |
| JP7437395B2 (ja) | 2018-11-12 | 2024-02-22 | イミュノジェン・インコーポレーテッド | 細胞傷害性ベンゾジアゼピン誘導体の調製方法 |
| US20220062339A1 (en) * | 2019-01-07 | 2022-03-03 | Magenta Therapeutics, Inc. | Use of an anti-cd45 antibody drug conjugate (adc) in cell therapy |
| US11833214B2 (en) | 2019-03-21 | 2023-12-05 | Immunogen, Inc. | Methods of preparing cell-binding agent-drug conjugates |
| WO2020191306A1 (en) | 2019-03-21 | 2020-09-24 | Immunogen, Inc. | Methods of preparing cell-binding agent-drug conjugates |
| WO2020205564A1 (en) | 2019-03-29 | 2020-10-08 | Immunogen, Inc. | Cytotoxic bis-benzodiazepine derivatives and conjugates thereof with cell-binding agents for inhibiting abnormal cell growth or for treating proliferative diseases |
| US11701428B2 (en) * | 2019-04-29 | 2023-07-18 | Immunogen, Inc. | Therapeutic combinations comprising anti-CD123 immunoconjugates |
| US20240033371A1 (en) * | 2019-04-29 | 2024-02-01 | Immunogen, Inc. | Therapeutic combinations comprising anti-cd123 immunoconjugates |
| WO2023051814A1 (zh) | 2021-09-30 | 2023-04-06 | 江苏恒瑞医药股份有限公司 | 吡咯并苯并二氮杂卓类衍生物及其偶联物、其制备方法及其应用 |
| WO2025235924A2 (en) | 2024-05-10 | 2025-11-13 | Immunogen, Inc. | Anti-cd123 immunoconjugates for the treatment of acute myeloid leukemia |
| WO2025235918A1 (en) | 2024-05-10 | 2025-11-13 | Immunogen, Inc. | Anti-cd123 immunoconjugates for the treatment of blastic plasmacytoid cell neoplasm |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11897961B2 (en) | Anti-CD123 antibodies and conjugates and derivatives thereof | |
| JP7515228B2 (ja) | フォレート受容体1抗体及びそのイムノコンジュゲート及び使用 | |
| HK40052909A (en) | Anti-cd123 antibodies and conjugates and derivatives thereof | |
| HK1252976B (en) | Anti-cd123 antibodies and conjugates and derivatives thereof | |
| BR122025011705A2 (pt) | Anticorpo ou fragmento de ligação a antígeno, polipeptídeo, imunoconjugado, composição farmacêutica, uso dos anteriores, célula, bem como métodos para produção dos referidos anticorpo e polipeptídeo, e para inibição do crescimento de uma célula que expressa cd123 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 16736718 Country of ref document: EP Kind code of ref document: A1 |
|
| ENP | Entry into the national phase |
Ref document number: 2989321 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11201710224Q Country of ref document: SG |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 122021007397 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2017568261 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2016285552 Country of ref document: AU Date of ref document: 20160628 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20187002732 Country of ref document: KR Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2017146345 Country of ref document: RU Ref document number: 2016736718 Country of ref document: EP |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017027254 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 112017027254 Country of ref document: BR Kind code of ref document: A2 Effective date: 20171218 |
|
| WWR | Wipo information: refused in national office |
Ref document number: 1020247014500 Country of ref document: KR |
|
| WWD | Wipo information: divisional of initial pct application |
Ref document number: 1020267007615 Country of ref document: KR |
|
| WWP | Wipo information: published in national office |
Ref document number: 1020267007615 Country of ref document: KR |