WO2016073789A2 - Anti-fgfr2/3 antibodies and methods using same - Google Patents
Anti-fgfr2/3 antibodies and methods using same Download PDFInfo
- Publication number
- WO2016073789A2 WO2016073789A2 PCT/US2015/059335 US2015059335W WO2016073789A2 WO 2016073789 A2 WO2016073789 A2 WO 2016073789A2 US 2015059335 W US2015059335 W US 2015059335W WO 2016073789 A2 WO2016073789 A2 WO 2016073789A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- seq
- fgfr2
- fgfr3
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
- A61P21/02—Muscle relaxants, e.g. for tetanus or cramps
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
- A61P25/16—Anti-Parkinson drugs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/04—Anorexiants; Antiobesity agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/06—Antihyperlipidemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P3/00—Drugs for disorders of the metabolism
- A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
- A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/12—Antihypertensives
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3015—Breast
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3023—Lung
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/303—Liver or Pancreas
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3069—Reproductive system, e.g. ovaria, uterus, testes, prostate
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/40—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against enzymes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12P—FERMENTATION OR ENZYME-USING PROCESSES TO SYNTHESISE A DESIRED CHEMICAL COMPOUND OR COMPOSITION OR TO SEPARATE OPTICAL ISOMERS FROM A RACEMIC MIXTURE
- C12P21/00—Preparation of peptides or proteins
- C12P21/02—Preparation of peptides or proteins having a known sequence of two or more amino acids, e.g. glutathione
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/31—Immunoglobulins specific features characterized by aspects of specificity or valency multispecific
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- the present invention relates generally to dual specific anti-FGFR2/3 antibodies, and uses of same.
- Fibroblast growth factors and their receptors (FGFRs) play critical roles during embryonic development, tissue homeostasis and metabolism (Eswarakumar, V.P., Lax, I., and Schlessinger, J. 2005. Cellular signaling by fibroblast growth factor receptors. Cytokine Growth Factor Rev 16: 139-149; L'Hote, C.G., and Knowles, M.A. 2005. Cell responses to FGFR3 signalling: growth, differentiation and apoptosis. Exp Cell Res 304:417- 431; Dailey, L., Ambrosetti, D., Mansukhani, A., and Basilico, C. 2005. Mechanisms underlying differential responses to FGF signaling.
- FGFs Fibroblast growth factors
- FGFRs receptors
- FGFs FGF1-14, FGF 16-273 and four FGF receptors with tyrosine kinase domain (FGFRl-4).
- FGFRs consist of an extracellular ligand binding region, with two or three immunoglobulin-like domains (IgDl-3), a single-pass transmembrane region, and a cytoplasmic, split tyrosine kinase domain.
- IgDl-3 immunoglobulin-like domains
- FGFR1, 2 and 3 each have two major alternatively spliced isoforms, designated Illb and IIIc. These isoforms differ by about 50 amino acids in the second half of IgD3, and have distinct tissue distribution and ligand specificity.
- the Illb isoform is found in epithelial cells, whereas IIIc is expressed in mesenchymal cells.
- FGFRs dimerize and become phosphorylated at specific tyrosine residues. This facilitates the recruitment of critical adaptor proteins, such as FGFR substrate 2 a (FRS2a), leading to activation of multiple signaling cascades, including the mitogen-activated protein kinase (MAPK) and PI3K-AKT pathways (Eswarakumar, V.P., Lax, I., and Schlessinger, J. 2005. Cellular signaling by fibroblast growth factor receptors.
- MAPK mitogen-activated protein kinase
- PI3K-AKT pathways Eswarakumar, V.P., Lax, I., and Schlessinger, J. 2005. Cellular signaling by fibroblast growth factor receptors.
- Cytokine Growth Factor Rev 16 139- 149; Dailey, L., Ambrosetti, D., Mansukhani, A., and Basilico, C. 2005. Mechanisms underlying differential responses to FGF signaling. Cytokine Growth Factor Rev 16:233-247; Mohammadi, M., Olsen, S.K., and (2004)i, O.A. 2005. Structural basis for fibroblast growth factor receptor activation. Cytokine Growth Factor Rev 16: 107-137). Consequently, FGFs and their cognate receptors regulate a broad array of cellular processes, including
- t(4;14) (pl6.3;q32) chromosomal translocation occurs in about 15-20% of multiple myeloma patients, leading to overexpression of FGFR3 and correlates with shorter overall survival (Chang, FL, Stewart, A.K., Qi, X.Y., Li, Z.H., Yi, Q.L., and Trudel, S. 2005. Immunohistochemistry accurately predicts FGFR3 aberrant expression and t(4;14) in multiple myeloma.
- Recurrent 14q32 translocations determine the prognosis of multiple myeloma, especially in patients receiving intensive chemotherapy. Blood 100: 1579-1583).
- FGFR3 is implicated also in conferring chemoresistance to myeloma cell lines in culture (Pollett, J.B., Trudel, S., Stern, D., Li, Z.H., and Stewart, A.K. 2002.
- Overexpression of the myeloma-associated oncogene fibroblast growth factor receptor 3 confers dexamethasone resistance.
- Overexpression of mutationally activated FGFR3 is sufficient to induce oncogenic transformation in hematopoietic cells and fibroblasts (Bernard-Pierrot, I., Brams, A., Dunois-Larde, C, Caillault, A., Diez de Medina, S.G., Cappeln, D., Graff, G., Thiery, J.P., Chopin, D., Ricol, D., et al. 2006. Oncogenic properties of the mutated forms of fibroblast growth factor receptor 3b. Carcinogenesis 27:740-747; Agazie, Y.M., Movilla, N., Ischenko, I., and Hayman, M.J. 2003.
- the phosphotyrosine phosphatase SHP2 is a critical mediator of transformation induced by the oncogenic fibroblast growth factor receptor 3.
- Activated fibroblast growth factor receptor 3 is an oncogene that contributes to tumor progression in multiple myeloma. Blood 97:729-736; Plowright, E.E., Li, Z., Bergsagel, P.L., Chesi, M., Barber, D.L., Branch, D.R., Hawley, R.G., and Stewart, A.K. 2000.
- FGFR3 overexpression has been documented also in a high fraction of bladder cancers (Gomez-Roman, J.J., Saenz, P., Molina, M., Cuevas Gonzalez, J., Escuredo, K., Santa Cruz, S., Junquera, C, Simon, L., Martinez, A., Gutierrez Banos, J.L., et al. 2005.
- Fibroblast growth factor receptor 3 is overexpressed in urinary tract carcinomas and modulates the neoplastic cell growth.
- Clin Cancer Res 11 :459-465 Tomlinson, D.C., Baldo, O., Harnden, P., and Knowles, M.A. 2007.
- FGFR3 protein expression and its relationship to mutation status and prognostic variables in bladder cancer J Pathol 213:91-98). Furthermore, somatic activating mutations in FGFR3 have been identified in 60-70% of papillary and 16- 20% of muscle-invasive bladder carcinomas (Tomlinson, D.C., Baldo, O., Harnden, P., and Knowles, M.A. 2007. FGFR3 protein expression and its relationship to mutation status and prognostic variables in bladder cancer. J Pathol 213:91-98; van Rhijn, B.W., Montironi, R., Zwarthoff, E.C., Jobsis, A.C., and van der Kwast, T.H. 2002.
- RNA interference (Bernard-Pierrot, I., Brams, A., Dunois-Larde, C, Caillault, A., Diez de Medina, S.G., Cappeln, D., Graff, G., Thiery, J.P., Chopin, D., Ricol, D., et al. 2006. Oncogenic properties of the mutated forms of fibroblast growth factor receptor 3b. Carcinogenesis 27:740-747; Tomlinson, D.C., Hurst, CD., and Knowles, M.A. 2007.
- Knockdown by shRNA identifies S249C mutant FGFR3 as a potential therapeutic target in bladder cancer.
- Oncogene 26:5889- 5899) or an FGFR3 single-chain Fv antibody fragment inhibited bladder cancer cell proliferation (Martinez-Torrecuadrada, J., Cifuentes, G., Lopez-Serra, P., Saenz, P., Martinez, A., and Casal, J.I. 2005. Targeting the extracellular domain of fibroblast growth factor receptor 3 with human single-chain Fv antibodies inhibits bladder carcinoma cell line proliferation. Clin Cancer Res 11 :6280-6290).
- an antibody that binds monospecifically to FGFR3 was redesigned for binding to other FGFR family members through multiple rounds of engineering, including recruiting binding to FGFR2 and removing binding to FGFR4.
- the first step of engineering was carried out to gain FGFR2 binding using phage display library.
- Each phage library constituted mutagenesis of one contacting CDR, and the range of mutagenesis covered as many residues in that CDR as allowed by library size. Choosing multiple consecutive positions for mutagenesis permitted significant freedom in the CDR backbones. Most of the resulting clones that were able to engage FGFR2 harbored all 5 mutations in CDR H2.
- the second round of engineering was refinement of specificity to remove FGFR4 binding.
- Detailed structural analysis of contact residues between the antibody CDR loops and the antigen surface was used to guide the design of phage display libraries.
- Selected antibody variants showed reduction in FGFR4 binding with retention of binding to FGFR2/3.
- the sequence solutions to this specificity refinement step were more limited compared to the first round of engineering.
- the refinement step further demonstrated the ability to
- the dual-specific antibodies generated through the antibody engineering described herein bind to two closely related antigens, namely FGFR2 and FGFR3 (anti-FGFR2/3 antibodies).
- These anti-FGFR2/3 antibodies (2B.1.3 antibody variants) are regular IgG molecules in that they use identical heavy and light chains.
- Certain anti-FGFR2/3 antibodies of this invention can bind to two FGFR2 isoforms, two FGFR3 isoforms or one FGFR2 and one FGFR3 isoform in a bivalent or monovalent manner respectively. This contrasts to conventional bispecific IgG, which commonly use two different heavy/light-chain pairs to bind to two different antigens in a monovalent manner.
- the dual-specific antibodies described share some similarities with "two-in-one" antibodies (Grand, E.K., Chase, A.J., Heath, C, Rahemtulla, A., and Cross, N.C. 2004. Targeting FGFR3 in multiple myeloma: inhibition of t(4;14)-positive cells by SU5402 and PD173074. Leukemia 18:962-966).
- Bostrom et al. randomized all 3 light-chain CDRs of Herceptin and selected for a second specificity as well as the parental specificity. As expected, the second specificity comes from the dominant contributions of light-chain CDRs (Grand, E.K., Chase, A. J., Heath, C, Rahemtulla, A., and Cross, N.C. 2004. Targeting FGFR3 in multiple myeloma: inhibition of t(4; 14)-positive cells by SU5402 and PD 173074. Leukemia 18:962-966; Gomez-Roman, J.
- Fibroblast growth factor receptor 3 is overexpressed in urinary tract carcinomas and modulates the neoplastic cell growth. Clin Cancer Res 11 :459-465).
- the antibody engineering presented here started from an existing and extensively characterized antibody anti-FGFR antibody that has potential utility for cancer therapy. Since introduction of the first therapeutic monoclonal antibody in the mid-1980s, there have been many clinically and commercially successful antibody drugs in different disease areas, including trastuzumab, cetuximab, adalimumab, bevacizumab, etc. These antibodies displayed exceptional activities in inhibiting their molecular targets. On the other hand, like the FGFR family, multiple homologous proteins are pursued as molecular targets for their various disease associations. Traditional discovery routes to obtain antibodies targeting a functional epitope, either animal immunization or other display-based library selections, are not guaranteed to be successful.
- an antibody can be engineered to acquire specificity towards homologous targets, thereby providing an alternative route for antibody discovery.
- this approach takes advantage of the favorable properties of previously developed antibodies by maintaining the functional epitopes and presumably the biological functions as well. As the clinical antibody repertoire expands, more antibodies could be engineered instead of being discovered ab initio.
- Potential applications may include protein families that comprise multiple members as disease targets, such as the EGFR family (Tomlinson, D.C., Baldo, O., Harnden, P., and Knowles, M.A. 2007.
- the invention is based in part on the identification of a variety of FGFR binding agents (such as antibodies, and fragments thereof) that bind FGFR2 and FGFR3
- FGFR2/3 presents an important and advantageous therapeutic target
- the invention provides compositions and methods based on binding of the agents to FGFR3, specifically agents that bind FGFR.
- invention provides compositions and methods based on binding of the agents to FGFR2/3 (i.e., binding of the agents that have dual specificity for FGFR2 and FGFR3).
- FGFR2/3 binding agents of the invention as described herein, provide important therapeutic and diagnostic agents for use in targeting pathological conditions associated with expression and/or activity of the FGFR3 and/or FGFR2 signaling pathways. Accordingly, the invention provides methods, compositions, kits, and articles of manufacture related to FGFR3 and FGFR2 binding.
- the present invention provides antibodies that bind to FGFR2 and FGFR3 (anti- FGFR2/3 antibodies).
- the invention features an isolated antibody that binds an FGFR3.
- the antibody binds a FGFR3 Illb isoform and/or a FGFR3 IIIc isoform.
- the antibody binds a mutated FGFR3 (e.g., one or more of FGFR3 nib R248C, S249C, G372C, Y375C, K652E, and/or one or more of FGFR3 IIIc R248C, S249C, G370C, Y373C, K650E).
- the antibody binds monomeric FGFR3 (e.g., monomeric FGFR3 Illb and/or IIIc isoforms).
- monomeric FGFR3 e.g., monomeric FGFR3 Illb and/or IIIc isoforms.
- the antibody promotes formation of monomeric FGFR3, such as by stabilizing the monomeric FGFR3 form relative to the dimeric FGFR3 form. In some embodiments, the antibody binds FGFR2 or a variant thereof. In some embodiments, the antibody binds FGFR2 and any one or more of the FGFR3 variants described herein.
- the invention provides an isolated anti-FGFR2/3 antibody, wherein a full length IgG form of the antibody binds human FGFR3 with a Kd of 1 x 10 "7 M or higher affinity. In one aspect, the invention provides an isolated anti-FGFR2/3 antibody, wherein a full length IgG form of the antibody binds human FGFR2 with a Kd of 1 x 10 "7 M or higher affinity.
- binding affinity of a ligand to its receptor can be determined using any of a variety of assays, and expressed in terms of a variety of quantitative values. Accordingly, in one embodiment, the binding affinity is expressed as Kd values and reflects intrinsic binding affinity (e.g., with minimized avidity effects).
- binding affinity is measured in vitro, whether in a cell-free or cell-associated setting. Any of a number of assays known in the art, including those described herein, can be used to obtain binding affinity measurements, including, for example, Biacore,
- RIA radioimmunoassay
- ELISA ELISA
- the antibody binds human FGFR3 with a Kd of 1 x 10 " M or higher affinity, with a Kd of 1 x 10 " 9 M or higher affinity, or with a Kd of 1 x 10 "10 M or higher affinity.
- the full length IgG form of the antibody binds human FGFR2 with a Kd of 1 x 10 " M or higher affinity, with a Kd of 1 x 10 ⁇ 9 M or higher affinity, or with a Kd of 1 x 10 ⁇ 10 M or higher affinity.
- the full length IgG form of the antibody binds human FGFR2 and FGFR3 with Kds of 1 x 10 "8 M or higher affinity, with Kds of 1 x 10 "9 M or higher affinity, or with Kds of 1 x 10 ⁇ 10 M or higher affinity.
- the anti-FGFR2/3 antibodies of the present invention are antagonist antibodies.
- the anti-FGFR2/3 antibodies inhibit FGFR3 activity (e.g., FGFR3-IIIb and/or FGFR3-IIIc activity).
- the anti-FGFR2/3 antibody (generally in bivalent form) does not possess substantial FGFR3 agonist function.
- the anti-FGFR2/3 antagonist antibody (generally in bivalent form) possesses little or no FGFR3 agonist function.
- an antibody of the invention (generally in bivalent form) does not exhibit an FGFR3 agonist activity level that is above background level that is of statistical significance.
- binding of the antibody to a FGFR3 may inhibit dimerization of the receptor with another unit of the receptor, whereby activation of the receptor is inhibited
- Inhibition can be direct or indirect.
- the invention provides anti-FGFR2/3 antibodies that do not possess substantial apoptotic activity (e.g., does not induce apoptosis of a cell, e.g., a transitional cell carcinoma cell or a multiple myeloma cell, such as a multiple myeloma cell comprising a FGFR3 translocation, such as a t(4; 14) translocation).
- the anti- FGFR2/3 antibody possesses little or no apoptotic function.
- the FGFR2/3 antibodies do not exhibit apoptotic function that is above background level that is of statistical significance.
- the invention provides anti-FGFR2/3 antibodies that do not induce substantial FGFR3 down-regulation.
- the anti-FGFR2/3 antibody induces little or no receptor down-regulation.
- the FGFR2/3 antibodies do not induce receptor down-regulation that is above background level that is of statistical significance.
- the invention provides anti-FGFR2/3 antibodies that possess effector function.
- the effector function comprises antibody-dependent cell- mediated cytotoxicity (ADCC).
- the anti-FGFR2/3 antibodies of this invention are capable of killing a cell, in some embodiments, a multiple myeloma cells (e.g., multiple myeloma cells comprising a translocation, e.g., a t(4; 14) translocation).
- the the anti- FGFR2/3 antibodies of this invention are capable of killing a cell that expresses about 10,000 FGFR3 molecules per cell or more (such as about 11,000, about 12,000, about 13,000, about 14,000, about 15,000, about 16,000, about 17,000, about 18,000 or more FGFR3 molecules per cell).
- the cell expresses about 2000, about 3000, about 4000, about 5000, about 6000, about 7000, about 8000, or more FGFR3 molecules per cell.
- the anti-FGFR2/3 antibodies of this invention are capable of killing a cell that expresses about 10,000 FGFR2 molecules per cell or more (such as about 11,000, about 12,000, about 13,000, about 14,000, about 15,000, about 16,000, about 17,000, about 18,000 or more FGFR3 molecules per cell).
- the cell expresses about 2000, about 3000, about 4000, about 5000, about 6000, about 7000, about 8000, or more FGFR2 molecules per cell.
- the anti-FGFR2/3 antibodies of the invention inhibit constitutive FGFR3 activity.
- constitutive FGFR3 activity is ligand-dependent FGFR3 constitutive activity.
- constitutive FGFR3 activity is ligand- independent constitutive FGFR3 activity.
- the anti-FGFR2/3 antibodies of the invention inhibit constitutive FGFR2 activity.
- the anti-FGFR2/3 antibodies of the invention inhibit constitutive FGFR2 and FGFR3 activity.
- the anti-FGFR2/3 antibodies of the invention inhibit FGFR3 comprising a mutation corresponding to FGFR3-IIIb .
- FGFR3-IIIb As used herein the term
- FGFR3-IIIb “comprising a mutation corresponding to FGFR3-IIIb” is understood to encompass FGFR3-IIIb R248C and FGFRS-IIIc 2480 , as well as additional FGFR3 forms comprising an R to C mutation at a position corresponding to FGFR3-IIIb R248.
- One of ordinary skill in the art understands how to align FGFR3 sequences in order identify corresponding residues between respective FGFR3 sequences, e.g., aligning a FGFR3- IIIc sequence with a FGFR3- Illb sequence to identify the position in FGFR3 corresponding R248 position in FGFR3-IIIb.
- the anti-FGFR2/3 antibodies of the invention inhibit FGFR3-IIIb and/or FGFRS-IIIc 2480
- the anti-FGFR2/3 antibodies of the invention inhibit FGFR3 comprising a mutation corresponding to FGFR3-IIIb K652E .
- FGFR3-IIIb K652E the term
- FGFR3-IIIb K652E and FGFR3-IIIc K650E as well as additional FGFR3 forms comprising a K to E mutation at a position corresponding to FGFR3-IIIb K652.
- align FGFR3 sequences in order identify corresponding residues between respective FGFR3 sequences, e.g., aligning a FGFR3- IIIc sequence with a FGFR3- Illb sequence to identify the position in FGFR3 corresponding K652 position in FGFR3-IIIb.
- the anti-FGFR2/3 antibodies of the invention inhibit FGFR3-IIIb K652E and/or FGFR3-IIIc K650E .
- the anti-FGFR2/3 antibodies of the invention inhibit FGFR3 comprising a mutation corresponding to FGFR3-IIIb .
- the term FGFR3 comprising a mutation corresponding to FGFR3-IIIb .
- the anti-FGFR2/3 antibodies of the invention inhibit FGFR3-IIIb S249C and/or FGFR3-IIIc S249C In one aspect, the anti-FGFR2/3 antibodies of the invention inhibit FGFR3 comprising a mutation corresponding to FGFR3-IIIb .
- the term "comprising a mutation corresponding to FGFR3-IIIb" is understood to encompass FGFR3-IIIb G372C and FGFR3-IIIc G370C , as well as additional FGFR3 forms comprising a G to C mutation at a position corresponding to FGFR3-IIIb G372.
- the anti-FGFR2/3 antibodies of the invention inhibit FGFR3-IIIb G372C and/or FGFR3-IIIc G370C
- the anti-FGFR2/3 antibodies of the invention inhibit FGFR3 comprising a mutation corresponding to FGFR3-IIIb .
- the term "comprising a mutation corresponding to FGFR3-IIIb" is understood to encompass FGFR3-IIIb Y375C and FGFR3-IIIc Y373C , as well as additional FGFR3 forms comprising an S to C mutation at a position corresponding to FGFR3-IIIb S249.
- the anti-FGFR2/3 antibodies of the invention inhibit FGFR3-IIIb Y375C and/or FGFR3-IIIc Y373C In one aspect, the anti-FGFR2/3 antibodies of the invention inhibit (a) FGFR3- IIIb K652E and (b) one or more of FGFR3-IIIb R248C , FGFR3-IIIb Y375C , FGFR3 -IIIb S249C , and FGFR3IIIb G372C
- the anti-FGFR2/3 antibodies of the invention inhibit (a) FGFR3- IIIc K650E and (b) one or more of FGFR3-IIIc R248C , FGFR3-IIIc Y373C , FGFR3 -IIIc S249C , and FGFR3IIIC G370C
- the anti-FGFR2/3 antibodies of the invention inhibit (a) FGFR3- IIIb R248C and (b) one or more of FGFR3-IIIb K652E , FGFR3-IIIb Y375C , FGFR3-IIIb S249C , and FGFR3-IIIb G372C .
- the anti-FGFR2/3 antibodies of the invention inhibit (a) FGFR3- IIIc* 2480 and (b) one or more of FGFR3-IIIc K650E , FGFR3-IIIc Y373C , FGFR3-IIIc S249C , and FGFR3-IIIc G370C
- the anti-FGFR2/3 antibodies of the invention inhibit (a) FGFR3- IIIb G372C and (b) one or more of FGFR3-IIIb K652E , FGFR3-IIIb Y375C , FGFR3-IIIb S249C , and FGFR3-IIIb R248C
- the anti-FGFR2/3 antibodies of the invention inhibit (a) FGFR3- IIIc G370C and (b) one or more of FGFR3-IIIc K650E , FGFR3-IIIc Y373C , FGFR3-IIIc S249C , and FGFR3-IIIc R248C .
- the anti-FGFR2/3 antibodies of the invention inhibit FGFR3-IIIb R248C ,
- the anti-FGFR2/3 antibodies of the invention inhibit FGFR3-IIIc , FGFR3-IIIc K650E , FGFR3-IIIc Y373C , FGFR3-IIIc S249C , and FGFR3-IIIc G370C .
- the invention provides an isolated anti-FGFR2/3 antibody comprising at least one, two, three, four, or five hypervariable region (HVR) sequences selected from: SEQ ID NO 1 : RASQDVDTSLA, SEQ ID NO 2: SASFLYS, SEQ ID NO 3: QQSTGHPQT, SEQ ID NO 4: GFPFTSQGIS, SEQ ID NO 5: RTHLGDGSTNYADSVKG, and SEQ ID NO 6: ART YGIYDT YDKYTE Y VMD Y .
- the invention provides the 2B.1.3.10 anti-FGFR2/3 antibody comprising HVR-L1 : RASQDVDTSLA, HVR-L2:
- HVR-L3 QQSTGHPQT
- HVR-H1 GFPFTSQGIS
- HVR-H2
- the invention provides an isolated anti-FGFR2/3 antibody comprising at least one, two, three, four, or five hypervariable region (HVR) sequences selected from: SEQ ID NO 7: RASQDVDTSLA, SEQ ID NO 8: SASFLYS, SEQ ID NO 9: QQSTGHPQT, SEQ ID NO 10: GFPFTSTGIS, SEQ ID NO 11 : RTHLGDGSTNYADSVKG, and SEQ ID NO 12: ARTYGIYDTYDMYTEYVMDY.
- HVR hypervariable region
- HVR-L3 QQSTGHPQT
- HVR-Hl GFPFTSTGIS
- HVR-H2
- HVR-H3 ARTYGIYDTYDMYTEYVMDY.
- the HVR-Hl of an anti-FGFR2/3 antibody described herein comprises the sequence FTS at positions 4-6 of SEQ ID NO:4.
- At least one HVR of an anti-FGFR2/3 antibody described herein is a variant HVR, where the variant HVR sequence comprises modification of at least one residue (at least two residues, at least three or more residues) of the sequence depicted in SEQ ID NOs: l-6.
- the modification desirably is a substitution, insertion, or deletion.
- a HVR-L1 variant comprises 1-6 (1, 2, 3, 4, 5, or 6) substitutions.
- a HVR-L2 variant comprises 1-6 (1, 2, 3, 4, 5, or 6) substitutions.
- a HVR-L3 variant comprises 1-6 (1, 2, 3, 4, 5, or 6) substitutions.
- a HVR-Hl variant comprises 1-6 (1, 2, 3, 4, 5, or 6) substitutions.
- a HVR-H2 variant comprises 1-6 (1, 2, 3, 4, 5, or 6) substitutions.
- a HVR-H3 variant comprises 1-6 (1 , 2, 3, 4, 5, or 6) substitutions.
- the HVR-Hl of an anti-FGFR2/3 antibody described herein is a variant HVR-Hl wherein the variant HVR-Hl comprises substitutions at amino acids P3 and/or Q7 (SEQ ID NO:4).
- the variant HVR-Hl comprises a P3T substitution.
- the variant HVR-Hl comprises a Q7T or a Q7L substitution.
- the variant HVR-Hl comprises a P3T and a Q7L substitution.
- the variant HVR-Hl comprises a P3T and a Q7T substitution.
- the variant HVR-Hl comprises a sequence selected from the group listed in Table 11: TFTST, PFTSL, PFTSQ, and PFTST.
- the HVR-H3 of an anti-FGFR2/3 antibody described herein is a variant HVR-H3 wherein the variant HVR-H3 comprises substitutions at amino acids T9, Dl 1, and/or K12 (SEQ ID NO:6).
- the variant HVR-H3 comprises a T9I substitution.
- the variant HVR-H3 comprises a T9L substitution.
- the variant HVR-H3 comprises a Dl IV substitution.
- the variant HVR-H3 comprises a Dl 1G substitution.
- the variant HVR-H3 comprises a Dl IE substitution. In specific embodiments, the variant HVR-H3 comprises a K12D substitution. In specific embodiments, the variant HVR-H3 comprises a K12N substitution. In specific embodiments, the variant HVR-H3 comprises a K12G substitution. In specific embodiments, the variant HVR-H3 comprises a K12E substitution. In specific embodiments, the variant FIVR-H3 comprises a K12M substitution. In specific embodiments, the variant HVR-H3 comprises a T9L, a Dl 1 V, and a K12D substitution. In specific embodiments, the variant FIVR-H3 comprises only a K12D substitution.
- the variant FIVR-H3 comprises a T9I, a Dl 1G, and a K12G substitution. In specific embodiments, the variant HVR-H3 comprises only a K12E substitution. In specific embodiments, the variant HVR-H3 comprises a T9I and a Dl IE substitution. In specific embodiments, the variant HVR-H3 comprises only a K12M substitution. In certain embodiments, the variant HVR-H3 comprises a sequence selected from the group listed in Table 11 : LYVD, TYDN, IYGG, TYDE, IKEK, TYDK, and TYDM.
- the HVR-H1 of an anti-FGFR2/3 antibody described herein is a variant HVR-H1 wherein the variant HVR-H1 comprises substitutions at amino acids P3 and/or Q7 (SEQ ID NO: 4) and the HVR-H3 of an anti-FGFR2/3 antibody described herein is a variant HVR-H3 wherein the variant HVR-H3 comprises substitutions at amino acids T9, Dl 1, and/or K12 (SEQ ID NO:6).
- the variant HVR-H1 and HVR- H3 of an anti-FGFR2/3 antibody of this invention comprise sequences selected from the group listed in Table 11: TFTST (HVR-H1) and LYVD (HVR-H3), TFTST (HVR-H1) and TYDN (HVR-H3), TFTST (HVR-H1) and IYGG (HVR-H3), TFTST (HVR-H1) and TYDE (HVR-H3), PFTSL (HVR-H1) and IYEK (HVR-H3), PFTSQ (HVR-H1) and TYDK (HVR- H3), PFTST (HVR-H1) and TYDM (HVR-H3).
- Table 11 TFTST (HVR-H1) and LYVD (HVR-H3), TFTST (HVR-H1) and TYDN (HVR-H3), TFTST (HVR-H1) and IYGG (HVR-H3), TFTST (HVR-H
- the anti-FGFR2/3 antibody of this invention comprises a HVR-H2 sequence selected from the group consisting of the sequences recited in SEQ ID NOs: 13-44. In certain embodiments, the anti-FGFR2/3 antibody of this invention comprises a FFVR-H2 sequence selected from the group consisting of the sequences recited in SEQ ID NOs:45-50.
- the anti-FGFR2/3 antibodies of this invention bind to FGFR2-IIIb (SEQ ID NOs:51 and 52), FGFR2-IIIc (SEQ ID NOs:53 and 54), FGFR3-IIIb (SEQ ID NOs:55 and 56), and/or FGFR3-IIIc (SEQ ID NOs:57 and 58). In certain embodiments, the anti-FGFR2/3 antibodies of this invention bind to FGFR2-IIIb, FGFR2- IIIc, FGFR3-IIIb, and FGFR3-IIIc.
- the anti-FGFR2/3 antibodies of this invention bind to an FGFR selected from the group consisting of FGFR2-IIIb, FGFR2- IIIc, FGFR3-IIIb, and FGFR3-IIIc. In specific embodiments, the anti-FGFR2/3 antibodies of this invention bind to two FGFRs selected from the group consisting of FGFR2-IIIb, FGFR2- IIIc, FGFR3-IIIb, and FGFR3-IIIc. In specific embodiments, the anti-FGFR2/3 antibodies of this invention bind to three FGFRs selected from the group consisting of FGFR2-IIIb, FGFR2-IIIC, FGFR3-IIIb, and FGFR3-IIIc.
- Antibodies of the invention can comprise any suitable framework variable domain sequence, provided binding activity to FGFR3 and FGFR2 are substantially retained.
- antibodies of the invention comprise a human subgroup III heavy chain framework consensus sequence.
- the framework consensus sequence comprises a substitution at position 71, 73, and/or 78.
- position 71 is A
- 73 is T
- 78 is A.
- these antibodies comprise heavy chain variable domain framework sequences of huMAb4D5-8 (HERCEPTIN ® , Genentech, Inc., South San Francisco, CA, USA) (also referred to in U.S. Patent Nos.
- these antibodies further comprise a human ⁇ light chain framework consensus sequence.
- these antibodies comprise light chain HVR sequences of huMAb4D5-8 as described in U.S. Patent Nos. 6,407,213 & 5,821,337.)
- these antibodies comprise light chain variable domain sequences of huMAb4D5 -8 (HERCEPTIN ® , Genentech, Inc. , South San Francisco, CA, USA) (also referred to in U.S. Patent Nos. 6,407,213 & 5,821,337, and Lee et al, J. Mol. Biol. (2004), 340(5): 1073-1093).
- amino acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO:59.
- amino acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO: 60.
- amino acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO:61.
- amino acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO: 62.
- amino acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO: 63.
- amino acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO: 64. In one embodiment, the amino acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO: 65.
- amino acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO: 66.
- amino acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO: 75.
- amino acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO: 76.
- amino acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO: 77.
- amino acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO:78.
- amino acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO:79.
- amino acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO:80.
- amino acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO:81.
- amino acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO: 82.
- the antibody of this invention comprises a light chain comprising amino acid SEQ ID NO:59 and a heavy chain amino acid sequence comprising SEQ ID NO:75. In specific embodiments, the antibody of this invention comprises a light chain amino acid sequence comprising SEQ ID NO: 60 and a heavy chain amino acid sequence comprising SEQ ID NO:76. In specific embodiments, the antibody of this invention comprises a light chain amino acid sequence comprising SEQ ID NO:61 and a heavy chain amino acid sequence comprising SEQ ID NO:77. In specific embodiments, the antibody of this invention comprises a light chain amino acid sequence comprising SEQ ID NO:62 and a heavy chain amino acid sequence comprising SEQ ID NO:78.
- the antibody of this invention comprises a light chain amino acid sequence comprising SEQ ID NO: 63 and a heavy chain amino acid sequence comprising SEQ ID NO: 79. In specific embodiments, the antibody of this invention comprises a light chain amino acid sequence comprising SEQ ID NO: 64 and a heavy chain amino acid sequence comprising SEQ ID NO: 60. In specific embodiments, the antibody of this invention comprises a light chain amino acid sequence comprising SEQ ID NO: 65 and a heavy chain amino acid sequence comprising SEQ ID NO:81. In specific embodiments, the antibody of this invention comprises a light chain amino acid sequence comprising SEQ ID NO: 66 and a heavy chain amino acid sequence comprising SEQ ID NO: 82.
- nucleic acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO: 67.
- nucleic acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO:68.
- nucleic acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO: 69.
- nucleic acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO: 70.
- nucleic acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO:71.
- nucleic acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO: 72. In one embodiment, the nucleic acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO: 73.
- nucleic acid sequence of the light chain of an antibody of this invention comprises SEQ ID NO: 74.
- nucleic acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO: 83.
- nucleic acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO: 84.
- nucleic acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO: 85.
- nucleic acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO:86.
- nucleic acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO:87.
- nucleic acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO:88.
- nucleic acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO:89.
- nucleic acid sequence of the heavy chain of an antibody of this invention comprises SEQ ID NO: 90.
- the antibody of this invention comprises a light chain comprising nucleic acid SEQ ID NO:67 and a heavy chain nucleic acid sequence comprising SEQ ID NO: 83.
- the antibody of this invention comprises a light chain nucleic acid sequence comprising SEQ ID NO:68 and a heavy chain nucleic acid sequence comprising SEQ ID NO: 84.
- the antibody of this invention comprises a light chain nucleic acid sequence comprising SEQ ID NO: 69 and a heavy chain nucleic acid sequence comprising SEQ ID NO: 85.
- the antibody of this invention comprises a light chain nucleic acid sequence comprising SEQ ID NO:70 and a heavy chain nucleic acid sequence comprising SEQ ID NO:86.
- the antibody of this invention comprises a light chain nucleic acid sequence comprising SEQ ID NO:71 and a heavy chain nucleic acid sequence comprising SEQ ID NO:87. In specific embodiments, the antibody of this invention comprises a light chain nucleic acid sequence comprising SEQ ID NO: 72 and a heavy chain nucleic acid sequence comprising SEQ ID NO: 88. In specific embodiments, the antibody of this invention comprises a light chain nucleic acid sequence comprising SEQ ID NO: 73 and a heavy chain nucleic acid sequence comprising SEQ ID NO:89. In specific embodiments, the antibody of this invention comprises a light chain nucleic acid sequence comprising SEQ ID NO:74 and a heavy chain nucleic acid sequence comprising SEQ ID NO: 90.
- the anti-FGFR2/3 antibody comprises a light chain amino acid sequence comprising SEQ ID NO: 65 and a heavy chain nucleic acid sequence comprising SEQ ID NO:81.
- the anti-FGFR2/3 antibody has the following CDRs:
- HVR-L1 RASQDVDTSLA (SEQ ID NO: l)
- HVR-L2 SASFLYS (SEQ ID NO:2)
- HVR-L3 QQSTGHPQT (SEQ ID NO:3)
- HVR-H1 GFPFTSQGIS (SEQ ID NO:4)
- HVR-H2 RTHLGDGSTNYADSVKG (SEQ ID NO:5)
- HVR-H3 ARTYGIYDTYDKYTEYVMDY (SEQ ID NO:6)
- the anti-FGFR2/3 antibody comprises a light chain amino acid sequence comprising SEQ ID NO: 66 and a heavy chain nucleic acid sequence comprising SEQ ID NO:82. In certain embodiments, the anti-FGFR2/3 antibody has the following CDRs:
- HVR-L1 RASQDVDTSLA (SEQ ID NO:7)
- HVR-L2 SASFLYS (SEQ ID NO: 8)
- HVR-L3 QQSTGHPQT (SEQ ID NO:9)
- HVR-H1 GFPFTSTGIS (SEQ ID NO: 10)
- HVR-H2 RTHLGDGSTNYADSVKG (SEQ ID NO: l 1)
- HVR-H3 ARTYGIYDTYDMYTEYVMDY (SEQ ID NO: 12)
- the anti-FGFR2/3 antibody binds to a region within amino acids 153-251 of a FGFR2 (SEQ ID NOs:52 and 54):
- the anti-FGFR2/3 antibody binds to a region within amino acids 150-248 of a FGFR3 (SEQ ID NOs:56 and 58):
- the anti-FGFR2/3 antibody binds to a region within amino acids 153-251 of a FGFR2 (SEQ ID NOs:52 and 54) and to a region within amino acids 150- 248 of a FGFR3 (SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody binds to a region within amino acids 157-181 (TNTEKMEKRLHAVPAANTVKFRCPA) of a FGFR2 (SEQ ID NOs:52 and 54) ( Figure 9). In certain embodiments the anti-FGFR2/3 antibody binds to a region within amino acids 207-220 (YKVRNQHWSLIMES) of a FGFR2 (SEQ ID NOs:52 and 54)
- the anti-FGFR2/3 antibody binds to a region of FGFR2-IIIb that aligns with SEQ ID NO:52. In specific embodiments, the anti-FGFR2/3 antibody binds to a region of FGFR2-IIIc that aligns with SEQ ID NO:54.
- the anti-FGFR2/3 antibody binds to amino acids 157-181 (TNTEKMEKRLHAVPAANTVKFRCPA) of FGFR2-IIIb (SEQ ID NO:52). In certain embodiments, the anti-FGFR2/3 antibody binds to amino acids 157-181 of FGFR2-IIIc (SEQ ID NO:54). In certain embodiments, the anti-FGFR2/3 antibody binds to amino acids 207- 220 (YKVRNQHWSLIMES) of a FGFR2 (SEQ ID NOs:52 and 54) ( Figure 9). In certain embodiments, the anti-FGFR2/3 antibody binds to amino acids 207-220 of FGFR2-IIIb (SEQ ID NO:52). In certain embodiments, the anti-FGFR2/3 antibody binds to amino acids 207- 220 of FGFR2-IIIC (SEQ ID NO:54).
- the anti-FGFR2/3 antibody binds to a region within amino acids 157-181 (TNTEKMEKRLHAVPAANTVKFRCPA) of a FGFR2 (SEQ ID NOs:52 and 54) and to a region within amino acids 207-220 (YKVRNQHWSLIMES) of FGFR2-IIIb (SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody binds to amino acids 157-181 (TNTEKMEKRLHAVPAANTVKFRCPA) of a FGFR2 (SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody binds to a region within amino acids 154-178 (TRPERMDKKLLAVPAANTVRFRCPA) of FGFR3-IIIb (SEQ ID NO:56). In certain embodiments the anti-FGFR2/3 antibody binds to a region within amino acids 154- 178 (TRPERMDKKLLAVPAANTVRFRCPA) of FGFR3-IIIc (SEQ ID NO:58). In certain embodiments the anti-FGFR2/3 antibody binds to a region within amino acids 204-217 (IKLRHQQWSLVMES) of FGFR3-IIIb (SEQ ID NO:56).
- the anti- FGFR2/3 antibody binds to a region within amino acids 204-217 (IKLRHQQWSLVMES) of FGFR3-IIIC (SEQ ID NO: 58). In specific embodiments, the anti-FGFR2/3 antibody binds to a region of FGFR3-IIIb that aligns with SEQ ID NO:56. In specific embodiments, the anti- FGFR2/3 antibody binds to a region of FGFR3-IIIb that aligns with SEQ ID NO:58.
- the anti-FGFR2/3 antibody binds to amino acids 154-178 (TRPERMDKKLLAVPAANTVRFRCPA) of FGFR3-IIIb (SEQ ID NO:56). In specific embodiments, the anti-FGFR2/3 antibody binds to amino acids 154-178
- the anti-FGFR2/3 antibody binds to amino acids 204-217
- the anti-FGFR2/3 antibody binds to amino acids 204-217 (IKLRHQQWSLVMES) of FGFR3- IIIc (SEQ ID NO:58).
- the anti-FGFR2/3 antibody binds to the following epitopes of an FGFR2: TNTEKMEKRLHAVPAANTVKFRCPA (SEQ ID NO:91) and YKVRNQHWSLIMES (SEQ ID NO:92). In a preferred embodiment, the anti-FGFR2/3 antibody binds to the following epitopes of an FGFR3 :
- the anti-FGFR2/3 antibody binds to following epitopes:
- FGFR2 TNTEKMEKRLHAVPAANTVKFRCPA (SEQ ID NO:91) and
- FGFR3 TRPERMDKKLLAVPAANTVRFRCPA (SEQ ID NO:93) and
- the anti-FGFR2/3 antibody binds to SEQ ID NOs:91-94. In certain embodiments, the anti-FGFR2/3 antibody binds to SEQ ID NOs:91 and 92. In certain embodiments, the anti-FGFR2/3 antibody binds to SEQ ID NOs:91-93. In certain embodiments, the anti-FGFR2/3 antibody binds to SEQ ID NOs:91, 93, and 94. In certain embodiments, the anti-FGFR2/3 antibody binds to SEQ ID NOs:91 and 94. In certain embodiments, the anti-FGFR2/3 antibody binds to SEQ ID NOs:92-94. In certain embodiments,
- the anti-FGFR2/3 antibody binds to SEQ ID NOs:92 and 93. In certain embodiments, the anti-FGFR2/3 antibody binds to SEQ ID NOs:92 and 94. In certain embodiments, the anti-FGFR2/3 antibody binds to SEQ ID NOs:93 and 91. In certain embodiments, the anti-FGFR2/3 antibody binds to SEQ ID NOs:91, 92, and 94. In certain embodiments, the anti-FGFR2/3 antibody binds to a combination of any two or more epitopes provided in SEQ ID NOs:91-94.
- the anti-FGFR2/3 antibody binds to a region within amino acids 153-251 of FGFR2-IIIb (SEQ ID NO:52). In certain embodiments, the anti-FGFR2/3 antibody binds to a region within amino acids 153-251 of FGFR2-IIIc (SEQ ID NO:54). In preferred embodiments, the anti-FGFR2/3 antibody binds to a region within amino acids 153- 251 of FGFR2-IIIb (SEQ ID NO:52) and FGFR2-IIIc (SEQ ID NO:54). In certain embodiments,
- the anti-FGFR2/3 antibody binds to a region within amino acids 150-248 of FGFR3-IIIb (SEQ ID NO:56). In certain embodiments, the anti-FGFR2/3 antibody binds to a region within amino acids 150-248 of FGFR3-IIIb (SEQ ID NO:58). In preferred
- the anti-FGFR2/3 antibody binds to a region within amino acids 150-248 of FGFR3-IIIb (SEQ ID NO:56) and FGFR3-IIIc (SEQ ID NO:58).
- the anti-FGFR2/3 antibody binds to a region within amino acids 153-251 of FGFR2-IIIb (SEQ ID NO:52) and/or FGFR2-IIIc (SEQ ID NO:54) and to a region within amino acids 150-248 of FGFR3-IIIb (SEQ ID NO:56) and/or FGFR3-IIIc (SEQ ID NO:58).
- the anti-FGFR2/3 antibody binds to an epitope comprising one or more amino acids selected from T157, N158, T159, E160, K161, M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody binds to an epitope comprising amino acids T157, N158, T159, E160, K161, M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody when bound to FGFR2 is positioned 4 angstroms or less from one or more amino acids T157, N158, T159, E160, K161, M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- amino acids T157, N158, T159, E160, K161, M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 e.g., SEQ ID NOs:52 and 54.
- the anti-FGFR2/3 antibody when bound to FGFR2 is positioned 4 angstroms or less from amino acids T157, N158, T159, E160, K161, M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the anti- FGFR2/3 antibody when bound to FGFR2 is positioned 3.5 angstroms or less from one or more amino acids T157, N158, T159, E160, K161 , M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- amino acids T157, N158, T159, E160, K161 , M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 e.g., SEQ ID NOs:52 and 54.
- the anti-FGFR2/3 antibody when bound to FGFR2 is positioned 3.5 angstroms or less from amino acids T157, N158, T159, E160, K161, M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody when bound to FGFR2 is positioned 3.5 angstroms or less from amino acids T157, N158, T159, E160, K161, M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 (e.g., SEQ ID NOs:52 and
- FGFR2 is positioned 3.0 angstroms or less from one or more amino acids T157, N158, T159, E160, K161, M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- amino acids T157, N158, T159, E160, K161, M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 e.g., SEQ ID NOs:52 and 54.
- the anti-FGFR2/3 antibody when bound to FGFR2 is positioned 3.0 angstroms or less from amino acids T157, N158, T159, E160, K161, M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody when bound to FGFR2 is positioned 4.0, 3.75, 3.5, 3.25, or 3.0 angstroms or less from one or more amino acids T157, N158, T159, E160, K161, M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- amino acids T157, N158, T159, E160, K161, M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 e.g., SEQ ID NOs:52 and 54.
- the anti-FGFR2/3 antibody when bound to FGFR2 is positioned 4.0, 3.75, 3.5, 3.25, or 3.0 angstroms or less from amino acids T157, N158, T159, E160, K161, M162, E163, K164, R165, L166, H167, A168, V169, P170, A171, A172, N173, T174, V175, K176, F177, R178, C179, P180, and A181 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the one or more amino acids and/or the one or more amino acid residues is about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, and/or 12 amino acids and/or amino acid residues.
- the epitope is determined by crystallography (e.g., crystallography methods described in the Examples).
- the anti-FGFR2/3 antibody binds to human FGFR2 (hFGFR2) (e.g., SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody binds to an epitope comprising one or more amino acids selected from Y207, K208, V209, R210, N211, Q212, H213, W214, S215, L216, 1217, M218, E219, and S220 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody binds to an epitope comprising amino acids Y207, K208, V209, R210, N211, Q212, H213, W214, S215, L216, 1217, M218, E219, and S220 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody when bound to FGFR2 is positioned 4 angstroms or less from one or more amino acids Y207, K208, V209, R210, N211, Q212, H213, W214, S215, L216, 1217, M218, E219, and S220 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody when bound to FGFR2 is positioned 4 angstroms or less from amino acids Y207, K208, V209, R210, N211, Q212, H213, W214, S215, L216, 1217, M218, E219, and S220 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody when bound to FGFR2 is positioned 3.5 angstroms or less from one or more amino acids Y207, K208, V209, R210, N211, Q212, H213, W214, S215, L216, 1217, M218, E219, and S220 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody when bound to FGFR2 is positioned 3.5 angstroms or less from amino acids Y207, K208, V209, R210, N211, Q212, H213, W214, S215, L216, 1217, M218, E219, and S220 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody when bound to FGFR2 is positioned 3.0 angstroms or less from one or more amino acids Y207, K208, V209, R210, N211, Q212, H213, W214, S215, L216, 1217, M218, E219, and S220 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody when bound to FGFR2 is positioned 3.0 angstroms or less from amino acids Y207, K208, V209, R210, N211, Q212, H213, W214, S215, L216, 1217, M218, E219, and S220 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody when bound to FGFR2 is positioned 4.0, 3.75, 3.5, 3.25, or 3.0 angstroms or less from one or more amino acids Y207, K208, V209, R210, N211, Q212, H213, W214, S215, L216, 1217, M218, E219, and S220 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- the anti- FGFR2/3 antibody when bound to FGFR2 is positioned 4.0, 3.75, 3.5, 3.25, or 3.0 angstroms or less from amino acids Y207, K208, V209, R210, N211, Q212, H213, W214, S215, L216, 1217, M218, E219, and S220 of FGFR2 (e.g., SEQ ID NOs:52 and 54).
- amino acids Y207, K208, V209, R210, N211, Q212, H213, W214, S215, L216, 1217, M218, E219, and S220 of FGFR2 e.g., SEQ ID NOs:52 and 54.
- the one or more amino acids and/or the one or more amino acid residues is about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, and/or 12 amino acids and/or amino acid residues.
- the epitope is determined by crystallography (e.g., crystallography methods described in the Examples). ).
- the anti-FGFR2/3 antibody binds to human FGFR2 (hFGFR2) (e.g., SEQ ID NOs:52 and 54).
- the anti-FGFR2/3 antibody binds to an epitope comprising one or more amino acids selected from T154, R155, P156, E157, R158, M159, D160, K161, K162, L163, L164, A165, V166, P167, A168, A169, N170, T171, V172, R173, F174, R175, C176, P177, and A178 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody binds to an epitope comprising amino acids T154, R155, P156, E157, R158, M159, D160, K161, K162, L163, L164, A165, V166, P167, A168, A169, N170, T171, V172, R173, F174, R175, C176, P177, and A178 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 4 angstroms or less from one or more amino acids T154, R155, P156, E157, R158, M159, D160, K161, K162, L163, L164, A165, V166, P167, A168, A169, N170, T171, V172, R173, F174, R175, C176, P177, and A178 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 4 angstroms or less from amino acids T154, R155, P156, E157, R158, M159, D160, K161, K162, L163, L164, A165, V166, P167, A168, A169, N170, T171, V172, R173, F174, R175, C176, P177, and A178 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 4 angstroms or less from amino acids T154, R155, P156, E157, R158, M159, D160, K161, K162, L163, L164, A165, V166, P167, A168, A169, N170, T171, V172, R173, F174, R175, C176, P177, and A178 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- FGFR2/3 antibody when bound to FGFR3 is positioned 3.5 angstroms or less from one or more amino acids T154, R155, P156, E157, R158, M159, D160, K161, K162, L163, L164, A165, V166, P167, A168, A169, N170, T171, V172, R173, F174, R175, C176, P177, and A178 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 3.5 angstroms or less from amino acids T154, R155, P156, E157, R158, M159, D160, K161, K162, L163, L164, A165, V166, P167, A168, A169, N170, T171, V172, R173, F174, R175, C176, P177, and A178 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 3.0 angstroms or less from one or more amino acids T154, R155, P156, E157, R158, M159, D160, K161, K162, L163, L164, A165, V166, P167, A168, A169, N170, T171, V172, R173, F174, R175, C176, P177, and A178 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 3.0 angstroms or less from amino acids T154, R155, P156, E157, R158, M159, D160, K161, K162, L163, L164, A165, V166, P167, A168, A169, N170, T171, V172, R173, F174, R175, C176, P177, and A178 of FGFR3 (e.g., SEQ ID NOs:56 and 58). .
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 4.0, 3.75, 3.5, 3.25, or 3.0 angstroms or less from one or more amino acids T154, R155, P156, E157, R158, M159, D160, K161, K162, L163, L164, A165, V166, P167, A168, A169, N170, T171, V172, R173, F174, R175, C176, P177, and A178 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 4.0, 3.75, 3.5, 3.25, or 3.0 angstroms or less from amino acids T154, R155, P156, E157, R158, M159, D160, K161, K162, L163, L164, A165, V166, P167, A168, A169, N170, T171, V172, R173, F174, R175, C176, P177, and A178 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the one or more amino acids and/or the one or more amino acid residues is about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, and/or 12 amino acids and/or amino acid residues.
- the epitope is determined by crystallography (e.g., crystallography methods described in the Examples).
- the anti-FGFR2/3 antibody binds to human FGFR3 (hFGFR3) (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody binds to an epitope comprising one or more amino acids selected from 1204, K205, L206, R207, H208, Q209, Q210, W211, S212, L213, V214, M215, E216, and S217 of FGFR3 (e.g., SEQ ID NOs:56 and 58). In some embodiments, the anti-FGFR2/3 antibody binds to an epitope comprising amino acids 1204, K205, L206, R207, H208, Q209, Q210, W211, S212, L213, V214, M215, E216, and S217 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 4 angstroms or less from one or more amino acids 1204, K205, L206, R207, H208, Q209, Q210, W21 1, S212, L213, V214, M215, E216, and S217 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 4 angstroms or less from amino acids 1204, K205, L206, R207, H208, Q209, Q210, W211, S212, L213, V214, M215, E216, and S217 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 3.5 angstroms or less from one or more amino acids 1204, K205, L206, R207, H208, Q209, Q210, W211, S212, L213, V214, M215, E216, and S217 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 3.5 angstroms or less from amino acids 1204, K205, L206, R207, H208, Q209, Q210, W211, S212, L213, V214, M215, E216, and S217 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 3.0 angstroms or less from one or more amino acids 1204, K205, L206, R207, H208, Q209, Q210, W211, S212, L213, V214, M215, E216, and S217 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 3.0 angstroms or less from amino acids 1204, K205, L206, R207, H208, Q209, Q210, W211, S212, L213, V214, M215, E216, and S217 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 4.0, 3.75, 3.5, 3.25, or 3.0 angstroms or less from one or more amino acids 1204, K205, L206, R207, H208, Q209, Q210, W211, S212, L213, V214, M215, E216, and S217 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody when bound to FGFR3 is positioned 4.0, 3.75, 3.5, 3.25, or 3.0 angstroms or less from amino acids 1204, K205, L206, R207, H208, Q209, Q210, W211, S212, L213, V214, M215, E216, and S217 of FGFR3 (e.g., SEQ ID NOs:56 and 58).
- the one or more amino acids and/or the one or more amino acid residues is about any of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, and/or 12 amino acids and/or amino acid residues.
- the epitope is determined by crystallography (e.g., crystallography methods described in the Examples).
- the anti- FGFR2/3 antibody binds to human FGFR3 (hFGFR3) (e.g., SEQ ID NOs:56 and 58).
- the anti-FGFR2/3 antibody binds to one epitope on FGFR2 selected from SEQ ID NOs: 91 and 92 and one epitope on FGFR3 selected from SEQ ID NOs: 93 and 94. In certain embodiments, the anti-FGFR2/3 antibody binds to two epitopes on FGFR2 comprising SEQ ID NOs: 91 and 92 and one epitope on FGFR3 selected from SEQ ID NOs: 93 and 94. In certain embodiments, the anti-FGFR2/3 antibody binds to one epitope on FGFR2 selected from SEQ ID NOs: 91 and 92 and two epitopes on FGFR3 comprising SEQ ID NOs: 93 and 94.
- the anti-FGFR2/3 antibody binds to two epitopes on FGFR2 comprising SEQ ID NOs: 91 and 92 and two epitopes on FGFR3 comprising SEQ ID NOs: 93 and 94 ( Figure 9).
- the invention provides an anti-FGFR2/3 antibody that binds a polypeptide comprising, consisting essentially of or consisting of the following amino acid sequence: TNTEKMEKRLHAVPAANTVKFRCPA (SEQ ID NO:91) and/or
- the invention provides an anti-FGFR2/3 antibody that binds a polypeptide comprising, consisting essentially of or consisting of the following amino acid sequence: TRRERMDKKLLAVPAANTVRFRCPA (SEQ ID NO:93) and/or
- the invention provides an anti-FGFR2/3 antibody that binds a polypeptide comprising, consisting essentially of or consisting of the following amino acid sequence: TNTEKMEKRLHAVPAANTVKFRCPA (SEQ ID NO:91) or
- an anti-FGFR2/3 antibody of the invention specifically binds an amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity or similarity with the sequence
- an anti-FGFR2/3 antibody of the invention specifically binds an amino acid sequence having at least 50%>, 60%>, 70%>, 80%>, 90%>, 95%, 96%o, 97%), 98%), or 99% sequence identity or similarity with the sequence
- TRRERMDKKLLAVPAANTVRFRCPA SEQ ID NO:93
- IKLRHQQWSLVMES SEQ ID NO:94
- an anti-FGFR2/3 antibody of the invention specifically binds an amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99%) sequence identity or similarity with the sequence
- TNTEKMEKRLHAVPAANTVKFRCPA (SEQ ID NO:91) or YKVRNQHWSLIMES (SEQ ID NO:92) and an amino acid sequence having at least 50%, 60%, 70%, 80%, 90%, 95%, 96%), 97%), 98%), or 99% sequence identity or similarity with the sequence
- TRRERMDKKLLAVPAANTVRFRCPA SEQ ID NO:93
- IKLRHQQWSLVMES SEQ ID NO:94
- One of ordinary skill in the art understands how to align FGFR3 sequences in order identify corresponding residues between respective FGFR3 sequences. Similarly, one of ordinary skill in the art understands how to align FGFR2 sequences in order identify corresponding residues between respective FGFR2 sequences.
- the invention provides an anti-FGFR2/3 antibody that competes with any of the above-mentioned antibodies for binding to FGFR3 and/or FGFR2. In one aspect, the invention provides an anti- FGFR2/3 antibody that binds to the same or a similar epitope on FGFR3 and/or FGFR2 as any of the above-mentioned antibodies.
- the amino acid position/boundary delineating a hypervariable region of an antibody can vary, depending on the context and the various definitions known in the art (as described below).
- positions within a variable domain may be viewed as hybrid hypervariable positions in that these positions can be deemed to be within a hypervariable region under one set of criteria while being deemed to be outside a hypervariable region under a different set of criteria.
- One or more of these positions can also be found in extended hypervariable regions (as further defined below).
- the antibody is a monoclonal antibody. In other embodiments, the antibody is a polyclonal antibody. In some embodiments, the antibody is selected from the group consisting of a chimeric antibody, an affinity matured antibody, a humanized antibody, and a human antibody. In certain embodiments, the antibody is an antibody fragment. In some embodiments, the antibody is a Fab, Fab', Fab'-SH, F(ab') 2 , or scFv.
- the FGFR2/3 antibody is a one-armed antibody (i.e., the heavy chain variable domain and the light chain variable domain form a single antigen binding arm) comprising an Fc region, wherein the Fc region comprises a first and a second Fc
- first and second Fc polypeptides are present in a complex and form a Fc region that increases stability of said antibody fragment compared to a Fab molecule comprising said antigen binding arm. See, e.g., WO2006/015371.
- the antibody is a chimeric antibody, for example, an antibody comprising antigen binding sequences from a non-human donor grafted to a heterologous non-human, human, or humanized sequence (e.g., framework and/or constant domain sequences).
- the non-human donor is a mouse.
- an antigen binding sequence is synthetic, e.g., obtained by mutagenesis (e.g., phage display screening, etc.).
- a chimeric antibody of the invention has murine V regions and a human C region.
- the murine light chain V region is fused to a human kappa light chain.
- the murine heavy chain V region is fused to a human IgGl C region.
- Humanized antibodies of the invention include those that have amino acid
- the antibodies of the invention further comprise changes in amino acid residues in the Fc region that lead to improved effector function including enhanced CDC and/or ADCC function and B-cell killing.
- Other antibodies of the invention include those having specific changes that improve stability.
- the antibodies of the invention comprise changes in amino acid residues in the Fc region that lead to decreased effector function, e.g., decreased CDC and/or ADCC function and/or decreased B-cell killing.
- the antibodies of the invention are characterized by decreased binding (such as absence of binding) to human complement factor C 1 q and/or human Fc receptor on natural killer (NK) cells. In some embodiments, the antibodies of the invention are characterized by decreased binding (such as the absence of binding) to human FcyRI, FcyRIIA, and/or FcyRIIIA. In some embodiments, the antibodies of the invention are of the IgG class (e.g., IgGl or IgG4) and comprise at least one mutation in E233, L234, G236, D265, D270, N297, E318, K320, K322, A327, A330, P331 , and/or P329 (numbering according to the EU index). In some embodiments, IgGl or IgG4) and comprise at least one mutation in E233, L234, G236, D265, D270, N297, E318, K320, K322, A327, A330, P331 , and/or P329 (number
- the antibodies comprise the mutations L234A/L235A or D265A/N297A.
- the carbohydrate attached thereto may be altered.
- antibodies with a mature carbohydrate structure that lacks fucose attached to an Fc region of the antibody are described in US Pat Appl No US 2003/0157108. See also US 2004/0093621.
- Antibodies with a bisecting N-acetylglucosamine (GlcNAc) in the carbohydrate attached to an Fc region of the antibody are referenced in WO 2003/011878 and US Patent No. 6,602,684.
- Antibodies with at least one galactose residue in the oligosaccharide attached to an Fc region of the antibody are reported in WO 1997/30087.
- the invention provides FGFR3 binding polypeptides comprising any of the antigen binding sequences provided herein, wherein the FGFR3 binding polypeptides specifically bind to a FGFR3, e.g., a human and/or cyno and/or mouse FGFR3.
- the antibodies of the invention bind (such as specifically bind) FGFR3 (e.g. FGFR3-
- Illb and/or FGFR3-IIIc) and FGFR2 may modulate (e.g. inhibit) one or more aspects of FGFR3 and/or FGFR2 signaling (such as FGFR3 phosphorylation) and/or disruption of any biologically relevant FGFR3 and/or FGFR3 ligand biological pathway and/or disruption of any biologically relevant FGFR2 and/or FGFR2 ligand biological pathway, and/or treatment and/or prevention of a tumor, cell proliferative disorder or a cancer; and/or treatment or prevention of a disorder associated with FGFR3 and/or FGFR2 expression and/or activity (such as increased FGFR3 and/or FGFR2 expression and/or activity).
- FGFR3 and/or FGFR2 signaling such as FGFR3 phosphorylation
- the FGFR2/3 antibody specifically binds to a polypeptide consisting of or consisting essentially of a FGFR3 (e.g., a human or mouse FGFR3) and/or a FGFR2 (e.g., a human or mouse FGFR3).
- the antibody specifically binds FGFR3 with a Kd of 1 x 10 "7 M or higher affinity.
- the antibody specifically binds FGFR2 with a Kd of 1 x 10 "7 M or higher affinity.
- the antibody specifically binds FGFR3 and FGF2 with Kds of 1 x 10 "7 M or higher affinity.
- the anti-FGFR2/3 antibody of the invention is not an anti- FGFR3 antibody described in U.S. Patent Publication no. 2005/0147612 (e.g., antibody MSPR02, MSPR012, MSPR059, MSPROl l, MSPR021, MSPR024, MSPR026,
- MSPR028, MSPR029, MSPR043, MSPR055) antibody described in Rauchenberger et al, J Biol Chem 278 (40):38194-38205 (2003); an antibody described in PCT Publication No. WO2006/048877 (e.g., antibody PRO-001), an antibody described in Martinez- Torrecuadrada et al, Mol Cancer Ther (2008) 7(4): 862-873 (e.g., scFvaFGFR3 3C), an antibody described in Direnzo, R et al (2007) Proceedings of AACR Annual Meeting, Abstract No. 2080 (e.g., Dl 1), or an antibody described in WO 2010/002862 (e.g., antibodies 15D8, 27H2, 4E7, 2G4, 20B4).
- WO 2010/002862 e.g., antibodies 15D8, 27H2, 4E7, 2G4, 20B4.
- the invention provides compositions comprising one or more antibodies of the invention and a carrier.
- the carrier is pharmaceutically acceptable.
- the invention provides nucleic acids encoding a FGFR2/3 antibody of the invention.
- the invention provides vectors comprising a nucleic acid of the invention.
- compositions comprising one or more nucleic acids of the invention and a carrier.
- the carrier is any suitable carrier.
- the invention provides host cells comprising a nucleic acid or a vector of the invention.
- a vector can be of any type, for example, a recombinant vector such as an expression vector. Any of a variety of host cells can be used.
- a host cell is a prokaryotic cell, for example, E. coli.
- a host cell is a eukaryotic cell, for example a mammalian cell such as Chinese Hamster Ovary (CHO) cell.
- the invention provides methods of making an antibody of the invention.
- the invention provides methods of making an anti-FGFR2/3 antibody (which, as defined herein includes full length antibody and fragments thereof), said method comprising expressing in a suitable host cell a recombinant vector of the invention encoding the antibody, and recovering the antibody.
- the method comprises culturing a host cell comprising nucleic acid encoding the antibody so that the nucleic acid is expressed.
- the method further comprises recovering the antibody from the host cell culture.
- the antibody is recovered from the host cell culture medium.
- the method further comprises combining the recovered antibody with a pharmaceutically acceptable carrier, excipient, or carrier to prepare a pharmaceutical formulation comprising the humanized antibody.
- the invention provides an article of manufacture comprising a container; and a composition contained within the container, wherein the composition comprises one or more FGFR2/3 antibodies of the invention.
- the composition comprises a nucleic acid of the invention.
- a composition comprises a nucleic acid of the invention.
- composition comprising an antibody further comprises a carrier, which in some embodiments is pharmaceutically acceptable.
- an article of manufacture of the invention further comprises instructions for administering the composition (e.g., the antibody) to an individual (such as instructions for any of the methods described herein).
- the invention provides a kit comprising a first container comprising a composition comprising one or more anti-FGFR2/3 antibodies of the invention; and a second container comprising a buffer.
- the buffer is pharmaceutically acceptable.
- a composition comprising an antibody further comprises a carrier, which in some embodiments is pharmaceutically acceptable.
- a kit further comprises instructions for administering the composition (e.g., the antibody) to an individual.
- the invention provides an anti-FGFR2/3 antibody of the invention for use as a medicament.
- the invention provides an anti-FGFR2/3 antibody of the invention for use in treating or preventing a disorder, such as a pathological condition associated with FGFR3 activation and/or expression (in some embodiments, over-expression).
- a disorder such as a pathological condition associated with FGFR3 activation and/or expression (in some embodiments, over-expression).
- the invention provides an anti-FGFR2/3 antibody of the invention for use in treating or preventing a disorder, such as a pathological condition associated with FGFR2 activation and/or expression (in some embodiments, over-expression).
- the disorder is a cancer, a tumor, and/or a cell proliferative disorder.
- the cancer, a tumor, and/or a cell proliferative disorder is multiple myeloma or bladder cancer (e.g., transitional cell carcinoma), breast cancer or liver cancer.
- the invention provides an anti-FGFR2/3 antibody of the invention for use in treating or preventing a disorder such as a skeletal disorder.
- a disorder such as a skeletal disorder.
- the disorder is achondroplasia, hypochondroplasia, dwarfism, thantophoric dysplasia (TD; clinical forms TD1 and TDII), or craniosynostosis syndrome.
- the invention provides an anti-FGFR2/3 antibody of the invention for use in reducing cell proliferation.
- the invention provides an anti-FGFR2/3 antibody of the invention for use in killing a cell.
- the cell is a multiple myeloma cell.
- the cell is killed by ADCC.
- the antibody is a naked antibody.
- the cell over-expresses FGFR3.
- the cell over-expresses FGFR2.
- the cell over-expresses FGFR2 and FGFR3.
- the invention provides an anti-FGFR2/3 antibody of the invention for use in depleting cells, such as multiple myeloma cells.
- the cell is killed by ADCC.
- the antibody is a naked antibody.
- the cell over-expresses FGFR3.
- the invention provides use of an anti-FGFR2/3 antibody of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as a pathological condition associated with FGFR3, FGFR2, or
- FGFR2 and FGFR3 activation and/or expression in some embodiments, over-expression.
- the disorder is a cancer, a tumor, and/or a cell proliferative disorder.
- the cancer, a tumor, and/or a cell proliferative disorder is multiple myeloma or bladder cancer (e.g., transitional cell carcinoma), breast cancer or liver cancer.
- the disorder is a skeletal disorder, e.g., achondroplasia,
- hypochondroplasia dwarfism, thantophoric dysplasia (TD; clinical forms TD1 and TDII), or craniosynostosis syndrome.
- the invention provides use of a nucleic acid of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as a pathological condition associated with FGFR3, FGFR2, or FGFR2 and FGFR3 activation and/or expression (in some embodiments, over-expression).
- a disorder such as a pathological condition associated with FGFR3, FGFR2, or FGFR2 and FGFR3 activation and/or expression (in some embodiments, over-expression).
- the disorder is a cancer, a tumor, and/or a cell proliferative disorder.
- the cancer, a tumor, and/or a cell proliferative disorder is multiple myeloma or bladder cancer (e.g., transitional cell carcinoma), breast cancer or liver cancer.
- the disorder is a skeletal disorder, e.g., achondroplasia, hypochondroplasia, dwarfism, thantophoric dysplasia (TD; clinical forms TD1 and TDII), or craniosynostosis syndrome.
- the invention provides use of an expression vector of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as a pathological condition associated with FGFR3, FGFR2, or FGFR2 and FGFR3 activation and/or expression (in some embodiments, over-expression).
- a disorder such as a pathological condition associated with FGFR3, FGFR2, or FGFR2 and FGFR3 activation and/or expression (in some embodiments, over-expression).
- the disorder is a cancer, a tumor, and/or a cell proliferative disorder.
- the cancer, a tumor, and/or a cell proliferative disorder is multiple myeloma or bladder cancer (e.g., transitional cell carcinoma), breast cancer or liver cancer.
- the disorder is a skeletal disorder, e.g., achondroplasia, hypochondroplasia, dwarfism, thantophoric dysplasia (TD; clinical forms TD1 and TDII), or craniosynostosis syndrome.
- achondroplasia e.g., hypochondroplasia, dwarfism, thantophoric dysplasia (TD; clinical forms TD1 and TDII), or craniosynostosis syndrome.
- the invention provides use of a host cell of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as a pathological condition associated with FGFR3, FGFR2, or FGFR2 and FGFR3 activation and/or expression (in some embodiments, over-expression).
- a disorder such as a pathological condition associated with FGFR3, FGFR2, or FGFR2 and FGFR3 activation and/or expression (in some embodiments, over-expression).
- the disorder is a cancer, a tumor, and/or a cell proliferative disorder.
- the cancer, a tumor, and/or a cell proliferative disorder is multiple myeloma or bladder cancer (e.g., transitional cell carcinoma), breast cancer or liver cancer.
- the disorder is a skeletal disorder, e.g., achondroplasia, hypochondroplasia, dwarfism, thantophoric dysplasia (TD; clinical forms TD1 and TDII), or craniosynostosis syndrome.
- the invention provides use of an article of manufacture of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as a pathological condition associated with FGFR3, FGFR2, or FGFR2 and FGFR3 activation and/or expression (in some embodiments, over-expression).
- a disorder such as a pathological condition associated with FGFR3, FGFR2, or FGFR2 and FGFR3 activation and/or expression (in some embodiments, over-expression).
- the disorder is a cancer, a tumor, and/or a cell proliferative disorder.
- the cancer, a tumor, and/or a cell proliferative disorder is multiple myeloma or bladder cancer (e.g., transitional cell carcinoma), breast cancer or liver cancer.
- the disorder is a skeletal disorder, e.g., achondroplasia,
- hypochondroplasia dwarfism, thantophoric dysplasia (TD; clinical forms TD1 and TDII), or craniosynostosis syndrome.
- the invention also provides use of a kit of the invention in the preparation of a medicament for the therapeutic and/or prophylactic treatment of a disorder, such as a pathological condition associated with FGFR3, FGFR2, or FGFR2 and FGFR3 activation and/or expression (in some embodiments, over-expression).
- a disorder such as a pathological condition associated with FGFR3, FGFR2, or FGFR2 and FGFR3 activation and/or expression (in some embodiments, over-expression).
- the disorder is a cancer, a tumor, and/or a cell proliferative disorder.
- the cancer, a tumor, and/or a cell proliferative disorder is multiple myeloma or bladder cancer (e.g., transitional cell carcinoma) , breast cancer or liver cancer.
- the disorder is a skeletal disorder, e.g., achondroplasia, hypochondroplasia, dwarfism, thantophoric dysplasia (TD; clinical forms TD1 and TDII), or craniosynostosis syndrome.
- the invention provides use of an anti-FGFR2/3 antibody of the invention in the preparation of a medicament for inhibition of cell proliferation.
- the invention provides use of an anti-FGFR2/3 antibody of the invention in the preparation of a medicament for cell killing.
- the cell is a multiple myeloma cell.
- the cell is killed by ADCC.
- the antibody is a naked antibody.
- the cell over-expresses FGFR3.
- the cell over-expresses FGFR2.
- the invention provides use of an anti-FGFR2/3 antibody of the invention in the preparation of a medicament for depleting cells, such as multiple myeloma cells.
- the cell is killed by ADCC.
- the antibody is a naked antibody.
- the cell over-expresses FGFR3.
- the cell over-expresses FGFR2.
- the cell over-expresses FGFR3 and FGFR2.
- the invention provides methods and compositions useful for modulating disorders associated with expression and/or signaling of FGFR3, such as increased expression and/or signaling or undesired expression and/or signaling.
- the invention provides methods and compositions useful for modulating disorders associated with expression and/or signaling of FGFR2, such as increased expression and/or signaling or undesired expression and/or signaling.
- the invention provides methods and compositions useful for modulating disorders associated with expression and/or signaling of FGFR3 and FGFR2, such as increased expression and/or signaling or undesired expression and/or signaling.
- Methods of the invention can be used to affect any suitable pathological state.
- Exemplary disorders include a cancer selected from the group consisting of non-small cell lung cancer, ovarian cancer, thyroid cancer, testicular cancer, endometrial cancer, head and neck cancer, brain cancer (e.g., neuroblastoma or meningioma), skin cancer (e.g., melanoma, basal cell carcinoma, or squamous cell carcinoma), bladder cancer (e.g., transitional cell carcinoma), breast carcinoma, gastric cancer, colorectal cancer (CRC), hepatocellular carcinoma, cervical cancer, lung cancer, pancreatic cancer, prostate cancer, and hematologic malignancies (e.g., T-cell acute lymphoblastic leukemia (T-ALL), B-cell acute lymphoblastic leukemia (B-ALL), acute myelogenous leukemia (AML), B-cell malignancies, Hodgkin lymphoma, and multiple myeloma).
- a cancer selected from the group consisting of non-small cell lung cancer, ovarian cancer, thyroid cancer
- the disorder is invasive transitional cell carcinoma. In some embodiments, the disorder is multiple myeloma. Additional exemplary disorders include skeletal disorders, such as achondroplasia, hypochondroplasia, dwarfism, thantophoric dysplasia (TD; clinical forms
- TD1 and TDII craniosynostosis syndrome.
- the cancer expresses FGFR3, amplified FGFR3, translocated FGFR3, and/or mutated FGFR3. In certain embodiments, the cancer expresses activated
- the cancer expresses translocated FGFR3 (e.g., a t(4;14) translocation).
- the cancer expresses constitutive FGFR3.
- the constitutive FGFR3 comprises a mutation in the tyrosine kinase domain and/or the juxtamembrane domain and/or a ligand-binding domain.
- the cancer expresses ligand-independent FGFR3.
- the cancer expresses ligand-dependent FGFR3.
- the cancer expresses FGFR3 comprising a mutation corresponding to FGFR3-IIIb ⁇ ° ⁇ In some embodiments, the cancer expressed FGFR3-IIIb
- the cancer expresses FGFR3 comprising a mutation corresponding to FGFR3-IIIb K652E . In some embodiments, the cancer expressed FGFR3-IIIb
- FGFR3 comprising a mutation corresponding to FGFR3-IIIb .
- the cancer expresses FGFR3-IIIb S249C and/or FGFR3-IIIc S249C .
- the cancer expresses FGFR3 comprising a mutation corresponding to
- the cancer expresses FGFR3-IIIb w ' ⁇ and/or
- the cancer expresses FGFR3 comprising a mutation corresponding to FGFR3-IIIb 1J J ⁇ In some embodiments, the cancer expresses FGFR3-IIIb 1J ' ⁇ and/or FGFR3-IIIc Y373C . In some embodiments, the cancer expresses (a) FGFR3-IIIb K652E and (b) one or more of FGFR3-IIIb R248C , FGFR3-IIIb Y375C , FGFR3 -IIIb S249C , and FGFR3IIIb G372C
- the cancer expresses (a) FGFR3-IIIb ⁇ ⁇ and (b) one or more of FGFR3-IIIb K652E , FGFR3-IIIb Y375C , FGFR3-IIIb S249C , and FGFR3-IIIb G372C
- the cancer expresses (a) FGFR3-IIIb and (b) one or more of FGFR3-IIIb K652E , FGFR3-IIIb Y375C , FGFR3-IIIb S249C , and FGFRS-IIIb 2480
- the cancer expresses FGFRS-IIIb 2480 , FGFR3-IIIb K652E , FGFR3-IIIb Y375C , FGFR3-IIIb S249C , and FGFR3-IIIb G372C
- the cancer expresses increased levels of phospho-FGFR3, phospho-FRS2 and/or phospho-MAPK relative to a control sample (e.g., a sample of normal tissue) or level.
- a control sample e.g., a sample of normal tissue
- the cancer expresses FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2. In certain embodiments, the cancer expresses activated FGFR2. In certain embodiments, the cancer expresses translocated FGFR2. In certain embodiments, the cancer expresses constitutive FGFR2. In certain embodiments, the cancer expresses ligand-independent FGFR2. In some embodiments, the cancer expresses ligand- dependent FGFR2.
- the cancer expresses FGFR2 comprising a mutation.
- the cancer expresses: 1) FGFR3, amplified FGFR3, translocated FGFR3, and/or mutated FGFR3 and 2) FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2.
- the cancer expresses activated FGFR3 and a FGFR2 as described above.
- the cancer expresses translocated FGFR3 (e.g., a t(4;14) translocation) and a FGFR2 as described above.
- the cancer expresses constitutive FGFR3 and a FGFR2 as described above.
- the constitutive FGFR3 comprises a mutation in the tyrosine kinase domain and/or the juxtamembrane domain and/or a ligand-binding domain.
- the cancer expresses ligand-independent FGFR3 and a FGFR2 as described above. In some embodiments, the cancer expresses ligand-dependent FGFR3 and a FGFR2 as described above.
- the cancer expresses FGFR3 comprising a mutation corresponding to FGFR3-IIIb and a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- the cancer expresses FGFR3-IIIb S248C and/or FGFR3-IIIc S248C and a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- the cancer expresses FGFR3 comprising a mutation corresponding to FGFR3-IIIb K652E and a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- the cancer expresses FGFR3-IIIb K652E and/or FGFR3-IIIc K650E and a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- FGFR3 comprising a mutation corresponding to FGFR3-IIIb and a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- the cancer expresses FGFR3-IIIb ⁇ and/or FGFR3-IIIc S249C and a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- the cancer expresses FGFR3 comprising a mutation corresponding to FGFR3-IIIb G372C and a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- the cancer expresses FGFR3-IIIb G372C and/or FGFR3-IIIc G370C and a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- the cancer expresses FGFR3 comprising a mutation corresponding to FGFR3-IIIb Y375C and a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- the cancer expresses FGFR3-IIIb Y375C and/or FGFR3-IIIc Y373C and a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- the cancer expresses (a) FGFR3-IIIb K652E and (b) one or more of FGFR3-IIIb R248C , FGFR3-IIIb Y375C , FGFR3 -IIIb S249C , and FGFR3IIIb G372C and (c) a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- the cancer expresses (a) FGFR3-IIIb ⁇ ⁇ and (b) one or more of FGFR3-IIIb K652E , FGFR3-IIIb Y375C , FGFR3-IIIb S249C , and FGFR3-IIIb G372C and (c) a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- the cancer expresses (a) FGFR3-IIIb and (b) one or more of FGFR3-IIIb K652E , FGFR3-IIIb Y375C , FGFR3-IIIb S249C , and FGFRS-IIIb* 2480 and (c) a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- the cancer expresses (a) FGFR3-IIIb R248C , FGFR3-IIIb K652E , FGFR3-IIIb Y375C , FGFR3-IIIb S249C , and FGFR3-IIIb G372C , and (b) a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- the cancer expresses increased levels of phospho-FGFR3, phospho-FRS2 and/or phospho-MAPK relative to a control sample (e.g., a sample of normal tissue) or level and a FGFR2 as described above (e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2).
- a control sample e.g., a sample of normal tissue
- FGFR2 e.g. FGFR2, amplified FGFR2, translocated FGFR2, and/or mutated FGFR2
- the cancer expresses (e.g., on the cell surface) about 10,000 FGFR3 molecules per cell or more (such as 11,000, 12,000, 13,000, 14,000, 15,000, 16,000, 17,000, 18,000 or more FGFR3 receptors). In some embodiments, the cancer expresses about 13000 FGFR3 molecules.
- the cancer expresses about 5000, 6000, 7000, 8000, or more FGFR3 molecules. In some embodiments, the cancer expresses less than about 4000, 3000, 2000, 1000, or fewer FGFR3 molecules. In some embodiments, the cancer expresses less than about 1000 FGFR3 molecules. In some embodiments, the cancer expresses (e.g., on the cell surface) about 10,000 FGFR2 molecules per cell or more (such as 11,000, 12,000, 13,000, 14,000, 15,000, 16,000, 17,000, 18,000 or more FGFR2 receptors). In some embodiments, the cancer expresses about 13000 FGFR2 molecules.
- the cancer expresses about 5000, 6000, 7000, 8000, or more FGFR2 molecules. In some embodiments, the cancer expresses less than about 4000, 3000, 2000, 1000, or fewer FGFR2 molecules. In some embodiments, the cancer expresses less than about 1000 FGFR2 molecules. In some embodiments, the cancer expresses (e.g., on the cell surface) about 10,000 FGFR3 and 10,000 FGFR2 molecules per cell or more (such as 11 ,000, 12,000, 13,000, 14,000, 15,000, 16,000, 17,000, 18,000 or more FGFR3 receptors and 11,000, 12,000, 13,000, 14,000, 15,000, 16,000, 17,000, 18,000 or more FGFR2 receptors).
- the cancer expresses about 13000 FGFR3 molecules and 13000 FGFR2 molecules. In other embodiments, the cancer expresses about 5000, 6000, 7000, 8000, or more FGFR3 molecules and about 5000, 6000, 7000, 8000, or more FGFR2 molecules. In some embodiments, the cancer expresses less than about 4000, 3000, 2000, 1000, or fewer FGFR3 molecules and less than about 4000, 3000, 2000, 1000, or fewer FGFR2 molecules. In some embodiments, the cancer expresses less than about 1000 FGFR3 molecules and less than about 1000 FGFR2 molecules. In one embodiment, a cell that is targeted in a method of the invention is a cancer cell.
- a cancer cell can be one selected from the group consisting of a breast cancer cell, a colorectal cancer cell, a lung cancer cell (e.g., a non- small cell lung cancer cell), a thyroid cancer cell, a multiple myeloma cell, a testicular cancer cell, a papillary carcinoma cell, a colon cancer cell, a pancreatic cancer cell, an ovarian cancer cell, a cervical cancer cell, a central nervous system cancer cell, an osteogenic sarcoma cell, a renal carcinoma cell, a hepatocellular carcinoma cell, a bladder cancer cell (e.g., a transitional cell carcinoma cell), a gastric carcinoma cell, a head and neck squamous carcinoma cell, a melanoma cell, a leukemia cell, a multiple myeloma cell (e.g.
- a multiple myeloma cell comprising a t(4: 14) FGFR3 translocation)and a colon adenoma cell.
- a cell that is targeted in a method of the invention is a hyperproliferative and/or hyperplastic cell.
- a cell that is targeted in a method of the invention is a dysplastic cell.
- a cell that is targeted in a method of the invention is a metastatic cell.
- the invention provides methods for inhibiting cell proliferation in a subject, the method comprising administering to the subject an effective amount of an anti- FGFR2/3 antibody to reduce cell proliferation.
- the invention provides methods for killing a cell in a subject, the method comprising administering to the subject an effective amount of an anti-FGFR2/3 antibody to kill a cell.
- the cell is a multiple myeloma cell.
- the cell is killed by ADCC.
- the antibody is a naked antibody.
- the cell over-expresses FGFR3.
- the cell over-expresses FGFR2.
- the cell over-expresses FGFR3 and FGFR2.
- the invention provides methods for depleting cells (such as multiple myeloma cells) in a subject, the method comprising administering to the subject an effective amount of an anti-FGFR2/3 antibody to kill a cell.
- the cell is killed by ADCC.
- the antibody is a naked antibody.
- the cell over-expresses FGFR2/3.
- the invention provides methods for treating or preventing a skeletal disorder.
- the disorder is achondroplasia, hypochondroplasia, dwarfism, thantophoric dysplasia (TD; clinical forms TD1 and TDII), or craniosynostosis syndrome.
- Methods of the invention can further comprise additional treatment steps.
- a method further comprises a step wherein a targeted cell and/or tissue (e.g., a cancer cell) is exposed to radiation treatment or a chemotherapeutic agent.
- a targeted cell and/or tissue e.g., a cancer cell
- the invention provides methods comprising administration of an effective amount of an anti-FGFR2/3 antibody in combination with an effective amount of another therapeutic agent (such as an anti-angiogenesis agent, another antibody, a
- anti-FGFR2/3 antibodies are used in combinations with an anti-cancer agent or an anti-angiogenic agent to treat various neoplastic or non-neoplastic conditions.
- the anti-FGFR2/3 antibodies are used in combination with velcade, revlimid, tamoxifen, letrozole, exemestane, anastrozole, irinotecan, cetuximab, fulvestrant, vinorelbine, bevacizumab, vincristine, cisplatin, gemcitabine, methotrexate, vinblastine, carboplatin, paclitaxel, docetaxel, pemetrexed, 5- fluorouracil, doxorubicin, bortezomib, lenalidomide, dexamethasone, melphalin, prednisone, vincristine, and/or thalidomide.
- the combination therapy of the invention can be combined with additional therapeutic agents, such as chemotherapeutic agents, or additional therapies such as radiotherapy or surgery.
- additional therapeutic agents such as chemotherapeutic agents, or additional therapies such as radiotherapy or surgery.
- chemotherapeutic agents can be used in the combination therapy of the invention. Preferably those chemotherapeutic agents that are standard for the treatment of the specific indications will be used. Dosage or frequency of each therapeutic agent to be used in the combination is preferably the same as, or less than, the dosage or frequency of the corresponding agent when used without the other agent(s).
- the invention provides any of the anti-FGFR2/3 antibodies described herein, wherein the anti-FGFR2/3 antibody comprises a detectable label.
- the invention provides a complex of any of the anti-FGFR2/3 antibodies described herein and FGFR2/3.
- the complex is in vivo or in vitro.
- the complex comprises a cancer cell.
- the anti-FGFR2/3 antibody is detectably labeled.
- the present disclosure also provides antibodies that bind to beta-Klotho (KLB) and bispecific antibodies that bind to both KLB and FGFR2 and/or FGFR3 (the "FGFR2/3 + KLB bispecific antibody”), and methods of using the same.
- the FGFR2/3 + KLB bispecific antibody can be used to treat metabolic diseases and disorders including weight loss and improvement in glucose and lipid metabolism.
- the FGFR2/3 + KLB bispecific antibody can be used to treat metabolic disorders or diseases without a significant impact on the liver and without a significant loss in bone mass.
- the FGFR2/3 + KLB bispecific antibody is used to treat non-alcoholic steatohepatitis (NASH).
- NASH non-alcoholic steatohepatitis
- the bispecific antibody is an isolated antibody.
- the bispecific antibody can bind to both KLB and FGFR2, KLB and FGFR3, or all three of KLB, FGFR2, and FGFR3, wherein the antibody binds to the C-terminal domain of KLB.
- the bispecific antibody binds to a fragment of KLB including the amino acid sequence SSPTRLAVIPWGVRKLLRWVRRNYGDMDIYITAS (SEQ ID NO: 103).
- the bispecific antibody that binds KLB also binds to an epitope within a fragment of FGFR2 including the amino acid sequence
- the bispecific antibody that binds KLB also binds to an epitope within a fragment of FGFR3 including the amino acid sequence
- TRPERMDKKLLAVPAANTVRFRCPA (SEQ ID NO: 93) and IKLRHQQWSLVMES
- the bispecific antibody that binds KLB also binds to an epitope within a fragment of FGFR2 including the amino acid sequence
- TNTEKMEKRLHAVPAANTVKFRCPA (SEQ ID NO: 91) or YKVRNQHWSLIMES (SEQ ID NO: 92) and binds to an epitope within a fragment of FGFR3 including the amino acid sequence TRPERMDKKLLAVPAANTVRFRCPA (SEQ ID NO: 93) and
- the bispecific antibody that binds KLB also binds to an epitope within a fragment of FGFR2 having at least 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%), 98%), or 99% sequence identity or similarity with amino acid sequence
- the bispecific antibody that binds KLB also binds to an epitope within a fragment of FGFR3 having at least 50%, 60%, 70%, 80%, 90%, 95%, 96%), 97%), 98%), or 99% sequence identity or similarity with amino acid sequence
- the bispecific antibody that binds KLB also binds to an epitope within a fragment of FGFR2 having at least 50%, 60%, 70%, 80%, 90%, 95%, 96%o, 97%), 98%o, or 99% sequence identity or similarity with amino acid sequence
- TNTEKMEKRLHAVPAANTVKFRCPA (SEQ ID NO: 91) and/or YKVRNQHWSLIMES (SEQ ID NO: 92) and also binds to an epitope within a fragment of FGFR3 having at least 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% sequence identity or similarity with amino acid sequence TRPERMDKKLLAVPAANTVRFRCPA (SEQ ID NO: 93) and IKLRHQQWSLVMES (SEQ ID NO:94).
- the bispecific antibody that binds KLB also binds FGFR2 within the amino acid sequence range of 157 to 181 of SEQ ID NOs: 52 or 54. In certain embodiments, the bispecific antibody that binds KLB also binds FGFR2 within the amino acid sequence range of 207 to 220 of SEQ ID NOs: 52 or 54. In certain embodiments, the bispecific antibody that binds KLB also binds FGFR2 within the amino acid sequence range of 157 to 181 and 207 to 220 of SEQ ID NOs: 52 or 54.
- the bispecific antibody that binds KLB and FGFR2/3 inhibits constitutive FGFR2 and/or FGFR3 activity.
- the constitutive FGFR2/3 activity is ligand-dependent constitutive FGFR2/3 activity.
- the constitutive FGFR2/3 activity is ligand-independent constitutive FGFR2/3 activity. In certain embodiments, the constitutive FGFR2/3 activity is FGFR2 and FGFR3 activity.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure reduces blood glucose levels in vivo. In certain embodiments, an FGFR2/3 + KLB bispecific antibody of the present disclosure does not significantly affect bone density. In certain embodiments, an FGFR2/3 + KLB bispecific antibody of the present disclosure does not have a significant impact on the liver. In certain embodiments, an FGFR2/3 + KLB bispecific antibody of the present disclosure induces ERK and MEK phosphorylation in the liver at significantly lower levels than FGF21 induces. In certain embodiments, an FGFR2/3
- KLB bispecific antibody of the present disclosure binds to KLB with a K d from 10 " M to
- an FGFR2/3 + KLB bispecific antibody of the present disclosure can bind to FGFR2 and /or FGFR3 with a K d from 10 "8 M to 10 "13 M.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure binds to an epitope present on KLB.
- the present disclosure provides an FGFR2/3 + KLB bispecific antibody can bind the same epitope on KLB as an antibody shown in Figures 11A and 11B.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure can bind the same epitope as the 12A11 or the 8C5 antibody.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure can bind to an epitope within the C-terminal domain of KLB.
- the an FGFR2/3 + KLB bispecific antibody of the present disclosure can bind to a fragment of KLB consisting of the amino acid sequence
- the KLB arm of any of the FGFR2/3 + KLB bispecific antibodies of the present disclosure is an arm of any KLB antibody described in
- the FGFR2/3 arm of any of the FGFR2/3 + KLB bispecific antibodies of the present disclosure is an arm of any FGFR2/3 antibodies described herein.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure includes a first antibody, or antigen binding portion thereof, that includes a heavy chain variable region and a light chain variable region, where the heavy chain variable region includes amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 104, and the light chain variable region includes amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 105.
- the second antibody, or antigen binding portion thereof includes a heavy chain variable region and a light chain variable region, where the heavy chain variable region includes amino acids having a sequence that is at least 95% identical to a sequence set forth in column 2 of Table 1, and the light chain variable region includes amino acids having a sequence that is at least 95% identical to a sequence set forth in column 3 of Table 1.
- an anti-KLB/anti-FGFRl bispecific antibody of the present disclosure includes a first antibody, or antigen binding portion thereof, which includes a heavy chain region and a light chain region, where the heavy chain region includes amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO 106, and the light chain region includes amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 107.
- the second antibody, or antigen binding portion thereof includes a heavy chain region and a light chain region, where the heavy chain region includes amino acids having a sequence that is at least 95% identical to a sequence set forth in column 2 of Table 1, and the light chain region includes amino acids having a sequence that is at least 95% identical to a sequence set forth in column 3 of Table 1.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure includes a first anti-KLB antibody, or antigen binding portion thereof, that includes a heavy chain variable region and a light chain variable region, where the heavy chain variable region includes amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 104, and the light chain variable region includes amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 105; and the second anti-FGFR2/3 antibody, or antigen binding portion thereof, includes a heavy chain variable region and a light chain variable region, where the heavy chain variable region includes amino acids having a sequence that is at least 95% identical to a sequence set SEQ ID NO: 66, and the light chain variable region includes amino acids having a sequence that is at least 95% identical to a sequence set forth in SEQ ID NO: 82.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure includes a first anti-KLB antibody, or antigen binding portion thereof, that includes a heavy chain variable region and a light chain variable region, where the heavy chain variable region includes amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 106, and the light chain variable region includes amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 107; and the second anti-FGFR2/3 antibody, or antigen binding portion thereof, includes a heavy chain variable region and a light chain variable region, where the heavy chain variable region includes amino acids having a sequence that is at least 95% identical to a sequence set SEQ ID NO: 82, and the light chain variable region includes amino acids having a sequence that is at least 95% identical to a sequence set forth in SEQ ID NO: 66.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure includes a first anti-KLB antibody, or antigen binding portion thereof, that includes a heavy chain variable region and a light chain variable region, where the heavy chain variable region includes amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 106, and the light chain variable region includes amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 107; and the second anti-FGFR2/3 antibody, or antigen binding portion thereof, includes a heavy chain and a light chain, where the heavy chain includes amino acids having a sequence that is at least 95% identical to a sequence set SEQ ID NO: 282, and the light chain includes amino acids having a sequence that is at least 95% identical to a sequence set forth in SEQ ID NO: 283.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure includes a first anti-KLB antibody, or antigen binding portion thereof, that includes a heavy chain variable region and a light chain variable region, where the heavy chain variable region includes amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 106, and the light chain variable region includes amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 107; and the second anti-FGFR2/3 antibody, or antigen binding portion thereof, wherein the CDRs on the light chain, comprise amino acids having a sequence that are at least 90%, 91%, 92%, 93%, 94%, 95%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a SEQ ID NOs: 7-9 (CDRLl, CDRL2, and CDRL3), and wherein the CDRs on the heavy chain, comprise amino acids having a sequence that are at least 90%, 91%, 92%, 93%,
- an FGFR2/3 + KLB bispecific antibody of the present disclosure includes a first anti-KLB antibody, or antigen binding portion thereof, that includes a heavy chain variable region and a light chain variable region, where the heavy chain variable region includes amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 106, and the light chain variable region includes amino acids having a sequence that is at least 95% identical to the sequence set forth in SEQ ID NO: 107; and the second anti-FGFR2/3 antibody, or antigen binding portion thereof, wherein the CDRs on the light chain, comprise amino acids having a sequence that are at least 90%, 91%, 92%, 93%, 94%, 95%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a SEQ ID NOs: 276-278 (CDRL1, CDRL2, and CDRL3), and wherein the CDRs on the heavy chain, comprise amino acids having a sequence that are at least 90%>, 91%>, 92%, 9
- an FGFR2/3 + KLB bispecific antibody of the present disclosure includes a first anti-KLB antibody, or antigen binding portion thereof, comprising: (a) FJVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 230-232 and 236-247, (b) HVR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 123-137, and (c) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 142 and 248-262 .
- an FGFR2/3 + KLB bispecific antibody of the present disclosure includes a first anti-KLB antibody, or antigen binding portion thereof, comprising (a) FJVR-Hl comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 230-232 and 236-247, (b) HVR-H2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 142 and 248-262 , and (c) HVR-H3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 263-278.
- an FGFR2/3 + KLB bispecific bispecific antibody of the present disclosure includes a first anti-KLB antibody, or antigen binding portion thereof, comprising (a) HVR-Ll comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 279-293, (b) HVR-L2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 294-309, and (c) HVR-L3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 310-324.
- an FGFR2/3 + KLB bispecific bispecific antibody of the present disclosure includes a first anti-KLB antibody, or antigen binding portion thereof, comprising (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 119, (b) HVR- H2 comprising the amino acid sequence of SEQ ID NO: 150, (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 166, (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 181, (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 197, and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 212.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure includes a first anti-KLB antibody, or antigen binding portion thereof, comprising (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 122, (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 153, (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 169, (d) HVR-Ll comprising the amino acid sequence of SEQ ID NO: 184, (e) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 200, and (f) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 215.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure includes one arm from an anti-KLB antibody, or antigen binding portion thereof, selected from any of the anti-KLB antibodies disclosed herein or in US20150218276 which is incorporated herein in its entirety and one arm of an FGFR2/3 antibody disclosed herein.
- the arms of the FGFR2/3 + KLB bispecific are selected from the following combinations: a) One arm from the 8C5.K4.M4L.H3.KNV anti-KLB antibody (comprising SEQ ID NO: 104 (HCVR) and SEQ ID NO: 105 (LCVR)) and one arm from the 2B.1.3.12 anti-FGFR2/3 antibody (comprising SEQ ID NO: 82 (heavy chain) and SEQ ID NO: 66 (light chain)); b) One arm from the 8C5.K4.M4L.H3.KNV anti-KLB antibody (comprising SEQ ID NO: 106 (heavy chain) and SEQ ID NO: 107 (light chain)) and one arm from the 2B.1.3.12 anti-FGFR2/3 antibody (comprising SEQ ID NO: 82 (heavy chain) and SEQ ID NO: 66 (light chain)); c) One arm from the 8C5.K4.M4L.H3.KNV anti-KLB antibody
- NV anti-KLB antibody comprising SEQ ID NO: 104 (HCVR) and SEQ ID NO: 105 (LCVR)
- 2B.1.1.6 anti-FGFR2/3 antibody comprising SEQ ID NOs: 276-278 (CDRL1, CDRL2, and CDRL3) and SEQ ID NO: 279-281 (CDRH1, CDRH2, and CDRH3)
- SEQ ID NO: 276-278 CDRL1, CDRL2, and CDRL3
- SEQ ID NO: 279-281 CDRH1, CDRH2, and CDRH3
- 8C5.K4.M4L.H3.KNV anti-KLB antibody comprising SEQ ID NO:
- an FGFR2/3 + KLB bispecific antibody of the present disclosure includes a first anti-KLB antibody, or antigen binding portion thereof, comprising (a) a heavy chain variable region comprising the amino acid sequence of SEQ ID NO: 104 and (b) a light chain variable region comprising the amino acid sequence of SEQ ID NO: 105.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure includes a first anti-KLB antibody, or antigen binding portion thereof, comprising (a) a heavy chain comprising the amino acid sequence of SEQ ID NO: 106 and (b) a light chain comprising the amino acid sequence of SEQ ID NO: 107.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure includes a first anti-KLB antibody, or antigen binding portion thereof, comprising (a) a heavy chain variable region having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 104; (b) a light chain variable region having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 105; and (c) a heavy chain variable region as in (a) and a light chain variable region as in (b).
- FGFR2/3 + KLB bispecific antibody of the present disclosure is a monoclonal antibody.
- the antibody is a human, humanized, or chimeric antibody.
- the antibody has reduced effector function.
- the present disclosure provides an isolated nucleic acid encoding an amino acid sequence of SEQ ID NO: 104; (b) a light chain variable region having at least 95% sequence identity to the amino acid sequence of SEQ ID NO: 105; and (c) a heavy chain variable region as in (a) and a light chain
- the present disclosure provides a host cell comprising a nucleic acid encoding an FGFR2/3 + KLB bispecific antibody of the present disclosure.
- the present disclosure provides a method of producing an FGFR2/3 + KLB bispecific antibody comprising culturing a host cell of the present disclosure so that the antibody is produced. In certain embodiments, this method further comprises recovering the FGFR2/3 + KLB bispecific antibody from the host cell.
- the present disclosure further provides a pharmaceutical formulation that includes one or more antibodies of the invention and a pharmaceutically acceptable carrier.
- the present disclosure provides a pharmaceutical formulation that includes an FGFR2/3 + KLB bispecific antibody described herein.
- the pharmaceutical formulation comprises an additional therapeutic agent.
- the present disclosure provides an FGFR2/3 + KLB bispecific antibody of the invention for use as a medicament.
- the an anti- KLB/anti-FGFRl bispecific antibody is for use in treating metabolic disorders, e.g., polycystic ovary syndrome (PCOS), metabolic syndrome (MetS), obesity, non-alcoholic steatohepatitis (NASH), non-alcoholic fatty liver disease (NAFLD), hyperlipidemia, hypertension, type 2 diabetes, non-type 2 diabetes, type 1 diabetes, latent autoimmune diabetes (LAD), and maturity onset diabetes of the young (MODY).
- an FGFR2/3 + KLB bispecific antibody is for use in treating type 2 diabetes.
- an FGFR2/3 + KLB bispecific antibody is for use in treating obesity.
- the present disclosure provides an an FGFR2/3 + KLB bispecific antibody for use in treating Bardet-Biedl syndrome, Prader-Willi syndrome, Alstrom syndrome, Cohen syndrome, Albright's hereditary osteodystrophy
- the an FGFR2/3 + KLB bispecific antibody is for use in treating NASH.
- the present disclosure provides the use of an FGFR2/3 + KLB bispecific antibody, disclosed herein, in the manufacture of a medicament for treatment of metabolic disorders, e.g., polycystic ovary syndrome (PCOS), metabolic syndrome (MetS), obesity, non-alcoholic steatohepatitis (NASH), non-alcoholic fatty liver disease (NAFLD), hyperlipidemia, hypertension, type 2 diabetes, non-type 2 diabetes, type 1 diabetes, latent autoimmune diabetes (LAD), and maturity onset diabetes of the young (MODY), and aging and related diseases such as Alzheimer's disease, Parkinson's disease and ALS.
- the metabolic disorder is type 2 diabetes.
- the metabolic disorder is NASH.
- the present disclosure provides a method of treating an individual having a disease selected from the group consisting of polycystic ovary syndrome (PCOS), metabolic syndrome (MetS), obesity, non-alcoholic steatohepatitis (NASH), non-alcoholic fatty liver disease (NAFLD), hyperlipidemia, hypertension, type 2 diabetes, non-type 2 diabetes, type 1 diabetes, latent autoimmune diabetes (LAD), and maturity onset diabetes of the young (MODY), and aging and related diseases such as Alzheimer's disease, Parkinson's disease and ALS, the method comprising administering to the individual an effective amount of one or more FGFR2/3 + KLB bispecific antibodies of the present disclosure.
- the disease is diabetes, e.g., type 2 diabetes.
- the disease is obesity.
- the present disclosure provides a method of treating an individual having a disease and/or disorder selected from the group consisting of Bardet-Biedl syndrome, Prader-Willi syndrome, Alstrom syndrome, Cohen syndrome, Albright's hereditary osteodystrophy (pseudohypoparathyroidism), Carpenter syndrome, MOMO syndrome, Rubinstein-Taybi syndrome, fragile X syndrome and Borjeson-Forssman- Lehman syndrome, the method comprising administering to the individual an effective amount of one or more FGFR2/3 + KLB bispecific antibodies of the present disclosure. In certain embodiments, the method further includes administering an additional therapeutic agent to the individual.
- a method using one or more FGFR2/3 + KLB bispecific antibodies of the present disclosure does not affect liver function in an individual.
- the present disclosure provides a method for inducing weight loss comprising administering to an individual an effective amount of one or more antibodies of the present disclosure.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure can be used as a medicament and includes one arm from an anti-KLB antibody, or antigen binding portion thereof, selected from any of the anti-KLB antibodies disclosed herein or in US20150218276 which is incorporated herein in its entirety and one arm of an FGFR2/3 antibody disclosed herein.
- the arms of the FGFR2/3 + KLB bispecific antibody that can be used as a medicament are selected from the following combinations: a) One arm from the 8C5.K4.M4L.H3.KNV anti-KLB antibody (comprising SEQ ID NO: 104 (HCVR) and SEQ ID NO: 105 (LCVR)) and one arm from the 2B.1.3.12 anti-FGFR2/3 antibody (comprising SEQ ID NO: 82 (heavy chain) and SEQ ID NO: 66 (light chain)); b) One arm from the 8C5.K4.M4L.H3.KNV anti-KLB antibody (comprising SEQ ID NO: 106 (heavy chain) and SEQ ID NO: 107 (light chain)) and one arm from the 2B.1.3.12 anti-FGFR2/3 antibody (comprising SEQ ID NO: 82 (heavy chain) and SEQ ID NO: 66 (light chain)); c) One arm from the 8C5.K4.M4L.
- NV anti-KLB antibody comprising SEQ ID NO: 106 (heavy chain) and SEQ ID NO: 107 (light chain)
- 1.6 anti-FGFR2/3 antibody comprising SEQ ID NOs: 276-278 (CDRL1, CDRL2, and CDRL3) and SEQ ID NO: 279-281 (CDRH1, CDRH2, and CDRH3)).
- an FGFR2/3 + KLB bispecific antibody of the present disclosure can be used to treat a metabolic disease (e.g., NASH or a related disease) and includes one arm from an anti-KLB antibody, or antigen binding portion thereof, selected from any of the anti-KLB antibodies disclosed herein or in US20150218276 which is incorporated herein in its entirety and one arm of an FGFR2/3 antibody disclosed herein.
- a metabolic disease e.g., NASH or a related disease
- an anti-KLB antibody, or antigen binding portion thereof selected from any of the anti-KLB antibodies disclosed herein or in US20150218276 which is incorporated herein in its entirety and one arm of an FGFR2/3 antibody disclosed herein.
- the arms of the FGFR2/3 + KLB bispecific antibody that can be used to treat a metabolic disease are selected from the following combinations: a) One arm from the 8C5.K4.M4L.H3.KNV anti-KLB antibody (comprising SEQ ID NO: 104 (HCVR) and SEQ ID NO: 105 (LCVR)) and one arm from the 2B.1.3.12 anti-FGFR2/3 antibody (comprising SEQ ID NO: 82 (heavy chain) and SEQ ID NO: 66 (light chain)); b) One arm from the 8C5.K4.M4L.H3.KNV anti-KLB antibody (comprising SEQ ID NO: 106 (heavy chain) and SEQ ID NO: 107 (light chain)) and one arm from the 2B.1.3.12 anti-FGFR2/3 antibody (comprising SEQ ID NO: 82 (heavy chain) and SEQ ID NO: 66 (light chain));
- FIGURE 1 shows the inhibitory effects of engineered 2B.1 antibodies for FGF7- stimulated MCF-7 cell proliferation. Error bars represent SEM.
- FIGURES 2A-2C show the crystal structure of the complex between FGFR2 D2 domain and the Fab fragment of Mab 2B.1.3.
- Figure 2A shows the overall structure of the complex.
- FGFR2-D2 was colored as magenta, the heavy chain of the Fab 2B.1.3 green and the light chain blue.
- Figure 2B shows the overlay of the structures of FGFR2-D2:2B.1.3 and FGFR3-D2D3:R3Mab.
- the former complex was colored the same as in Figure 2A.
- FGFR3- D2D3 was colored in yellow, and R3Mab gray.
- Figure 2C shows the zoom-in representation of the boxed area in Figure 2B showing the structural differences between the two complexes. Color scheme is the same as in Figure 2B.
- FIGURES 3A-3D show the differential blocking of FGF ligands by R3Mab variants.
- Figure 3 A shows the blocking of FGF-7 binding to human FGFR2-IIIb.
- Figure 3B shows the blocking of FGF- 1 binding to human FGFR2-IIIc.
- Figure 3C shows the blocking of FGF- 1 binding to human FGFR3-IIIb.
- Figure 3D shows the blocking of FGF- 1 binding to human FGFR3-IIIc.
- Figure 3E shows the blocking of FGF-19 binding to human FGFR4.
- FIGURES 4A-4C show that the 2B.1 variants inhibit FGFR2 signaling in vitro and suppress in vivo xenograft growth.
- Figure 4A shows the blocking of FGF7-stimulated FGFR2 signaling by 2B.1 variants in gastric cancer cell line SNU-16.
- Figure 4B shows the effect of 2B .1.3.10 and 2B .1.3.12 on the growth of FGFR2-dependent SNU- 16 xenografts compared to control antibody.
- Figure 4C shows the effects of 2B.1.3.10 and 2B.1.3.12 on the growth of FGFR3 -dependent RT112 bladder cancer xenografts.
- FIGURE 5 shows the surface areas on FGFR3-IIIb contacted by R3Mab (PDB 3GRW).
- the surface of the D2 and D3 domains of FGFR3-IIIb is shown in gray.
- the contact areas by individual CDR loops of R3Mab are colored.
- the contact areas by each CDR and their percentages of overall contact areas are labeled as numbers in parentheses.
- FIGURE 6 shows the sequence logo of CDR H2 from phage libraries selected for binding to FGFR2-IIIb prepared using Weblogo 3 (Crooks, G. E., G. Hon, J. M. Chandonia and S. E. Brenner (2004). "Web Logo: a sequence logo generator.” Genome Res 14(6): 1188- 1190).
- FIGURE 7 shows the overall structural alignment of the complexes of FGFR2- D2:2B.1.3 and FGFR3-D2D3 :R3Mab.
- FIGURE 8A show blocking of FGF7-stimulated FGFR2 signaling by 2B.1 variants in breast cancer cell line MFM-223x2.2.
- FIGURE 8B shows the effects of 2B.1.3.10 and
- FIGURES 9A-9D shows the epitopes of the 2B.1.3.10 (i.e., 1.3.10) and 2B.1.3.12 (i.e., 1.3.12) anti-FGFR2/3 antibodies.
- Figure 9A shows the FGFR2-IIIb sequence and the epitopes of the anti-FGFR2/3 1.3.10 and 1.3.12 antibodies are underlined and in bold.
- Figure 9B shows the FGFR2-IIIc sequence and the epitopes of the anti-FGFR2/3 1.3.10 and 1.3.12 antibodies are underlined and in bold.
- Figure 9C shows the FGFR3-IIIb sequence and the epitopes of the anti-FGFR2/3 1.3.10 and 1.3.12 antibodies are underlined and in bold.
- Figure 9D shows the FGFR3-IIIc sequence and the epitopes of the anti-FGFR2/3 1.3.10 and 1.3.12 antibodies are underlined and in bold.
- Antibody 2B.1.3.10 binds to epitopes on FGFR2 that are composed of two beta-strands with residue numbers of 157-181 and 207-220 according to SEQ ID NOs: 52 and 54 (see also SEQ ID NOs: 91 and 92 for epitope sequences).
- Antibody 2B.1.3.10 also binds to epitopes on FGFR3 that are composed of two beta-strands with residue numbers of 154-178 and 204-217 according to SEQ ID NOs: 56 and 58 (see also SEQ ID NOs: 93 and 94 for epitope sequences).
- 2B.1.3.12 binds to the same epitopes as 2B.1.3.10. In particular, 2B.1.3.12 binds to the epitope on FGFR2 that is composed of two beta-strands with residue numbers of 157-181 and 207-220. 2B.1.3.12 also binds to an epitope on FGFR3 that is composed of two beta-strands with residue numbers of 154-178 and 204-217.
- FIGURE 10 shows a chart of the nucleic acid and amino acid SEQ ID NOs corresponding to anti-FGFR2/3 antibodies 1.3, 1.95, 1.73, 1.32, 1.88, 1.1, 1.3.10, and 1.3.12.
- Figure 11A depicts the light chain variable region sequences for 17 anti-KLB antibodies.
- the CDR LI sequences are, in order, SEQ ID NOs: 279-293; the CDR L2 sequences are, in order, SEQ ID NOs: 294-309; and the CDH L3 sequences are, in order, SEQ ID NOs: 123-137.
- the light chain variable region sequences are, in order, SEQ ID NOs: 111-127.
- Figure 1 IB depicts the heavy chain variable region sequences for 17 anti-KLB antibodies.
- the CDR HI sequences for the antibodies are, in order (11F1-8C5), SEQ ID NOs: 230-232 and 236-247; the CDR H2 sequences are, in order, SEQ ID NOs: 142 and 248- 262 ; the CDR H3 sequences are, in order, SEQ ID NOs: 263-278.
- the heavy chain variable region sequences for the antibodies are, in order, SEQ ID NOs: 216-232.
- Figure 12 depicts the median shift observed in the FACS plot at 0.8 ⁇ g/ml measuring binding of various anti-KLB antibodies to 293 cells expressing hKLB.
- Figure 13 depicts the relative binding of various anti-KLB antibodies to hKLB-ECD- HIS protein.
- Figure 14A shows the N-terminal amino acid sequence of mouse KLB protein (SEQ ID NO: 165), and the corresponding amino acid sequence encoded by the Klb allele in the
- KO mice (SEQ ID NO: 166) are shown. A missense mutation in Klb gene results in a frame- shift after the second amino acid in the KO allele, as shown with red letters.
- Figure 14B shows KLB protein expression in epididymal white adipose tissue in wildtype (+/+) and KLB knockout (-/-) mice.
- Figure 14C shows that KLB is important for BsAb20 to affect glucose metabolism.
- Figures 15A and 15B show detection of human FGFR2 (Figure 15 A) and FGFR3 ( Figure 15B) in SNU-16 xenograft tumors.
- Tumor samples were lysed and subjected to Western blot analysis for human FGFR2 and FGFR3 proteins.
- Tumors collected from the current study showed signal for FGFR3 ( Figure 15B, Lane 5-24).
- tumors collected from a previous SNU-16 study Figure 15B, Lane 3
- the in vz ' tro-cultured SNU- 16 cells Figure B, Lane 4
- Figures collected from a previous SNU-16 study Figure 15B, Lane 3
- the in vz ' tro-cultured SNU- 16 cells Figure B, Lane 4
- Figure B Lane 4
- Figures 16A-16C shows seven 2B1.1 variants that were expressed and tested for agonist activity and FGFR2, FGFR3, and FGFR4 binding.
- Figure 16A shows a chart detailing the anti-FGFR2/3 antibody variant, the sequence of the CDR H1-H3 of each variant, and the FGFR3 affinity measured by Biacor assays and ELISA.
- Figure 16B shows binding affinity for FGFR3 of the variants as measured by ELISA.
- Figure 16C shows binding affinity for FGFR4 of the variants as measured by ELISA.
- Figures 17A and 17B show a comparison of anti-FGFR2/3 antibody variant activity against the FGFRs using a luciferase assay.
- Figure 17A shows FGFR3 and FGFR4 activity.
- Figure 17B shows FGFR2 and FGFR1 activity.
- Figure 18 shows the anti-FGFR2/3 antibody variant decision matrix used for selecting which anti-FGFR2/3 antibody should be used for the FGFGR2/3 + KLB bispecific antibody.
- Figures 19A-19C show FGFR activity of selected anti-FGFR2/3 antibody variants.
- Figure 19A shows FGFR3 activity.
- Figure 19B shows FGFR2 activity.
- Figure 19C shows FGFR4 activity.
- Fibroblast growth factors and their tyrosine kinase receptors (FGFRs) play key roles in regulating specific pathways during embryonic development, as well as homeostasis of diverse tissues, wound healing processes and certain metabolic functions in the adult animal.
- FGFs Fibroblast growth factors
- FGFRs tyrosine kinase receptors
- the FGFRs comprise an extracellular region with 3
- Dysregulated signaling by FGFRs 1-4 is associated with pathogenesis in several cancer types (L'Hote, C.G., and Knowles, M.A. 2005. Cell responses to FGFR3 signalling: growth, differentiation and apoptosis. Exp Cell Res 304:417-431; Dailey, L., Ambrosetti, D., Mansukhani, A., and Basilico, C. 2005. Mechanisms underlying differential responses to FGF signaling. Cytokine Growth Factor Rev 16:233-247). Genomic FGFR alterations, which include gene amplification, chromosomal translocation and activating mutations, can drive aberrant activation of the FGF pathway and promote neoplastic transformation of normal cells.
- FGFR2 gene amplification occurs in -10% of gastric and -4% of triple-negative breast cancers (Chesi, M., Nardini, E., Brents, L.A., Schrock, E., Ried, T., Kuehl, W.M., and Bergsagel, P.L. 1997. Frequent translocation t(4; 14)(pl6.3;q32.3) in multiple myeloma is associated with increased expression and activating mutations of fibroblast growth factor receptor 3.
- Recurrent 14q32 translocations determine the prognosis of multiple myeloma, especially in patients receiving intensive chemotherapy. Blood 100: 1579-1583), while FGFR3 amplification is associated with specific subsets of bladder cancer (Moreau, P., Facon, T., Leleu, X., Morineau, N., Huyghe, P., Harousseau, J.L., Bataille, R., and Avet-Loiseau, H. 2002. Recurrent 14q32 translocations determine the prognosis of multiple myeloma, especially in patients receiving intensive chemotherapy.
- the phosphotyrosine phosphatase SHP2 is a critical mediator of transformation induced by the oncogenic fibroblast growth factor receptor 3. Oncogene 22:6909-6918). Specifically, amino-acid substitutions in the linker region between D2 and D3, e.g. S252W in FGFR2 and S249C in FGFR3, augment FGF-driven signaling and tumor-cell proliferation and represent hot spots for somatic mutation (Agazie, Y.M., Movilla, N., Ischenko, I., and Hayman, M.J. 2003. The phosphotyrosine phosphatase SHP2 is a critical mediator of transformation induced by the oncogenic fibroblast growth factor receptor 3.
- Activating mutations also occur in the tyrosine kinase region of FGFRs (Chesi, M., Brents, L.A., Ely, S.A., Bais, C, Robbiani, D.F., Mesri, E.A., Kuehl, W.M., and Bergsagel, P.L. 2001.
- Activated fibroblast growth factor receptor 3 is an oncogene that contributes to tumor progression in multiple myeloma. Blood 97:729-736).
- TKIs small-molecule tyrosine kinase inhibitors
- blocking antibodies blocking antibodies
- ligand traps ligand traps
- FGFR2 Trudel, S., Li, Z.H., Wei, E., Wiesmann, M., Chang, H., Chen, C, Reece, D., Heise, C, and Stewart, A.K. 2005. CHIR-258, a novel, multitargeted tyrosine kinase inhibitor for the potential treatment of t(4; 14) multiple myeloma.
- the previously described monospecific anti-FGFR3 antibody R3Mab effectively blocks binding of FGFl and FGF9 to both the Illb and IIIc isoforms of wild-type FGFR3, as well as to certain cancer-associated mutant forms of FGFR3 (Chen, J., Lee, B.H., Williams, I.R., Kutok, J.L., Mitsiades, C.S., Duclos, N., Cohen, S., Adelsperger, J., Okabe, R., Coburn, A., et al. 2005. FGFR3 as a therapeutic target of the small molecule inhibitor PKC412 in hematopoietic malignancies.
- Br J Haematol 124:595-603 X-ray structural analysis revealed that R3Mab binds to a specific epitope on FGFR3 that is required for ligand binding.
- R3Mab displayed potent antitumor activity in mice against human bladder cancer and multiple myeloma tumor xenografts.
- structure-guided phage display was used iteratively to re-engineer R3Mab into derivative antibodies that carry dual specificity for FGFR3 and FGFR2 while sparing FGFR1 and FGFR4.
- the practical aim of this study was to broaden the potential therapeutic scope beyond that of the parent molecule while avoiding added safety risks.
- the re-engineered antibodies displayed inhibition of FGF-stimulated tumor-cell growth in vitro and significant efficacy against human cancer xenografts overexpressing FGFR2 or FGFR3 in vivo.
- the invention herein provides anti-FGFR2/3 antibodies that are useful for, e.g., treatment or prevention of disease states associated with expression and/or activity of FGFR2 and/or FGFR3, such as increased expression and/or activity or undesired expression and/or activity.
- the invention herein provides anti-FGFR2/3 antibodies that are useful for, e.g., treatment or prevention of disease states associated with expression and/or activity of FGFR2 and FGFR3, such as increased expression and/or activity or undesired expression and/or activity.
- the antibodies of the invention are used to treat a tumor, a cancer, and/or a cell proliferative disorder.
- the anti-FGFR2/3 antibodies of the invention find utility as reagents for detection and/or isolation of FGFR2 and/or FGFR3, such as detection of FGFR3 in various tissues and cell type.
- the anti-FGFR2/3 antibodies of the invention find utility as reagents for detection and/or isolation of FGFR2 and FGFR3, such as detection of FGFR2 and FGFR3 in various tissues and cell type.
- the invention further provides methods of making and using anti-FGFR2/3 antibodies, and polynucleotides encoding anti-FGFR2/3 antibodies.
- an “isolated” antibody is one which has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials which would interfere with diagnostic or therapeutic uses for the antibody, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes.
- the antibody will be purified (1) to greater than 95% by weight of antibody as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE (sodium dodecyl sulfate polyacrylamide gel electrophoresis) under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain.
- Isolated antibody includes the antibody in situ within recombinant cells since at least one component of the antibody's natural environment will not be present. Ordinarily, however, isolated antibody will be prepared by at least one purification step.
- an "antibody that competes for binding” with a reference antibody refers to an antibody that blocks binding of the reference antibody to its antigen in a competition assay by 50% or more, and conversely, the reference antibody blocks binding of the antibody to its antigen in a competition assay by 50% or more.
- An exemplary competition assay is described in "Antibodies,” Harlow and Lane (Cold Spring Harbor Press, Cold Spring Harbor, NY).
- the "class" of an antibody refers to the type of constant domain or constant region possessed by its heavy chain.
- the heavy chain constant domains that correspond to the different classes of immunoglobulins are called ⁇ , ⁇ , ⁇ , ⁇ , and ⁇ , respectively.
- cytotoxic agent refers to a substance that inhibits or prevents a cellular function and/or causes cell death or destruction.
- Cytotoxic agents include, but are not limited to, radioactive isotopes (e.g., At 21 1 , 1 131 , 1 125 , Y 90 , Re 186 , Re 188 , Sm 153 , Bi 212 , P 32 , Pb 212 and radioactive isotopes of Lu); chemotherapeutic agents or drugs (e.g., methotrexate, adriamicin, vinca alkaloids (vincristine, vinblastine, etoposide), doxorubicin, melphalan, mitomycin C, chlorambucil, daunorubicin or other intercalating agents); growth inhibitory agents; enzymes and fragments thereof such as nucleolytic enzymes; antibiotics; toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal
- an “effective amount” of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic or prophylactic result.
- an “effective amount” can refer to an amount of an antibody, disclosed herein, that is able to alleviate, minimize and/or prevent the symptoms of the disease and/or disorder, prolong survival and/or prolong the period until relapse of the disease and/or disorder.
- full length antibody “intact antibody,” and “whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region as defined herein.
- host cell refers to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells.
- Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
- An "individual” or “subject,” as used interchangeably herein, is a mammal.
- Mammals include, but are not limited to, domesticated animals (e.g., cows, sheep, cats, dogs, and horses), primates (e.g., humans and non-human primates such as monkeys), rabbits, and rodents (e.g., mice and rats).
- domesticated animals e.g., cows, sheep, cats, dogs, and horses
- primates e.g., humans and non-human primates such as monkeys
- rabbits e.g., mice and rats
- rodents e.g., mice and rats.
- the individual or subject is a human.
- the term "monoclonal antibody,” as used herein, refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e. , the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts.
- polyclonal antibody preparations typically include different antibodies directed against different determinants (epitopes)
- each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen.
- the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
- the monoclonal antibodies to be used in accordance with the presently disclosed subject matter may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
- naked antibody refers to an antibody that is not conjugated to a heterologous moiety (e.g., a cytotoxic moiety) or radiolabel.
- the naked antibody may be present in a pharmaceutical formulation.
- Native antibodies refer to naturally occurring immunoglobulin molecules with varying structures.
- native IgG antibodies are heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light chains and two identical heavy chains that are disulfide-bonded. From N- to C-terminus, each heavy chain has a variable region (VH), also called a variable heavy domain or a heavy chain variable domain, followed by three constant domains (CHI , CH2, and CH3). Similarly, from N- to C-terminus, each light chain has a variable region (VL), also called a variable light domain or a light chain variable domain, followed by a constant light (CL) domain.
- VH variable region
- VL variable region
- the light chain of an antibody may be assigned to one of two types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequence of its constant domain.
- package insert refers to instructions customarily included in commercial packages of therapeutic products, that contain information about the indications, usage, dosage, administration, combination therapy, contraindications and/or warnings concerning the use of such therapeutic products.
- an "isolated" nucleic acid molecule is a nucleic acid molecule that is identified and separated from at least one contaminant nucleic acid molecule with which it is ordinarily associated in the natural source of the nucleic acid.
- An isolated nucleic acid molecule is other than in the form or setting in which it is found in nature. Isolated nucleic acid molecules therefore are distinguished from the nucleic acid molecule as it exists in natural cells.
- an isolated nucleic acid molecule includes a nucleic acid molecule contained in cells that ordinarily express the nucleic acid (for example, an antibody encoding nucleic acid) where, for example, the nucleic acid molecule is in a chromosomal location different from that of natural cells.
- isolated nucleic acid encoding an antibody refers to one or more nucleic acid molecules encoding antibody heavy and light chains (or fragments thereof), including such nucleic acid molecule(s) in a single vector or separate vectors, and such nucleic acid molecule(s) present at one or more locations in a host cell.
- variable domain residue numbering as in Kabat or "amino acid position numbering as in Kabat,” and variations thereof, refers to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991). Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain.
- a heavy chain variable domain may include a single amino acid insert (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g. residues 82a, 82b, and 82c, etc according to Kabat) after heavy chain FR residue 82.
- the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard" Kabat numbered sequence.
- the difference between said two values is preferably less than about 50%, preferably less than about 40%, preferably less than about 30%>, preferably less than about 20%>, preferably less than about 10% as a function of the value for the reference/comparator antibody.
- Binding affinity generally refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, "binding affinity” refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
- the affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd).
- the Kd is 1 x 10 "7 , 1 x 10 ⁇ 8 , 5 x 10 ⁇ 8 , 1 x 10 ⁇ 9 , 3 x 10 ⁇ 9 , 5 x 10 "9 , or even 1 x 10 "10 or higher affinity.
- Affinity can be measured by common methods known in the art, including those described herein. Low- affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high- affinity antibodies generally bind antigen faster and tend to remain bound longer. A variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present invention. Specific illustrative embodiments are described in the following.
- the "Kd" or "Kd value" according to this invention is measured by a radiolabeled antigen binding assay (RIA) performed with the Fab version of an antibody of interest and its antigen as described by the following assay that measures solution binding
- RIA radiolabeled antigen binding assay
- microtiter plates (Dynex) are coated overnight with 5 ⁇ g/ml of a capturing anti-Fab antibody (Cappel Labs) in 50 mM sodium carbonate (pH 9.6), and subsequently blocked with 2% (w/v) bovine serum albumin in PBS for two to five hours at room temperature (approximately 23°C).
- a capturing anti-Fab antibody Cappel Labs
- bovine serum albumin in PBS for two to five hours at room temperature (approximately 23°C).
- a non-adsorbant plate (Nunc #269620)
- Fab-12 100 pM or 26 pM [ I] -antigen are mixed with serial dilutions of a Fab of interest (e.g., consistent with assessment of an anti-VEGF antibody, Fab-12, in Presta et al., (1997) Cancer Res. 57:4593-4599).
- the Fab of interest is then incubated overnight; however, the incubation may continue for a longer period (e.g., 65 hours) to insure that equilibrium is reached.
- the Kd or Kd value is measured by using surface plasmon resonance assays using a BIAcoreTM-2000 or a BIAcoreTM-3000 (BIAcore, Inc., Piscataway, NJ) at 25°C with immobilized antigen CM5 chips at -10 response units (RU).
- CM5 carboxymethylated dextran biosensor chips
- EDC N-ethyl-N'- (3- dimethylaminopropyl)-carbodiimide hydrochloride
- NHS N-hydroxysuccinimide
- the following modifications are used for the surface Plasmon resonance assay method: antibody is immobilized to CM5 biosensor chips to achieve approximately 400 RU, and for kinetic measurements, two-fold serial dilutions of target protein (e.g., FGFR3-IIIb or -IIIc) (starting from 67 nM) are injected in PBST buffer at 25°C with a flow rate of about 30 ul/minute. Association rates (k on ) and dissociation rates (k off ) are calculated using a simple one-to-one Langmuir binding model (BIAcore Evaluation Software version 3.2) by simultaneous fitting the association and dissociation sensorgram.
- target protein e.g., FGFR3-IIIb or -IIIc
- Association rates (k on ) and dissociation rates (k off ) are calculated using a simple one-to-one Langmuir binding model (BIAcore Evaluation Software version 3.2) by simultaneous fitting the association and dissociation sensorgram.
- a spectrometer such as a
- CM5 chips CM5 chips
- RU -10 response units
- carboxymethylated dextran biosensor chips CM5, BIAcore Inc.
- EDC N-ethyl- N'- (3-dimethylaminopropyl)-carbodiimide hydrochloride
- NHS N-hydroxysuccinimide
- Antigen is diluted with lOmM sodium acetate, pH 4.8, into 5 ⁇ g/ml ( ⁇ 0.2uM) before injection at a flow rate of 5 ⁇ 1/ ⁇ to achieve approximately 10 response units (RU) of coupled protein. Following the injection of antigen, 1M ethanolamine is injected to block unreacted groups. For kinetics measurements, two-fold serial dilutions of Fab (0.78 iiM to 500 iiM) are injected in PBS with 0.05% Tween 20 (PBST) at 25°C at a flow rate of approximately 25 ⁇ 1/ ⁇ .
- PBST Tween 20
- the following modifications are used for the surface Plasmon resonance assay method: antibody is immobilized to CM5 biosensor chips to achieve approximately 400 RU, and for kinetic measurements, two-fold serial dilutions of target protein (e.g., FGFR3-IIIb or -IIIc) (starting from 67 iiM) are injected in PBST buffer at 25°C with a flow rate of about 30 ul/minute. Association rates (k on ) and dissociation rates (k off ) are calculated using a simple one-to-one Langmuir binding model (BIAcore Evaluation Software version 3.2) by simultaneous fitting the association and dissociation sensorgram.
- target protein e.g., FGFR3-IIIb or -IIIc
- Association rates (k on ) and dissociation rates (k off ) are calculated using a simple one-to-one Langmuir binding model (BIAcore Evaluation Software version 3.2) by simultaneous fitting the association and dissociation sensorgram.
- a spectrometer such
- vector is intended to refer to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked.
- plasmid refers to a circular double stranded DNA loop into which additional DNA segments may be ligated.
- phage vector Another type of vector is a viral vector, wherein additional DNA segments may be ligated into the viral genome.
- viral vector is capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors).
- vectors e.g., non-episomal mammalian vectors
- vectors can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.
- certain vectors are capable of directing the expression of genes to which they are operatively linked.
- Such vectors are referred to herein as "recombinant expression vectors” (or simply, “recombinant vectors”).
- expression vectors of utility in recombinant DNA techniques are often in the form of plasmids.
- plasmid and “vector” may be used interchangeably as the plasmid is the most commonly used form of vector.
- Polynucleotide or “nucleic acid,” as used interchangeably herein, refer to polymers of nucleotides of any length, and include DNA and RNA.
- the nucleotides can be
- a polynucleotide may comprise modified nucleotides, such as methylated nucleotides and their analogs. If present, modification to the nucleotide structure may be imparted before or after assembly of the polymer.
- the sequence of nucleotides may be interrupted by non-nucleotide components.
- a polynucleotide may be further modified after synthesis, such as by conjugation with a label.
- modifications include, for example, "caps,” substitution of one or more of the naturally occurring nucleotides with an analog, internucleotide modifications such as, for example, those with uncharged linkages (e.g., methyl phosphonates, phosphotriesters, phosphoamidates, carbamates, etc.) and with charged linkages (e.g., phosphorothioates, phosphorodithioates, etc.), those containing pendant moieties, such as, for example, proteins (e.g., nucleases, toxins, antibodies, signal peptides, ply-L-lysine, etc.), those with intercalators (e.g., acridine, psoralen, etc.), those containing chelators (e.g., metals, radioactive metals, boron, oxidative metals, etc.), those containing alkylators, those with modified linkages (e.g., alpha anomeric nucleic acids, etc.), as well
- any of the hydroxyl groups ordinarily present in the sugars may be replaced, for example, by phosphonate groups, phosphate groups, protected by standard protecting groups, or activated to prepare additional linkages to additional nucleotides, or may be conjugated to solid or semi-solid supports.
- the 5 ' and 3 ' terminal OH can be phosphorylated or substituted with amines or organic capping group moieties of from 1 to 20 carbon atoms.
- Other hydroxyls may also be derivatized to standard protecting groups.
- Polynucleotides can also contain analogous forms of ribose or deoxyribose sugars that are generally known in the art, including, for example, 2'-0-methyl-, 2'-0-allyl, 2'-fluoro- or 2'-azido-ribose, carbocyclic sugar analogs, alpha-anomeric sugars, epimeric sugars such as arabinose, xyloses or lyxoses, pyranose sugars, furanose sugars, sedoheptuloses, acyclic analogs and a basic nucleoside analogs such as methyl riboside.
- One or more phosphodiester linkages may be replaced by alternative linking groups.
- linking groups include, but are not limited to, embodiments wherein phosphate is replaced by P(0)S ("thioate”), P(S)S ("dithioate”), (0)NR 2 ("amidate”), P(0)R, P(0)OR', CO or CH 2 ("formacetal”), in which each R or R' is independently H or substituted or unsubstituted alkyl (1-20 C) optionally containing an ether (-0-) linkage, aryl, alkenyl, cycloalkyl, cycloalkenyl or araldyl. Not all linkages in a polynucleotide need be identical. The preceding description applies to all polynucleotides referred to herein, including RNA and DNA.
- Oligonucleotide generally refers to short, generally single stranded, generally synthetic polynucleotides that are generally, but not necessarily, less than about 200 nucleotides in length.
- oligonucleotide and “polynucleotide” are not mutually exclusive. The description above for polynucleotides is equally and fully applicable to oligonucleotides.
- Percent (%) amino acid sequence identity with respect to a peptide or polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
- % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2, wherein the complete source code for the ALIGN-2 program is provided in the chart below.
- the ALIGN-2 sequence comparison computer program was authored by Genentech, Inc. and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087.
- the ALIGN-2 program is publicly available through
- ALIGN-2 program should be compiled for use on a UNIX operating system, preferably digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
- % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B is calculated as follows:
- two or more amino acid sequences are at least 50%, 60%, 70%), 80%o, or 90%) identical. In some embodiments, two or more amino acid sequences are at least 95%, 97%, 98%>, 99%, or even 100% identical. Unless specifically stated otherwise, all % amino acid sequence identity values used herein are obtained as described in the immediately preceding paragraph using the ALIGN-2 computer program.
- FGFR3 refers, unless specifically or contextually indicated otherwise, to any native or variant (whether native or synthetic) FGFR3 polypeptide (e.g., FGFR3-IIIb isoform or FGFR3-IIIc isoform).
- native sequence specifically encompasses naturally occurring truncated forms (e.g., an extracellular domain sequence or a transmembrane subunit sequence), naturally occurring variant forms (e.g., alternatively spliced forms) and naturally-occurring allelic variants.
- wild-type FGFR3 generally refers to a polypeptide comprising an amino acid sequence of a naturally occurring FGFR3 protein.
- wild type FGFR3 sequence generally refers to an amino acid sequence found in a naturally occurring FGFR3.
- FGFR3 ligand refers, unless specifically or contextually indicated otherwise, to any native or variant (whether native or synthetic) FGFR3 ligand (for example, FGF1 , FGF2, FGF4, FGF8, FGF9, FGF 17, FGF 18, FGF23) polypeptide.
- native sequence specifically encompasses naturally occurring truncated forms (e.g., an extracellular domain sequence or a transmembrane subunit sequence), naturally occurring variant forms (e.g., alternatively spliced forms) and naturally-occurring allelic variants.
- wild-type FGFR3 ligand generally refers to a polypeptide comprising an amino acid sequence of a naturally occurring FGFR3 ligand protein.
- wild type FGFR3 ligand sequence generally refers to an amino acid sequence found in a naturally occurring FGFR3 ligand.
- FGFR3 activation refers to activation, or phosphorylation, of the FGFR3 receptor. Generally, FGFR3 activation results in signal transduction (e.g. that caused by an intracellular kinase domain of a FGFR3 receptor phosphorylating tyrosine residues in FGFR3 or a substrate polypeptide). FGFR3 activation may be mediated by FGFR ligand binding to a FGFR3 receptor of interest.
- FGFR3 ligand e.g., such as FGF1 or FGF9 binding to FGFR3 may activate a kinase domain of FGFR3 and thereby result in phosphorylation of tyrosine residues in the FGFR3 and/or phosphorylation of tyrosine residues in additional substrate polypeptides(s).
- FGFR2 refers, unless specifically or contextually indicated otherwise, to any native or variant (whether native or synthetic) FGFR2 polypeptide (e.g., FGFR2-IIIb isoform or FGFR2-IIIc isoform).
- native sequence specifically encompasses naturally occurring truncated forms (e.g., an extracellular domain sequence or a transmembrane subunit sequence), naturally occurring variant forms (e.g., alternatively spliced forms) and naturally-occurring allelic variants.
- wild-type FGFR2 generally refers to a polypeptide comprising an amino acid sequence of a naturally occurring FGFR2 protein.
- wild type FGFR2 sequence generally refers to an amino acid sequence found in a naturally occurring FGFR2.
- FGFR2 ligand refers, unless specifically or contextually indicated otherwise, to any native or variant (whether native or synthetic) FGFR2 ligand.
- native sequence specifically encompasses naturally occurring truncated forms (e.g., an extracellular domain sequence or a
- wild-type FGFR2 ligand generally refers to a polypeptide comprising an amino acid sequence of a naturally occurring FGFR2 ligand protein.
- wild type FGFR2 ligand sequence generally refers to an amino acid sequence found in a naturally occurring FGFR2 ligand.
- FGFR2 activation refers to activation, or phosphorylation, of the FGFR2 receptor.
- FGFR2 activation may be mediated by FGFR ligand binding to a FGFR2 receptor of interest.
- FGFR2 ligand binding to FGFR2 may activate a kinase domain of FGFR2 and thereby result in phosphorylation of tyrosine residues in the FGFR2 and/or phosphorylation of tyrosine residues in additional substrate polypeptides(s).
- FGFR2/3 antibody refers to dual-specific antibodies that bind to FGFR2 and FGFR3.
- Non-limiting examples of FGFR2/3 antibodies include the dual specific monoclonoal antibodies 2B.1.3.10 and 2B.1.3.12 as described herein.
- the terms FGFR2/3 and "FGFR 2 and FGFR3" and “FGFR3 and FGFR2” are used interchangeably herein.
- the activity may be constitutive or the activity of the receptor may be further activated by the binding of other molecules (e. g. ligands).
- ligands e.g. ligands
- Cellular events that lead to activation of receptors are well known among those of ordinary skill in the art.
- activation may include oligomerization, e.g., dimerization, trimerization, etc., into higher order receptor complexes.
- Complexes may comprise a single species of protein, i.e., a homomeric complex. Alternatively, complexes may comprise at least two different protein species, i.e., a heteromeric complex.
- Complex formation may be caused by, for example, overexpression of normal or mutant forms of receptor on the surface of a cell. Complex formation may also be caused by a specific mutation or mutations in a receptor.
- ligand-independent refers to signaling activity that is not dependent on the presence of a ligand.
- a receptor having ligand-independent kinase activity will not necessarily preclude the binding of ligand to that receptor to produce additional activation of the kinase activity.
- ligand-dependent refers to signaling activity that is dependent on the presence of a ligand.
- gene amplification refers to a process by which multiple copies of a gene or gene fragment are formed in a particular cell or cell line.
- the duplicated region (a stretch of amplified DNA) is often referred to as "amplicon.”
- amplicon a stretch of amplified DNA
- the amount of the messenger R A (mR A) produced i.e., the level of gene expression, also increases in the proportion of the number of copies made of the particular gene expressed.
- a “tyrosine kinase inhibitor” is a molecule which inhibits to some extent tyrosine kinase activity of a tyrosine kinase such as FGFR2 and FGFR3 receptors.
- a cancer or biological sample which "displays FGFR3 expression, amplification, or activation” is one which, in a diagnostic test, expresses (including overexpresses) FGFR3, has amplified FGFR3 gene, and/or otherwise demonstrates activation or phosphorylation of a FGFR3.
- a cancer or biological sample which "displays FGFR2 expression, amplification, or activation” is one which, in a diagnostic test, expresses (including overexpresses) FGFR2, has amplified FGFR2 gene, and/or otherwise demonstrates activation or phosphorylation of a FGFR2.
- a cancer or biological sample which "displays FGFR2/3 expression, amplification, or activation” or “displays FGFR2 and FGFR3 expression, amplicification, or activation” is one which, in a diagnostic test, expresses (including overexpresses) FGFR2 and FGFR3, has amplified FGFR2 and FGFR3 genes, and/or otherwise demonstrates activation or
- Klotho-beta refers to any native beta- Klotho from any vertebrate source, including mammals such as primates (e.g., humans) and rodents (e.g., mice and rats), unless otherwise indicated.
- the term encompasses "full- length,” unprocessed KLB as well as any form of KLB that results from processing in the cell.
- the term also encompasses naturally occurring variants of KLB, e.g., splice variants or allelic variants.
- a non-limiting example of a human KLB amino acid sequence targeted by an antibody of the present disclosure, excluding the signal sequence is as follows:
- a KLB protein can include a N-terminal signal sequence having the amino acid sequence
- C-terminal domain of KLB refers to the carboxy-terminal glycosidase-like domain of KLB.
- the C-terminal domain of the exemplary KLB protein shown in SEQ ID NO: 233 comprises the following amino acid sequence:
- anti-KLB antibody and "an antibody that binds to KLB” refer to an antibody that is capable of binding KLB with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting KLB.
- the extent of binding of an anti-KLB antibody to an unrelated, non-KLB protein is less than about 10% of the binding of the antibody to KLB as measured, e.g., by a radioimmunoassay (RIA).
- RIA radioimmunoassay
- an antibody that binds to KLB has a dissociation constant (K d ) of ⁇ ⁇ , ⁇ 100 iiM, ⁇ 10 iiM, ⁇ 1 iiM, ⁇ 0.1 iiM, ⁇ 0.01 iiM, or ⁇ 0.001 iiM (e.g., 10 ⁇ 8 M or less, e.g., from 10 ⁇ 8 M to 10 "13 M, e.g., from 10 "9 M to 10 "13 M).
- an anti-KLB antibody binds to an epitope of KLB that is conserved among KLB from different species.
- an anti-KLB antibody binds to an epitope on KLB that is in the C-terminal part of the protein.
- pharmaceutical formulation refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
- a “pharmaceutically acceptable carrier,” as used herein, refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject.
- a pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
- treatment refers to clinical intervention in an attempt to alter the natural course of the individual being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
- antibodies of the present disclosure can be used to delay development of a disease or to slow the progression of a disease.
- Treatment refers to both therapeutic treatment and prophylactic or preventative measures. As it relates to the FGFR2/3 antibody, those in need of treatment include those already having a benign, pre-cancerous, or non-metastatic tumor as well as those in which the occurrence or recurrence of cancer is to be prevented.
- a cancer or biological sample which "displays FGFR3 activation” is one which, in a diagnostic test, demonstrates activation or phosphorylation of FGFR3. Such activation can be determined directly (e.g. by measuring FGFR3 phosphorylation by ELISA) or indirectly.
- a cancer or biological sample which "displays FGFR2 activation” is one which, in a diagnostic test, demonstrates activation or phosphorylation of FGFR2. Such activation can be determined directly or indirectly.
- a cancer or biological sample which "displays FGFR2 and FGFR3 activation" is one which, in a diagnostic test, demonstrates activation or
- Such activation can be determined directly or indirectly.
- a cancer or biological sample which "displays constitutive FGFR3 activation" is one which, in a diagnostic test, demonstrates constitutive activation or phosphorylation of a FGFR3. Such activation can be determined directly (e.g. by measuring C-FGFR3
- a cancer or biological sample which "displays constitutive FGFR2 activation” is one which, in a diagnostic test, demonstrates constitutive activation or phosphorylation of a FGFR2. Such activation can be determined directly or indirectly.
- a cancer or biological sample which "displays constitutive FGFR2 and FGFR3 activation” is one which, in a diagnostic test, demonstrates constitutive activation or phosphorylation of a FGFR2 and a FGFR3. Such activation can be determined directly or indirectly.
- a cancer or biological sample which "displays FGFR3 amplification” is one which, in a diagnostic test, has amplified FGFR3 gene.
- a cancer or biological sample which "displays FGFR2 amplification” is one which, in a diagnostic test, has amplified FGFR2 gene.
- a cancer or biological sample which "displays FGFR2 and FGFR3 amplification” is one which, in a diagnostic test, has amplified FGFR2 and FGFR3 genes.
- a cancer or biological sample which "displays FGFR3 translocation" is one which, in a diagnostic test, has translocated FGFR3 gene.
- An example of a FGFR3 translocation is the t(4; 14) translocation, which occurs in some multiple myeloma tumors.
- a cancer or biological sample which "displays FGFR2 translocation" is one which, in a diagnostic test, has translocated FGFR2 gene.
- FGFR3 translocation is one which, in a diagnostic test, has translocated FGFR2 and FGFR3 genes.
- a "phospho-ELISA assay” herein is an assay in which phosphorylation of one or more FGFR (e.g. FGFR2 and FGFR3), substrate or downstream signaling molecules is evaluated in an enzyme-linked immunosorbent assay (ELISA) using a reagent, usually an antibody, to detect a phosphorylated FGFR (e.g. FGFR2 and FGFR3), substrate, or downstream signaling molecule.
- a reagent usually an antibody
- an antibody which detects phosphorylated FGFR2, FGFR3, or pMAPK is used.
- an antibody which detects phosphorylated FGFR2 and FGFR3 is used.
- the assay may be performed on cell lysates, preferably from fresh or frozen biological samples.
- a cancer or biological sample which "displays ligand-independent FGFR3 activation is one which, in a diagnostic test, demonstrates ligand-independent activation or
- a cancer or biological sample which "displays ligand-independent FGFR2 activation" is one which, in a diagnostic test, demonstrates ligand-independent activation or phosphorylation of a FGFR2. Such activation can be determined directly or indirectly.
- a cancer or biological sample which "displays ligand-independent FGFR2/3 activation" is one which, in a diagnostic test, demonstrates ligand-independent activation or phosphorylation of a FGFR2 and FGFR3. Such activation can be determined directly or indirectly.
- a cancer or biological sample which "displays ligand-dependent FGFR3 activation" is one which, in a diagnostic test, demonstrates ligand-dependent activation or
- a cancer or biological sample which "displays ligand-dependent FGFR2 activation" is one which, in a diagnostic test, demonstrates ligand-dependent activation or phosphorylation of a FGFR2. Such activation can be determined directly or indirectly.
- a cancer or biological sample which "displays ligand-dependent FGFR2/3 activation" is one which, in a diagnostic test, demonstrates ligand-dependent activation or phosphorylation of a FGFR2/3. Such activation can be determined directly or indirectly.
- a cancer or biological sample which "displays ligand-independent FGFR3 activation is one which, in a diagnostic test, demonstrates ligand-independent activation or
- a cancer or biological sample which "displays ligand-independent FGFR2 activation" is one which, in a diagnostic test, demonstrates ligand-independent activation or phosphorylation of a FGFR2. Such activation can be determined directly or indirectly.
- a cancer or biological sample which "displays ligand-independent FGFR2/3 activation" is one which, in a diagnostic test, demonstrates ligand-independent activation or phosphorylation of a FGFR2/3. Such activation can be determined directly or indirectly.
- a cancer cell with "FGFR3 overexpression or amplification” is one which has significantly higher levels of a FGFR3 protein or gene compared to a noncancerous cell of the same tissue type. Such overexpression may be caused by gene amplification or by increased transcription or translation. FGFR3 overexpression or amplification may be determined in a diagnostic or prognostic assay by evaluating increased levels of the FGFR3 protein present on the surface of a cell (e.g. via an immunohistochemistry assay; IHC).
- FISH fluorescent in situ hybridization
- PCR polymerase chain reaction
- qRT-PCR quantitative real time PCR
- various in vivo assays are available to the skilled practitioner. For example, one may expose cells within the body of the patient to an antibody which is optionally labeled with a detectable label, e.g. a radioactive isotope, and binding of the antibody to cells in the patient can be evaluated, e.g. by external scanning for radioactivity or by analyzing a biopsy taken from a patient previously exposed to the antibody.
- a detectable label e.g. a radioactive isotope
- a cancer cell with "FGFR2 overexpression or amplification” is one which has significantly higher levels of a FGFR2 protein or gene compared to a noncancerous cell of the same tissue type. Such overexpression may be caused by gene amplification or by increased transcription or translation. FGFR2 overexpression or amplification may be determined in a diagnostic or prognostic assay by evaluating increased levels of the FGFR2 protein present on the surface of a cell (e.g. via an immunohistochemistry assay; IHC).
- FISH fluorescent in situ hybridization
- PCR polymerase chain reaction
- qRT-PCR quantitative real time PCR
- various in vivo assays are available to the skilled practitioner. For example, one may expose cells within the body of the patient to an antibody which is optionally labeled with a detectable label, e.g. a radioactive isotope, and binding of the antibody to cells in the patient can be evaluated, e.g. by external scanning for radioactivity or by analyzing a biopsy taken from a patient previously exposed to the antibody.
- a detectable label e.g. a radioactive isotope
- a cancer cell with "FGFR2/3 overexpression or amplification" is one which has significantly higher levels of FGFR2 and FGFR3 proteins or genes compared to a
- FGFR2 and FGFR3 overexpression or amplification may be determined in a diagnostic or prognostic assay by evaluating increased levels of the FGFR2 and FGFR3 proteins present on the surface of a cell (e.g. via an immunohistochemistry assay; IHC). Alternatively, or additionally, one may measure levels of FGFR2 and FGFR3 -encoding nucleic acid in the cell, e.g. via fluorescent in situ hybridization (FISH; see W098/45479 published October, 1998), southern blotting, or polymerase chain reaction (PCR) techniques, such as quantitative real time PCR (qRT-PCR).
- FISH fluorescent in situ hybridization
- PCR polymerase chain reaction
- various in vivo assays are available to the skilled practitioner.
- a detectable label e.g. a radioactive isotope
- binding of the antibody to cells in the patient can be evaluated, e.g. by external scanning for radioactivity or by analyzing a biopsy taken from a patient previously exposed to the antibody.
- mutation means a difference in the amino acid or nucleic acid sequence of a particular protein or nucleic acid (gene, RNA) relative to the wild-type protein or nucleic acid, respectively.
- a mutated protein or nucleic acid can be expressed from or found on one allele (heterozygous) or both alleles (homozygous) of a gene, and may be somatic or germ line.
- mutations are generally somatic. Mutations include sequence rearrangements such as insertions, deletions, and point mutations (including single nucleotide/amino acid polymorphisms).
- To “inhibit” is to decrease or reduce an activity, function, and/or amount as compared to a reference.
- An agent possesses "agonist activity or function" when an agent mimics at least one of the functional activities of a polypeptide of interest (e.g., FGFR ligand, such as FGF1 or FGF9).
- a polypeptide of interest e.g., FGFR ligand, such as FGF1 or FGF9.
- an "agonist antibody”, as used herein, is an antibody which mimics at least one of the functional activities of a polypeptide of interest (e.g., FGFR ligand, such as FGF1 or FGF9).
- FGFR ligand such as FGF1 or FGF9
- Protein expression refers to conversion of the information encoded in a gene into messenger RNA (mRNA) and then to the protein.
- mRNA messenger RNA
- a sample or cell that "expresses" a protein of interest is one in which mRNA encoding the protein, or the protein, including fragments thereof, is determined to be present in the sample or cell.
- immunoconjugate (interchangeably referred to as “antibody-drug conjugate,” or “ADC”) means an antibody conjugated to one or more cytotoxic agents, such as a
- Fc region generally refers to a dimer complex comprising the C-terminal polypeptide sequences of an immunoglobulin heavy chain, wherein a C- terminal polypeptide sequence is that which is obtainable by papain digestion of an intact antibody.
- the Fc region may comprise native or variant Fc sequences.
- the human IgG heavy chain Fc sequence is usually defined to stretch from an amino acid residue at about position Cys226, or from about position Pro230, to the carboxyl terminus of the Fc sequence.
- the Fc sequence of an immunoglobulin generally comprises two constant domains, a CH2 domain and a CH3 domain, and optionally comprises a CH4 domain.
- the C-terminal lysine (residue 447 according to the EU numbering system) of the Fc region may be removed, for example, during purification of the antibody or by recombinant engineering of the nucleic acid encoding the antibody.
- a composition comprising an antibody having an Fc region according to this invention can comprise an antibody with K447, with all K447 removed, or a mixture of antibodies with and without the K447 residue.
- Fc polypeptide herein is meant one of the polypeptides that make up an Fc region.
- An Fc polypeptide may be obtained from any suitable immunoglobulin, such as IgGi, IgG 2 , IgG 3 , or IgG 4 subtypes, IgA, IgE, IgD or IgM.
- an Fc polypeptide comprises part or all of a wild type hinge sequence (generally at its N terminus). In some embodiments, an Fc polypeptide does not comprise a functional or wild type hinge sequence.
- blocking antibody or an antibody “antagonist” is one which inhibits or reduces biological activity of the antigen it binds.
- Preferred blocking antibodies or antagonist antibodies completely inhibit the biological activity of the antigen.
- a “naked antibody” is an antibody that is not conjugated to a heterologous molecule, such as a cytotoxic moiety or radiolabel.
- An antibody having a "biological characteristic" of a designated antibody is one which possesses one or more of the biological characteristics of that antibody which distinguish it from other antibodies that bind to the same antigen.
- a salvage receptor binding epitope to the antibody (especially an antibody fragment), as described, e.g., in US Patent 5,739,277.
- a nucleic acid molecule encoding the salvage receptor binding epitope can be linked in frame to a nucleic acid encoding a polypeptide sequence of this invention so that the fusion protein expressed by the engineered nucleic acid molecule comprises the salvage receptor binding epitope and a polypeptide sequence of this invention.
- the term "salvage receptor binding epitope” refers to an epitope of the Fc region of an IgG molecule (e.g., IgGi, IgG 2 , IgG 3 , or IgG 4 ) that is responsible for increasing the in vivo serum half-life of the IgG molecule (e.g., Ghetie et al., Ann. Rev. Immunol. 18:739-766 (2000), Table 1). Antibodies with substitutions in an Fc region thereof and increased serum half-lives are also described in WO00/42072, WO 02/060919; Shields et al, J. Biol. Chem.
- the serum half-life can also be increased, for example, by attaching other polypeptide sequences.
- antibodies or other polypeptides useful in the methods of the invention can be attached to serum albumin or a portion of serum albumin that binds to the FcRn receptor or a serum albumin binding peptide so that serum albumin binds to the antibody or polypeptide, e.g., such polypeptide sequences are disclosed in WOOl/45746.
- the serum albumin peptide to be attached comprises an amino acid sequence of
- DICLPRWGCLW (SEQ ID NO: 183).
- the half-life of a Fab is increased by these methods. See also, Dennis et al. J. Biol. Chem. 277:35035-35043 (2002) for serum albumin binding peptide sequences.
- fragment is meant a portion of a polypeptide or nucleic acid molecule that contains, preferably, at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or more of the entire length of the reference nucleic acid molecule or polypeptide.
- a fragment may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100, 200, 300, 400, 500, 600, or more nucleotides or 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 190, 200 amino acids or more.
- the phrase "little to no agonist function" with respect to an antibody of the invention, as used herein, means the antibody does not elicit a biologically meaningful amount of agonist activity, e.g., upon administration to a subject.
- amount of an activity may be determined quantitatively or qualitatively, so long as a comparison between an antibody of the invention and a reference counterpart can be done.
- the activity can be measured or detected according to any assay or technique known in the art, including, e.g., those described herein.
- the amount of activity for an antibody of the invention and its reference counterpart can be determined in parallel or in separate runs.
- a bivalent antibody of the invention does not possess substantial agonist function.
- apoptosis and “apoptotic activity” are used in a broad sense and refer to the orderly or controlled form of cell death in mammals that is typically accompanied by one or more characteristic cell changes, including condensation of cytoplasm, loss of plasma membrane microvilli, segmentation of the nucleus, degradation of chromosomal DNA or loss of mitochondrial function.
- This activity can be determined and measured using techniques known in the art, for instance, by cell viability assays, FACS analysis or DNA electrophoresis, and more specifically by binding of annexin V, fragmentation of DNA, cell shrinkage, dilation of endoplasmatic reticulum, cell fragmentation, and/or formation of membrane vesicles (called apoptotic bodies).
- antibody and “immunoglobulin” are used interchangeably in the broadest sense and include monoclonal antibodies (e.g., full length or intact monoclonal antibodies), polyclonal antibodies, multivalent antibodies, multispecific antibodies (e.g., bispecific antibodies so long as they exhibit the desired biological activity) and may also include certain antibody fragments (as described in greater detail herein).
- An antibody can be human, humanized, and/or affinity matured.
- variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called complementarity-determining regions (CDRs) or hypervariable regions both in the light-chain and the heavy-chain variable domains. The more highly conserved portions of variable domains are called the framework (FR).
- CDRs complementarity-determining regions
- FR framework
- the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a ⁇ -sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the ⁇ -sheet structure.
- the CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen- binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, MD (1991)).
- the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody-dependent cellular toxicity.
- Papain digestion of antibodies produces two identical antigen-binding fragments, called "Fab" fragments, each with a single antigen-binding site, and a residual "Fc" fragment, whose name reflects its ability to crystallize readily.
- Pepsin treatment yields an F(ab') 2 fragment that has two antigen-combining sites and is still capable of cross-linking antigen.
- Fv is the minimum antibody fragment which contains a complete antigen- recognition and -binding site.
- this region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association.
- one heavy- and one light-chain variable domain can be covalently linked by a flexible peptide linker such that the light and heavy chains can associate in a "dimeric" structure analogous to that in a two-chain Fv species. It is in this configuration that the three CDRs of each variable domain interact to define an antigen-binding site on the surface of the VH-VL dimer.
- the six CDRs confer antigen-binding specificity to the antibody.
- the Fab fragment also contains the constant domain of the light chain and the first constant domain (CHI) of the heavy chain.
- Fab' fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CHI domain including one or more cysteines from the antibody hinge region.
- Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) of the constant domains bear a free thiol group.
- F(ab') 2 antibody fragments originally were produced as pairs of Fab' fragments which have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
- immunoglobulins The "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa ( ⁇ ) and lambda ( ⁇ ), based on the amino acid sequences of their constant domains. Depending on the amino acid sequence of the constant domain of their heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these can be further divided into subclasses (isotypes), e.g., IgGi, IgG 2 , IgG 3 , IgG 4 , IgAi, and IgA 2 .
- immunoglobulins There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these can be further divided into subclasses (isotypes), e.g.,
- antibody fragments comprise only a portion of an intact antibody, wherein the portion preferably retains at least one, preferably most or all, of the functions normally associated with that portion when present in an intact antibody.
- antibody fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies; single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
- an antibody fragment comprises an antigen binding site of the intact antibody and thus retains the ability to bind antigen.
- an antibody fragment for example one that comprises the Fc region, retains at least one of the biological functions normally associated with the Fc region when present in an intact antibody, such as FcRn binding, antibody half life modulation, ADCC function and complement binding.
- an antibody fragment is a
- an antibody fragment may comprise on antigen binding arm linked to an Fc sequence capable of conferring in vivo stability to the fragment.
- hypervariable region when used herein refers to the regions of an antibody variable domain which are hypervariable in sequence and/or form structurally defined loops.
- antibodies comprise six hypervariable regions; three in the VH (HI, H2, H3), and three in the VL (LI, L2, L3).
- a number of hypervariable region delineations are in use and are encompassed herein.
- the Kabat Complementarity Determining Regions are based on sequence variability and are the most commonly used (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. (1991)).
- Chothia refers instead to the location of the structural loops (Chothia and Lesk, J. Mol. Biol. 196:901-917 (1987)).
- the AbM hypervariable regions represent a compromise between the Kabat CDRs and Chothia structural loops, and are used by Oxford Molecular' s AbM antibody modeling software.
- the "contact" hypervariable regions are based on an analysis of the available complex crystal structures. The residues from each of these hypervariable regions are noted below.
- Hypervariable regions may comprise "extended hypervariable regions” as follows: 24-36 or 24-34 (LI), 46-56 or 50-56 (L2) and 89-97 (L3) in the VL and 26-35 (HI), 50-65 or 49-65 (H2) and 93-102, 94-102 or 95-102 (H3) in the VH.
- the variable domain residues are numbered according to Kabat et al., supra for each of these definitions.
- I l l "Framework" or "FR" residues are those variable domain residues other than the hypervariable region residues as herein defined.
- Humanized forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin.
- humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
- donor antibody such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity.
- framework region (FR) residues of the human immunoglobulin are replaced by corresponding non- human residues.
- humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance.
- the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human
- immunoglobulin and all or substantially all of the FRs are those of a human immunoglobulin sequence.
- the humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
- Fc immunoglobulin constant region
- “Chimeric” antibodies have a portion of the heavy and/or light chain identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Patent No. 4,816,567; and Morrison et al, Proc. Natl. Acad. Sci. USA 81 :6851-6855 (1984)).
- Humanized antibody as used herein is a subset of chimeric antibodies.
- Single-chain Fv or “scFv” antibody fragments comprise the VH and VL domains of antibody, wherein these domains are present in a single polypeptide chain.
- the scFv polypeptide further comprises a polypeptide linker between the VH and VL domains which enables the scFv to form the desired structure for antigen binding.
- an “antigen” is a predetermined antigen to which an antibody can selectively bind.
- the target antigen may be polypeptide, carbohydrate, nucleic acid, lipid, hapten or other naturally occurring or synthetic compound.
- the target antigen is a polypeptide.
- diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy-chain variable domain (VH) connected to a light- chain variable domain (VL) in the same polypeptide chain (VH - VL).
- VH heavy-chain variable domain
- VL light- chain variable domain
- a "human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
- affinity matured antibody is one with one or more alterations in one or more CDRs thereof which result in an improvement in the affinity of the antibody for antigen, compared to a parent antibody which does not possess those alteration(s).
- Preferred affinity matured antibodies will have nanomolar or even picomolar affinities for the target antigen.
- Affinity matured antibodies are produced by procedures known in the art. Marks et al.
- Antibody effector functions refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody, and vary with the antibody isotype. Examples of antibody effector functions include: C lq binding and complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptor); and B cell activation.
- ADCC antibody-dependent cell-mediated cytotoxicity
- FcRs Fc receptors
- cytotoxic cells e.g., Natural Killer (NK) cells, neutrophils, and macrophages
- NK Natural Killer
- the antibodies “arm” the cytotoxic cells and are absolutely required for such killing.
- ADCC activity of a molecule of interest is assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al, PNAS (USA) 95:652-656 (1998).
- Human effector cells are leukocytes which express one or more FcRs and perform effector functions. Preferably, the cells express at least FcyRIII and perform ADCC effector function. Examples of human leukocytes which mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, cytotoxic T cells and neutrophils; with PBMCs and NK cells being preferred.
- PBMC peripheral blood mononuclear cells
- NK natural killer cells
- monocytes cytotoxic T cells and neutrophils
- the effector cells may be isolated from a native source, e.g., from blood.
- Fc receptor or “FcR” describes a receptor that binds to the Fc region of an antibody.
- the preferred FcR is a native sequence human FcR.
- a preferred FcR is one which binds an IgG antibody (a gamma receptor) and includes receptors of the FcyRI, FcyRII, and FcyRIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
- FcyRII receptors include FcyRIIA (an “activating receptor”) and FcyRIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
- Activating receptor FcyRIIA contains an immunoreceptor tyrosine -based activation motif (IT AM) in its cytoplasmic domain.
- Inhibiting receptor FcyRIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain, (see review M. in Daeron, Annu. Rev. Immunol. 15:203-234 (1997)).
- FcRs are reviewed in Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991); Capel et al, Immunomethods 4:25-34 (1994); and de Haas et al, J. Lab. Clin. Med. 126:330-41 (1995).
- FcR FcR
- the term also includes the neonatal receptor, FcRn, which is responsible for the transfer of maternal IgGs to the fetus (Guyer et al., J. Immunol. 117:587 (1976) and Kim et al, J. Immunol. 24:249 (1994)) and regulates homeostasis of immunoglobulins.
- FcRn neonatal receptor
- 00/42072 (Presta) describes antibody variants with improved or diminished binding to FcRs.
- Binding to human FcRn in vivo and serum half life of human FcRn high affinity binding polypeptides can be assayed, e.g, in transgenic mice or transfected human cell lines expressing human FcRn, or in primates administered with the Fc variant polypeptides.
- “Complement dependent cytotoxicity” or “CDC” refers to the lysis of a target cell in the presence of complement. Activation of the classical complement pathway is initiated by the binding of the first component of the complement system (Clq) to antibodies (of the appropriate subclass) which are bound to their cognate antigen.
- Clq first component of the complement system
- a CDC assay e.g., as described in Gazzano-Santoro et al., J. Immunol. Methods
- Fc region-comprising polypeptide refers to a polypeptide, such as an antibody or immunoadhesin, which comprises an Fc region.
- the C-terminal lysine (residue) refers to a polypeptide, such as an antibody or immunoadhesin, which comprises an Fc region.
- composition comprising a polypeptide having an Fc region according to this invention can comprise polypeptides with K447, with all K447 removed, or a mixture of polypeptides with and without the K447 residue.
- acceptor human framework for the purposes herein is a framework comprising the amino acid sequence of a VL or VH framework derived from a human immunoglobulin framework, or from a human consensus framework.
- An acceptor human framework "derived from” a human immunoglobulin framework or human consensus framework may comprise the same amino acid sequence thereof, or may contain pre-existing amino acid sequence changes. Where pre-existing amino acid changes are present, preferably no more than 5 and preferably 4 or less, or 3 or less, pre-existing amino acid changes are present.
- VH preferably those changes are only at three, two, or one of positions 71H, 73H, and 78H; for instance, the amino acid residues at those positions may be 71 A, 73T, and/or 78A.
- the VL acceptor human framework is identical in sequence to the VL human immunoglobulin framework sequence or human consensus framework sequence.
- a "human consensus framework” is a framework which represents the most commonly occurring amino acid residue in a selection of human immunoglobulin VL or VH framework sequences.
- the selection of human immunoglobulin VL or VH sequences is from a subgroup of variable domain sequences.
- the subgroup of sequences is a subgroup as in Kabat et al.
- the subgroup is subgroup kappa I as in Kabat et al.
- the subgroup III as in Kabat et al.
- VH subgroup III consensus framework comprises the consensus sequence obtained from the amino acid sequences in variable heavy subgroup III of Kabat et al.
- the VH subgroup III consensus framework amino acid sequence comprises at least a portion or all of each of the following sequences:
- VL subgroup I consensus framework comprises the consensus sequence obtained from the amino acid sequences in variable light kappa subgroup I of Kabat et al.
- the VH subgroup I consensus framework amino acid sequence comprises at least a portion or all of each of the following sequences: DIQMTQSPSSLSASVGDRVTITC (SEQ ID NO : 99)-L 1 - WYQQKPGKAPKLLIY (SEQ ID NO: 100)-L2- GVPSRFSGSGSGTDFTLTISSLQPEDFATYYC (SEQ ID NO: 101)-L3-FGQGTKVEIK (SEQ ID NO: 102).
- antibody mutant refers to an amino acid sequence variant of an antibody wherein one or more of the amino acid residues of the species-dependent antibody have been modified. Such mutants necessarily have less than 100% sequence identity or similarity with the species-dependent antibody.
- the antibody mutant will have an amino acid sequence having at least 75% amino acid sequence identity or similarity with the amino acid sequence of either the heavy or light chain variable domain of the species-dependent antibody, more preferably at least 80%, more preferably at least 85%, more preferably at least 90%, and most preferably at least 95%. Identity or similarity with respect to this sequence is defined herein as the percentage of amino acid residues in the candidate sequence that are identical (i.e same residue) or similar (i.e.
- a “disorder” or “disease” is any condition that would benefit from treatment with a substance/molecule or method of the invention. This includes chronic and acute disorders or diseases including those pathological conditions which predispose the mammal to the disorder in question.
- disorders to be treated herein include malignant and benign tumors; carcinoma, blastoma, and sarcoma.
- terapéuticaally effective amount refers to an amount of a therapeutic agent to treat or prevent a disease or disorder in a mammal.
- a therapeutic agent to treat or prevent a disease or disorder in a mammal.
- therapeutically effective amount of the therapeutic agent may reduce the number of cancer cells; reduce the primary tumor size; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the disorder.
- the drug may prevent growth and/or kill existing cancer cells, it may be cytostatic and/or cytotoxic.
- efficacy in vivo can, for example, be measured by assessing the duration of survival, time to disease progression (TTP), the response rates (RR), duration of response, and/or quality of life.
- cancer and “cancerous” refer to or describe the physiological condition in mammals that is typically characterized by unregulated cell growth. Included in this definition are benign and malignant cancers.
- head stage cancer or “early stage tumor” is meant a cancer that is not invasive or metastatic or is classified as a Stage 0, 1, or II cancer. Examples of cancer include, but are not limited to, carcinoma, lymphoma, blastoma
- cancers include medulloblastoma and retinoblastoma, sarcoma (including liposarcoma and synovial cell sarcoma), neuroendocrine tumors (including carcinoid tumors, gastrinoma, and islet cell cancer), mesothelioma, schwannoma (including acoustic neuroma), meningioma, adenocarcinoma, melanoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer (e.g.
- lung cancer including small-cell lung cancer (SCLC), non-small cell lung cancer (NSCLC), adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer (including metastatic breast cancer), colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, testicular cancer, esophagael cancer, tumors of the biliary tract, as well as head and neck cancer and multiple myeloma.
- SCLC small-cell lung cancer
- NSCLC non-small cell lung cancer
- adenocarcinoma of the lung and squamous carcinoma of the lung cancer
- pre-cancerous refers to a condition or a growth that typically precedes or develops into a cancer.
- a "pre-cancerous" growth will have cells that are characterized by abnormal cell cycle regulation, proliferation, or differentiation, which can be determined by markers of cell cycle regulation, cellular proliferation, or differentiation.
- dysplasia is meant any abnormal growth or development of tissue, organ, or cells.
- the dysplasia is high grade or precancerous.
- Metastasis is meant the spread of cancer from its primary site to other places in the body. Cancer cells can break away from a primary tumor, penetrate into lymphatic and blood vessels, circulate through the bloodstream, and grow in a distant focus (metastasize) in normal tissues elsewhere in the body. Metastasis can be local or distant. Metastasis is a sequential process, contingent on tumor cells breaking off from the primary tumor, traveling through the bloodstream, and stopping at a distant site. At the new site, the cells establish a blood supply and can grow to form a life-threatening mass. Both stimulatory and inhibitory molecular pathways within the tumor cell regulate this behavior, and interactions between the tumor cell and host cells in the distant site are also significant.
- non-metastatic is meant a cancer that is benign or that remains at the primary site and has not penetrated into the lymphatic or blood vessel system or to tissues other than the primary site.
- a non-metastatic cancer is any cancer that is a Stage 0, 1, or II cancer, and occasionally a Stage III cancer.
- primary tumor or “primary cancer” is meant the original cancer and not a metastatic lesion located in another tissue, organ, or location in the subject's body.
- cancer benign tumor
- a tumor that remains localized at the site of origin and does not have the capacity to infiltrate, invade, or metastasize to a distant site.
- tumor burden is meant the number of cancer cells, the size of a tumor, or the amount of cancer in the body. Tumor burden is also referred to as tumor load.
- tumor number is meant the number of tumors.
- subject is meant a mammal, including, but not limited to, a human or non- human mammal, such as a bovine, equine, canine, ovine, or feline.
- a human a mammal
- the subject is a human.
- anti-cancer therapy refers to a therapy useful in treating cancer.
- anti-cancer therapeutic agents include, but are limited to, e.g., chemotherapeutic agents, growth inhibitory agents, cytotoxic agents, agents used in radiation therapy, anti-angiogenesis agents, apoptotic agents, anti-tubulin agents, and other agents to treat cancer , anti-CD20 antibodies, platelet derived growth factor inhibitors (e.g., Gleevec TM (Imatinib Mesylate)), a COX-2 inhibitor (e.g., celecoxib), interferons, cytokines, antagonists (e.g., neutralizing antibodies) that bind to one or more of the following targets ErbB2, ErbB3, ErbB4, PDGFR- beta, BlyS, APRIL, BCMA or VEGF receptor(s), TRAIL/Apo2, and other bioactive and organic chemical agents, etc. Combinations thereof are also included in the invention.
- chemotherapeutic agent is a chemical compound useful in the treatment of cancer.
- chemotherapeutic agents include is a chemical compound useful in the treatment of cancer.
- chemotherapeutic agents include alkylating agents such as thiotepa and CYTOXAN® cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine;
- acetogenins especially bullatacin and bullatacinone
- a camptothecin including the synthetic analogue topotecan
- bryostatin callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide,
- calicheamicin omegall see, e.g., Agnew, Chem Intl. Ed. Engl, 33: 183-186 (1994));
- dynemicin including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antiobiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, ADRIAMYCIN® doxorubicin (including morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marc
- etoglucid gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine;
- TAXOL® paclitaxel Bristol- Myers Squibb Oncology, Princeton, N.
- ABRAXANETM Cremophor-free, albumin-engineered nanoparticle formulation of paclitaxel American Pharmaceutical Partners, Schaumberg, Illinois
- TAXOTERE® doxetaxel Rhone- Poulenc Rorer, Antony, France
- chloranbucil GEMZAR® gemcitabine
- 6-thioguanine mercaptopurine
- methotrexate platinum analogs such as cisplatin and carboplatin;
- vinblastine platinum; etoposide (VP- 16); ifosfamide; mitoxantrone; vincristine;
- NAVELBINE® vinorelbine novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; irinotecan (Camptosar, CPT-11) (including the treatment regimen of irinotecan with 5-FU and leucovorin); topoisomerase inhibitor RFS 2000;
- DMFO difluorometlhylornithine
- retinoids such as retinoic acid
- capecitabine difluorometlhylornithine
- oxaliplatin including the oxaliplatin treatment regimen (FOLFOX); inhibitors of PKC-alpha, Raf, H-Ras, EGFR (e.g., erlotinib (TarcevaTM)) and VEGF-A that reduce cell proliferation and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- FOLFOX oxaliplatin treatment regimen
- inhibitors of PKC-alpha, Raf, H-Ras, EGFR e.g., erlotinib (TarcevaTM)
- VEGF-A e.g., VEGF-A that reduce cell proliferation and pharmaceutically acceptable salts, acids or derivatives of any of the above.
- anti-hormonal agents that act to regulate or inhibit hormone action on tumors
- SERMs selective estrogen receptor modulators
- tamoxifen including NOLVADEX® tamoxifen
- raloxifene including NOLVADEX® tamoxifen
- droloxifene 4-hydroxytamoxifen
- trioxifene keoxifene
- LY 117018 onapristone
- aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, MEGASE® megestrol acetate, AROMASIN® exemestane, formestanie, fadrozole, RIVISOR® vorozole, FEMARA® letrozole, and ARIMIDEX® anastrozole
- anti-androgens such as flutamide, nil
- prodrug refers to a precursor or derivative form of a pharmaceutically active substance that is less cytotoxic to tumor cells compared to the parent drug and is capable of being enzymatically activated or converted into the more active parent form. See, e.g., Wilman, "Prodrugs in Cancer Chemotherapy” Biochemical Society Transactions, 14, pp. 375-382, 615th Meeting Harbor (1986) and Stella et al, “Prodrugs: A Chemical Approach to Targeted Drug Delivery,” Directed Drug Delivery, Borchardt et al., (ed.), pp. 247-267, Humana Press (1985).
- the prodrugs of this invention include, but are not limited to, phosphate-containing prodrugs, thiophosphate-containing prodrugs, sulfate- containing prodrugs, peptide-containing prodrugs, D-amino acid-modified prodrugs, glycosylated prodrugs, ⁇ -lactam-containing prodrugs, optionally substituted
- cytotoxic drugs that can be derivatized into a prodrug form for use in this invention include, but are not limited to, those
- radiation therapy is meant the use of directed gamma rays or beta rays to induce sufficient damage to a cell so as to limit its ability to function normally or to destroy the cell altogether. It will be appreciated that there will be many ways known in the art to determine the dosage and duration of treatment. Typical treatments are given as a one time
- administration and typical dosages range from 10 to 200 units (Grays) per day.
- sample encompasses a variety of sample types obtained from an individual and can be used in a diagnostic or monitoring assay.
- the definition encompasses blood and other liquid samples of biological origin, solid tissue samples such as a biopsy specimen or tissue cultures or cells derived therefrom, and the progeny thereof.
- the definition also includes samples that have been manipulated in any way after their procurement, such as by treatment with reagents, solubilization, or enrichment for certain components, such as proteins or polynucleotides, or embedding in a semi-solid or solid matrix for sectioning purposes.
- biological sample encompasses a clinical sample, and also includes cells in culture, cell supernatants, cell lysates, serum, plasma, biological fluid, and tissue samples.
- the source of the biological sample may be solid tissue as from a fresh, frozen and/or preserved organ or tissue sample or biopsy or aspirate; blood or any blood constituents; bodily fluids such as cerebral spinal fluid, amniotic fluid, peritoneal fluid, or interstitial fluid; cells from any time in gestation or development of the individual.
- the biological sample is obtained from a primary or metastatic tumor.
- the biological sample may contain compounds which are not naturally intermixed with the tissue in nature such as preservatives, anticoagulants, buffers, fixatives, nutrients, antibiotics, or the like.
- a "section" of a tissue sample is meant a single part or piece of a tissue sample, e.g., a thin slice of tissue or cells cut from a tissue sample. It is understood that multiple sections of tissue samples may be taken and subjected to analysis according to the present invention. In some embodiments, the same section of tissue sample is analyzed at both morphological and molecular levels, or is analyzed with respect to both protein and nucleic acid.
- label when used herein refers to a compound or composition which is conjugated or fused directly or indirectly to a reagent such as a nucleic acid probe or an antibody and facilitates detection of the reagent to which it is conjugated or fused.
- the label may itself be detectable (e.g., radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition which is detectable.
- compositions including pharmaceutical compositions, comprising an anti-FGFR2/3 antibody; and polynucleotides comprising sequences encoding an anti-FGFR2/3 antibody.
- compositions comprise one or more antibodies that bind to FGFR2 and FGFR3, and/or one or more polynucleotides comprising sequences encoding one or more antibodies that bind to FGFR2 and FGFR3.
- suitable carriers such as pharmaceutically acceptable excipients including buffers, which are well known in the art.
- the invention also encompasses isolated antibody and polynucleotide embodiments.
- the invention also encompasses substantially pure antibody and polynucleotide
- the invention also encompasses method of treating a disorder, e.g. multiple myeloma or transitional stage carcinoma (e.g., invasive transitional stage carcinoma) using an anti- FGFR2/3 antibody (as described herein or as known in the art).
- a disorder e.g. multiple myeloma or transitional stage carcinoma (e.g., invasive transitional stage carcinoma) using an anti- FGFR2/3 antibody (as described herein or as known in the art).
- the anti-FGFR2/3 antibodies of the invention are preferably monoclonal. Also encompassed within the scope of the invention are Fab, Fab', Fab'-SH and F(ab') 2 fragments of the anti-FGFR2/3 antibodies provided herein. These antibody fragments can be created by traditional means, such as enzymatic digestion, or may be generated by recombinant techniques. Such antibody fragments may be chimeric or humanized. These fragments are useful for the diagnostic and therapeutic purposes set forth below. Monoclonal antibodies are obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Thus, the modifier "monoclonal" indicates the character of the antibody as not being a mixture of discrete antibodies.
- the anti-FGFR2/3 monoclonal antibodies of the invention can be made using the hybridoma method first described by Kohler et al, Nature, 256:495 (1975), or may be made by recombinant DNA methods (U.S. Patent No. 4,816,567).
- a mouse or other appropriate host animal such as a hamster
- a hamster is immunized to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the protein used for immunization.
- Antibodies to FGFR2/3 may be raised in animals by multiple subcutaneous (sc) or intraperitoneal (ip) injections of FGFR2/3 and an adjuvant.
- FGFR2/3 may be prepared using methods well- known in the art, some of which are further described herein. For example, recombinant production of human and mouse FGFR2/3 is described below.
- animals are immunized with a FGFR2/3 fused to the Fc portion of an immunoglobulin heavy chain.
- animals are immunized with a FGFR2/3-IgGl fusion protein.
- Animals ordinarily are immunized against immunogenic conjugates or derivatives of FGFR2/3 with monophosphoryl lipid A (MPL)/trehalose dicrynomycolate (TDM) (Ribi Immunochem. Research, Inc., Hamilton, MT) and the solution is injected intradermally at multiple sites. Two weeks later the animals are boosted. 7 to 14 days later animals are bled and the serum is assayed for anti-FGFR2/3 titer. Animals are boosted until titer plateaus.
- MPL monophosphoryl lipid A
- TDM trehalose dicrynomycolate
- lymphocytes may be immunized in vitro. Lymphocytes then are fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, pp.59-103
- the hybridoma cells thus prepared are seeded and grown in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
- a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells.
- the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
- Preferred myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium.
- preferred myeloma cell lines are murine myeloma lines, such as those derived from MOPC-21 and MPC-11 mouse tumors available from the Salk Institute Cell Distribution Center, San Diego, California USA, and SP-2 or X63-Ag8-653 cells available from the American Type Culture Collection, Rockville, Maryland USA.
- Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and
- Culture medium in which hybridoma cells are growing is assayed for production of monoclonal antibodies directed against FGFR2/3.
- the binding specificity of monoclonal antibodies produced by hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked
- ELISA immunoadsorbent assay
- the binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson et al., Anal. Biochem., 107:220 (1980).
- the clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, Monoclonal Antibodies: Principles and Practice, pp.59- 103 (Academic Press, 1986)).
- Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium.
- the hybridoma cells may be grown in vivo as ascites tumors in an animal.
- the monoclonal antibodies secreted by the subclones are suitably separated from the culture medium, ascites fluid, or serum by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
- the anti-FGFR2/3 antibodies of the invention can be made by using combinatorial libraries to screen for synthetic antibody clones with the desired activity or activities.
- synthetic antibody clones are selected by screening phage libraries containing phage that display various fragments of antibody variable region (Fv) fused to phage coat protein. Such phage libraries are panned by affinity chromatography against the desired antigen. Clones expressing Fv fragments capable of binding to the desired antigen are adsorbed to the antigen and thus separated from the non-binding clones in the library. The binding clones are then eluted from the antigen, and can be further enriched by additional cycles of antigen adsorption/elution.
- Fv antibody variable region
- any of the anti-FGFR3 antibodies of the invention can be obtained by designing a suitable antigen screening procedure to select for the phage clone of interest followed by construction of a full length anti-FGFR2/3 antibody clone using the Fv sequences from the phage clone of interest and suitable constant region (Fc) sequences described in Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, NIH Publication 91-3242, Bethesda MD (1991), vols. 1-3.
- Fc constant region
- the antigen-binding domain of an antibody is formed from two variable (V) regions of about 110 amino acids, one each from the light (VL) and heavy (VH) chains, that both present three hypervariable loops or complementarity-determining regions (CDRs).
- V variable
- VH variable
- CDRs complementarity-determining regions
- Variable domains can be displayed functionally on phage, either as single-chain Fv (scFv) fragments, in which VH and VL are covalently linked through a short, flexible peptide, or as Fab fragments, in which they are each fused to a constant domain and interact non-covalently, as described in Winter et ⁇ ., ⁇ . Rev. Immunol, 12: 433-455 (1994).
- scFv encoding phage clones and Fab encoding phage clones are collectively referred to as "Fv phage clones" or "Fv clones”.
- Repertoires of VH and VL genes can be separately cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which can then be searched for antigen-binding clones as described in Winter et al, Ann. Rev. Immunol, 12: 433-455 (1994).
- Libraries from immunized sources provide high-affinity antibodies to the immunogen without the requirement of constructing hybridomas.
- the naive repertoire can be cloned to provide a single source of human antibodies to a wide range of non-self and also self antigens without any immunization as described by Griffiths et al, EMBO J 12: 725-734 (1993).
- naive libraries can also be made synthetically by cloning the unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro as described by Hoogenboom and Winter, J. Mol Biol, 227: 381-388 (1992).
- Filamentous phage is used to display antibody fragments by fusion to the minor coat protein pill.
- the antibody fragments can be displayed as single chain Fv fragments, in which VH and VL domains are connected on the same polypeptide chain by a flexible polypeptide spacer, e.g., as described by Marks et al, J. Mol Biol, 222: 581-597 (1991), or as Fab fragments, in which one chain is fused to pill and the other is secreted into the bacterial host cell periplasm where assembly of a Fab-coat protein structure which becomes displayed on the phage surface by displacing some of the wild type coat proteins, e.g., as described in Hoogenboom et al., Nucl. Acids Res., 19: 4133-4137 (1991).
- nucleic acids encoding antibody gene fragments are obtained from immune cells harvested from humans or animals. If a library biased in favor of anti-FGFR2/3 clones is desired, the individual is immunized with FGFR2/3 to generate an antibody response, and spleen cells and/or circulating B cells other peripheral blood lymphocytes (PBLs) are recovered for library construction.
- PBLs peripheral blood lymphocytes
- a human antibody gene fragment library biased in favor of anti-FGFR2/3 clones is obtained by generating an anti-FGFR2/3 antibody response in transgenic mice carrying a functional human
- Additional enrichment for anti-FGFR2/3 reactive cell populations can be obtained by using a suitable screening procedure to isolate B cells expressing FGFR2/3-specific membrane bound antibody, e.g., by cell separation with FGFR2/3 affinity chromatography or adsorption of cells to fluorochrome-labeled FGFR2/3 followed by flow-activated cell sorting (FACS).
- FACS flow-activated cell sorting
- spleen cells and/or B cells or other PBLs from an
- unimmunized donor provides a better representation of the possible antibody repertoire, and also permits the construction of an antibody library using any animal (human or non-human) species in which FGFR2/3 is not antigenic.
- stem cells are harvested from the individual to provide nucleic acids encoding unrearranged antibody gene segments.
- the immune cells of interest can be obtained from a variety of animal species, such as human, mouse, rat, lagomorpha, luprine, canine, feline, porcine, bovine, equine, and avian species, etc.
- Nucleic acid encoding antibody variable gene segments are recovered from the cells of interest and amplified.
- the desired DNA can be obtained by isolating genomic DNA or mRNA from lymphocytes followed by polymerase chain reaction (PCR) with primers matching the 5' and 3' ends of rearranged VH and VL genes as described in Orlandi et al, Proc. Natl. Acad. Sci. (USA), 86: 3833-3837 (1989), thereby making diverse V gene repertoires for expression.
- the V genes can be amplified from cDNA and genomic DNA, with back primers at the 5' end of the exon encoding the mature V-domain and forward primers based within the J-segment as described in Orlandi et al. (1989) and in Ward et al, Nature, 341 : 544-546 (1989).
- back primers can also be based in the leader exon as described in Jones et al, Biotechnol, 9: 88-89 (1991), and forward primers within the constant region as described in Sastry et al, Proc. Natl. Acad. Sci. (USA), 86: 5728-5732 (1989).
- degeneracy can be used to maximize complementarity.
- the library diversity is maximized by using PCR primers targeted to each V-gene family in order to amplify all available VH and VL arrangements present in the immune cell nucleic acid sample, e.g. as described in the method of Marks et al, J. Mol. Biol, 222: 581- 597 (1991) or as described in the method of Oram et al, Nucleic Acids Res., 21 : 4491-4498 (1993).
- rare restriction sites can be introduced within the PCR primer as a tag at one end as described in Orlandi et al.
- VH-gene segments can be derived in vitro from V gene segments. Most of the human VH-gene segments have been cloned and sequenced (reported in Tomlinson et al, J. Mol.
- VH repertoires can also be made with all the sequence diversity focused in a long H3 loop of a single length as described in Barbas et al., Proc. Natl. Acad. Sci. USA, 89: 4457-4461 (1992).
- Human VK and ⁇ segments have been cloned and sequenced (reported in Williams and Winter, Eur. J.
- V- gene repertoires based on a range of VH and VL folds, and L3 and H3 lengths, will encode antibodies of considerable structural diversity.
- germline V-gene segments can be rearranged in vitro according to the methods of Hoogenboom and Winter, J. Mol. Biol, 227: 381-388 (1992).
- Repertoires of antibody fragments can be constructed by combining VH and VL gene repertoires together in several ways. Each repertoire can be created in different vectors, and the vectors recombined in vitro, e.g., as described in Hogrefe et al, Gene, 128: 119-126 (1993), or in vivo by combinatorial infection, e.g., the loxP system described in Waterhouse et al, Nucl. Acids Res., 21 :2265-2266 (1993). The in vivo recombination approach exploits the two-chain nature of Fab fragments to overcome the limit on library size imposed by E. coli transformation efficiency.
- Naive VH and VL repertoires are cloned separately, one into a phagemid and the other into a phage vector. The two libraries are then combined by phage infection of phagemid-containing bacteria so that each cell contains a different combination
- Both vectors contain in vivo recombination signals so that the VH and VL genes are recombined onto a single replicon and are co-packaged into phage virions.
- the repertoires may be cloned sequentially into the same vector, e.g., as described in Barbas et al, Proc. Natl Acad. Sci. USA, 88:7978-7982 (1991), or assembled together by PCR and then cloned, e.g. as described in Clackson et al, Nature, 352: 624-628 (1991).
- PCR assembly can also be used to join VH and VL DNAs with DNA encoding a flexible peptide spacer to form single chain Fv (scFv) repertoires.
- in cell PCR assembly is used to combine VH and VL genes within lymphocytes by PCR and then clone repertoires of linked genes as described in Embleton et al , Nucl Acids Res. , 20:3831-3837 (1992).
- the antibodies produced by naive libraries can be of moderate affinity (K ⁇ f 1 of about 10 6 to 10 7 M "1 ), but affinity maturation can also be mimicked in vitro by constructing and reselecting from secondary libraries as described in Winter et al (1994), supra.
- mutations can be introduced at random in vitro by using error- prone polymerase (reported in Leung et al, Technique, 1 : 1230-232 and 236-247 (1989)) in the method of Hawkins et al, J. Mol. Biol, 226: 889-896 (1992) or in the method of Gram et al, Proc. Natl Acad. Sci USA, 89: 3576-3580 (1992).
- affinity maturation can be performed by randomly mutating one or more CDRs, e.g. using PCR with primers carrying random sequence spanning the CDR of interest, in selected individual Fv clones and screening for higher affinity clones.
- WO 96/07754 published 14 March 1996) described a method for inducing mutagenesis in a complementarity determining region of an
- immunoglobulin light chain to create a library of light chain genes.
- Another effective approach is to recombine the VH or VL domains selected by phage display with repertoires of naturally occurring V domain variants obtained from unimmunized donors and screen for higher affinity in several rounds of chain reshuffling as described in Marks et al., BiotechnoL, 10:779-783 (1992). This technique allows the production of antibodies and antibody fragments with affinities in the 10 "9 M range.
- FGFR2 and FGFR3 nucleic acid and amino acid sequences are known in the art. Nucleic acid sequence encoding the FGFR2 and FGFR3 can be designed using the amino acid sequence of the desired region of FGFR2 and FGFR3. For example, the FGFR3 can be designed using the amino acid sequence of R3Mab As is well-known in the art, there are two major splice isoforms of FGFR3, FGFR3 Illb and FGFR3 IIIc. FGFR3 sequences are well- known in the art and may include the sequence of UniProKB/Swiss-Prot accession number P22607 (FGFR3 IIIc) or P22607 2 (FGFR3 Illb).
- FGFR2 and FGFR3 mutations have been identified and are well-known in the art and include the following mutations (with reference to the sequences shown in UniProKB/Swiss-Prot accession number P22607 (FGFR3 IIIc) or P22607 2 (FGFR3 Illb):
- Nucleic acids encoding FGFR2 and/or FGFR3 can be prepared by a variety of methods known in the art. These methods include, but are not limited to, chemical synthesis by any of the methods described in Engels et al., Agnew. Chem. Int. Ed. Engl., 28: 716-734 (1989), such as the triester, phosphite, phosphoramidite and H-phosphonate methods. In one embodiment, codons preferred by the expression host cell are used in the design of the FGFR2 and/or FGFR3 encoding DNA. Alternatively, DNA encoding FGFR2 and/or FGFR3 can be isolated from a genomic or cDNA library.
- the DNA molecule is operably linked to an expression control sequence in an expression vector, such as a plasmid, wherein the control sequence is recognized by a host cell transformed with the vector.
- an expression vector such as a plasmid
- plasmid vectors contain replication and control sequences which are derived from species compatible with the host cell.
- the vector ordinarily carries a replication site, as well as sequences which encode proteins that are capable of providing phenotypic selection in transformed cells.
- Suitable vectors for expression in prokaryotic and eukaryotic host cells are known in the art and some are further described herein. Eukaryotic organisms, such as yeasts, or cells derived from multicellular organisms, such as mammals, may be used.
- the DNA encoding the FGFR2 and/or FGFR3 is operably linked to a secretory leader sequence resulting in secretion of the expression product by the host cell into the culture medium.
- secretory leader sequences include stll, ecotin, lamB, herpes GD, lpp, alkaline phosphatase, invertase, and alpha factor.
- secretory leader sequences include stll, ecotin, lamB, herpes GD, lpp, alkaline phosphatase, invertase, and alpha factor.
- secretory leader sequences include stll, ecotin, lamB, herpes GD, lpp, alkaline phosphatase, invertase, and alpha factor.
- 36 amino acid leader sequence of protein A Abrahmsen et ⁇ ., ⁇ J, 4: 3901 (1985)).
- Host cells are transfected and preferably transformed with the above-described expression or cloning vectors of this invention and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
- Transfection refers to the taking up of an expression vector by a host cell whether or not any coding sequences are in fact expressed. Numerous methods of transfection are known to the ordinarily skilled artisan, for example, CaP0 4 precipitation and electroporation. Successful transfection is generally recognized when any indication of the operation of this vector occurs within the host cell. Methods for transfection are well known in the art, and some are further described herein.
- Transformation means introducing DNA into an organism so that the DNA is replicable, either as an extrachromosomal element or by chromosomal integrant. Depending on the host cell used, transformation is done using standard techniques appropriate to such cells. Methods for transformation are well known in the art, and some are further described herein.
- Prokaryotic host cells used to produce the FGFR2 and/or FGFR3 can be cultured as described generally in Sambrook et al. , supra.
- the mammalian host cells used to produce the FGFR2 and/or FGFR3 can be cultured in a variety of media, which is well known in the art and some of which is described herein.
- the host cells referred to in this disclosure encompass cells in in vitro culture as well as cells that are within a host animal.
- FGFR2 and/or FGFR3 Purification of FGFR2 and/or FGFR3 may be accomplished using art-recognized methods, some of which are described herein.
- the purified FGFR2 and/or FGFR3 can be attached to a suitable matrix such as agarose beads, acrylamide beads, glass beads, cellulose, various acrylic copolymers, hydroxyl methacrylate gels, polyacrylic and polymethacrylic copolymers, nylon, neutral and ionic carriers, and the like, for use in the affinity chromatographic separation of phage display clones.
- a suitable matrix such as agarose beads, acrylamide beads, glass beads, cellulose, various acrylic copolymers, hydroxyl methacrylate gels, polyacrylic and polymethacrylic copolymers, nylon, neutral and ionic carriers, and the like.
- Attachment of the FGFR2 and/or FGFR3 protein to the matrix can be accomplished by the methods described in Methods in Enzymology, vol. 44 (1976).
- a commonly employed technique for attaching protein ligands to polysaccharide matrices e.g.
- FGFR2 and/or FGFR3 can be used to coat the wells of adsorption plates, expressed on host cells affixed to adsorption plates or used in cell sorting, or conjugated to biotin for capture with streptavidin-coated beads, or used in any other art- known method for panning phage display libraries.
- the phage library samples are contacted with immobilized FGFR2 and/or FGFR3 under conditions suitable for binding of at least a portion of the phage particles with the adsorbent. Normally, the conditions, including pH, ionic strength, temperature and the like are selected to mimic physiological conditions.
- the phages bound to the solid phase are washed and then eluted by acid, e.g. as described in Barbas et al., Proc. Natl. Acad. Sci USA, 88: 7978-7982 (1991), or by alkali, e.g. as described in Marks et al, J. Mol. Biol, 222: 581- 597 (1991), or by FGFR3 antigen competition, e.g.
- Phages can be enriched 20-1,000-fold in a single round of selection. Moreover, the enriched phages can be grown in bacterial culture and subjected to further rounds of selection.
- the efficiency of selection depends on many factors, including the kinetics of dissociation during washing, and whether multiple antibody fragments on a single phage can simultaneously engage with antigen.
- Antibodies with fast dissociation kinetics (and weak binding affinities) can be retained by use of short washes, multivalent phage display and high coating density of antigen in solid phase. The high density not only stabilizes the phage through multivalent interactions, but favors rebinding of phage that has dissociated.
- phages can be incubated with excess biotinylated FGFR2 and/or FGFR3, but with the biotinylated FGFR2 and/or FGFR3 at a concentration of lower molarity than the target molar affinity constant for FGFR2 and/or FGFR3.
- the high affinity-binding phages can then be captured by streptavidin-coated paramagnetic beads.
- FGFR2/3 clones may be activity selected.
- the invention provides
- FGFR2/3 antibodies that block the binding between a FGFR3 receptor and its ligand (such as FGF1 and/or FGF9) and FGFR2 and its ligand.
- Fv clones corresponding to such FGFR2/3 antibodies can be selected by (1) isolating FGFR2/3 clones from a phage library as described above, and optionally amplifying the isolated population of phage clones by growing up the population in a suitable bacterial host; (2) selecting FGFR2/3 and a second protein against which blocking and non-blocking activity, respectively, is desired; (3) adsorbing the anti- FGFR2/3 phage clones to immobilized FGFR2/3; (4) using an excess of the second protein to elute any undesired clones that recognize FGFR2/3 -binding determinants which overlap or are shared with the binding determinants of the second protein; and (5) eluting the clones which remain adsorbed following step (4).
- DNA encoding the hybridoma-derived monoclonal antibodies or phage display Fv clones of the invention is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide primers designed to specifically amplify the heavy and light chain coding regions of interest from hybridoma or phage DNA template).
- the DNA can be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of the desired monoclonal antibodies in the recombinant host cells.
- host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of the desired monoclonal antibodies in the recombinant host cells.
- DNA encoding the Fv clones of the invention can be combined with known DNA sequences encoding heavy chain and/or light chain constant regions (e.g., the appropriate DNA sequences can be obtained from Kabat et al, supra) to form clones encoding full or partial length heavy and/or light chains.
- constant regions of any isotype can be used for this purpose, including IgG, IgM, IgA, IgD, and IgE constant regions, and that such constant regions can be obtained from any human or animal species.
- a Fv clone derived from the variable domain DNA of one animal (such as human) species and then fused to constant region DNA of another animal species to form coding sequence(s) for "hybrid," full length heavy chain and/or light chain is included in the definition of "chimeric” and "hybrid” antibody as used herein.
- a Fv clone derived from human variable DNA is fused to human constant region DNA to form coding sequence(s) for all human, full or partial length heavy and/or light chains.
- DNA encoding anti-FGFR2/3 antibody derived from a hybridoma of the invention can also be modified, for example, by substituting the coding sequence for human heavy- and light-chain constant domains in place of homologous murine sequences derived from the hybridoma clone (e.g., as in the method of Morrison et ah, Proc. Natl. Acad. Sci. USA, 81 :6851 -6855 (1984)).
- DNA encoding a hybridoma or Fv clone-derived antibody or fragment can be further modified by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. In this manner, "chimeric" or “hybrid” antibodies are prepared that have the binding specificity of the Fv clone or hybridoma clone-derived antibodies of the invention.
- the invention is based, in part, on the discovery of bispecific antibodies that bind to both KLB and FGFR2/3 ("FGFR2/3 + KLB bispecific antibodies").
- the FGFR2/3 + KLB bispecific antibodies can be used in the treatment of metabolic diseases and disdorders, such treatment resulting in weight loss and/or improvement in glucose and lipid metabolism without a significant impact on the liver and without significant loss in bone mass.
- the FGFR2/3 + KLB bispecific antibodies can be used in the treatment of NASH.
- the FGFR2/3 + KLB bispecific antibodies disclosed herein comprise a first arm of any of the anti-FGFR2/3 antibodies disclosed herein and a second arm of any anti-KLB antibody disclosed herein or disclosed in US20150218276 which is incorporated herein in its entirity.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure does not have a significant impact on the liver, e.g., liver function.. In certain embodiments, an FGFR2/3 + KLB bispecific antibody of the present disclosure does not modulate the activity of an FGFR/KLB receptor complex in the liver as compared to the modulation of an FGFR/KLB receptor complex in the liver by an FGF21 protein. In certain embodiments, an FGFR2/3 + KLB bispecific antibody of the present disclosure does not result in the inhibition of the FGFR4/KLB complex and/or does not result in the elevation of liver enzymes such as, but not limited to, ALT, AST, ALP and GLDH. In certain
- an FGFR2/3 + KLB bispecific antibody of the present disclosure does not function as an agonist of the FGFR2c/KLB complex and/or the FGFR3c/KLB complex in the liver, which can lead to activated MAPK signaling and/or altered expression of Spry4 and Dusp6 in the liver.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure does not result in the activation of MAPK signaling in the liver as compared to the activation of MAPK signaling by an FGF21 protein.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure does not function as an agonist of the FGFR4/KLB complex in the liver.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure can be humanized.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure comprises an acceptor human framework, e.g. , a human immunoglobulin framework or a human consensus framework.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure can be a monoclonal antibody, including a chimeric, humanized or human antibody.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure can be an antibody fragment, e.g., a Fv, Fab, Fab', scFv, diabody, or F(ab') 2 fragment.
- the FGFR2/3 + KLB bispecific antibody is a full length antibody, e.g., an intact IgGl antibody, or other antibody class or isotype as defined herein.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure can incorporate any of the features, singly or in combination, as described in detailed below.
- FGFR2/3 + KLB bispecific antibodies of the present disclosure are useful, e.g., for the diagnosis or treatment of metabolic disorders.
- metabolic disorders include polycystic ovary syndrome (PCOS), metabolic syndrome (MetS), obesity, nonalcoholic steatohepatitis (NASH), non-alcoholic fatty liver disease (NAFLD),
- the metabolic disease is NASH.
- the FGFR2/3 + KLB bispecific antibodies of the present disclosure are can be used, e.g., for the diagnosis or treatment of metabolic disorders.
- metabolic disorders include polycystic ovary syndrome (PCOS), metabolic syndrome (MetS), obesity, non-alcoholic steatohepatitis (NASH), non-alcoholic fatty liver disease (NAFLD), hyperlipidemia, hypertension, type 2 diabetes, non-type 2 diabetes, type 1 diabetes, latent autoimmune diabetes (LAD), maturity onset diabetes of the young (MODY), and aging and related diseases such as Alzheimer's disease, Parkinson's disease and ALS.
- the metabolic disease is NASH.
- the present disclosure provides isolated antibodies that bind to a KLB protein.
- an anti-KLB antibody of the present disclosure binds to the C-terminal domain of KLB.
- an anti-KLB antibody of the present disclosure binds to a fragment of KLB that comprises the amino acid sequence
- the antibody binds to the same epitope as an anti-KLB antibody, e.g., 8C5, described herein.
- an anti-KLB antibody of the present disclosure comprises at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising an amino acid sequence of any one of SEQ ID NOs: 230-232 and 236-247, e.g., 244 or 247; (b) HVR- H2 comprising an amino acid sequence of any one of SEQ ID NOs: 142 and 248-262 , e.g., 259 or 262; (c) HVR-H3 comprising an amino acid sequence of any one of SEQ ID NOs: 263-278, e.g., 166 or 169; (d) HVR-L1 comprising an amino acid sequence of any one of SEQ ID NOs: 279-293, e.g., Ill or 184; (e) HVR-L2 comprising an amino acid sequence of any one of SEQ ID NOs: 294-309, e.g., 197 or 200; and (f) HVR-L3
- the present disclosure provides an anti-KLB antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising SEQ ID NO: 119; (b) HVR-H2 comprising SEQ ID NO: 150; (c) HVR-H3 comprising SEQ ID NO: 166; (d) HVR-L1 comprising SEQ ID NO: 171; (e) HVR-L2 comprising SEQ ID NO: 197; and (f) HVR-L3 comprising SEQ ID NO: 212.
- HVR-H1 comprising SEQ ID NO: 119
- HVR-H2 comprising SEQ ID NO: 150
- HVR-H3 comprising SEQ ID NO: 166
- HVR-L1 comprising SEQ ID NO: 171
- HVR-L2 comprising SEQ ID NO: 197
- HVR-L3 comprising SEQ ID NO: 212.
- the present disclosure provides an anti-KLB antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-Hl comprising SEQ ID NO: 122; (b) HVR-H2 comprising SEQ ID NO 153; (c) HVR-H3 comprising SEQ ID NO: 169; (d) HVR-L1 comprising SEQ ID NO 184; (e) HVR-L2 comprising SEQ ID NO: 200; and (f) HVR-L3 comprising SEQ ID NO: 215.
- HVR-Hl comprising SEQ ID NO: 122
- HVR-H2 comprising SEQ ID NO 153
- HVR-H3 comprising SEQ ID NO: 169
- HVR-L1 comprising SEQ ID NO 184
- HVR-L2 comprising SEQ ID NO: 200
- HVR-L3 comprising SEQ ID NO: 215.
- the present disclosure further provides an anti-KLB antibody that comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 104.
- VH heavy chain variable domain
- a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%o, 97%), 98%o, or 99%> identity contains substitutions ⁇ e.g., conservative substitutions as disclosed below), insertions, or deletions relative to the reference sequence, but an anti-KLB antibody comprising that sequence retains the ability to bind to KLB.
- the anti-KLB antibody comprises the VH sequence in SEQ ID NO: 104, including post-translational modifications of that sequence as disclosed below.
- the VH comprises one, two or three HVRs selected from: (a) HVR-H1 comprising the amino acid sequence of SEQ ID NO: 122, (b) HVR-H2 comprising the amino acid sequence of SEQ ID NO: 153, and (c) HVR-H3 comprising the amino acid sequence of SEQ ID NO: 169.
- the present disclosure provides an anti-KLB antibody, wherein the antibody comprises a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 105.
- VL light chain variable domain
- a VL sequence having at least 90%>, 91 >, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-KLB antibody comprising that sequence retains the ability to bind to KLB.
- the anti-KLB antibody comprises the VL sequence in SEQ ID NO: 105, including post-translational modifications of that sequence.
- the VL comprises one, two or three HVRs selected from (a) HVR-L1 comprising the amino acid sequence of SEQ ID NO: 184; (b) HVR-L2 comprising the amino acid sequence of SEQ ID NO: 200; and (c) HVR-L3 comprising the amino acid sequence of SEQ ID NO: 215.
- the present disclosure further provides an anti-KLB antibody, wherein the antibody comprises a VH as in any of the embodiments provided above, and a VL as in any of the embodiments provided above.
- the antibody comprises the VH and VL sequences in SEQ ID NO: 104 and SEQ ID NO: 105, respectively, including post- translational modifications of those sequences.
- an anti-KLB antibody binds to a fragment of KLB consisting of the amino acid sequence S SPTRLAVIP WGVRKLLRWVRRNYGDMDIYIT AS (SEQ ID NO: 103).
- the present disclosure further provides bispecific antibodies that bind to both KLB and FGFR2/3 ⁇ i.e., FGFR2/3 + KLB bispecific antibodies).
- a bispecific antibody has two different binding specificities, see, e.g., U.S. Patent Nos. 5,922,845 and 5,837,243; Zeilder (1999) J. Immunol. 163: 1246-1252; Somasundaram (1999) Hum. Antibodies 9:47-54; Keler (1997) Cancer Res. 57:4008-4014.
- the presently disclosed subject matter provides bispecific antibodies having one binding site ⁇ e.g., antigen binding site) for a first epitope present on KLB and a second binding site for a second epitope present on FGFR2/3.
- the present disclosure provides an antibody where one arm binds KLB and comprises any of the anti-KLB antibody sequences described herein and the second arm binds to FGFR2/3 and comprises any of the anti-FGFR2/3 antibody sequences described herein.
- an FGFR2/3 + KLB bispecific antibody of the present disclosure has one binding site for a first epitope present on KLB and a second binding site for a second epitope present on FGFR2/3.
- an FGFR2/3 + KLB bispecific antibody, or an antigen- binding portion thereof includes a heavy chain and a light chain region.
- the full length heavy chain includes amino acids having a sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence set forth in SEQ ID NO: 106.
- the full length light chain includes amino acids having a sequence that is at least 90%>, 91 >, 92%, 93%>, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence set forth in SEQ ID NO: 107.
- the full length heavy chain includes amino acids having the sequence set forth in SEQ ID NO: 106.
- the full length light chain includes amino acids having the sequence set forth in SEQ ID NO: 107.
- an FGFR2/3 + KLB bispecific antibody, or an antigen- binding portion thereof includes a heavy chain variable region and a light chain variable region.
- the heavy chain variable region includes amino acids having a sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence set forth in SEQ ID NO: 104.
- the light chain variable region includes amino acids having a sequence that is at least 90%>, 91 >, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence set forth in SEQ ID NO: 105.
- the heavy chain variable region includes amino acids having the sequence set forth in SEQ ID NO: 104.
- the light chain variable region includes amino acids having the sequence set forth in SEQ ID NO: 105.
- an FGFR2/3 + KLB bispecific antibody comprises at least one, two, three, four, five, or six HVRs selected from (a) HVR-Hl comprising an amino acid sequence of any one of SEQ ID NOs: 230-232 and 236-247, e.g., 244 or 247; (b) HVR-H2 comprising an amino acid sequence of any one of SEQ ID NOs: 142 and 248-262 , e.g., 259 or 262; (c) HVR-H3 comprising an amino acid sequence of any one of SEQ ID NOs: 263- 278, e.g., 275 or 278; (d) HVR-L1 comprising an amino acid sequence of any one of SEQ ID NOs: 279-293, e.g., 280 or 293; (e) HVR-L2 comprising an amino acid sequence of any one of SEQ ID NOs: 294-309, e.g., 306 or 309; and (f) HVRs selected from
- an FGFR2/3 + KLB bispecific antibody comprises at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising SEQ ID NO: 119; (b) HVR-H2 comprising SEQ ID NO: 150; (c) HVR-H3 comprising SEQ ID NO: 166; (d) HVR-Ll comprising SEQ ID NO: 171; (e) HVR-L2 comprising SEQ ID NO: 197; and (f) HVR-L3 comprising SEQ ID NO: 212.
- the present disclosure provides an anti-KLB antibody comprising at least one, two, three, four, five, or six HVRs selected from (a) HVR-H1 comprising SEQ ID NO: 122; (b) HVR-H2 comprising SEQ ID NO: 153; (c) HVR-H3 comprising SEQ ID NO: 169; (d) HVR-Ll comprising SEQ ID NO: 184; (e) HVR-L2 comprising SEQ ID NO: 200; and (f) HVR-L3 comprising SEQ ID NO: 215.
- HVR-H1 comprising SEQ ID NO: 122
- HVR-H2 comprising SEQ ID NO: 153
- HVR-H3 comprising SEQ ID NO: 169
- HVR-Ll comprising SEQ ID NO: 184
- HVR-L2 comprising SEQ ID NO: 200
- HVR-L3 comprising SEQ ID NO: 215.
- an FGFR2/3 + KLB bispecific antibody includes a heavy chain variable region that comprises CDRl, CDR2, and CDR3 domains, and a light chain variable region that comprises CDRl, CDR2, and CDR3 domains.
- the heavy chain variable region CDRl domain includes an amino acid sequence having a sequence set forth in SEQ ID NO: 230-232 and 236-247.
- the heavy chain variable region CDR2 domain includes an amino acid sequence a sequence set forth in SEQ ID NO: 142 and 248-262 .
- the heavy chain variable region CDR3 domain includes an amino acid sequence having a sequence that is at least 90%, 91 >, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 263-278.
- the light chain variable region CDRl domain includes an amino acid sequence having a sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 279-293.
- the light chain variable region CDR2 domain includes an amino acid sequence having a sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 294-309.
- the light chain variable region CDR3 domain includes an amino acid sequence having a sequence that is at least 90%>, 91 >, 92%, 93%>, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 310-324.
- an FGFR2/3 + KLB bispecific antibody includes a heavy chain variable region that comprises CDRl, CDR2, and CDR3 domains, and a light chain variable region that comprises CDRl, CDR2, and CDR3 domains.
- the heavy chain variable region CDRl domain includes an amino acid sequence having a sequence set forth in SEQ ID NO: 230-232 and 236-247.
- the heavy chain variable region CDR2 domain includes an amino acid sequence having a sequence set forth in SEQ ID NO: 103 and 248-262 .
- the heavy chain variable region CDR3 domain includes an amino acid sequence having a sequence set forth in SEQ ID NO: 263-278.
- the light chain variable region CDRl domain includes an amino acid sequence having a sequence set forth in SEQ ID NO: 279-293.
- the light chain variable region CDR2 domain includes an amino acid sequence having a sequence set forth in SEQ ID NO: 294-309.
- the light chain variable region CDR3 domain includes an amino acid sequence having a sequence set forth in SEQ ID NO: 310-324.
- an FGFR2/3 + KLB bispecific antibody includes a heavy chain variable region CDRl having the sequence set forth in SEQ ID NO: 122; a heavy chain variable region CDR2 having the sequence set forth in SEQ ID NO: 153; a heavy chain variable region CDR3 having the sequence set forth in SEQ ID NO: 169; a light chain variable region CDRl having the sequence set forth in SEQ ID NO: 184; a light chain variable region CDR2 having the sequence set forth in SEQ ID NO: 200; and a light chain variable region CDR3 having the sequence set forth in SEQ ID NO: 215.
- an FGFR2/3 + KLB bispecific antibody includes a first antibody, or antigen binding portion thereof, and includes a second antibody, or antigen binding portion thereof, where the first antibody, or antigen binding portion thereof, binds to an epitope present on KLB, and the second antibody, or antigen binding portion thereof, bind to an epitope present on FGFR2/3.
- the first antibody, or antigen binding portion thereof can include a heavy chain variable region and a light chain variable region; and the second antibody, or antigen binding portion thereof, can include a heavy chain variable region and a light chain variable region.
- the heavy chain variable region of the first antibody, or antigen binding portion thereof includes amino acids having a sequence that is at least 90%, 91 >, 92%, 93%>, 94%>, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence set forth in SEQ ID NO: 104.
- the light chain variable region of the first antibody, or antigen binding portions thereof includes amino acids having a sequence that is at least 90%>, 91 >, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence set forth in SEQ ID NO: 105.
- the heavy chain of the second antibody (anti- FGFR2/3 antibody) or antigen binding portion thereof includes amino acids having a sequence that is at least 60%, 70%, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence set forth in SEQ ID NO: 282.
- the light chain of the second antibody includes amino acids having a sequence that is at least 60%>, 70%>, 80%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence set forth in SEQ ID NO: 283.
- an FGFR2/3 + KLB bispecific antibody that binds to the same epitope as an anti-KLB antibody is provided herein.
- an FGFR2/3 + KLB bispecific antibody that binds to the same epitope as an anti-KLB antibody is provided herein.
- an FGFR2/3 + KLB bispecific antibody that binds to the same epitope as an anti-KLB antibody comprising the VH sequence of SEQ ID NO: 104 and a VL sequence of SEQ ID NO: 105.
- an FGFR2/3 + KLB bispecific antibody is provided that binds to a fragment of KLB consisting of the amino acid sequence SSPTRLAVIPWGVRKLLRWVRRNYGDMDIYITAS (SEQ ID NO: 103).
- an FGFR2/3 + KLB bispecific antibody that binds to a fragment of KLB having an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence set forth in SEQ ID NO: 103.
- an FGFR2/3 + KLB bispecific antibody binds to the same epitope as an anti-KLB antibody is provided herein.
- an FGFR2/3 + KLB bispecific antibody is provided that binds to the same epitope as an anti- KLB antibody comprising the full length heavy chain sequence of SEQ ID NO: 106 and a full length light chain sequence of SEQ ID NO: 107.
- the present disclosure provides an FGFR2/3 + KLB bispecific antibody that binds to the same epitope as an anti-FGFR2/3 antibody provided herein.
- an FGFR2/3 + KLB bispecific antibody is provided that binds to the same epitope as an anti-FGFR2/3 antibody comprising the VH sequence of SEQ ID NO: 82 and a VL sequence of SEQ ID NO: 66.
- an FGFR2/3 + KLB bispecific antibody that binds to an epitope on FGFR2 comprising amino acid sequence TNTEKMEKRLHAVPAANTVKFRCPA (SEQ ID NO: 91) and/or YKVRNQHWSLIMES (SEQ ID NO: 92) and/or also binds to an epitope on FGFR3 comprising amino acid sequence TRPERMDKKLLAVPAANTVRFRCPA (SEQ ID NO: 93) and/or IKLRHQQWSLVMES (SEQ ID NO: 94).
- the present disclosure provides an FGFR2/3 + KLB bispecific antibody that binds to the same epitope as an anti-FGFR2/3 antibody provided herein.
- an FGFR2/3 + KLB bispecific antibody that binds to the same epitope as the 2B.1.3.12, 2B.1.3.10, or the 2B.1.1.6 anti- FGFR2/3 antibodies disclosed herein.
- an FGFR2/3 + KLB bispecific antibody is provided that binds to the same epitopes as the anti-FGFR2/3 antibodies
- 2B.1.3.10 and 2B.1.3.12 i.e., the FGFR2/3 + KLB bispecific antibody binds to the same epitope(s) on FGFR2 comprising amino acid sequence
- TNTEKMEKRLHAVPAANTVKFRCPA (SEQ ID NO: 91) and/or YKVRNQHWSLIMES (SEQ ID NO: 92) and/or also binds to the same epitope(s) on FGFR3 comprising amino acid sequence TRPERMDKKLLAVPAANTVRFRCPA (SEQ ID NO: 93) and/or
- IKLRHQQWSLVMES SEQ ID NO: 94 as the 2B.1.3.10 and 2B.1.3.12 do).
- the present disclosure provides an FGFR2/3 + KLB bispecific antibody that competes for binding to FGFR2/3 with the 2B.1.3.10 and 2B.1.3.12 antibodies provided herein.
- an FGFR2/3 + KLB bispecific antibody that binds to a fragment of KLB having an amino acid sequence that is at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the sequence set forth in SEQ ID NO: 103, and binds to or competes for binding to the FGFR2 epitopes selected from TNTEKMEKRLHAVPAANTVKFRCPA (SEQ ID NO : 91 ) and YKVRNQHWSLIMES (SEQ ID NO: 92) and binds to or competes for biding to the FGFR3 epitopes selected from TRPERMDKKLLAVPAANTVRFRCPA (SEQ ID NO: 93) and IKLRHQQWSLVMES (SEQ ID NO: 94).
- an anti-KLB/anti-FGFRl bispecific antibody that binds to a fragment of KLB having the amino acid sequence set forth in SEQ ID NO: 103 and binds to or competes for binding to the FGFR2 epitopes provided in SEQ ID NOs: 91 and 92 and binds to or competes for binding to the FGFR3 epitopes provided in SEQ ID NOs: 93 and 94.
- the present invention encompasses antibody fragments. In certain circumstances there are advantages of using antibody fragments, rather than whole antibodies. The smaller size of the fragments allows for rapid clearance, and may lead to improved access to solid tumors.
- F(ab') 2 fragments can be isolated directly from recombinant host cell culture.
- Fab and F(ab') 2 fragment with increased in vivo half-life comprising a salvage receptor binding epitope residues are described in U.S. Pat. No.
- the antibody of choice is a single chain Fv fragment (scFv) (see, e.g., WO 93/16185; U.S. Pat. Nos. 5,571,894 and 5,587,458).
- Fv and sFv are the only species with intact combining sites that are devoid of constant regions; thus, they are suitable for reduced nonspecific binding during in vivo use.
- sFv fusion proteins may be constructed to yield fusion of an effector protein at either the amino or the carboxy terminus of an sFv. See Antibody Engineering, ed. Borrebaeck, supra. The antibody
- fragment may also be a "linear antibody,” e.g., as described, for example, in U.S. Pat. No.
- Such linear antibody fragments may be monospecific or bispecific.
- the present invention encompasses humanized antibodies.
- Various methods for humanizing non-human antibodies are known in the art.
- a humanized antibody can have one or more amino acid residues introduced into it from a source which is non- human. These non-human amino acid residues are often referred to as "import" residues, which are typically taken from an "import” variable domain. Humanization can be
- humanized antibodies are chimeric antibodies (U.S. Patent No. 4,816,567) wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non- human species.
- humanized antibodies are typically human antibodies in which some hypervariable region residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
- variable domains both light and heavy
- sequence of the variable domain of a rodent antibody is screened against the entire library of known human variable-domain sequences.
- the human sequence which is closest to that of the rodent is then accepted as the human framework for the humanized antibody (Sims et al. (1993) J. Immunol. 151 :2296; Chothia et a/. (1987) J. Mol. Biol. 196:901.
- Another method uses a particular framework derived from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains.
- the same framework may be used for several different humanized antibodies (Carter et al. (1992) Proc. Natl. Acad. Sci. USA, 89:4285; Presta et al. (1993) J. Immunol, 151 :2623.
- humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional immunoglobulin models are commonly
- FR residues can be selected and combined from the recipient and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen(s), is achieved.
- the hypervariable region residues are directly and most substantially involved in influencing antigen binding.
- Human anti-FGFR2/3 antibodies of the invention can be constructed by combining Fv clone variable domain sequence(s) selected from human-derived phage display libraries with known human constant domain sequences(s) as described above.
- human monoclonal anti-FGFR2/3 antibodies of the invention can be made by the hybridoma method.
- Human myeloma and mouse-human heteromyeloma cell lines for the production of human monoclonal antibodies have been described, for example, by Kozbor J. Immunol, 133:3001 (1984); Brodeur et al, Monoclonal Antibody Production Techniques and Applications, pp. 51-63 (Marcel Dekker, Inc., New York, 1987); and Boerner et al., J. Immunol., 147:86 (1991).
- transgenic animals e.g., mice
- transgenic animals e.g., mice
- JH antibody heavy-chain joining region
- Jakobovits et al Proc. Natl. Acad. Sci USA, 90: 2551 (1993); Jakobovits et al, Nature, 362: 255 (1993); Bruggermann et al, Year in Immunol, 7:33 (1993).
- Gene shuffling can also be used to derive human antibodies from non-human, e.g., rodent, antibodies, where the human antibody has similar affinities and specificities to the starting non-human antibody.
- this method which is also called "epitope imprinting" either the heavy or light chain variable region of a non-human antibody fragment obtained by phage display techniques as described above is replaced with a repertoire of human V domain genes, creating a population of non-human chain/human chain scFv or Fab chimeras.
- Bispecific antibodies are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens. In the present case, one of the binding specificities is for FGFR3 and the other is for FGFR2. Bispecific antibodies may also be used to localize cytotoxic agents to cells which express FGFR3, FGFR2, or FGFR2/3. Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g., F(ab') 2 bispecific antibodies).
- bispecific antibodies are known in the art. Traditionally, the recombinant production of bispecific antibodies is based on the co-expression of two immunoglobulin heavy chain-light chain pairs, where the two heavy chains have different specificities (Milstein and Cuello, Nature, 305: 537 (1983)). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of 10 different antibody molecules, of which only one has the correct bispecific structure. The purification of the correct molecule, which is usually done by affinity chromatography steps, is rather cumbersome, and the product yields are low. Similar procedures are disclosed in WO 93/08829 published May 13, 1993, and in
- antibody variable domains with the desired binding specificities are fused to
- the fusion preferably is with an
- immunoglobulin heavy chain constant domain comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CHI), containing the site necessary for light chain binding, present in at least one of the fusions.
- CHI first heavy-chain constant region
- immunoglobulin light chain are inserted into separate expression vectors, and are co- transfected into a suitable host organism. This provides for great flexibility in adjusting the mutual proportions of the three polypeptide fragments in embodiments when unequal ratios of the three polypeptide chains used in the construction provide the optimum yields. It is, however, possible to insert the coding sequences for two or all three polypeptide chains in one expression vector when the expression of at least two polypeptide chains in equal ratios results in high yields or when the ratios are of no particular significance.
- the bispecific antibodies are composed of a hybrid immunoglobulin heavy chain with a first binding specificity in one arm, and a hybrid immunoglobulin heavy chain-light chain pair (providing a second binding specificity) in the other arm. It was found that this asymmetric structure facilitates the separation of the desired bispecific compound from unwanted immunoglobulin chain combinations, as the presence of an immunoglobulin light chain in only one half of the bispecific molecule provides for a facile way of separation. This approach is disclosed in WO 94/04690. For further details of generating bispecific antibodies see, for example, Suresh et ah, Methods in Enzymology, 121 :210 (1986).
- the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture.
- the preferred interface comprises at least a part of the C H 3 domain of an antibody constant domain.
- one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g., tyrosine or tryptophan).
- Compensatory "cavities" of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g., alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.
- Bispecific antibodies include cross-linked or "heteroconjugate” antibodies.
- one of the antibodies in the heteroconjugate can be coupled to avidin, the other to biotin.
- Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (US Patent No. 4,676,980), and for treatment of HIV infection (WO
- Heteroconjugate antibodies may be made using any convenient cross-linking methods. Suitable cross-linking agents are well known in the art, and are disclosed in US Patent No. 4,676,980, along with a number of cross-linking techniques.
- bispecific antibodies can be prepared using chemical linkage.
- Brennan et ah, Science, 229: 81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab') 2 fragments. These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation.
- the Fab' fragments generated are then converted to thionitrobenzoate (TNB) derivatives.
- One of the Fab'-TNB derivatives is then reconverted to the Fab'-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab'-TNB derivative to form the bispecific antibody.
- the bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.
- bispecific antibodies have been produced using leucine zippers.
- the leucine zipper peptides from the Fos and Jun proteins were linked to the Fab' portions of two different antibodies by gene fusion.
- the antibody homodimers were reduced at the hinge region to form monomers and then re -oxidized to form the antibody
- the "diabody” technology described by Hollinger et al, Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993) has provided an alternative mechanism for making bispecific antibody fragments.
- the fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen-binding sites.
- Another strategy for making bispecific antibody fragments by the use of single-chain Fv (sFv) dimers has also been reported. See Gruber et al, J. Immunol, 152:5368 (1994).
- Antibodies with more than two valencies are contemplated.
- trispecific antibodies can be prepared. Tutt et al. J. Immunol. 147: 60 (1991).
- a multivalent antibody may be internalized (and/or catabolized) faster than a bivalent antibody by a cell expressing an antigen to which the antibodies bind.
- the antibodies of the present invention can be multivalent antibodies (which are other than of the IgM class) with three or more antigen binding sites (e.g. tetravalent antibodies), which can be readily produced by recombinant expression of nucleic acid encoding the polypeptide chains of the antibody.
- the multivalent antibody can comprise a dimerization domain and three or more antigen binding sites.
- the preferred dimerization domain comprises (or consists of) an Fc region or a hinge region. In this scenario, the antibody will comprise an Fc region and three or more antigen binding sites amino-terminal to the Fe region.
- the preferred multivalent antibody herein comprises (or consists of) three to about eight, but preferably four, antigen binding sites.
- the multivalent antibody comprises at least one polypeptide chain (and preferably two polypeptide chains), wherein the polypeptide chain(s) comprise two or more variable domains.
- the polypeptide chain(s) may comprise VDl-(Xl)n -VD2- (X2)n -Fc, wherein VD1 is a first variable domain, VD2 is a second variable domain, Fc is one polypeptide chain of an Fc region, XI and X2 represent an amino acid or polypeptide, and n is 0 or 1.
- the polypeptide chain(s) may comprise: VH-CH1 -flexible linker-VH-CHl-Fc region chain; or VH-CHl-VH-CHl-Fc region chain.
- the multivalent antibody herein preferably further comprises at least two (and preferably four) light chain variable domain polypeptides.
- the multivalent antibody herein may, for instance, comprise from about two to about eight light chain variable domain polypeptides.
- the light chain variable domain polypeptides contemplated here comprise a light chain variable domain and, optionally, further comprise a CL domain.
- amino acid sequence modification(s) of the antibodies described herein are contemplated.
- Amino acid sequence variants of the antibody are prepared by introducing appropriate nucleotide changes into the antibody nucleic acid, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the antibody. Any combination of deletion, insertion, and substitution is made to arrive at the final construct, provided that the final construct possesses the desired characteristics.
- the amino acid alterations may be introduced in the subject antibody amino acid sequence at the time that sequence is made.
- a useful method for identification of certain residues or regions of the antibody that are preferred locations for mutagenesis is called “alanine scanning mutagenesis” as described by Cunningham and Wells (1989) Science, 244: 1081-1085.
- a residue or group of target residues are identified (e.g., charged residues such as arg, asp, his, lys, and glu) and replaced by a neutral or negatively charged amino acid (most preferably alanine or polyalanine) to affect the interaction of the amino acids with antigen.
- Those amino acid locations are identified (e.g., charged residues such as arg, asp, his, lys, and glu) and replaced by a neutral or negatively charged amino acid (most preferably alanine or polyalanine) to affect the interaction of the amino acids with antigen.
- Those amino acid locations are identified (e.g., charged residues such as arg, asp, his, lys, and glu) and replaced by a neutral or negatively charged amino acid
- demonstrating functional sensitivity to the substitutions then are refined by introducing further or other variants at, or for, the sites of substitution.
- site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be predetermined. For example, to analyze the performance of a mutation at a given site, ala scanning or random mutagenesis is conducted at the target codon or region and the expressed immunoglobulins are screened for the desired activity.
- Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues.
- terminal insertions include an antibody with an N-terminal methionyl residue or the antibody fused to a cytotoxic polypeptide.
- Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme (e.g., for ADEPT) or a polypeptide which increases the serum half-life of the antibody.
- N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue.
- the tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain.
- O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5- hydroxyproline or 5-hydroxylysine may also be used.
- glycosylation sites to the antibody is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites).
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
- the carbohydrate attached thereto may be altered.
- antibodies with a mature carbohydrate structure that lacks fucose attached to an Fc region of the antibody are described in US Pat Appl No US 2003/0157108 (Presta, L.). See also US 2004/0093621 (Kyowa Hakko Kogyo Co., Ltd).
- Antibodies with a bisecting N-acetylglucosamine (GlcNAc) in the carbohydrate attached to an Fc region of the antibody are referenced in WO 2003/011878, Jean-Mairet et al. and US Patent No.
- the preferred glycosylation variant herein comprises an Fc region, wherein a carbohydrate structure attached to the Fc region lacks fucose.
- Such variants have improved ADCC function.
- the Fc region further comprises one or more amino acid substitutions therein which further improve ADCC, for example, substitutions at positions 298, 333, and/or 334 of the Fc region (Eu numbering of residues).
- Examples of cell lines producing defucosylated antibodies include Lecl3 CHO cells deficient in protein fucosylation (Ripka et al. Arch. Biochem. Biophys. 249:533-545 (1986); US Pat Appl No US 2003/0157108 Al, Presta, L; and WO 2004/056312 Al, Adams et al, especially at Example 11), and knockout cell lines, such as alpha- 1,6-fucosyltransferase gene,
- variants are an amino acid substitution variant. These variants have at least one amino acid (at leat two, at leat three, at least 4 or more) residue in the antibody molecule replaced by a different residue.
- the sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but FR alterations are also contemplated. Conservative substitutions are shown in the chart below, under the heading of "preferred substitutions.” If such substitutions result in a change in biological activity, then more substantial changes, denominated "exemplary substitutions" in the chart below, or as further described below in reference to amino acid classes, may be introduced and the products screened.
- Norleucine Substantial modifications in the biological properties of the antibody are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain.
- Naturally occurring residues are divided into groups based on common side-chain properties : (1) hydrophobic: norleucine, met, ala, val, leu, ile;
- Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
- substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g., a humanized or human antibody).
- a parent antibody e.g., a humanized or human antibody
- the resulting variant(s) selected for further development will have improved biological properties relative to the parent antibody from which they are generated.
- a convenient way for generating such substitutional variants involves affinity maturation using phage display. Briefly, several hypervariable region sites (e.g., 6-7 sites) are mutated to generate all possible amino acid substitutions at each site.
- the antibodies thus generated are displayed from filamentous phage particles as fusions to the gene III product of Ml 3 packaged within each particle. The phage-displayed variants are then screened for their biological activity (e.g., binding affinity) as herein disclosed.
- alanine scanning mutagenesis can be performed to identify hypervariable region residues contributing significantly to antigen binding.
- Nucleic acid molecules encoding amino acid sequence variants of the antibody are prepared by a variety of methods known in the art. These methods include, but are not limited to, isolation from a natural source (in the case of naturally occurring amino acid sequence variants) or preparation by oligonucleotide-mediated (or site-directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared variant or a non- variant version of the antibody.
- the Fc region variant may comprise a human Fc region sequence (e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g., a substitution) at one or more amino acid positions including that of a hinge cysteine.
- a human Fc region sequence e.g., a human IgGl, IgG2, IgG3 or IgG4 Fc region
- an amino acid modification e.g., a substitution
- an antibody used in methods of the invention may comprise one or more alterations as compared to the wild type counterpart antibody, e.g., in the Fc region. These antibodies would nonetheless retain substantially the same characteristics required for therapeutic utility as compared to their wild type counterpart. For example, it is thought that certain alterations can be made in the Fc region that would result in altered (i.e., either improved or diminished) Clq binding and/or Complement Dependent Cytotoxicity (CDC), e.g., as described in W099/51642. See also Duncan & Winter Nature 322:738-40 (1988); US Patent No. 5,648,260; US Patent No.
- the antibodies of the present invention can be further modified to contain additional nonproteinaceous moieties that are known in the art and readily available.
- the moieties suitable for derivatization of the antibody are water soluble polymers.
- water soluble polymers include, but are not limited to, polyethylene glycol (PEG), copolymers of ethylene glycol/propylene glycol, carboxymethylcellulose, dextran, polyvinyl alcohol, polyvinyl pyrrolidone, poly-1, 3-dioxolane, poly-l,3,6-trioxane, ethylene/maleic anhydride copolymer, polyaminoacids (either homopolymers or random copolymers), and dextran or poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers, prolypropylene oxide/ethylene oxide co-polymers, polyoxyethylated polyols (e.g., glycerol), poly
- Polyethylene glycol propionaldehyde may have advantages in manufacturing due to its stability in water.
- the polymer may be of any molecular weight, and may be branched or unbranched.
- the number of polymers attached to the antibody may vary, and if more than one polymers are attached, they can be the same or different molecules. In general, the number and/or type of polymers used for derivatization can be determined based on considerations including, but not limited to, the particular properties or functions of the antibody to be improved, whether the antibody derivative will be used in a therapy under defined conditions, etc.
- antibodies are characterized for any one or more of reduction or blocking of FGF (such as FGF1 and/or FGF9) binding, reduction or blocking of FGFR3 activation, reduction or blocking of FGFR3 downstream molecular signaling, disruption or blocking of FGFR3 binding to a ligand (e.g., FGF1,
- the antibodies are screened for increased FGFR3 activation, increased FGFR3 downstream molecule signaling, apoptotic activity, FGFR3 down-regulation, and effector function (e.g., ADCC activity).
- antibodies are characterized for any one or more of reduction or blocking of FGFR2 activation, reduction or blocking of FGFR2 downstream molecular signaling, disruption or blocking of FGFR2 binding to a ligand, reduction or blocking of FGFR2 dimerization, promotion of formation of monomeric FGFR2, binding to monomeric FGFR2, and/or treatment and/or prevention of a tumor, cell proliferative disorder or a cancer; and/or treatment or prevention of a disorder associated with FGFR2 expression and/or activity (such as increased FGFR2 expression and/or activity).
- the antibodies are screened for increased FGFR2 activation, increased FGFR2 downstream molecule signaling, FGFR2 down-regulation, and effector function (e.g., ADCC activity).
- antibodies are characterized for any one or more of reduction or blocking of FGFR2 and FGFR3 activation, reduction or blocking of FGFR2 and FGFR3 downstream molecular signaling, disruption or blocking of FGFR2 and FGFR3 binding to a ligand (e.g., FGF1, FGF9), reduction or blocking of FGFR2 and FGFR3 dimerization, promotion of formation of monomeric FGFR2 and FGFR3, binding to monomeric FGFR2 and monomeric FGFR3, and/or treatment and/or prevention of a tumor, cell proliferative disorder or a cancer; and/or treatment or prevention of a disorder associated with FGFR2 and FGFR3 expression and/or activity (such as increased FGFR2 and/or FGFR3 expression and/or activity).
- a ligand
- the antibodies are screened for increased FGFR2 and FGFR3 activation, increased FGFR2 and FGFR3 downstream molecule signaling, apoptotic activity, FGFR2 and FGFR3 down-regulation, and effector function (e.g., ADCC activity).
- effector function e.g., ADCC activity
- the purified antibodies can be further characterized by a series of assays including, but not limited to, N-terminal sequencing, amino acid analysis, non-denaturing size exclusion high pressure liquid chromatography (HPLC), mass spectrometry, ion exchange
- the antibodies produced herein are analyzed for their biological activity.
- the antibodies of the present invention are tested for their antigen binding activity.
- the antigen binding assays that are known in the art and can be used herein include without limitation any direct or competitive binding assays using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), "sandwich” immunoassays, immunoprecipitation assays, fluorescent immunoassays, and protein A immunoassays. Illustrative antigen binding and other assay are provided below in the Examples section.
- the candidate antibody can be tested in in vitro and/or in vivo assays that measure inhibition of cell growth. If an anti-FGFR2/3 antibody that does or does not promote apoptosis is desired, the candidate antibody can be tested in assays that measure apoptosis.
- Methods for examining growth and/or proliferation of a cancer cell, or determining apoptosis of a cancer cell are well known in the art and some are described and exemplified herein. Exemplary methods for determining cell growth and/or proliferation and/or apoptosis include, for example, BrdU incorporation assay, MTT, [3H]-thymidine incorporation (e.g., TopCount assay
- the present invention contemplates an antibody that possesses effector functions.
- the Fc activities of the antibody are measured.
- In vitro and/or in vivo cytotoxicity assays can be conducted to confirm the reduction/depletion of CDC and/or ADCC activities.
- Fc receptor (FcR) binding assays can be conducted to ensure that the antibody lacks FcyR binding (hence likely lacking ADCC activity), but retains FcRn binding ability.
- the primary cells for mediating ADCC, NK cells express FcyRIII only, whereas monocytes express FcyRI, FcyRII and FcyRIII.
- FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991).
- An example of an in vitro assay to assess ADCC activity of a molecule of interest is described in US Patent No. 5,500,362 or
- ADCC activity is also exemplified herein.
- useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells.
- PBMC peripheral blood mononuclear cells
- NK Natural Killer
- ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al. PNAS (USA) 95:652-656 (1998).
- Clq binding assays may also be carried out to confirm that the antibody is unable to bind Clq and hence lacks CDC activity.
- a CDC assay e.g., as described in Gazzano-Santoro et al., J. Immunol. Methods 202: 163 (1996), may be performed.
- FcRn binding and in vivo clearance/half life determinations can also be performed using methods known in the art, e.g., those described in the Examples section.
- the candidate antibody can be tested in assays (such as in vitro assays) that measure binding to monomeric FGFR2 and/or FGFR3 and promotion of the formation of monomeric FGFR2 and/or FGFR3.
- assays are known in the art and some assays are described and exemplified herein.
- the candidate antibody can be tested in dimerization assays, e.g., as described herein.
- the FGFR2 and/or FGFR3 agonist function of the candidate antibody is determined.
- Methods for assessing agonist function or activity of FGFR2 and/or FGFR3 antibodies are known in the art and some are also described herein.
- ability of an FGFR2/3 antibody to promote FGFR2 and/or FGFR3 receptor down-regulation is determined, e.g., using methods described and exemplified herein.
- a FGFR2/3 antibody is incubated with suitable test cells, e.g., bladder cancer cell lines (e.g., RT112), and after a suitable period of time, cell lysates are harvested and examined for total FGFR2 and FGFR3 levels. FACS analysis may also be used to examine surface FGFR2 and FGFR3 receptor levels following incubation with candidate FGFR2/3 antibodies
- nucleic acid encoding it is isolated and inserted into a replicable vector for further cloning (amplification of the DNA) or for expression.
- DNA encoding the antibody is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody).
- Many vectors are available. The choice of vector depends in part on the host cell to be used. Generally, preferred host cells are of either prokaryotic or eukaryotic (generally mammalian) origin. It will be appreciated that constant regions of any isotype can be used for this purpose, including IgG, IgM, IgA, IgD, and IgE constant regions, and that such constant regions can be obtained from any human or animal species.
- Polynucleotide sequences encoding polypeptide components of the antibody of the invention can be obtained using standard recombinant techniques. Desired polynucleotide sequences may be isolated and sequenced from antibody producing cells such as hybridoma cells. Alternatively, polynucleotides can be synthesized using nucleotide synthesizer or PCR techniques. Once obtained, sequences encoding the polypeptides are inserted into a recombinant vector capable of replicating and expressing heterologous polynucleotides in prokaryotic hosts. Many vectors that are available and known in the art can be used for the purpose of the present invention.
- Selection of an appropriate vector will depend mainly on the size of the nucleic acids to be inserted into the vector and the particular host cell to be transformed with the vector.
- Each vector contains various components, depending on its function (amplification or expression of heterologous polynucleotide, or both) and its compatibility with the particular host cell in which it resides.
- the vector components generally include, but are not limited to: an origin of replication, a selection marker gene, a promoter, a ribosome binding site (RBS), a signal sequence, the heterologous nucleic acid insert and a transcription termination sequence.
- plasmid vectors containing replicon and control sequences which are derived from species compatible with the host cell are used in connection with these hosts.
- the vector ordinarily carries a replication site, as well as marking sequences which are capable of providing phenotypic selection in transformed cells.
- E. coli is typically transformed using pBR322, a plasmid derived from an E. coli species.
- pBR322 contains genes encoding ampicillin (Amp) and tetracycline (Tet) resistance and thus provides easy means for identifying transformed cells.
- pBR322 its derivatives, or other microbial plasmids or bacteriophage may also contain, or be modified to contain, promoters which can be used by the microbial organism for expression of endogenous proteins.
- promoters which can be used by the microbial organism for expression of endogenous proteins. Examples of pBR322 derivatives used for expression of particular antibodies are described in detail in Carter et al, U.S. Patent No. 5,648,237.
- phage vectors containing replicon and control sequences that are compatible with the host microorganism can be used as transforming vectors in connection with these hosts.
- bacteriophage such as ⁇ . ⁇ .-11 may be utilized in making a recombinant vector which can be used to transform susceptible host cells such as E. coli LE392.
- the expression vector of the invention may comprise two or more promoter-cistron pairs, encoding each of the polypeptide components.
- a promoter is an untranslated regulatory sequence located upstream (5') to a cistron that modulates its expression.
- Prokaryotic promoters typically fall into two classes, inducible and constitutive.
- Inducible promoter is a promoter that initiates increased levels of transcription of the cistron under its control in response to changes in the culture condition, e.g., the presence or absence of a nutrient or a change in temperature.
- the selected promoter can be operably linked to cistron DNA encoding the light or heavy chain by removing the promoter from the source DNA via restriction enzyme digestion and inserting the isolated promoter sequence into the vector of the invention.
- Both the native promoter sequence and many heterologous promoters may be used to direct amplification and/or expression of the target genes.
- heterologous promoters are utilized, as they generally permit greater transcription and higher yields of expressed target gene as compared to the native target polypeptide promoter.
- Promoters suitable for use with prokaryotic hosts include the PhoA promoter, the ⁇ - galactamase and lactose promoter systems, a tryptophan (trp) promoter system and hybrid promoters such as the tac or the trc promoter.
- trp tryptophan
- other promoters that are functional in bacteria such as other known bacterial or phage promoters
- Their nucleotide sequences have been published, thereby enabling a skilled worker operably to ligate them to cistrons encoding the target light and heavy chains (Siebenlist et al., (1980) Cell 20: 269) using linkers or adaptors to supply any required restriction sites.
- each cistron within the recombinant vector comprises a secretion signal sequence component that directs translocation of the expressed polypeptides across a membrane.
- the signal sequence may be a component of the vector, or it may be a part of the target polypeptide DNA that is inserted into the vector.
- the signal sequence selected for the purpose of this invention should be one that is recognized and processed (i.e., cleaved by a signal peptidase) by the host cell.
- the signal sequence is substituted by a prokaryotic signal sequence selected, for example, from the group consisting of the alkaline phosphatase, penicillinase, Ipp, or heat-stable enterotoxin II (STII) leaders, LamB, PhoE, PelB, OmpA, and MBP.
- STII heat-stable enterotoxin II
- LamB, PhoE, PelB, OmpA, and MBP the signal sequences used in both cistrons of the expression system are STII signal sequences or variants thereof.
- the production of the immunoglobulins according to the invention can occur in the cytoplasm of the host cell, and therefore does not require the presence of secretion signal sequences within each cistron.
- immunoglobulin light and heavy chains are expressed, folded and assembled to form functional immunoglobulins within the cytoplasm.
- Certain host strains e.g., the E. coli trxB- strains
- Prokaryotic host cells suitable for expressing antibodies of the invention include
- Archaebacteria and Eubacteria such as Gram-negative or Gram-positive organisms.
- E. coli Escherichia
- Bacilli e.g., B. subtilis
- Enterobacteria Pseudomonas species (e.g., P. aeruginosa)
- Salmonella typhimurium Salmonella typhimurium
- Serratia marcescans Klebsiella, Proteus, Shigella, Rhizobia, Vitreoscilla, or Paracoccus.
- gram-negative cells are used.
- E. coli cells are used as hosts for the invention.
- E. coli strains include strain W3110 (Bachmann, Cellular and Molecular Biology, vol. 2 (Washington, D.C.: American Society for Microbiology, 1987), pp.
- strain 33D3 having genotype W3110 AfhuA ( ⁇ ) ptr3 lac Iq lacL8 AompTA(nmpc-fepE) degP41 kanR (U.S. Pat. No. 5,639,635).
- Other strains and derivatives thereof such as E. coli 294 (ATCC 31,446), E. coli B, E. coXiX 1776 (ATCC 31,537) and E. coli RV308(ATCC 31,608) are also suitable. These examples are illustrative rather than limiting.
- Host cells are transformed with the above-described expression vectors and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
- Transformation means introducing DNA into the prokaryotic host so that the DNA is replicable, either as an extrachromosomal element or by chromosomal integrant.
- transformation is done using standard techniques appropriate to such cells.
- the calcium treatment employing calcium chloride is generally used for bacterial cells that contain substantial cell-wall barriers.
- Another method for transformation employs polyethylene glycol/DMSO.
- Yet another technique used is electroporation.
- Prokaryotic cells used to produce the polypeptides of the invention are grown in media known in the art and suitable for culture of the selected host cells.
- suitable media include Luria broth (LB) plus necessary nutrient supplements.
- the media also contains a selection agent, chosen based on the construction of the expression vector, to selectively permit growth of prokaryotic cells containing the expression vector. For example, ampicillin is added to media for growth of cells expressing ampicillin resistant gene.
- any necessary supplements besides carbon, nitrogen, and inorganic phosphate sources may also be included at appropriate concentrations introduced alone or as a mixture with another supplement or medium such as a complex nitrogen source.
- the culture medium may contain one or more reducing agents selected from the group consisting of glutathione, cysteine, cystamine, thioglycollate, dithioerythritol and dithiothreitol.
- the prokaryotic host cells are cultured at suitable temperatures.
- the preferred temperature ranges from about 20°C to about 39°C, more preferably from about 25°C to about 37°C, even more preferably at about 30°C.
- the pH of the medium may be any pH ranging from about 5 to about 9, depending mainly on the host organism.
- the pH is preferably from about 6.8 to about 7.4, and more preferably about 7.0.
- an inducible promoter is used in the expression vector of the invention, protein expression is induced under conditions suitable for the activation of the promoter.
- PhoA promoters are used for controlling transcription of the polypeptides.
- the transformed host cells are cultured in a phosphate-limiting medium for induction.
- the phosphate-limiting medium is the C.R.A.P medium (see, e.g., Simmons et al, J. Immunol. Methods (2002), 263: 133-147).
- a variety of other inducers may be used, according to the vector construct employed, as is known in the art.
- the expressed polypeptides of the present invention are secreted into and recovered from the periplasm of the host cells.
- Protein recovery typically involves disrupting the microorganism, generally by such means as osmotic shock, sonication or lysis. Once cells are disrupted, cell debris or whole cells may be removed by centrifugation or filtration. The proteins may be further purified, for example, by affinity resin
- proteins can be transported into the culture media and isolated therein. Cells may be removed from the culture and the culture supernatant being filtered and concentrated for further purification of the proteins produced.
- the expressed polypeptides can be further isolated and identified using commonly known methods such as polyacrylamide gel electrophoresis (PAGE) and Western blot assay.
- PAGE polyacrylamide gel electrophoresis
- antibody production is conducted in large quantity by a fermentation process.
- Large-scale fed-batch fermentation procedures are available for production of recombinant proteins. Large-scale fermentations have at least 1000 liters of capacity, preferably about 1,000 to 100,000 liters of capacity. These fermentors use agitator impellers to distribute oxygen and nutrients, especially glucose (the preferred carbon/energy source).
- Small scale fermentation refers generally to fermentation in a fermentor that is no more than approximately 100 liters in volumetric capacity, and can range from about 1 liter to about 100 liters.
- induction of protein expression is typically initiated after the cells have been grown under suitable conditions to a desired density, e.g., an OD550 of about 180-220, at which stage the cells are in the early stationary phase.
- a desired density e.g., an OD550 of about 180-220
- inducers may be used, according to the vector construct employed, as is known in the art and described above. Cells may be grown for shorter periods prior to induction. Cells are usually induced for about 12-50 hours, although longer or shorter induction time may be used.
- chaperone proteins such as Dsb proteins (DsbA, DsbB, DsbC, DsbD, and/or DsbG) or FkpA (a peptidylprolyl cis,trans-isomerase with chaperone activity) can be used to co-transform the host prokaryotic cells.
- the chaperone proteins have been demonstrated to facilitate the proper folding and solubility of heterologous proteins produced in bacterial host cells. Chen et al, (1999) J. Biol. Chem. 274: 19601-19605; Georgiou et al., U.S. Patent No. 6,083,715; Georgiou et al., U.S. Patent No.
- host cell strains may be modified to effect genetic mutation(s) in the genes encoding known bacterial proteases such as Protease III, OmpT, DegP, Tsp, Protease I, Protease Mi, Protease V, Protease VI, and combinations thereof.
- known bacterial proteases such as Protease III, OmpT, DegP, Tsp, Protease I, Protease Mi, Protease V, Protease VI, and combinations thereof.
- E. coli protease-deficient strains are available and described in, for example, Joly et al., (1998), supra; Georgiou et al, U.S. Patent No. 5,264,365; Georgiou et al., U.S. Patent No. 5,508,192; Hara et al., Microbial Drug Resistance, 2:63-72 (1996).
- E. coli strains deficient for proteolytic enzymes and transformed with plasmids overexpressing one or more chaperone proteins are used as host cells in the expression system of the invention.
- Standard protein purification methods known in the art can be employed.
- the following procedures are exemplary of suitable purification procedures: fractionation on immunoaffinity or ion-exchange columns, ethanol precipitation, reverse phase HPLC, chromatography on silica or on a cation-exchange resin such as DEAE, chromatofocusing, SDS-PAGE, ammonium sulfate precipitation, and gel filtration using, for example, Sephadex G-75.
- Protein A immobilized on a solid phase is used for immunoaffinity purification of the full length antibody products of the invention.
- Protein A is a 41kD cell wall protein from Staphylococcus aureas which binds with a high affinity to the Fc region of antibodies. Lindmark et al., (1983) J. Immunol. Meth. 62: 1-13.
- the solid phase to which Protein A is immobilized is preferably a column comprising a glass or silica surface, more preferably a controlled pore glass column or a silicic acid column. In some applications, the column has been coated with a reagent, such as glycerol, in an attempt to prevent nonspecific adherence of contaminants.
- the preparation derived from the cell culture as described above is applied onto the Protein A immobilized solid phase to allow specific binding of the antibody of interest to Protein A.
- the solid phase is then washed to remove contaminants non- specifically bound to the solid phase.
- the antibody of interest is recovered from the solid phase by elution.
- the vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence.
- a vector for use in a eukaryotic host cell may also contain a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide of interest.
- the heterologous signal sequence selected preferably is one that is recognized and processed (i.e., cleaved by a signal peptidase) by the host cell.
- mammalian signal sequences as well as viral secretory leaders, for example, the herpes simplex gD signal are available.
- the DNA for such precursor region is ligated in reading frame to DNA encoding the antibody.
- an origin of replication component is not needed for mammalian expression vectors.
- the SV40 origin may typically be used only because it contains the early promoter. (Hi) Selection gene component
- Selection genes may contain a selection gene, also termed a selectable marker.
- Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, where relevant, or (c) supply critical nutrients not available from complex media.
- One example of a selection scheme utilizes a drug to arrest growth of a host cell. Those cells that are successfully transformed with a heterologous gene produce a protein conferring drug resistance and thus survive the selection regimen. Examples of such dominant selection use the drugs neomycin, mycophenolic acid and hygromycin.
- Suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up the antibody nucleic acid, such as DHFR, thymidine kinase, metallothionein-I and -II, preferably primate metallothionein genes, adenosine deaminase, ornithine decarboxylase, etc.
- cells transformed with the DHFR selection gene are first identified by culturing all of the transformants in a culture medium that contains methotrexate (Mtx), a competitive antagonist of DHFR.
- Mtx methotrexate
- An appropriate host cell when wild-type DHFR is employed is the Chinese hamster ovary (CHO) cell line deficient in DHFR activity (e.g., ATCC CRL-9096).
- host cells particularly wild-type hosts that contain endogenous DHFR transformed or co-transformed with DNA sequences encoding an antibody, wild-type DHFR protein, and another selectable marker such as aminoglycoside 3 '-phosphotransferase (APH) can be selected by cell growth in medium containing a selection agent for the selectable marker such as an aminoglycosidic antibiotic, e.g., kanamycin, neomycin, or G418. See U.S. Patent No. 4,965,199. (iv) Promoter component
- Expression and cloning vectors usually contain a promoter that is recognized by the host organism and is operably linked to the antibody polypeptide nucleic acid.
- Promoter sequences are known for eukaryotes.
- Virtually alleukaryotic genes have an AT-rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated.
- Another sequence found 70 to 80 bases upstream from the start of transcription of many genes is a CNCAAT region where N may be any nucleotide.
- N may be any nucleotide.
- AATAAA sequence At the 3 ' end of most eukaryotic genes is an AATAAA sequence that may be the signal for addition of the poly A tail to the 3' end of the coding sequence. All of these sequences are suitably inserted into eukaryotic expression vectors.
- Antibody polypeptide transcription from vectors in mammalian host cells is controlled, for example, by promoters obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus, and Simian Virus 40 (SV40), from heterologous mammalian promoters, e.g., the actin promoter or an immunoglobulin promoter, from heat-shock promoters, provided such promoters are compatible with the host cell systems.
- viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus, and Simian Virus 40 (SV40),
- the early and late promoters of the SV40 virus are conveniently obtained as an SV40 restriction fragment that also contains the SV40 viral origin of replication.
- the immediate early promoter of the human cytomegalovirus is conveniently obtained as a Hindlll E restriction fragment.
- a system for expressing DNA in mammalian hosts using the bovine papilloma virus as a vector is disclosed in U.S. Patent No. 4,419,446. A modification of this system is described in U.S. Patent No. 4,601,978.
- the Rous Sarcoma Virus long terminal repeat can be used as the promoter.
- Enhancer sequences are now known from mammalian genes (globin, elastase, albumin, a- fetoprotein, and insulin). Typically, however, one will use an enhancer from a eukaryotic cell virus. Examples include the SV40 enhancer on the late side of the replication origin (bp 100- 270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers.
- the enhancer may be spliced into the vector at a position 5 ' or 3 ' to the antibody polypepti de-encoding sequence, but is preferably located at a site 5 ' from the promoter.
- Expression vectors used in eukaryotic host cells will typically also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5' and, occasionally 3', untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding an antibody.
- One useful transcription termination component is the bovine growth hormone
- Suitable host cells for cloning or expressing the DNA in the vectors herein include higher eukaryote cells described herein, including vertebrate host cells. Propagation of vertebrate cells in culture (tissue culture) has become a routine procedure. Examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al, J. Gen. Virol. 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells/-DHFR (CHO, Urlaub et al, Proc. Natl. Acad. Sci.
- COS-7 monkey kidney CV1 line transformed by SV40
- human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al, J. Gen. Virol. 36:59 (1977)
- baby hamster kidney cells B
- mice Sertoli cells TM4, Mather, Biol. Reprod. 23:243- 251 (1980)
- monkey kidney cells CVl ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al, Annals N.Y. Acad. Sci. 383:44-68 (1982)); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).
- Host cells are transformed with the above-described expression or cloning vectors for antibody production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
- the host cells used to produce an antibody of this invention may be cultured in a variety of media.
- Commercially available media such as Ham's F10 (Sigma), Minimal Essential Medium ((MEM), (Sigma), RPMI-1640 (Sigma), and Dulbecco's Modified Eagle's Medium ((DMEM), Sigma) are suitable for culturing the host cells.
- any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as GENTAMYCINTM drug), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art.
- the culture conditions such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
- the antibody can be produced intracellularly, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, are removed, for example, by centrifugation or ultrafiltration. Where the antibody is secreted into the medium,
- supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit.
- a protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
- the antibody composition prepared from the cells can be purified using, for example, hydroxylapatite chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being the preferred purification technique.
- affinity chromatography is the preferred purification technique.
- the suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody.
- Protein A can be used to purify antibodies that are based on human ⁇ , ⁇ 2, or ⁇ 4 heavy chains (Lindmark et al., J. Immunol. Meth. 62: 1-13 (1983)). Protein G is recommended for all mouse isotypes and for human ⁇ 3 (Guss et al, EMBO J. 5: 15671575 (1986)).
- the matrix to which the affinity ligand is attached is most often agarose, but other matrices are available.
- Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose.
- the antibody comprises a CH3 domain
- the Bakerbond ABXTMresin J. T. Baker, Phillipsburg, NJ is useful for purification.
- the mixture comprising the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction
- the invention also provides immunoconjugates (interchangeably termed "antibody- drug conjugates” or "ADC”), comprising any of the anti-FGFR2/3 antibodies described herein conjugated to a cytotoxic agent such as a chemotherapeutic agent, a drug, a growth inhibitory agent, a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
- a cytotoxic agent such as a chemotherapeutic agent, a drug, a growth inhibitory agent, a toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).
- Toxins used in antibody-toxin conjugates include bacterial toxins such as diphtheria toxin, plant toxins such as ricin, small molecule toxins such as geldanamycin (Mandler et al (2000) Jour, of the Nat. Cancer Inst. 92(19): 1573-1581;
- cytotoxic drugs may effect their cytotoxic and cytostatic effects by mechanisms including tubulin binding, DNA binding, or topoisomerase inhibition. Some cytotoxic drugs tend to be inactive or less active when conjugated to large antibodies or protein receptor ligands.
- ZEVALIN® is an antibody-radioisotope conjugate composed of a murine IgGl kappa monoclonal antibody directed against the CD20 antigen found on the surface of normal and malignant B lymphocytes and m In or 90 Y radioisotope bound by a thiourea linker-chelator (Wiseman et al., (2000) Eur. Jour. Nucl. Med. 27(7):766-77; Wiseman et al, (2002) Blood 99(12):4336-42; Witzig et al, (2002) J. Clin. Oncol.
- ZEVALIN has activity against B-cell non-Hodgkin's Lymphoma (NHL), administration results in severe and prolonged cytopenias in most patients.
- MYLOTARGTM (gemtuzumab ozogamicin, Wyeth Pharmaceuticals), an antibody drug conjugate composed of a hu CD33 antibody linked to calicheamicin, was approved in 2000 for the treatment of acute myeloid leukemia by injection (Drugs of the Future (2000) 25(7):686; US Patent Nos.
- Cantuzumab mertansine an antibody drug conjugate composed of the huC242 antibody linked via the disulfide linker SPP to the maytansinoid drug moiety, DM1
- CanAg such as colon, pancreatic, gastric, and others.
- MLN-2704 (Millennium Pharm., BZL Biologies, Immunogen Inc.), an antibody drug conjugate composed of the anti-prostate specific membrane antigen (PSMA) monoclonal antibody linked to the maytansinoid drug moiety, DM1, is under development for the potential treatment of prostate tumors.
- PSMA anti-prostate specific membrane antigen
- auristatin peptides auristatin E (AE) and monomethylauristatin (MMAE), synthetic analogs of dolastatin, were conjugated to chimeric monoclonal antibodies cBR96 (specific to Lewis Y on carcinomas) and cACIO (specific to CD30 on hematological malignancies) (Doronina et al., (2003) Nature Biotechnology 21(7):778-784) and are under therapeutic development.
- Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAP II, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes. See, e.g., WO 93/21232 published October 28, 1993. A variety of
- radionuclides are available for the production of radioconjugated antibodies. Examples include 212 Bi, 131 I, 131 In, 90 Y, and 186 Re. Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2- pyridyldithiol) propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HC1), active esters (such as disuccinimidyl suberate), aldehydes (such as glutaraldehyde), bis-azido compounds (such as bis (p-azidobenzoyl) hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)- ethylenediamine), diisocyanates (such as toluene 2,6-diisocyanate),
- a ricin immunotoxin can be prepared as described in Vitetta et al, Science, 238: 1098 (1987).
- Carbon- 14-labeled 1- isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See
- Conjugates of an antibody and one or more small molecule toxins such as a calicheamicin, maytansinoids, dolastatins, aurostatins, a trichothecene, and CC1065, and the derivatives of these toxins that have toxin activity, are also contemplated herein.
- the immunoconjugate comprises an antibody (full length or fragments) of the invention conjugated to one or more maytansinoid molecules.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Cell Biology (AREA)
- Diabetes (AREA)
- Neurology (AREA)
- Biomedical Technology (AREA)
- Neurosurgery (AREA)
- Obesity (AREA)
- Hematology (AREA)
- Reproductive Health (AREA)
- Gastroenterology & Hepatology (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- Pregnancy & Childbirth (AREA)
- Gynecology & Obstetrics (AREA)
- Endocrinology (AREA)
- Biotechnology (AREA)
- Microbiology (AREA)
- General Engineering & Computer Science (AREA)
- Child & Adolescent Psychology (AREA)
- Pain & Pain Management (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| KR1020177015299A KR20170080675A (ko) | 2014-11-05 | 2015-11-05 | 항-fgfr2/3 항체 및 이의 이용 방법 |
| HK18102604.4A HK1243104B (zh) | 2014-11-05 | 2015-11-05 | 抗fgfr2/3抗体及其使用方法 |
| MX2017003478A MX2017003478A (es) | 2014-11-05 | 2015-11-05 | Anticuerpos anti-fgfr2/3 y metodos para su uso. |
| BR112017008666-2A BR112017008666A2 (pt) | 2014-11-05 | 2015-11-05 | anticorpos anti-fgfr2/3 e métodos de uso dos mesmos |
| EP15794781.3A EP3215533A2 (en) | 2014-11-05 | 2015-11-05 | Anti-fgfr2/3 antibodies and methods using same |
| JP2017543319A JP6877350B2 (ja) | 2014-11-05 | 2015-11-05 | 抗fgfr2/3抗体及びその使用方法 |
| CA2961439A CA2961439A1 (en) | 2014-11-05 | 2015-11-05 | Anti-fgfr2/3 antibodies and methods using same |
| RU2017119185A RU2017119185A (ru) | 2014-11-05 | 2015-11-05 | Антитела против fgfr2/3 и способы их применения |
| CN201580064184.0A CN107108740B (zh) | 2014-11-05 | 2015-11-05 | 抗fgfr2/3抗体及其使用方法 |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462075740P | 2014-11-05 | 2014-11-05 | |
| US62/075,740 | 2014-11-05 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2016073789A2 true WO2016073789A2 (en) | 2016-05-12 |
| WO2016073789A3 WO2016073789A3 (en) | 2016-06-30 |
Family
ID=54542605
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/059335 Ceased WO2016073789A2 (en) | 2014-11-05 | 2015-11-05 | Anti-fgfr2/3 antibodies and methods using same |
Country Status (10)
| Country | Link |
|---|---|
| US (1) | US10208120B2 (OSRAM) |
| EP (1) | EP3215533A2 (OSRAM) |
| JP (1) | JP6877350B2 (OSRAM) |
| KR (1) | KR20170080675A (OSRAM) |
| CN (1) | CN107108740B (OSRAM) |
| BR (1) | BR112017008666A2 (OSRAM) |
| CA (1) | CA2961439A1 (OSRAM) |
| MX (1) | MX2017003478A (OSRAM) |
| RU (1) | RU2017119185A (OSRAM) |
| WO (1) | WO2016073789A2 (OSRAM) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2797560C2 (ru) * | 2017-05-16 | 2023-06-07 | Файв Прайм Терапьютикс, Инк. | Антитела к fgfr2 в комбинации с химиотерапевтическими средствами при лечении рака |
| EP4126074A4 (en) * | 2020-03-23 | 2024-11-20 | Fusion Pharmaceuticals Inc. | FGFR3-TARGETED RADIOIMMUNECONJUGATES AND USES THEREOF |
| WO2025067442A1 (zh) * | 2023-09-28 | 2025-04-03 | 南京维立志博生物科技股份有限公司 | 抗fgfr2抗体和包含其的多特异性结合分子 |
| US12319738B2 (en) | 2017-05-16 | 2025-06-03 | Five Prime Therapeutics, Inc. | Anti-FGFR2 antibodies in combination with chemotherapy agents in gastric cancer |
| US12465636B2 (en) | 2013-08-01 | 2025-11-11 | Five Prime Therapeutics, Inc. | Method of making afucosylated anti-FGFR2IIIB antibodies |
Families Citing this family (44)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| RU2745707C2 (ru) * | 2015-11-23 | 2021-03-30 | Файв Прайм Терапьютикс, Инк. | Ингибиторы fgfr2 отдельно или в комбинации с иммуностимулирующими агентами в лечении рака |
| WO2018045110A1 (en) | 2016-08-30 | 2018-03-08 | Xencor, Inc. | Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors |
| BR112019007281A2 (pt) | 2016-10-14 | 2019-07-09 | Xencor Inc | proteína heterodimérica, composições de ácido nucleico e de vetor de expressão, vetor de expressão, célula hospedeira, e, métodos para produzir proteína heterodimérica e para tratar câncer em um paciente |
| JP2018139530A (ja) | 2017-02-27 | 2018-09-13 | 帝人ファーマ株式会社 | 認知症治療又は予防のためのヒト化抗体及びその製造方法、並びにそれを用いた認知症治療剤又は予防剤 |
| KR102207221B1 (ko) * | 2017-03-06 | 2021-03-24 | 서울대학교산학협력단 | 도펠-타겟팅 분자를 이용한 병리학적 신생혈관 생성을 억제하는 방법 |
| AU2018291497A1 (en) | 2017-06-30 | 2020-01-16 | Xencor, Inc. | Targeted heterodimeric Fc fusion proteins containing IL-15/IL-15Ra and antigen binding domains |
| AU2018390418B2 (en) | 2017-12-19 | 2023-12-21 | Xencor, Inc. | Engineered IL-2 Fc fusion proteins |
| ES3032290T3 (en) | 2018-03-20 | 2025-07-16 | Theriva Biologics Inc | Intestinal alkaline phosphatase formulations |
| CA3097593A1 (en) | 2018-04-18 | 2019-10-24 | Xencor, Inc. | Pd-1 targeted heterodimeric fusion proteins containing il-15/il-15ra fc-fusion proteins and pd-1 antigen binding domains and uses thereof |
| JP7516254B2 (ja) | 2018-04-18 | 2024-07-16 | ゼンコア インコーポレイテッド | Il-15/il-15raヘテロ二量体fc融合タンパク質およびその使用 |
| JP2021520829A (ja) | 2018-04-18 | 2021-08-26 | ゼンコア インコーポレイテッド | IL−15/IL−15RA Fc融合タンパク質およびTIM−3抗原結合ドメインを含む、TIM−3標的化ヘテロ二量体融合タンパク質 |
| KR20210003813A (ko) | 2018-04-18 | 2021-01-12 | 젠코어 인코포레이티드 | IL-15/IL-15Rα Fc-융합 단백질 및 LAG-3 항원 결합 도메인을 함유하는 LAG-3 표적화 이종이량체 융합 단백질 |
| CN109030835B (zh) * | 2018-09-06 | 2021-06-22 | 江苏省人民医院(南京医科大学第一附属医院) | 一种分析Rab8调节Klotho表达在非小细胞肺癌中的作用的方法 |
| SG11202103192RA (en) | 2018-10-03 | 2021-04-29 | Xencor Inc | Il-12 heterodimeric fc-fusion proteins |
| CR20210239A (es) | 2018-10-12 | 2021-12-15 | Xencor Inc | Proteínas de fusión de il-15/il-15ralfa-fc dirigidas a pd-1 y usos de las mismas en terapias combinadas |
| CN111116745B (zh) * | 2018-11-01 | 2022-10-14 | 上海新理念生物医药科技有限公司 | 抗CD79b抗体、其药物偶联物及其应用 |
| CN113438961A (zh) | 2018-12-20 | 2021-09-24 | Xencor股份有限公司 | 含有IL-15/IL-15Rα和NKG2D抗原结合结构域的靶向异二聚体Fc融合蛋白 |
| SG11202107663UA (en) | 2019-01-18 | 2021-08-30 | Univ Health Network | Lilrb3-binding molecules and uses therefor |
| JP7418756B2 (ja) | 2019-01-23 | 2024-01-22 | ミレニアム ファーマシューティカルズ, インコーポレイテッド | 脱免疫化志賀毒素aサブユニットエフェクターを含むcd38結合性タンパク質 |
| AU2020211407A1 (en) | 2019-01-23 | 2021-08-12 | Millennium Pharmaceuticals, Inc. | Anti-CD38 antibodies |
| TWI857009B (zh) | 2019-02-15 | 2024-10-01 | 大學健康網絡 | Fcmr結合分子及其用途 |
| WO2020172631A2 (en) | 2019-02-21 | 2020-08-27 | Xencor, Inc. | Untargeted and targeted il-10 fc-fusion proteins |
| WO2020205849A1 (en) | 2019-04-01 | 2020-10-08 | Lakepharma, Inc. | Btla-binding (cd272) antibodies for modulating immune response and treating disease |
| CN110133285B (zh) * | 2019-05-09 | 2022-05-03 | 青岛海兰深生物科技有限公司 | 一种检测抗肝癌天然抗体的检测试剂、试剂盒和方法 |
| AU2020279112A1 (en) | 2019-05-17 | 2021-12-02 | Xencor, Inc. | IL-7-Fc-fusion proteins |
| US20210102002A1 (en) | 2019-08-06 | 2021-04-08 | Xencor, Inc. | HETERODIMERIC IgG-LIKE BISPECIFIC ANTIBODIES |
| WO2021067863A2 (en) | 2019-10-03 | 2021-04-08 | Xencor, Inc. | Targeted il-12 heterodimeric fc-fusion proteins |
| TW202128757A (zh) | 2019-10-11 | 2021-08-01 | 美商建南德克公司 | 具有改善之特性的 PD-1 標靶 IL-15/IL-15Rα FC 融合蛋白 |
| CN115746138A (zh) | 2019-12-19 | 2023-03-07 | 恩格姆生物制药公司 | Ilt3结合剂及其使用方法 |
| WO2021133921A1 (en) | 2019-12-23 | 2021-07-01 | Soteria Biotherapeutics, Inc. | Chemically induced association and dissociation of therapeutic fc compositions and chemically induced dimerization of t cell engager with human serum albumin |
| WO2021129656A1 (en) * | 2019-12-24 | 2021-07-01 | Dizal (Jiangsu) Pharmaceutical Co., Ltd. | Novel anti-fgfr2b antibodies |
| EP4161566A4 (en) * | 2020-06-03 | 2024-06-12 | The Broad Institute, Inc. | ANTAGONISTIC BIPARATOPIC ANTIBODIES SPECIFICALLY BINDING FIBROBLAST GROWTH FACTOR RECEPTOR 2 AND METHODS OF USE THEREOF |
| MX2023003997A (es) | 2020-10-06 | 2023-06-15 | Xencor Inc | Biomarcadores, métodos y composiciones para el tratamiento de la enfermedad autoinmunitaria, que incluye el lupus eritematoso sistémico (les). |
| WO2022140701A1 (en) | 2020-12-24 | 2022-06-30 | Xencor, Inc. | Icos targeted heterodimeric fusion proteins containing il-15/il-15ra fc-fusion proteins and icos antigen binding domains |
| US20220313798A1 (en) | 2021-03-30 | 2022-10-06 | Jazz Pharmaceuticals Ireland Ltd. | Dosing of recombinant l-asparaginase |
| US20230146665A1 (en) | 2021-07-27 | 2023-05-11 | Xencor, Inc. | Il-18-fc fusion proteins |
| IL310372A (en) | 2021-07-28 | 2024-03-01 | Genentech Inc | Il15/il15r alpha heterodimeric fc-fusion proteins for the treatment of blood cancers |
| EP4380596A1 (en) | 2021-08-04 | 2024-06-12 | Genentech, Inc. | Il15/il15r alpha heterodimeric fc-fusion proteins for the expansion of nk cells in the treatment of solid tumours |
| US20240025968A1 (en) | 2022-04-07 | 2024-01-25 | Xencor, Inc. | LAG-3 TARGETED HETERODIMERIC FUSION PROTEINS CONTAINING IL-15/IL-15RA Fc-FUSION PROTEINS AND LAG-3 ANTIGEN BINDING DOMAINS |
| WO2024015529A2 (en) | 2022-07-14 | 2024-01-18 | Jazz Pharmaceuticals Ireland Ltd. | Combination therapies involving l-asparaginase |
| US20240166705A1 (en) | 2022-11-07 | 2024-05-23 | Xencor, Inc. | Il18-fc fusion proteins |
| WO2024248867A1 (en) | 2023-05-31 | 2024-12-05 | Genentech, Inc. | Methods of treating tgf beta-related disorders with anti-transforming growth factor beta 3 antibodies |
| CN119855835A (zh) * | 2023-06-13 | 2025-04-18 | 南京维立志博生物科技股份有限公司 | 基于共同轻链产生双特异性抗体的方法 |
| WO2025085447A1 (en) | 2023-10-17 | 2025-04-24 | Xencor, Inc. | Pd-1 targeted il18-fc fusion proteins |
Family Cites Families (126)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
| US3896111A (en) | 1973-02-20 | 1975-07-22 | Research Corp | Ansa macrolides |
| US4151042A (en) | 1977-03-31 | 1979-04-24 | Takeda Chemical Industries, Ltd. | Method for producing maytansinol and its derivatives |
| US4137230A (en) | 1977-11-14 | 1979-01-30 | Takeda Chemical Industries, Ltd. | Method for the production of maytansinoids |
| USRE30985E (en) | 1978-01-01 | 1982-06-29 | Serum-free cell culture media | |
| US4265814A (en) | 1978-03-24 | 1981-05-05 | Takeda Chemical Industries | Matansinol 3-n-hexadecanoate |
| US4307016A (en) | 1978-03-24 | 1981-12-22 | Takeda Chemical Industries, Ltd. | Demethyl maytansinoids |
| JPS5562090A (en) | 1978-10-27 | 1980-05-10 | Takeda Chem Ind Ltd | Novel maytansinoid compound and its preparation |
| JPS5566585A (en) | 1978-11-14 | 1980-05-20 | Takeda Chem Ind Ltd | Novel maytansinoid compound and its preparation |
| JPS55164687A (en) | 1979-06-11 | 1980-12-22 | Takeda Chem Ind Ltd | Novel maytansinoid compound and its preparation |
| US4256746A (en) | 1978-11-14 | 1981-03-17 | Takeda Chemical Industries | Dechloromaytansinoids, their pharmaceutical compositions and method of use |
| JPS55102583A (en) | 1979-01-31 | 1980-08-05 | Takeda Chem Ind Ltd | 20-acyloxy-20-demethylmaytansinoid compound |
| JPS55162791A (en) | 1979-06-05 | 1980-12-18 | Takeda Chem Ind Ltd | Antibiotic c-15003pnd and its preparation |
| JPS55164685A (en) | 1979-06-08 | 1980-12-22 | Takeda Chem Ind Ltd | Novel maytansinoid compound and its preparation |
| JPS55164686A (en) | 1979-06-11 | 1980-12-22 | Takeda Chem Ind Ltd | Novel maytansinoid compound and its preparation |
| US4309428A (en) | 1979-07-30 | 1982-01-05 | Takeda Chemical Industries, Ltd. | Maytansinoids |
| JPS5645483A (en) | 1979-09-19 | 1981-04-25 | Takeda Chem Ind Ltd | C-15003phm and its preparation |
| EP0028683A1 (en) | 1979-09-21 | 1981-05-20 | Takeda Chemical Industries, Ltd. | Antibiotic C-15003 PHO and production thereof |
| JPS5645485A (en) | 1979-09-21 | 1981-04-25 | Takeda Chem Ind Ltd | Production of c-15003pnd |
| WO1982001188A1 (en) | 1980-10-08 | 1982-04-15 | Takeda Chemical Industries Ltd | 4,5-deoxymaytansinoide compounds and process for preparing same |
| US4450254A (en) | 1980-11-03 | 1984-05-22 | Standard Oil Company | Impact improvement of high nitrile resins |
| US4419446A (en) | 1980-12-31 | 1983-12-06 | The United States Of America As Represented By The Department Of Health And Human Services | Recombinant DNA process utilizing a papilloma virus DNA as a vector |
| US4315929A (en) | 1981-01-27 | 1982-02-16 | The United States Of America As Represented By The Secretary Of Agriculture | Method of controlling the European corn borer with trewiasine |
| US4313946A (en) | 1981-01-27 | 1982-02-02 | The United States Of America As Represented By The Secretary Of Agriculture | Chemotherapeutically active maytansinoids from Trewia nudiflora |
| JPS57192389A (en) | 1981-05-20 | 1982-11-26 | Takeda Chem Ind Ltd | Novel maytansinoid |
| US4601978A (en) | 1982-11-24 | 1986-07-22 | The Regents Of The University Of California | Mammalian metallothionein promoter system |
| US4560655A (en) | 1982-12-16 | 1985-12-24 | Immunex Corporation | Serum-free cell culture medium and process for making same |
| US4657866A (en) | 1982-12-21 | 1987-04-14 | Sudhir Kumar | Serum-free, synthetic, completely chemically defined tissue culture media |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US4675187A (en) | 1983-05-16 | 1987-06-23 | Bristol-Myers Company | BBM-1675, a new antibiotic complex |
| US4767704A (en) | 1983-10-07 | 1988-08-30 | Columbia University In The City Of New York | Protein-free culture medium |
| US4683203A (en) | 1984-04-14 | 1987-07-28 | Redco N.V. | Immobilized enzymes, processes for preparing same, and use thereof |
| US4965199A (en) | 1984-04-20 | 1990-10-23 | Genentech, Inc. | Preparation of functional human factor VIII in mammalian cells using methotrexate based selection |
| US4970198A (en) | 1985-10-17 | 1990-11-13 | American Cyanamid Company | Antitumor antibiotics (LL-E33288 complex) |
| US4683195A (en) | 1986-01-30 | 1987-07-28 | Cetus Corporation | Process for amplifying, detecting, and/or-cloning nucleic acid sequences |
| GB8516415D0 (en) | 1985-06-28 | 1985-07-31 | Celltech Ltd | Culture of animal cells |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| US4927762A (en) | 1986-04-01 | 1990-05-22 | Cell Enterprises, Inc. | Cell culture medium with antioxidant |
| IL85035A0 (en) | 1987-01-08 | 1988-06-30 | Int Genetic Eng | Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same |
| US5079233A (en) | 1987-01-30 | 1992-01-07 | American Cyanamid Company | N-acyl derivatives of the LL-E33288 antitumor antibiotics, composition and methods for using the same |
| EP0307434B2 (en) | 1987-03-18 | 1998-07-29 | Scotgen Biopharmaceuticals, Inc. | Altered antibodies |
| US4975278A (en) | 1988-02-26 | 1990-12-04 | Bristol-Myers Company | Antibody-enzyme conjugates in combination with prodrugs for the delivery of cytotoxic agents to tumor cells |
| US5770701A (en) | 1987-10-30 | 1998-06-23 | American Cyanamid Company | Process for preparing targeted forms of methyltrithio antitumor agents |
| US5053394A (en) | 1988-09-21 | 1991-10-01 | American Cyanamid Company | Targeted forms of methyltrithio antitumor agents |
| US5606040A (en) | 1987-10-30 | 1997-02-25 | American Cyanamid Company | Antitumor and antibacterial substituted disulfide derivatives prepared from compounds possessing a methyl-trithio group |
| IE61148B1 (en) | 1988-03-10 | 1994-10-05 | Ici Plc | Method of detecting nucleotide sequences |
| DE68925971T2 (de) | 1988-09-23 | 1996-09-05 | Cetus Oncology Corp | Zellenzuchtmedium für erhöhtes zellenwachstum, zur erhöhung der langlebigkeit und expression der produkte |
| US5530101A (en) | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| DE3920358A1 (de) | 1989-06-22 | 1991-01-17 | Behringwerke Ag | Bispezifische und oligospezifische, mono- und oligovalente antikoerperkonstrukte, ihre herstellung und verwendung |
| EP0479909B1 (en) | 1989-06-29 | 1996-10-30 | Medarex, Inc. | Bispecific reagents for aids therapy |
| US5208020A (en) | 1989-10-25 | 1993-05-04 | Immunogen Inc. | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| CA2026147C (en) | 1989-10-25 | 2006-02-07 | Ravi J. Chari | Cytotoxic agents comprising maytansinoids and their therapeutic use |
| ATE204902T1 (de) | 1990-06-29 | 2001-09-15 | Large Scale Biology Corp | Melaninproduktion durch transformierte mikroorganismen |
| US5122469A (en) | 1990-10-03 | 1992-06-16 | Genentech, Inc. | Method for culturing Chinese hamster ovary cells to improve production of recombinant proteins |
| US5508192A (en) | 1990-11-09 | 1996-04-16 | Board Of Regents, The University Of Texas System | Bacterial host strains for producing proteolytically sensitive polypeptides |
| US5264365A (en) | 1990-11-09 | 1993-11-23 | Board Of Regents, The University Of Texas System | Protease-deficient bacterial strains for production of proteolytically sensitive polypeptides |
| ES2113940T3 (es) | 1990-12-03 | 1998-05-16 | Genentech Inc | Metodo de enriquecimiento para variantes de proteinas con propiedades de union alteradas. |
| US5571894A (en) | 1991-02-05 | 1996-11-05 | Ciba-Geigy Corporation | Recombinant antibodies specific for a growth factor receptor |
| ATE255131T1 (de) | 1991-06-14 | 2003-12-15 | Genentech Inc | Humanisierter heregulin antikörper |
| CA2116774C (en) | 1991-09-19 | 2003-11-11 | Paul J. Carter | Expression in e. coli antibody fragments having at least a cysteine present as a free thiol. use for the production of bifunctional f(ab') 2 antibodies |
| EP0605522B1 (en) | 1991-09-23 | 1999-06-23 | Medical Research Council | Methods for the production of humanized antibodies |
| US5362852A (en) | 1991-09-27 | 1994-11-08 | Pfizer Inc. | Modified peptide derivatives conjugated at 2-hydroxyethylamine moieties |
| FI941572L (fi) | 1991-10-07 | 1994-05-27 | Oncologix Inc | Anti-erbB-2-monoklonaalisten vasta-aineiden yhdistelmä ja käyttömenetelmä |
| WO1993008829A1 (en) | 1991-11-04 | 1993-05-13 | The Regents Of The University Of California | Compositions that mediate killing of hiv-infected cells |
| DE69233528T2 (de) | 1991-11-25 | 2006-03-16 | Enzon, Inc. | Verfahren zur Herstellung von multivalenten antigenbindenden Proteinen |
| US5667988A (en) | 1992-01-27 | 1997-09-16 | The Scripps Research Institute | Methods for producing antibody libraries using universal or randomized immunoglobulin light chains |
| WO1993016185A2 (en) | 1992-02-06 | 1993-08-19 | Creative Biomolecules, Inc. | Biosynthetic binding protein for cancer marker |
| ZA932522B (en) | 1992-04-10 | 1993-12-20 | Res Dev Foundation | Immunotoxins directed against c-erbB-2(HER/neu) related surface antigens |
| EP0656064B1 (en) | 1992-08-17 | 1997-03-05 | Genentech, Inc. | Bispecific immunoadhesins |
| DE69303494T2 (de) | 1992-11-13 | 1997-01-16 | Idec Pharma Corp | Therapeutische verwendung von chimerischen und markierten antikörper gegen menschlichen b lymphozyt beschränkter differenzierung antigen für die behandlung von b-zell-lymphoma |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| JPH08511420A (ja) | 1993-06-16 | 1996-12-03 | セルテック・セラピューテイクス・リミテッド | 抗 体 |
| US5773001A (en) | 1994-06-03 | 1998-06-30 | American Cyanamid Company | Conjugates of methyltrithio antitumor agents and intermediates for their synthesis |
| US5910486A (en) | 1994-09-06 | 1999-06-08 | Uab Research Foundation | Methods for modulating protein function in cells using, intracellular antibody homologues |
| US5639635A (en) | 1994-11-03 | 1997-06-17 | Genentech, Inc. | Process for bacterial production of polypeptides |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5712374A (en) | 1995-06-07 | 1998-01-27 | American Cyanamid Company | Method for the preparation of substantiallly monomeric calicheamicin derivative/carrier conjugates |
| US5714586A (en) | 1995-06-07 | 1998-02-03 | American Cyanamid Company | Methods for the preparation of monomeric calicheamicin derivative/carrier conjugates |
| US6410690B1 (en) | 1995-06-07 | 2002-06-25 | Medarex, Inc. | Therapeutic compounds comprised of anti-Fc receptor antibodies |
| GB9603256D0 (en) | 1996-02-16 | 1996-04-17 | Wellcome Found | Antibodies |
| AU2660397A (en) | 1996-04-05 | 1997-10-29 | Board Of Regents, The University Of Texas System | Methods for producing soluble, biologically-active disulfide bond-containing eukaryotic proteins in bacterial cells |
| US5869245A (en) | 1996-06-05 | 1999-02-09 | Fox Chase Cancer Center | Mismatch endonuclease and its use in identifying mutations in targeted polynucleotide strands |
| US5922845A (en) | 1996-07-11 | 1999-07-13 | Medarex, Inc. | Therapeutic multispecific compounds comprised of anti-Fcα receptor antibodies |
| US5994071A (en) | 1997-04-04 | 1999-11-30 | Albany Medical College | Assessment of prostate cancer |
| US6083715A (en) | 1997-06-09 | 2000-07-04 | Board Of Regents, The University Of Texas System | Methods for producing heterologous disulfide bond-containing polypeptides in bacterial cells |
| CA2293829C (en) | 1997-06-24 | 2011-06-14 | Genentech, Inc. | Methods and compositions for galactosylated glycoproteins |
| DE69840412D1 (de) | 1997-10-31 | 2009-02-12 | Genentech Inc | Methoden und zusammensetzungen bestehend aus glykoprotein-glykoformen |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| IL138608A0 (en) | 1998-04-02 | 2001-10-31 | Genentech Inc | Antibody variants and fragments thereof |
| AU3657899A (en) | 1998-04-20 | 1999-11-08 | James E. Bailey | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| KR100940380B1 (ko) | 1999-01-15 | 2010-02-02 | 제넨테크, 인크. | 효과기 기능이 변화된 폴리펩티드 변이체 |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| PT1176195E (pt) | 1999-04-09 | 2013-07-18 | Kyowa Hakko Kirin Co Ltd | Processo para controlar a actividade de uma molécula funcional sob o ponto de vista imunológico |
| CA2388245C (en) | 1999-10-19 | 2012-01-10 | Kyowa Kirin Co., Ltd. | The use of serum-free adapted rat cells for producing heterologous polypeptides |
| US7608681B2 (en) | 1999-12-24 | 2009-10-27 | Genentech, Inc. | Methods and compositions for prolonging elimination half-times of bioactive compounds |
| US6946292B2 (en) | 2000-10-06 | 2005-09-20 | Kyowa Hakko Kogyo Co., Ltd. | Cells producing antibody compositions with increased antibody dependent cytotoxic activity |
| US7064191B2 (en) | 2000-10-06 | 2006-06-20 | Kyowa Hakko Kogyo Co., Ltd. | Process for purifying antibody |
| JP4336498B2 (ja) | 2000-12-12 | 2009-09-30 | メディミューン,エルエルシー | 延長した半減期を有する分子ならびにその組成物および用途 |
| US6884869B2 (en) | 2001-04-30 | 2005-04-26 | Seattle Genetics, Inc. | Pentapeptide compounds and uses related thereto |
| CA2450793A1 (en) | 2001-06-20 | 2002-12-27 | Prochon Biotech Ltd. | Antibodies that block receptor protein tyrosine kinase activation, methods of screening for and uses thereof |
| NZ581474A (en) | 2001-08-03 | 2011-04-29 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
| KR100988949B1 (ko) | 2001-10-25 | 2010-10-20 | 제넨테크, 인크. | 당단백질 조성물 |
| US20040093621A1 (en) | 2001-12-25 | 2004-05-13 | Kyowa Hakko Kogyo Co., Ltd | Antibody composition which specifically binds to CD20 |
| AU2003236020B2 (en) | 2002-04-09 | 2009-03-19 | Kyowa Hakko Kirin Co., Ltd. | Cell with depression or deletion of the activity of protein participating in GDP-fucose transport |
| AU2003236017B2 (en) | 2002-04-09 | 2009-03-26 | Kyowa Kirin Co., Ltd. | Drug containing antibody composition |
| US20040259150A1 (en) | 2002-04-09 | 2004-12-23 | Kyowa Hakko Kogyo Co., Ltd. | Method of enhancing of binding activity of antibody composition to Fcgamma receptor IIIa |
| EP1502603A4 (en) | 2002-04-09 | 2006-12-13 | Kyowa Hakko Kogyo Kk | AN ANTIBODY COMPOSITION CONTAINING MEDICAMENT FOR PATIENTS WITH Fc gamma RIIIa POLYMORPHISM |
| CA2481837A1 (en) | 2002-04-09 | 2003-10-16 | Kyowa Hakko Kogyo Co., Ltd. | Production process for antibody composition |
| US20040110704A1 (en) | 2002-04-09 | 2004-06-10 | Kyowa Hakko Kogyo Co., Ltd. | Cells of which genome is modified |
| US7361740B2 (en) | 2002-10-15 | 2008-04-22 | Pdl Biopharma, Inc. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| EP1944320A1 (en) | 2002-12-16 | 2008-07-16 | Genentech, Inc. | Immunoglobulin variants and uses thereof |
| AU2004279742A1 (en) | 2003-10-08 | 2005-04-21 | Kyowa Hakko Kirin Co., Ltd. | Fused protein composition |
| JPWO2005035778A1 (ja) | 2003-10-09 | 2006-12-21 | 協和醗酵工業株式会社 | α1,6−フコシルトランスフェラーゼの機能を抑制するRNAを用いた抗体組成物の製造法 |
| PT1692182E (pt) | 2003-11-05 | 2010-05-13 | Roche Glycart Ag | Anticorpos de cd20 com uma afinidade de ligação acrescida ao receptor fc e uma função efectora acrescida |
| JPWO2005053742A1 (ja) | 2003-12-04 | 2007-06-28 | 協和醗酵工業株式会社 | 抗体組成物を含有する医薬 |
| PT1773885E (pt) | 2004-08-05 | 2010-07-21 | Genentech Inc | Antagonistas anti-cmet humanizados |
| US20090175866A1 (en) | 2004-11-04 | 2009-07-09 | Avner Yayon | Treatment of b-cell malignancies |
| BRPI0613382A8 (pt) | 2005-06-20 | 2018-01-02 | Genentech Inc | anticorpos isolados, anticorpo monoclonal, célula de hibridoma, método de identificação, método de inibição do crescimento de uma célula, método de tratamento terapêutico, método de determinação da presença de uma proteína, métodos de diagnósticos da presença de tumor |
| WO2007144893A2 (en) * | 2006-06-15 | 2007-12-21 | Fibron Ltd. | Antibodies blocking fibroblast growth factor receptor activation and methods of use thereof |
| US8187601B2 (en) | 2008-07-01 | 2012-05-29 | Aveo Pharmaceuticals, Inc. | Fibroblast growth factor receptor 3 (FGFR3) binding proteins |
| HRP20150965T1 (hr) * | 2009-03-25 | 2015-11-06 | Genentech, Inc. | Anti-fgr3 protutijela i metode koje ih koriste |
| TWI670283B (zh) | 2013-12-23 | 2019-09-01 | 美商建南德克公司 | 抗體及使用方法 |
-
2015
- 2015-11-05 CN CN201580064184.0A patent/CN107108740B/zh active Active
- 2015-11-05 JP JP2017543319A patent/JP6877350B2/ja active Active
- 2015-11-05 BR BR112017008666-2A patent/BR112017008666A2/pt not_active Application Discontinuation
- 2015-11-05 RU RU2017119185A patent/RU2017119185A/ru not_active Application Discontinuation
- 2015-11-05 MX MX2017003478A patent/MX2017003478A/es unknown
- 2015-11-05 US US14/934,059 patent/US10208120B2/en active Active
- 2015-11-05 WO PCT/US2015/059335 patent/WO2016073789A2/en not_active Ceased
- 2015-11-05 CA CA2961439A patent/CA2961439A1/en not_active Abandoned
- 2015-11-05 KR KR1020177015299A patent/KR20170080675A/ko not_active Withdrawn
- 2015-11-05 EP EP15794781.3A patent/EP3215533A2/en not_active Withdrawn
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12465636B2 (en) | 2013-08-01 | 2025-11-11 | Five Prime Therapeutics, Inc. | Method of making afucosylated anti-FGFR2IIIB antibodies |
| RU2797560C2 (ru) * | 2017-05-16 | 2023-06-07 | Файв Прайм Терапьютикс, Инк. | Антитела к fgfr2 в комбинации с химиотерапевтическими средствами при лечении рака |
| US12319738B2 (en) | 2017-05-16 | 2025-06-03 | Five Prime Therapeutics, Inc. | Anti-FGFR2 antibodies in combination with chemotherapy agents in gastric cancer |
| EP4126074A4 (en) * | 2020-03-23 | 2024-11-20 | Fusion Pharmaceuticals Inc. | FGFR3-TARGETED RADIOIMMUNECONJUGATES AND USES THEREOF |
| WO2025067442A1 (zh) * | 2023-09-28 | 2025-04-03 | 南京维立志博生物科技股份有限公司 | 抗fgfr2抗体和包含其的多特异性结合分子 |
Also Published As
| Publication number | Publication date |
|---|---|
| JP2017538442A (ja) | 2017-12-28 |
| CN107108740A (zh) | 2017-08-29 |
| US20160244525A1 (en) | 2016-08-25 |
| BR112017008666A2 (pt) | 2018-01-30 |
| HK1243104A1 (zh) | 2018-07-06 |
| CN107108740B (zh) | 2021-09-17 |
| EP3215533A2 (en) | 2017-09-13 |
| CA2961439A1 (en) | 2016-05-12 |
| RU2017119185A (ru) | 2018-12-05 |
| KR20170080675A (ko) | 2017-07-10 |
| JP6877350B2 (ja) | 2021-05-26 |
| RU2017119185A3 (OSRAM) | 2019-05-29 |
| US10208120B2 (en) | 2019-02-19 |
| MX2017003478A (es) | 2018-02-01 |
| WO2016073789A3 (en) | 2016-06-30 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10208120B2 (en) | Anti-FGFR2/3 antibodies and methods using same | |
| US11401333B2 (en) | Anti-FGFR3 antibodies and methods using same | |
| JP2017538442A5 (OSRAM) | ||
| JP2012521759A5 (OSRAM) | ||
| AU2013205318B2 (en) | Anti-FGFR3 antibodies and methods using same | |
| HK40037257A (en) | Anti-fgfr3 antibodies and methods using same | |
| HK40037257B (en) | Anti-fgfr3 antibodies and methods using same |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15794781 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2961439 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2017/003478 Country of ref document: MX |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015794781 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015794781 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2017543319 Country of ref document: JP Kind code of ref document: A |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017008666 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 20177015299 Country of ref document: KR Kind code of ref document: A Ref document number: 2017119185 Country of ref document: RU Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 112017008666 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170426 |