WO2016011035A2 - Neutralizing anti-influenza b antibodies and uses thereof - Google Patents
Neutralizing anti-influenza b antibodies and uses thereof Download PDFInfo
- Publication number
- WO2016011035A2 WO2016011035A2 PCT/US2015/040385 US2015040385W WO2016011035A2 WO 2016011035 A2 WO2016011035 A2 WO 2016011035A2 US 2015040385 W US2015040385 W US 2015040385W WO 2016011035 A2 WO2016011035 A2 WO 2016011035A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- antibody
- influenza
- lcdr
- hcdr
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
- C07K16/108—Orthomyxoviridae (F), e.g. influenza virus
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/08—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from viruses
- C07K16/10—RNA viruses
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/569—Immunoassay; Biospecific binding assay; Materials therefor for microorganisms, e.g. protozoa, bacteria, viruses
- G01N33/56983—Viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/20—Immunoglobulins specific features characterized by taxonomic origin
- C07K2317/21—Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/515—Complete light chain, i.e. VL + CL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/005—Assays involving biological materials from specific organisms or of a specific nature from viruses
- G01N2333/08—RNA viruses
- G01N2333/11—Orthomyxoviridae, e.g. influenza virus
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2469/00—Immunoassays for the detection of microorganisms
- G01N2469/10—Detection of antigens from microorganism in sample from host
Definitions
- the invention relates to antibodies that have broad neutralizing activity against influenza B virus and to uses of such antibodies.
- Influenza viruses cause annual influenza epidemics and occasional pandemics, which pose a significant threat to public health worldwide.
- Seasonal influenza infection is associated with 200,000-500,000 deaths each year, particularly in young children, immunocompromised patients and the elderly. Mortality rates typically increase further during seasons with pandemic influenza outbreaks.
- potent anti-viral therapeutics for preventing and treating influenza infections, particularly in under-served populations.
- influenza viruses There are three types of influenza viruses: types A, B and C.
- the majority of influenza disease is caused by influenza A and B viruses (Thompson et al. (2004) JAMA. 292:1333-1340; and Zhou et al. (2012) Clin Infect. Dis. 54:1427-1436).
- the overall structure of influenza viruses A, B and C is similar, and includes a viral envelope which surrounds a central core.
- the viral envelope includes two surface glycoproteins, Hemagglutinin (HA) and neuraminidase (NA); HA mediates binding of the virus to target cells and entry into target cells, whereas NA is involved in the release of progeny virus from infected cells.
- HA Hemagglutinin
- NA neuraminidase
- the HA protein is trimeric in structure and includes three identical copies of a single polypeptide precursor, HA0, which, upon proteolytic maturation, is cleaved into a pH-dependent, metastable intermediate containing a globular head (HA1 ) and stalk region (HA2) (Wilson et al. (1981 ) Nature. 289:366- 373).
- HA1 globular head
- HA2 stalk region
- the membrane distal globular head constitutes the majority of the HA1 structure and contains the sialic acid binding pocket for viral entry and major antigenic domains.
- Influenza A viruses can be classified into subtypes based on genetic variations in hemagglutinin (HA) and neuraminidase (NA) genes.
- HA hemagglutinin
- NA neuraminidase
- influenza B viruses are not divided into subtypes based on the two surface glycoproteins and until the 1970s were classified as one homogenous group. Through the 1970s, the influenza B viruses started to diverge into two antigenically distinguishable lineages which were named the Victoria and Yamagata lineages after their first
- Influenza B viruses are restricted to human infection, and both lineages contribute to annual epidemics. Although the morbidity caused by influenza B viruses is lower than that associated with influenza A H3N2, it is higher than that associated with influenza A H1 N1 (Zhou et al. (2012) Clin Infect. Dis. 54:1427-1436).
- Neutralizing antibodies elicited by influenza virus infection are normally targeted to the variable HA1 globular head to prevent viral receptor binding and are usually strain-specific. Broadly cross-reactive antibodies that neutralize one or more subtype or lineage are rare. Recently, a few human antibodies have been discovered that can neutralize multiple subtypes of influenza B viruses of both lineages (Dreyfus et al. (2012) Science. 337(6100):1 343-8; and Yasugi et al. (2013) PLoS Path. 9(2):e10031 50). Although these antibodies recognize many influenza B viruses, they have a limited breadth of coverage and potency, and do not neutralize any influenza A virus strains. To date, there are no available antibodies that broadly neutralize or inhibit all influenza B virus infections or attenuate diseases caused by influenza B virus. Therefore, there is a need to identify new antibodies that protect against multiple of influenza viruses.
- the invention described herein provides an isolated antibody or an antigen binding fragment thereof that is capable of binding to influenza B virus hemagglutinin (HA) and neutralizing influenza B virus in two phylogenetically distinct lineages.
- the antibody or antigen binding fragment thereof is capable of binding to influenza B virus hemagglutinin and neutralizing influenza B virus in both Yamagata and Victoria lineages.
- Yamagata lineages include, but are not limited to: B/AA/94 (ca B/Ann Arbor/2/94 (yamagata)); B/YSI/98 (ca B/Yamanashi/166/98 (yamagata)); B/JHB/99 (ca B/Johannesburg/5/99 (yamagata)); B/SC/99 (B/Sichuan/379/99 (yamagata)); B/FL/06 (B/Florida/4/2006 (yamagata)).
- Victoria lineages include, but are not limited to: B/BJ/97 (ca B/Beijing/243/97 (victoria)), B/HK/01 (B/Hong Kong/330/2001 (victoria)); B/MY/04 (B/Malaysia/2506/2004 (victoria)); B/BNE/08 (ca B/Brisbane/60/2008 (victoria)).
- the invention provides an isolated antibody or an antigen binding fragment thereof that is capable of binding to influenza B virus hemagglutinin and neutralizing influenza B virus in a pre-divergent strain.
- pre-divergent refers to influena B strains that were identified prior to the divergence of influenza B into Yamagata and Victoria lineages.
- Pre-divergent influenza B strains include, but are not limited to: B/Lee/40 (B/Lee/40); B/AA/66 (ca B/Ann Arbor/1 /66); and B/HK/72 (B/Hong Kong/5/72).
- the antibody or antigen binding fragment binds influenza B virus with an EC 5 o in the range of from about 1 ⁇ g/ml to about 50 ⁇ g/ml of antibody.
- the antibody or antigen binding fragment has a neutralizing potency expressed as 50% inhibitory concentration (IC 5 o ⁇ 9/ ⁇ ) in the range of from about 0.001 ⁇ 9/ ⁇ to about 5 ⁇ 9/ ⁇ of antibody for neutralization of influenza B virus in a microneutralization assay as described in Example 3. Other microneutralization assays are also described in Example 1 .
- the antibody is capable of binding to influenza A virus hemagglutinin.
- Influenza A virus hemagglutinin includes subtype 1 and subtype 2 hemagglutinin.
- Influenza A virus group 1 subtypes include: H1 , H2, H5, H6, H8, H9, H1 1 , H12, H13, H16 and variants thereof.
- Influenza A virus group 2 subtype include: H3, H4, H7, H10, H14 and H15 and variants thereof.
- the antibody is capable of binding to one or more influenza A virus group 1 subtypes.
- the antibody is capable of binding to one or more influenza A virus group 2 subtypes.
- the antibody is capable of binding to influenza A virus group 1 subtype H9.
- the invention provides an isolated antibody or an antigen binding fragment thereof that is capable of binding to influenza B virus hemagglutinin (HA) and influenza A virus hemagglutinin (HA) and neutralizing at least one Yamagata lineage influenza B virus; at least one Victoria lineage influenza B virus; at least one influenza A virus subtype, or combinations thereof.
- the invention provides an isolated antibody or an antigen binding fragment thereof that is capable of binding to influenza B virus hemagglutinin (HA) and one or more influenza A virus subtype 1 hemagglutinin (HA) and neutralizing at least one Yamagata lineage influenza B virus or at least one Victoria lineage influenza B virus and at least one influenza A virus subtype 1 .
- the invention provides an isolated antibody or an antigen binding fragment thereof that is capable of binding to influenza B virus hemagglutinin (HA) and influenza A virus subtype H9 hemagglutinin (HA) and neutralizing at least one Yamagata lineage influenza B virus; at least one Victoria lineage influenza B virus; influenza A virus subtype H9, or combinations thereof.
- the antibody or antigen binding fragment binds influenza A HA at an EC 5 o in the range of from about 1 ⁇ g/ml to about 50 ⁇ g/ml of antibody. In another embodiment, the antibody or antigen binding fragment has an IC 50 in the range of from about 0.01 ⁇ g/ml to about 5 ⁇ g/ml of antibody for neutralization of influenza A virus in a microneutralization assay.
- an antibody or fragment thereof of the invention binds to the globular head region of HA and neutralizes infection of influenza B virus in two phylogenetically distinct lineages.
- the antibody or antigen binding fragment thereof binds to the globular head region of HA and neutralizes infection of influenza B virus from both Yamagata and Victoria lineages.
- Antibodies of the invention which are anti-Influenza B HA globular head binding antibodies, demonstrate a broader breath of coverage or better neutralizing activity against influenza B viruses compared to known anti- influenza B antibodies.
- the antibody or antigen binding fragment thereof includes a set of six CDRs: HCDR-1 , HCDR-2, HCDR-3, LCDR-1 , LCDR-2, LCDR-3, in which the set of six CDRs is selected from:
- (s) a set of six CDRS according to any one of (a) to (r) including one or more amino acid substitutions, deletions or insertions.
- antibody or antigen binding fragment thereof has a VH having at least 75%, 80%, 85%, 90%, 95% or 100% identity and/or a VL having at least 75%, 80%, 85%, 90%, 95% or 100% identity to a VH and/or
- VL VL, respectively, selected from:
- the antibody or antigen binding fragment thereof includes a VH and a VL selected from:
- the invention provides an antibody or antigen binding fragment thereof that is capable of binding to influenza B virus hemagglutinin (HA) and neutralizing influenza B virus in two phylogenetically distinct lineages, wherein the antibody has a VH amino acid sequence of SEQ ID NO:71 , wherein Xaai of SEQ ID NO:71 is Val or Glu; Xaa 2 SEQ ID NO:71 is Leu or Phe; Xaa 3 SEQ ID NO:71 is Ser or Thr; Xaa SEQ ID NO:71 is Leu or Ser; Xaa 5 SEQ ID NO:71 is Ser or Thr; Xaa 6 SEQ ID NO:71 is Met or Thr; Xaa 7 SEQ ID NO:71 is Phe or Tyr; Xaa 8 SEQ ID NO:71 is His or Gin; Xaa 9 SEQ ID NO:71 is Ser or Asn; Xaai 0 SEQ ID NO:71 is Arg or Lys; and Xaan SEQ ID NO:
- Xaa 9 of SEQ ID NO:71 is Ser.
- Xaa of SEQ ID NO:71 is Leu.
- Xaai of SEQ ID NO:71 is Glu;
- Xaa 5 of SEQ ID NO:71 is Thr;
- Xaa 6 of SEQ ID NO:71 is Thr;
- Xaa 7 of SEQ ID NO:71 is Tyr;
- Xaa 8 of SEQ ID NO:71 is Gin;
- Xaai 0 of SEQ ID NO:71 is Lys;
- Xaan of SEQ ID NO:71 is Thr, or combinations thereof.
- Xaai of SEQ ID NO:71 is Glu; Xaa 5 of SEQ ID NO:71 is Thr; Xaa 6 of SEQ ID NO:71 is Thr; Xaa 7 of SEQ ID NO:71 is Tyr; Xaa 8 of SEQ ID NO:71 is Gin; Xaa 9 of SEQ ID NO:71 is Ser; Xaai 0 of SEQ ID NO:71 is Lys; and Xaan of SEQ ID NO:71 is Thr.
- the antibody or antigen binding fragment thereof is selected from: an immunoglobulin molecule, a monoclonal antibody, a chimeric antibody, a CDR-grafted antibody, a humanized antibody, a Fab, a Fab', a F(ab')2, a Fv, a disulfide linked Fv, a scFv, a single domain antibody, a diabody, a multispecific antibody, a dual-specific antibody, and a bispecific antibody.
- the antibody or antigen binding fragment thereof includes an Fc region.
- the antibody or antigen binding fragment thereof is an lgG1 , lgG2 or lgG4 or fragment thereof.
- the invention provides an antibody to influenza B virus or an antigen binding fragment thereof that is capable of binding to influenza B virus and neutralizing at least one Yamagata lineage and at least one Victoria lineage of influenza B virus, wherein the antibody or antigen binding fragment thereof binds an epitope that is conserved among at least one Yamagata lineage, and at least one Victoria lineage of influenza B virus.
- one or more contact residues of the epitope are located in a head region of influenza B HA.
- the epitope includes one or more amino acids selected from: 128, 141 , 150 and 235 of the sequence of the head region of HA as contact residues (Wang et al. (2008) J. Virol. 82(6):301 1 -20).
- the invention provides an antibody to influenza B virus or an antigen binding fragment thereof that is capable of binding to influenza B virus hemagglutinin and neutralizing influenza B virus in two phylogenetically distinct lineages that binds to the same epitope as or competes for binding to influenza B virus hemagglutinin with an antibody of the invention.
- the antibody or antigen binding fragment binds to the same epitope or competes for binding to influenza A virus hemagglutinin with an antibody having an amino acid sequence selected from:
- the invention also provides an isolated nucleic acid encoding an antibody or antigen binding fragment thereof of the invention, as well as a vector that includes such an isolated nucleic acid and a host cell that includes such a nucleic acid or vector.
- the vector is an expression vector.
- the vector is a non-naturally occurring recombinant vector.
- the vector is a plasmid.
- the vector or plasmid includes a nucleotide sequence encoding an antibody molecule of the invention, or antigen binding fragment thereof, a heavy or light chain of an antibody molecule of the invention, a heavy or light chain variable domain of an antibody of the invention, or a portion thereof, or a heavy or light chain CDR, operably linked to one or more expression control elements (e.g., promoter, enhancer, transcription terminators, polyadenylation sites, etc.), a selectable marker gene, or combinations thereof.
- the vector or plasmid includes at least one heterologous expression control element, selectable marker, or combinations thereof.
- the invention provides a method for manufacturing an antibody or antigen binding fragment thereof by culturing a host cell described herein under conditions suitable for expression of the antibody or fragment thereof.
- the method includes isolating the antibody or antigen binding fragment thereof from the host cell culture.
- the host cell is isolated from tissues in which the cell is naturally found.
- a host cell can be isolated from an organism and maintained ex vivo in a cell culture.
- the invention also provides a composition that includes an antibody or antigen binding fragment thereof of the invention and a pharmaceutically acceptable carrier.
- the composition includes an antibody or antigen binding fragment thereof of the invention and 25mM His and 0.15M NaCI at pH 6.0
- the antibody or antigen binding fragment thereof of the invention is used in the prophylaxis or treatment of influenza B infection in a subject. In another embodiment, the antibody or antigen binding fragment thereof is used in the prophylaxis or treatment of influenza A and influenza B infection in a subject. In another embodiment, the antibody or antigen binding fragment thereof of the invention is used in the manufacture of a medicament for the prophylaxis or treatment of influenza B infection in a subject. In another embodiment, the antibody or antigen binding fragment thereof of the invention is used in the manufacture of a medicament for the prophylaxis or treatment of influenza A and influenza B infection in a subject.
- the invention provides a method for prophylaxis or treatment of influenza B infection in a subject, which includes administering an effective amount of an antibody or antigen binding fragment thereof of the invention to the subject.
- the invention provides method for prophylaxis or treatment of influenza A and influenza B infection in a subject, which includes administering an effective amount of an antibody or antigen binding fragment thereof of the invention to the subject.
- the antibody or fragment thereof of the invention is used for in vitro diagnosis of influenza B infection in a subject. In another embodiment, the antibody or fragment thereof of the invention is used for in vitro diagnosis of influenza A infection in a subject. In yet another embodiment, the antibody or fragment thereof of the invention is used for in vitro diagnosis of influenza A infection and influenza B infection in a subject.
- Figure 1 shows the antibody-dependent cellular cytotoxicity (ADCC) as measured by NK cell activation after incubation with B/HongKong/330/2001 (Victoria lineage) and a serial dilution of anti-HA antibodies FBD-94 and FBC- 39, as well as variants that lack Fc-effector function (FBD-94 LALA and FBC- 39 LALA).
- ADCC antibody-dependent cellular cytotoxicity
- Figure 2 shows the percentage of surviving animals that were administered with different concentrations of FBC-39 (A and C), FBD-94 (B and D) and a non-relevant control antibody 4 hours before infection with a lethal dose of B/Sichuan/379/99 (Yamagata) (A and B) or B/Hong Kong/330/2001 (Victoria) (C and D) influenza virus.
- Figure 3 shows the percentage of surviving animals that were infected with a lethal dose of B/Sichuan/379/99 (Yamagata) (A and B) or B/Hong Kong/330/2001 (Victoria) (C and D) and treated on day 2 post-infection with different doses of FBC-39 (A and C) or FBD-94 (B and D), or a non-relevant control antibody.
- Figure 4 shows the percentage of surviving animals that were infected with a lethal dose of B/Hong Kong/330/2001 (Victoria) and treated at 1 , 2, 3, or 4 days post-infection with 3 mg/kg of FBC-39 (A) or FBD-94 (B), or a non- relevant control antibody.
- Figure 5 shows the CDRs (boxed) within the VH and VL sequences of anti- influenza B antibodies FBD-56, FBD-94, FBC-39, FBC-39 LSL, FBC-39 FSL, FBC-39 LTL, FBC-39 FTL, FBC-39 FSS, FBC-39 LTS, and FBC-39 FTS using the Kabat and IMGT numbering systems. Modified amino acids within the VH and VL sequences are bolded and underlined.
- Figure 6 shows the heavy chain amino acid sequence of a genericized anti- influenza B antibody (SEQ ID NO:71 ), based on the heavy chain amino acid sequence of FBC-39 (SEQ ID NO:22), wherein Xaai can be Val or Glu; Xaa 2 can be Leu or Phe; Xaa 3 can be Thr or Ser; Xaa 4 can be Ser or Leu; Xaa 5 can be Thr or Ser; Xaa 6 can be Thr or Met; Xaa 7 can be Tyr or Phe; Xaa 8 can be Gin or His; Xaa 9 can be Asn or Ser; Xaai 0 can be Lys or Arg; and Xaan can be Thr or Ala.
- Figure 7 shows the light chain amino acid sequence of a genericized anti- influenza B antibody (SEQ ID NO:72), based on the light chain amino acid sequence of FBC-39 (SEQ ID NO:27), wherein Xaai can be Phe or Tyr.
- Figure 8 shows the alignment of the HA1 proteins from the viruses used in the monoclonal antibody resistant mutant (MARM) isolation. Amino acid positions found to be contact residues through MARM selection are boxed.
- the present invention provides antibodies, including human forms, as well as antigen binding fragments, derivatives/conjugates and compositions thereof that bind to influenza B virus hemagglutinin (HA) and neutralize influenza B virus in two phylogenetically distinct lineages as described herein.
- the antibodies or antigen binding fragments thereof bind to influenza B virus hemagglutinin (HA) and neutralize influenza B virus in both Yamagata and Victoria lineages as described herein; such anti-influenza B antibodies and fragments thereof are referred to herein as antibodies of the invention.
- the antibodies or antigen binding fragments thereof bind influenza B virus hemagglutinin (HA) and influenza A virus hemagglutinin (HA) and neutralize at least one Yamagata lineage influenza B virus; at least one Victoria lineage influenza B virus; at least one influenza A virus subtype, or combinations thereof.
- HA hemagglutinin
- HA influenza A virus hemagglutinin
- Such anti-influenza B antibodies and fragments thereof are also referred to herein as antibodies of the invention.
- the term “neutralize” refers to the ability of an antibody, or antigen binding fragment thereof, to bind to an infectious agent, such as influenza A and/or B virus, and reduce the biological activity, for example, virulence, of the infectious agent.
- the antibody or antigen binding fragment thereof of the invention immunospecifically binds at least one specified epitope or antigenic determinant of the influenza A virus; influenza B virus, or combinations thereof.
- the antibody or antigen binding fragment thereof of the invention immunospecifically binds at least one specified epitope or antigenic determinant of influenza B virus hemagglutinin (HA).
- HA hemagglutinin
- the antibody or binding fragment thereof of the invention immunospecifically binds at least one specified epitope or antigenic determinant of the Influenza B virus HA globular head.
- An antibody can neutralize the activity of an infectious agent, such as influenza A and/or influenza B virus at various points during the lifecycle of the virus.
- an antibody may interfere with viral attachment to a target cell by interfering with the interaction of the virus and one or more cell surface receptors.
- an antibody may interfere with one or more post- attachment interactions of the virus with its receptors, for example, by interfering with viral internalization by receptor-mediated endocytosis.
- antibody and “antibodies”, also known as immunoglobulins, encompass monoclonal antibodies (including full-length monoclonal antibodies), human antibodies, humanized antibodies, camelid antibodies, chimeric antibodies, single-chain Fvs (scFv), single-chain antibodies, single domain antibodies, domain antibodies, Fab fragments, F(ab')2 fragments, antibody fragments that exhibit the desired biological activity (e.g. the antigen binding portion), disulfide-linked Fvs (dsFv), and anti- idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention), intrabodies, and epitope-binding fragments of any of the above.
- scFv single-chain Fvs
- Fab fragments single-chain antibodies
- F(ab')2 fragments fragments that exhibit the desired biological activity
- dsFv disulfide-linked Fvs
- anti-Id anti- idiotypic antibodies
- antibodies include immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, i.e., molecules that contain at least one antigen-binding site.
- Immunoglobulin molecules can be of any isotype (e.g., IgG, IgE, IgM, IgD, IgA and IgY), subisotype (e.g., lgG 1 , lgG2, lgG3, lgG4, lgA1 and lgA2) or allotype (e.g., Gm, e.g., G1 m(f, z, a or x), G2m(n), G3m(g, b, or c), Am, Em, and Km(1 , 2 or 3)).
- isotype e.g., IgG, IgE, IgM, IgD, IgA and IgY
- subisotype e.g., lgG 1 , lg
- Human antibodies are usually heterotetrameric glycoproteins of about 150,000 daltons, which include two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies between the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (VH) followed by a number of constant domains (CH).
- VH variable domain
- CH constant domains
- Each light chain has a variable domain at one end (VL) and a constant domain (CL) at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain.
- Light chains are classified as either lambda chains or kappa chains based on the amino acid sequence of the light chain constant region.
- the variable domain of a kappa light chain may also be denoted herein as VK.
- the antibodies of the invention include full length or intact antibody, antibody fragments, including antigen binding fragments, native sequence antibody or amino acid variants, human, humanized, post-translationally modified, chimeric or fusion antibodies, immunoconjugates, and functional fragments thereof.
- the antibodies can be modified in the Fc region to provide desired effector functions or serum half-life.
- the naked antibody bound on the cell surface can induce cytotoxicity, e.g., via antibody-dependent cellular cytotoxicity (ADCC) or by recruiting complement in complement dependent cytotoxicity (CDC), or by recruiting nonspecific cytotoxic cells that express one or more effector ligands that recognize bound antibody on the influenza A and/or influenza B virus and subsequently cause phagocytosis of the cell in antibody dependent cell-mediated phagocytosis (ADCP), or some other mechanism.
- ADCC antibody-dependent cellular cytotoxicity
- CDC complement in complement dependent cytotoxicity
- ADCP antibody dependent cell-mediated phagocytosis
- certain other Fc regions may be used. Methods for enhancing as well as reducing or eliminating Fc-effector function are described herein.
- the Fc region of the antibodies of the invention can be modified to increase the binding affinity for FcRn and thus increase serum half-life.
- the Fc region can be conjugated to PEG or albumin to increase the serum half- life, or some other conjugation that results in the desired effect.
- the antibodies are useful for diagnosing, preventing, treating and/or alleviating one or more symptoms of influenza B virus infection in a mammal. In another embodiment, the antibodies are useful for diagnosing, preventing, treating and/or alleviating one or more symptoms of influenza A and influenza B virus infection in an animal.
- the term "animal” refers to mammals including, but not limited to, humans, non- human primates, dogs, cats, horses, rabbits, mice, and rats; and non- mammalian species, including, but not limited to, avian species such as chickens, turkeys, ducks, and quail.
- the invention provides a composition that includes an antibody of the invention and a carrier.
- compositions can be administered to the patient in need of such treatment.
- the composition can be administered to a patient for preventing or treating influenza A virus infection; influenza B virus infection; and combinations thereof.
- the invention also provides formulations that include an antibody of the invention and a carrier.
- the formulation is a therapeutic formulation that includes a pharmaceutically acceptable carrier.
- the invention provides methods useful for preventing or treating influenza B infection in a mammal, including administering a therapeutically effective amount of the antibody to the mammal. In other embodiments, the invention provides methods useful for preventing or treating influenza A infection; influenza B infection; and combinations thereof in a mammal, including administering a therapeutically effective amount of the antibody to the mammal.
- the antibody therapeutic compositions can be administered short term (acutely), chronically, or intermittently as directed by physician.
- the invention also provides articles of manufacture that include at least an antibody of the invention, such as sterile dosage forms and kits.
- Kits can be provided which contain the antibodies for detection and quantitation of influenza virus in vitro, e.g. in an ELISA or a Western blot.
- Such antibody useful for detection may be provided with a label such as a fluorescent or radiolabel.
- Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the lUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
- the antibodies are isolated and/or purified and/or pyrogen free antibodies.
- purified refers to other molecules, e.g., polypeptide, nucleic acid molecule that have been identified and separated and/or recovered from a component of its natural environment.
- the antibodies of the invention are purified antibodies wherein they have been separated from one or more components of their natural environment.
- isolated antibody refers to an antibody which is substantially free of other antibody molecules having different antigenic specificities (e.g., an isolated antibody that specifically binds to influenza B virus that is substantially free of antibodies that specifically bind antigens other than those of the influenza B virus HA antibody).
- the antibodies of the invention are isolated antibodies that have been separated from antibodies with a different specificity.
- an isolated antibody is a monoclonal antibody.
- an isolated antibody of the invention may be substantially free of one or more other cellular materials and/or chemicals and is herein referred to an isolated and purified antibody.
- a combination of "isolated" monoclonal antibodies relates to antibodies having different specificities and being combined in a well-defined composition. Methods of production and purification/isolation of antibodies are described below in more detail.
- the isolated antibodies of the present invention include antibody amino acid sequences disclosed herein encoded by any suitable polynucleotide, or any isolated or formulated antibody.
- the antibodies of the invention immunospecifically bind at least one specified epitope specific to the influenza B virus HA protein.
- epitope refers to a protein determinant capable of binding to an antibody.
- Epitopes usually include chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
- the antibody or antigen binding fragment thereof binds to an epitope present on at least two phylogenetically distinct influenza B lineages. In a more particular embodiment, the antibody or antigen binding fragment thereof binds to an epitope present in at least one influenza B Yamagata strain and at least one influenza B Victoria strain. In one embodiment, the antibody or antigen binding fragment thereof binds to an epitope that is present in influenza B virus of both Yamagata lineage and Victoria lineage. In one embodiment, the antibody or antigen binding fragment thereof binds to an epitope that is conserved among influenza B of both Yamagata lineage and Victoria lineage.
- the antibody or antigen binding fragment thereof binds to at least one influenza B Yamagata strain and at least one influenza B Victoria strain with a half maximal effective concentration (EC 50 ) of between about 1 ng/ml and about 500 ng/ml, or between about 1 ng/ml and about 250 ng/ml, or between about 1 ng/ml and about 50 ng/ml, or less than about 500 ng/ml, 250 ng/ml, 100 ng/ml, 50 ng/ml, 40 ng/ml, 30 ng/ml, 20 ng/ml, or 1 5 ⁇ g/ml.
- EC 50 half maximal effective concentration
- the antibody or antigen binding fragment thereof binds to influenza B virus of Yamagata and Victoria lineage with an EC 5 o of between about 1 ng/ml and about 500 ng/ml, or between about 1 ng/ml and about 250 ng/ml, or between about 1 ng/ml and about 50 ng/ml, or less than about 500 ng/ml, 250 ng/ml, 100 ng/ml, 50 ng/ml, 40 ng/ml, 30 ng/ml, 20 ng/ml, or 15 ⁇ g/ml.
- the antibody or antigen binding fragment thereof binds to an epitope present in influenza B virus of both Yamagata lineage and Victoria lineage with an EC 5 o of between about 1 ng/ml and about 500 ng/ml, or between about 1 ng/ml and about 250 ng/ml, or between about 1 ng/ml and about 50 ng/ml, or less than about 500 ng/ml, 250 ng/ml, 100 ng/ml, 50 ng/ml, 40 ng/ml, 30 ng/ml, 20 ng/ml, or 15 ⁇ g/ml.
- the antibody or antigen binding fragment thereof binds to: an epitope present on influenza B Yamagata lineage at an EC 50 of between about 1 ng/ml and about 100 ng/ml, 1 ng/ml and about 50 ng/ml, or between about 1 ng/ml and about 25 ng/ml, or less than about 50 ng/ml or 25 ng/ml; and an epitope present on influenza B Victoria lineage at an EC 50 of between about 1 ng/ml and about 500 ng/ml, or between about 1 ng/ml and about 250 ng/ml, or between about 1 ng/ml and about 50 ng/ml, or less than about 500 ng/ml, 250 ng/ml, 100 ng/ml or 50 ng/ml.
- the antibody or antigen binding fragment thereof binds to: an epitope present on influenza B Yamagata lineage at an EC 5 o of between about 1 ng/ml and about 100 ng/ml, 1 ng/ml and about 50 ng/ml, or between about 1 ng/ml and about 25 ng/ml, or less than about 50 ng/ml or 25 ng/ml; an epitope present on influenza B Victoria lineage at an EC 5 o of between about 1 ng/ml and about 500 ng/ml, or between about 1 ng/ml and about 250 ng/ml, or between about 1 ng/ml and about 50 ng/ml, or less than about 500 ng/ml, 250 ng/ml or 100 ng/ml; and an epitope on influenza A HA with an EC 5 o of between about 1 ⁇ g/ml and about 50 ⁇ ig/m ⁇ , or less than about 50 [ig/m ⁇ , 25
- the antibody or antigen binding fragment thereof binds to: an epitope present on influenza B Yamagata lineage at an EC 5 o of between about 1 ng/ml and about 100 ng/ml, 1 ng/ml and about 50 ng/ml, or between about 1 ng/ml and about 25 ng/ml, or less than about 50 ng/ml or 25 ng/ml; an epitope present on influenza B Victoria lineage at an EC 5 o of between about 1 ng/ml and about 500 ng/ml, or between about 1 ng/ml and about 250 ng/ml, or between about 1 ng/ml and about 50 ng/ml, or less than about 500 ng/ml, 250 ng/ml or 1 00 ng/ml; and an epitope on influenza A H9 HA with an EC 5 o of between about 1 ⁇ g/ml and about 50 ⁇ ig/m ⁇ , or less than about 50 ⁇ ig/m ⁇ ,
- the antibody or antigen binding fragment thereof recognizes an epitope that is either a linear epitope, or continuous epitope. In another embodiment, the antibody or antigen binding fragment thereof recognizes a non-linear or conformational epitope.
- the epitope is located on the hemagglutinin (HA) glycoprotein of influenza B. In a more particular embodiment, the epitope is located on the head region of the HA glycoprotein of influenza B. In one embodiment, the epitope includes one or more amino acids at positions 128, 141 , 150 or 235 in the head region of influenza B HA as contact residues, which are numbered according to the H3 numbering system as described in Wang et al. (2008) J. Virol.
- the epitope includes amino acid 128 of the sequence of the head region of influenza B HA as a contact residue. In another embodiment, the epitope includes amino acids 141 , 150 and 235 of the sequence of the head region of influenza B HA as contact residues.
- the epitope or epitopes recognized by the antibody or antigen binding fragment thereof of the invention may have a number of uses.
- the epitope in purified or synthetic form can be used to raise immune responses (i.e., as a vaccine, or for the production of antibodies for other uses) or for screening sera for antibodies that immunoreact with the epitope.
- an epitope recognized by the antibody or antigen binding fragment thereof of the invention, or an antigen having such an epitope may be used as a vaccine for raising an immune response.
- the antibodies and antigen binding fragments of the invention can be used to monitor the quality of vaccines, for example, by determining whether the antigen in a vaccine contains the correct immunogenic epitope in the correct conformation.
- parent antibody refers to an antibody which is encoded by an amino acid sequence used for the preparation of a variant or derivative, defined herein.
- the parent polypeptide may include a native antibody sequence (i.e., a naturally occurring, including a naturally occurring allelic variant) or an antibody sequence with pre-existing amino acid sequence modifications (such as other insertions, deletions and/or substitutions) of a naturally occurring sequence.
- the parent antibody may be a humanized antibody or a human antibody.
- antibodies of the invention are variants of a parent antibody.
- variant refers to an antibody that differs in amino acid sequence from a "parent” antibody amino acid sequence by virtue of addition, deletion and/or substitution of one or more amino acid residue(s) in the parent antibody sequence.
- the antigen-binding portion of an antibody includes one or more fragments of an antibody that retain the ability to specifically bind to an antigen. It has been shown that the antigen-binding function of an antibody can be performed by fragments of a full-length antibody.
- antigen binding fragments encompassed within the term "antigen-binding portion" of an antibody include (i) a Fab fragment, a monovalent fragment that includes the VL, VH, CL and CH1 domains; (ii) a F(ab')2 fragment, a bivalent fragment that includes two Fab fragments linked by a disulfide bridge at the hinge region; (iii) a Fd fragment that includes the VH and CH1 domains; (iv) a Fv fragment that includes the VL and VH domains of a single arm of an antibody, (v) a dAb fragment (Ward et al.
- VL and VH are coded for by separate genes, they can be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain Fv (scFv); see e.g., Bird et al. (1988) Science. 242:423-426; and Huston et al. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883).
- scFv single chain Fv
- Antibodies of the invention include at least one antigen binding domain, which include a VH and a VL domain described herein. Exemplary VH and VL domains are shown in Table 1 , below.
- the purified antibodies include a VH and/or VL that has a given percent identify to at least one of the VH and/or VL sequences disclosed herein.
- percent (%) sequence identity also including “homology” is defined as the percentage of amino acid residues or nucleotides in a candidate sequence that are identical with the amino acid residues or nucleotides in the reference sequences, such as parent antibody sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.
- Optimal alignment of the sequences for comparison may be produced, besides manually, by means of the local homology algorithm of Smith and Waterman (1981 ) Ads App. Math.
- Antibodies of the invention may include a VH amino acid sequence having at least 65%, 70%, 75%, 80%, 85%, 90%, 95% or 100% identity to the VH amino acid sequences described herein.
- antibodies of the invention may have a VH amino acid sequence having at least, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the amino acid sequence of the VH amino acid sequences described herein.
- Antibodies of the invention may include a VL amino acid sequence having at least 65%, 70%, 75%, 80%, 85%, 90%, 95% or 1 00% identity to the VL amino acid sequences described herein.
- antibodies of the invention may have a VL amino acid sequence having at least, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identity to the VL amino acid sequences described herein.
- CDRs Complementarity Determining Regions
- variable domain includes the antigen-binding region; the variability is not evenly distributed through the variable domains of antibodies. It is concentrated in segments called Complementarity Determining Regions (CDRs), both in the light chain (VL or VK) and the heavy chain (VH) variable domains. The more highly conserved portions of the variable domains are called the framework regions (FR).
- CDRs Complementarity Determining Regions
- FR framework regions
- the variable domains of native heavy and light chains each include four FR, largely adopting a ⁇ -sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the ⁇ -sheet structure.
- the CDRs in each chain are held together in close proximity by the FR and, with the CDRs from the other chain, contribute to the formation of the antigen- binding site of antibodies.
- the three CDRs of the heavy chain are designated HCDR-1 , HCDR-2, and HCDR-3, and the three CDRs of the light chain are designated LCDR-1 , LCDR-2, and LCDR-3.
- the amino acids in the variable domain, complementarity determining region (CDRs) and framework regions (FR) of an antibody can be identified following Kabat et al. (1991 ) Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD. Using this numbering system, the actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or CDR of the variable domain.
- a heavy chain variable domain may include a single amino acid insertion (residue 52a according to Kabat) after residue 52 of H2 and inserted residues (e.g.
- residues 82a, 82b, and 82c, etc., according to Kabat after heavy chain FR residue 82.
- the Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a "standard” Kabat numbered sequence. Maximal alignment of framework residues often requires the insertion of "spacer" residues in the numbering system. In addition, the identity of certain individual residues at any given Kabat site number may vary from antibody chain to antibody chain due to interspecies or allelic divergence.
- HCDR-1 begins at approximately amino acid 31 (i.e., approximately 9 residues after the first cysteine residue), includes approximately 5-7 amino acids, and ends at the next tyrosine residue.
- HCDR-2 begins at the fifteenth residue after the end of CDR- H1 , includes approximately 16-19 amino acids, and ends at the next arginine or lysine residue.
- HCDR-3 begins at approximately the thirty third amino acid residue after the end of HCDR-2; includes 3-25 amino acids; and ends at the sequence W-G-X-G, where X is any amino acid.
- LCDR-1 begins at approximately residue 24 (i.e., following a cysteine residue); includes approximately 10-1 7 residues; and ends at the next tyrosine residue.
- LCDR-2 begins at approximately the sixteenth residue after the end of LCDR-1 and includes approximately 7 residues.
- LCDR-3 begins at approximately the thirty third residue after the end of LCDR-2; includes approximately 7-1 1 residues and ends at the sequence F-G-X-G, where X is any amino acid. Note that CDRs vary considerably from antibody to antibody (and by definition will not exhibit homology with the Kabat consensus sequences). CDR heavy chain and light chain sequences of antibodies of the invention, numbered using the Kabat system are shown in Tables 2 and 3, below.
- the Kabat numbering scheme is widely used, it has some shortcomings.
- the amino acids in the variable domain, complementarity determining regions (CDRs) and framework regions (FR) of an antibody can be identified using the Immunogenetics (IMGT) database (http://imgt.cines.fr).
- IMGT immunoglobulins
- TcR T-cell receptors
- MHC Major Histocompatibility Complex
- IMGT also takes into account and combines the definition of the framework (FR) and complementarity determining regions (CDR) from Kabat et al., the characterization of the hypervariable loops from Chothia et al., as well as structural data from X-ray diffraction studies.
- CDR heavy chain and light chain sequences for antibodies of the invention are shown in Tables 4 and 5, below.
- Figure 5 provides an alignment of the FBD-56, FBD-94 and FBC-39 sequences showing the CDR sequences as identified by Kabat, and IMGT.
- the present invention encompasses neutralizing anti-influenza B antibodies that include amino acids in a sequence that is at least 75%, 80%, 85%, 90%, 95% or 100% identical to an amino acid sequence of a VH of SEQ ID NO.: 2; SEQ ID NO.: 12; SEQ ID NO.: 22; SEQ ID NO.: 32; SEQ ID NO.: 42; SEQ ID NO.: 52; SEQ ID NO.: 62; SEQ ID NO.: 74; SEQ ID NO.: 90; or SEQ ID NO.: 106; and/or at least 75%, 80%, 85%, 90%, 95% or 100% identical to an amino acid sequence of a VL of SEQ ID NO.: 7; SEQ ID NO.: 17; SEQ ID NO.: 27; SEQ ID NO.: 37; SEQ ID NO.: 47; SEQ ID NO.: 57; SEQ ID NO.: 67; SEQ ID NO.: 82; SEQ ID NO.
- the present invention encompasses neutralizing anti-influenza B antibodies that include amino acids in a sequence that is at least 95%, 96%, 97%, 98%, 99% or 1 00% identical to an amino acid sequence of a VH of SEQ ID NO.: 2; SEQ ID NO.: 12; SEQ ID NO.: 22; SEQ ID NO.
- invention provides antibodies and antigen binding fragments thereof that include a set of six CDRs: HCDR-1 , HCDR-2, HCDR-3, LCDR-1 , LCDR-2, LCDR-3, wherein CDRs are selected from the HCDRs and LCDRs shown in Tables 2 through 5.
- the invention provides antibodies and antigen binding fragments thereof that include a set of six CDRs: HCDR-1 , HCDR-2, HCD R-3, LCDR-1 , LCDR-2, LCDR-3, wherein CDRs include amino acids in a sequence that is at least 75%, 80%, 85%, 90%, 95% or 1 00% identical to an amino acid sequence of the HCDRs and LCDRs shown in Tables 2 through 5.
- the invention provides antibodies and antigen binding fragments thereof that include a set of six CDRs: HCDR-1 , HCDR-2, HCDR-3, LCD R-1 , LCDR-2, LCDR-3, wherein CDRs include amino acids in a sequence that is at least 95%, 96%, 97%, 98%, 99% or 1 00% identical to an amino acid sequence of the HCDRs and LCDRs shown in Tables 2 through 5.
- variable domains of the heavy and light chains each include four framework regions (FR1 , FR2, FR3, FR4), which are the more highly conserved portions of the variable domains.
- the four FRs of the heavy chain are designated FR-H 1 , FR-H2, FR-H3 and FR-H4, and the four FRs of the light chain are designated FR-L1 , FR-L2, FR-L3 and FR-L4.
- the Kabat numbering system can be used to identify the framework regions.
- FR-H 1 begins at position 1 and ends at approximately amino acid 30, FR-H2 is approximately from amino acid 36 to 49, FR-H3 is approximately from amino acid 66 to 94 and FR-H4 is approximately amino acid 1 03 to 1 1 3.
- FR-L1 begins at amino acid 1 and ends at approximately amino acid 23
- FR-L2 is approximately from amino acid 35 to 49
- FR-L3 is approximately from amino acid 57 to 88
- FR-L4 is approximately from amino acid 98 to 1 07.
- the framework regions may contain substitutions according to the Kabat numbering system, e.g., insertion at 1 06A in FR-L1 .
- one or more alterations (e.g., substitutions) of FR residues may also be introduced in an antibody of the invention, provided it retains neutralizing ability. In certain embodiments, these result in an improvement or optimization in the binding affinity of the antibody for influenza B virus HA.
- framework region residues to modify include those which non-covalently bind antigen directly (Amit et al. (1 986) Science. 233:747-753); interact with/effect the conformation of a CDR (Chothia et al. (1987) J. Mol. Biol. 196:901 -91 7); and/or participate in the VL-VH interface (US Patent No. 5,225,539).
- the framework regions can be identified using the numbering system of IMGT.
- the FR may include one or more amino acid changes for the purposes of "germlining".
- the amino acid sequences of selected antibody heavy and light chains can be compared to germline heavy and light chain amino acid sequences; where certain framework residues of the selected VL and/or VH chains differ from the germline configuration (e.g., as a result of somatic mutation of the immunoglobulin), it may be desirable to "back-mutate” the altered framework residues of the selected antibodies to the germline configuration (i.e., change the framework amino acid sequences of the selected antibodies so that they are the same as the germline framework amino acid sequences), for example, to reduce the chance of immunogenicity.
- Such "back-mutation" (or “germlining") of framework residues can be accomplished by standard molecular biology methods for introducing specific mutations (e.g., site-directed mutagenesis; PCR-mediated mutagenesis, and the like).
- Figure 6 shows the amino acid sequence of the VH domain of a genericized anti-influenza B antibody (SEQ ID NO:71 ) in which non-germline residues in FBC-39 (SEQ ID NO: 22) are designated as Xaai-n .
- non-germline residues in FBC-39 SEQ ID NO: 22
- one or more of the non-germline (Xaai-n) residues are "back-mutated" to germline.
- Xaai of SEQ ID NO: 71 is Val or Glu; Xaa 2 of SEQ ID NO: 71 is Leu or Phe; Xaa 3 of SEQ ID NO: 71 is Ser or Thr; Xaa of SEQ ID NO: 71 is Leu or Ser; Xaa 5 of SEQ ID NO: 71 is Ser or Thr; Xaa 6 of SEQ ID NO: 71 is Met or Thr; Xaa 7 of SEQ ID NO: 71 is Phe or Tyr; Xaa 8 of SEQ ID NO: 71 is His or Gin; Xaa 9 of SEQ ID NO: 71 is Ser or Asn; Xaai 0 of SEQ ID NO: 71 is Arg or Lys; and Xaan of SEQ ID NO: 71 is Ala or Thr.
- Xaai of SEQ ID NO:71 is Glu; Xaa 5 of SEQ ID NO:71 is Thr; Xaa 6 of SEQ ID NO:71 is Thr; Xaa 7 of SEQ ID NO:71 is Tyr; Xaa 8 of SEQ ID NO:71 is Gin; Xaai 0 of SEQ ID NO:71 is Lys; Xaan of SEQ ID NO:71 is Thr, or combinations thereof.
- Xaa 9 of SEQ ID NO:71 is Ser.
- Xaa of SEQ ID NO:71 is Leu.
- Figure 7 shows an amino acid sequence of the VL domain of a genericized anti-influenza B antibody (SEQ ID NO:72), in which non-germline residues in FBC-39 (SEQ ID NO: 27) are represented by Xaai .
- the non-germline residue (Xaai) is "back-mutated" to germline.
- Xaai of SEQ ID NO:72 is Phe or Tyr.
- Xaai of SEQ ID NO:72 is Tyr.
- the invention further provides nucleotide sequences corresponding to the amino acid sequences and encoding the human antibodies of the invention.
- the invention provides polynucleotides that include a nucleotide sequence encoding an antibody described herein or fragments thereof. These include, but are not limited to, nucleotide sequences that code for the above referenced amino acid sequences.
- the present invention also provides polynucleotide sequences encoding VH and VL framework regions including CDRs and FRs of antibodies described herein as well as expression vectors for their efficient expression in cells (e.g. mammalian cells). Methods of making the antibodies using polynucleotides are described below in more detail.
- the invention also encompasses polynucleotides that hybridize under stringent or lower stringency hybridization conditions, e.g., as defined herein, to polynucleotides that encode an antibody of the invention described herein.
- stringency refers to experimental conditions (e.g. temperature and salt concentration) of a hybridization experiment to denote the degree of homology between the probe and the filter bound nucleic acid; the higher the stringency, the higher percent homology between the probe and filter bound nucleic acid.
- Stringent hybridization conditions include, but are not limited to, hybridization to filter-bound DNA in 6X sodium chloride/sodium citrate (SSC) at about 45 ° C followed by one or more washes in 0.2X SSC/0.1 % SDS at about 50-65 ° C, highly stringent conditions such as hybridization to filter-bound DNA in 6X SSC at about 45 °C followed by one or more washes in 0.1 X SSC/0.2% SDS at about 65 ° C, or any other stringent hybridization conditions known to those skilled in the art (see, for example, Ausubel et al., eds. (1989) Current Protocols in Molecular Biology, vol. 1 , Green Publishing Associates, Inc. and John Wiley and Sons, Inc., NY at pages 6.3.1 to 6.3.6 and 2.1 0.3).
- SSC sodium chloride/sodium citrate
- Substantially identical sequences may be polymorphic sequences, i.e., alternative sequences or alleles in a population.
- An allelic difference may be as small as one base pair.
- Substantially identical sequences may also include mutagenized sequences, including sequences having silent mutations.
- a mutation may include one or more residue changes, a deletion of one or more residues, or an insertion of one or more additional residues.
- the polynucleotides may be obtained, and the nucleotide sequence of the polynucleotides determined, by any method known in the art.
- a polynucleotide encoding the antibody may be assembled from chemically synthesized oligonucleotides (e.g., as described in Kutmeier et al. (1994) BioTechniques. 17:242), which, briefly, involves the synthesis of overlapping oligonucleotides containing portions of the sequence encoding the antibody, annealing and ligating of those oligonucleotides, and then amplification of the ligated oligonucleotides by PCR.
- a polynucleotide encoding an antibody may also be generated from nucleic acid from a suitable source. If a clone containing a nucleic acid encoding a particular antibody is not available, but the sequence of the antibody molecule is known, a nucleic acid encoding the immunoglobulin may be chemically synthesized or obtained from a suitable source (e.g., an antibody cDNA library, or a cDNA library generated from, or nucleic acid, in one embodiment polyA+RNA, isolated from, any tissue or cells expressing the antibody, such as hybridoma cells selected to express an antibody) by PCR amplification using synthetic primers hybridizable to the 3' and 5' ends of the sequence or by cloning using an oligonucleotide probe specific for the particular gene sequence to identify, e.g., a cDNA clone from a cDNA library that encodes the antibody. Amplified nucleic acids generated by PCR may then be cloned
- the nucleotide sequence of the antibody may be manipulated using methods well known in the art for the manipulation of nucleotide sequences, e.g., recombinant DNA techniques, site directed mutagenesis, PCR, etc. (see, for example, the techniques described in Sambrook et al. (1 990) Molecular Cloning, A Laboratory Manual, 2d Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. and Ausubel et al. eds. (1998) Current Protocols in Molecular Biology, John Wiley & Sons, NY), to generate antibodies having a different amino acid sequence, for example to create amino acid substitutions, deletions, and/or insertions.
- the antibodies or antigen binding fragments of the invention immunospecifically bind at least one specified epitope or antigenic determinant of influenza B virus HA protein, peptide, subunit, fragment, portion or any combination thereof either exclusively or preferentially with respect to other polypeptides.
- the epitope or antigenic determinant of influenza B virus HA protein is the globular head.
- epitope or antigenic determinant refers to a protein determinant capable of binding to an antibody.
- binding herein relates to specific binding.
- protein determinants or epitopes usually include chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have a specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
- discontinuous epitope refers to a conformational epitope on a protein antigen which is formed from at least two separate regions in the primary sequence of the protein.
- antigens and antibodies are the same as for other non-covalent protein-protein interactions.
- Hydrophobic interactions are a major driving force for the antibody-antigen interaction, and are based on repulsion of water by non-polar groups rather than attraction of molecules (Tanford, (1 978) Science. 200:1 01 2-8).
- certain physical forces also contribute to antigen-antibody binding, for example, the fit or complimentary of epitope shapes with different antibody binding sites.
- other materials and antigens may cross- react with an antibody, thereby competing for available free antibody.
- Binding affinity generally refers to the strength of the sum total of the noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen).
- binding affinity refers to intrinsic binding affinity which reflects a 1 : 1 interaction between members of a binding pair (e.g., antibody and antigen).
- the affinity of a molecule X for its partner Y can generally be represented by the equilibrium dissociation constant (Kd), which is calculated as the ratio k 0 ff/k on .
- Kd equilibrium dissociation constant
- Low-affinity antibodies generally bind antigen slowly and tend to dissociate readily, whereas high-affinity antibodies generally bind antigen faster and tend to remain bound longer.
- a variety of methods of measuring binding affinity are known in the art, any of which can be used for purposes of the present invention.
- One method for determining binding affinity includes measuring the disassociation constant "Kd" by a radiolabeled antigen binding assay (RIA) performed with the Fab version of an antibody of interest and its antigen as described by Chen et al. (1 999) J. Mol Biol. 293:865-881 .
- the Kd value may be measured by using surface plasmon resonance assays using a BIAcoreTM-2000 or a BIAcoreTM-3000 (BIAcore, Inc. , Piscataway, N.J.).
- the on-rate can be determined by using a fluorescent quenching technique that measures the increase or decrease in fluorescence emission intensity in the presence of increasing concentrations of antigen.
- An "on-rate” or “rate of association” or “association rate” or “k on” can also be determined with the same surface plasmon resonance technique described above.
- antibodies of the present invention may also be described or specified in terms of their binding affinity for influenza A virus polypeptides; influenza B virus polypeptides; or a combination thereof.
- antibodies with high affinity have Kd of less than 1 0 ⁇ 7 M.
- antibodies or antigen binding fragments thereof bind influenza A polypeptides; influenza B polypeptides; fragments or variants thereof; or a combination thereof, with a dissociation constant or Kd of less than or equal to 5 ⁇ 10 "7 M, 10 "7 M, 5 ⁇ 10 "8 M, 10 “8 M, 5x10 "9 M, 10 "9 M, 5 ⁇ 1( ⁇ 10 ⁇ , 1( ⁇ 10 ⁇ , 5 ⁇ 1( ⁇ 11 M, 1( ⁇ 11 M, 5 ⁇ 1( ⁇ 12 M, 10 "12 M, 5 ⁇ 10 "13 ⁇ , 10 "13 M, 5 ⁇ 10 "1 ⁇ , 10 "1 M, 5 ⁇ 10 "15 ⁇ or 10 "15 M.
- antibodies or antigen binding fragments thereof bind influenza A polypeptides; influenza B polypeptides, fragments or variants thereof; or combinations thereof, with a dissociation constant or Kd of less than or equal to 5 ⁇ 10 "10 ⁇ , 10 "10 M, 5x10 "11 M, 10 "11 M, 5 ⁇ 10 "12 ⁇ or 10 "12 M.
- the invention encompasses antibodies that bind influenza A polypeptides; influenza B polypeptides; or a combination thereof, with a dissociation constant or Kd that is within a range between any of the individual recited values.
- antibodies or antigen binding fragments thereof of the invention bind influenza A polypeptides; influenza B polypeptides; fragments or variants thereof; or combinations thereof, with an off rate (k off ) of less than or equal to 5 ⁇ 10 "2 sec “1 , 10 "2 sec “1 , 5 ⁇ 10 "3 sec “1 or 10 “3 sec “1 , 5 ⁇ 10 “4 sec “1 , 10 " sec “1 , 5x10 “5 sec “1 , or 10 "5 sec “1 , 5x10 “6 sec “1 , 10 “6 sec “1 , 5x10 "7 sec “1 or 10 “7 sec “1 .
- antibodies or antigen binding fragments thereof of the invention bind influenza A polypeptides or fragments or variants thereof with an off rate (k of f) less than or equal to 5x10 " sec “1 , 10 "4 sec “1 , 5x10 "5 sec “1 , or 10 "5 sec “1 , 5 ⁇ 10 "6 sec “1 , 10 “6 sec “1 , 5 ⁇ 10 "7 sec “1 or 10 "7 sec “1 .
- the invention also encompasses antibodies that bind influenza A polypeptides; influenza B polypeptides; or combinations thereof, with an off rate (k 0 ff) that is within a range between any of the individual recited values.
- antibodies or antigen binding fragments thereof of the invention bind influenza A polypeptides; influenza B polypeptides; fragments or variants thereof; or combinations thereof, with an on rate (k on ) of greater than or equal to 10 3 M "1 sec “1 , 5 ⁇ 10 3 M “1 sec “1 , 10 4 M “1 sec “1 , 5 ⁇ 10 4 M “1 sec “1 , 10 5 M “1 sec “1 , 5x10 5 M “1 sec “1 , 10 6 M “1 sec-1, 5 ⁇ 10 6 M “1 sec “1 , 10 7 M “1 sec-1, or 5x10 7 M “1 sec “1 .
- antibodies or antigen binding fragments thereof of the invention bind influenza A polypeptides; influenza B polypeptides; fragments or variants thereof; or combinations thereof, with an on rate (k on ) greater than or equal to 10 5 M "1 sec “1 , 5 ⁇ 10 5 M “1 sec -1 , 10 6 M “1 sec-1 , 5 ⁇ 10 6 M “1 sec “1 , 10 7 M “1 sec “1 or 5 ⁇ 10 7 M “1 sec “1 .
- the invention encompasses antibodies that bind influenza A polypeptides; influenza B polypeptides; or combinations thereof, with on rate (k on ) that is within a range between any of the individual recited values.
- a binding assay may be performed either as a direct binding assay or as a competition-binding assay. Binding can be detected using standard ELISA or standard Flow Cytometry assays.
- a direct binding assay a candidate antibody is tested for binding to its cognate antigen.
- Competition-binding assay assess the ability of a candidate antibody to compete with a known antibody or other compound that binds to a particular antigen, for example, influenza B virus HA.
- any method that permits the binding of an antibody with the influenza B virus HA that can be detected is encompassed with the scope of the present invention for detecting and measuring the binding characteristics of the antibodies.
- One of skill in the art will recognize these well-known methods and for this reason are not provided in detail here. These methods are also utilized to screen a panel of antibodies for those providing the desired characteristics.
- an antibody of the invention immunospecifically binds to influenza B virus HA and is capable of neutralizing influenza B virus infection. In one embodiment, an antibody of the invention immunospecifically binds to at least one Yamagata lineage influenza B virus and at least one Victoria lineage influenza B virus. In another embodiment, an antibody of the invention immunospecifically binds Yamagata lineage and Victoria lineage influenza B virus.
- an antibody of the invention immunospecifically binds to influenza B virus HA and influenza A virus HA and is capable of neutralizing influenza B virus and influenza A virus infection. In one embodiment, an antibody of the invention immunospecifically binds to at least one Yamagata lineage influenza B virus; at least one Victoria lineage influenza B virus and at least one influenza A virus subtype.
- an antibody or antigen binding fragment according to the invention is capable of binding to and/or neutralizing one or more influenza A virus group 1 subtypes selected from H8, H9, H 1 1 , H 1 2, H 1 3, H 1 6 and H 1 7 and variants thereof.
- an antibody or antigen binding fragment according to the invention is capable of binding to and/or neutralizing one or more influenza A virus group 2 subtypes selected from H4, H 1 0, H 14 and H 1 5 and variants thereof.
- the antibody of the invention binds to influenza A virus group 1 subtype H9.
- the antibody of the invention binds to and neutralizes influenza A virus group 1 subtype H9.
- the antibody of the invention immunospecifically binds to influenza B virus HA and is capable of neutralizing influenza B virus infection. In another embodiment, the antibody of the invention immunospecifically binds to influenza A and influenza B virus HA and is capable of neutralizing influenza A and influenza B virus infection.
- Neutralization assays can be performed as described herein in the Examples section or using other methods known in the art.
- the term "inhibitory concentration 50%" (abbreviated as "IC 5 o") represents the concentration of an inhibitor (e.g., an antibody of the invention) that is required for 50% neutralization of influenza A and/or influenza B virus. It will be understood by one of ordinary skill in the art that a lower IC 5 o value corresponds to a more potent inhibitor.
- an antibody or antigen binding fragment thereof according to the invention has an IC 50 for neutralizing influenza B virus in the range of from about 0.001 ⁇ 9/ ⁇ to about 5 ⁇ 9/ ⁇ , or in the range of from about 0.001 ⁇ 9/ ⁇ to about 1 ⁇ 9/ ⁇ of antibody, or less than 5 9/ ⁇ , less than 2 ⁇ 9/ ⁇ , less than 1 ⁇ 9/ ⁇ , less than 0.5 ⁇ 9/ ⁇ , less than 0.1 ⁇ 9/ ⁇ , less than 0.05 ⁇ 9/ ⁇ or less than 0.01 ⁇ 9/ ⁇ in a microneutralization assay.
- an antibody or antigen binding fragment thereof according to the invention has an IC 50 for neutralizing influenza B virus in the range of from about 0.001 ⁇ g/ml to about 5 ⁇ g/ml, or in the range of from about 0.001 ⁇ g/ml to about 1 ⁇ g/ml of antibody, or less than 5 ⁇ g/ml, less than 2 ⁇ g/ml, less than 1 ⁇ g/ml, less than 0.5 ⁇ g/ml, less than 0.1 ⁇ g/ml, less than 0.05 ⁇ g/ml or less than 0.01 ⁇ g/ml in a microneutralization assay; and an IC 5 o for neutralizing influenza A virus in the range of from about 0.1 ⁇ g/ml to about 5 ⁇ g/ml, or in the range of from about 0.1 ⁇ g/ml to about 2 ⁇ g/ml of antibody, or less than 5 ⁇ g/ml, less than 2 ⁇ g/ml, less than 1 ⁇ g
- an antibody or antigen binding fragment thereof according to the invention has an IC 50 for neutralizing influenza B virus in the range of from about 0.001 ⁇ g/ml to about 50 ⁇ g/ml, or in the range of from about 0.001 ⁇ g/ml to about 5 ⁇ g/ml of antibody, or in the range of from about 0.001 ⁇ g/ml to about 1 ⁇ g/ml of antibody, or less than 10 ⁇ g/ml, less than 5 ⁇ g/ml, less than 1 ⁇ g/ml, less than 0.5 ⁇ g/ml, less than 0.1 ⁇ g/ml, less than 0.05 ⁇ g/ml or less than 0.01 ⁇ g/ml in a microneutralization assay; and an IC 5 o for neutralizing influenza A virus in the range of from about 0.01 ⁇ g/ml to about 50 ⁇ g/ml, or in the range of from about 0.05 ⁇ g/ml to about 5 ⁇ g/ml of antibody
- the antibodies of the invention may induce cell death.
- An antibody which "induces cell death” is one which causes a viable cell to become nonviable.
- Cell death in vitro may be determined in the absence of complement and immune effector cells to distinguish cell death induced by antibody-dependent cell-mediated cytotoxicity (ADCC) or complement dependent cytotoxicity (CDC).
- ADCC antibody-dependent cell-mediated cytotoxicity
- CDC complement dependent cytotoxicity
- the assay for cell death may be performed using heat inactivated serum (i.e., in the absence of complement) and in the absence of immune effector cells.
- loss of membrane integrity as evaluated by uptake of propidium iodide (PI), trypan blue (see, Moore et al. (1995) Cytotechnology 17:1 -1 1 ), 7AAD or other methods well known in the art can be assessed relative to untreated cells.
- PI propidium iodide
- trypan blue see, Moore et al. (1995) Cytotechnology 17:1 -1 1
- the antibodies of the invention may induce cell death via apoptosis.
- An antibody which "induces apoptosis" is one which induces programmed cell death as determined by binding of annexin V, fragmentation of DNA, cell shrinkage, dilation of endoplasmic reticulum, cell fragmentation, and/or formation of membrane vesicles (called apoptotic bodies).
- apoptotic bodies membrane vesicles
- Various methods are available for evaluating the cellular events associated with apoptosis. For example, phosphatidyl serine (PS) translocation can be measured by annexin binding; DNA fragmentation can be evaluated through DNA laddering; and nuclear/chromatin condensation along with DNA fragmentation can be evaluated by any increase in hypodiploid cells.
- PS phosphatidyl serine
- the antibody which induces apoptosis is one which results in about 2 to 50 fold, in one embodiment about 5 to 50 fold, and in one embodiment about 1 0 to 50 fold, induction of annexin binding relative to untreated cell in an annexin binding assay.
- the antibodies of the invention may induce cell death via antibody-dependent cellular cytotoxicity (ADCC) and/or complement-dependent cell-mediated cytotoxicity (CDC) and/or antibody dependent cell-mediated phagocytosis (ADCP).
- ADCC antibody-dependent cellular cytotoxicity
- CDC complement-dependent cell-mediated cytotoxicity
- ADCP antibody dependent cell-mediated phagocytosis
- FcyR receptor for an antibody
- Cy2 domain the second domain of C region of the antibody
- Cy2 domain several amino acid residues in the hinge region and the second domain of C region (hereinafter referred to as "Cy2 domain") of the antibody are important (Greenwood et al. (1993) Eur. J. Immunol. 23(5):1098- 104; Morgan et al. (1995) Immunology. 86(2):319-324; Clark, M. (1997) Chemical Immunology. 65:88-1 10) and that a sugar chain in the Cy2 domain (Clark, M. (1997) Chemical Immunology. 65:88-1 10) is also important.
- an in vitro ADCC assay can be used, such as that described in U.S. Patent No. 5,500,362.
- the assay may also be performed using a commercially available kit, e.g. CytoTox 96 ® (Promega).
- Useful effector cells for such assays include, but are not limited to peripheral blood mononuclear cells (PBMC), Natural Killer (NK) cells, and NK cell lines.
- PBMC peripheral blood mononuclear cells
- NK Natural Killer
- NK cell lines expressing a transgenic Fc receptor (e.g. CD16) and associated signaling polypeptide (e.g. FC £ RI-Y) may also serve as effector cells (WO 2006/023148).
- the NK cell line includes CD16 and has luciferase under the NFAT promoter and can be used to measure NK cell activation, rather than cell lysis or cell death.
- a similar technology is sold by Promega, which uses Jurkat cells instead of NK cells (Promega ADCC reporter bioassay #G7010).
- Promega ADCC reporter bioassay #G7010 the ability of any particular antibody to mediate lysis by complement activation and/or ADCC can be assayed.
- the cells of interest are grown and labeled in vitro; the antibody is added to the cell culture in combination with immune cells which may be activated by the antigen antibody complexes; i.e., effector cells involved in the ADCC response.
- the antibody can also be tested for complement activation.
- cytolysis is detected by the release of label from the lysed cells.
- the extent of cell lysis may also be determined by detecting the release of cytoplasmic proteins (e.g. LDH) into the supernatant.
- cytoplasmic proteins e.g. LDH
- antibodies can be screened using the patient's own serum as a source of complement and/or immune cells. Antibodies that are capable of mediating human ADCC in the in vitro test can then be used therapeutically in that particular patient.
- ADCC activity of the molecule of interest may also be assessed in vivo, e.g., in an animal model such as that disclosed in Clynes et al. (1998) Proc. Natl. Acad. Sci. USA 95:652-656.
- Antibodies of the present invention may be capable or may have been modified to have the ability of inducing ADCC and/or CDC.
- Assays to determine ADCC function can be practiced using human effector cells to assess human ADCC function. Such assays may also include those intended to screen for antibodies that induce, mediate, enhance, block cell death by necrotic and/or apoptotic mechanisms.
- Such methods including assays utilizing viable dyes, methods of detecting and analyzing caspases, and assays measuring DNA breaks can be used to assess the apoptotic activity of cells cultured in vitro with an antibody of interest.
- Monoclonal antibodies can be prepared using a wide variety of techniques known in the art including the use of hybridoma (Kohler et al. (1975) Nature. 256:495; Harlow et al. (1988) Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed.); Hammerling et al. (1 981 ) in: Monoclonal Antibodies and T-Cell Hybridomas 563-681 (Elsevier, N.Y.), recombinant, and phage display technologies, or a combination thereof.
- monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous or isolated antibodies, e.g., the individual antibodies that make up the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations which include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against the same determinant on the antigen. In addition to their specificity, monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies. The modifier "monoclonal" is not to be construed as requiring production of the antibody by any particular method.
- monoclonal antibodies which is not intended to be limiting and may be used to produce, for example, monoclonal mammalian, chimeric, humanized, human, domain, diabodies, vaccibodies, linear and multispecific antibodies.
- mice or other appropriate host animals such as hamster
- lymphocytes may be immunized in vitro.
- lymphocytes are isolated and then fused with a myeloma cell line using a suitable fusing agent or fusion partner, such as polyethylene glycol, to form a hybridoma cell (Goding (1986) Monoclonal Antibodies: Principles and Practice, pp.59-103 (Academic Press)).
- the selected myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody- producing cells, and are sensitive to a selective medium that selects against the unfused parental cells.
- the myeloma cell lines are murine myeloma lines, such as those derived from MOPC-21 and MPC-1 1 mouse tumors available from the Salk Institute Cell Distribution Center, San Diego, Calif. USA, and SP-2 and derivatives e.g., X63-Ag8-653 cells available from the American Type Culture Collection, Rockville, MD USA.
- Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor (1984) J. Immunol. 133:3001 ; and Brodeur et al. (1987) Monoclonal Antibody Production Techniques and Applications, pp.51 -63 (Marcel Dekker, Inc., New York).
- the clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, Supra). Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium.
- the hybridoma cells may be grown in vivo as ascites tumors in an animal e.g., by i.p. injection of the cells into mice.
- the monoclonal antibodies secreted by the sub-clones are suitably separated from the culture medium, ascites fluid, or serum by conventional antibody purification procedures such as, for example, affinity chromatography (e.g., using protein A or protein G-Sepharose) or ion-exchange chromatography, affinity tags, hydroxylapatite chromatography, gel electrophoresis, dialysis, etc. Exemplary purification methods are described in more detail below.
- DNA encoding the monoclonal antibodies may be readily isolated and/or sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
- the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese Hamster Ovary (CHO) cells, or myeloma cells that do not otherwise produce antibody protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
- the invention thus, provides replicable vectors that include a nucleotide sequence encoding an antibody molecule, a heavy or light chain of an antibody, a heavy or light chain variable domain of an antibody or a portion thereof, or a heavy or light chain CDR, operably linked to a promoter.
- Such vectors may include the nucleotide sequence encoding the constant region of the antibody molecule (see, e.g., US. Patent Nos. 5,981 ,216; 5,591 ,639; 5,658,759 and 5,1 22,464) and the variable domain of the antibody may be cloned into such a vector for expression of the entire heavy, the entire light chain, or both the entire heavy and light chains.
- the transfected cells are then cultured by conventional techniques to produce an antibody.
- the invention includes host cells containing a polynucleotide encoding an antibody of the invention or fragments thereof, or a heavy or light chain thereof, or portion thereof, or a single-chain antibody of the invention, operably linked to a heterologous promoter.
- vectors encoding both the heavy and light chains may be co-expressed in the host cell for expression of the entire immunoglobulin molecule, as detailed below.
- Mammalian cell lines available as hosts for expression of recombinant antibodies are well known in the art and include many immortalized cell lines available from the American Type Culture Collection (ATCC), including but not limited to Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2), human epithelial kidney 293 cells, and a number of other cell lines.
- ATCC American Type Culture Collection
- CHO Chinese hamster ovary
- HeLa cells HeLa cells
- BHK baby hamster kidney
- COS monkey kidney cells
- human hepatocellular carcinoma cells e.g., Hep G2
- human epithelial kidney 293 cells e.g., Hep G2
- Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins and gene products. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the antibody or portion thereof
- eukaryotic host cells which possess the cellular machinery for proper processing of the primary transcript, glycosylation, and phosphorylation of the gene product may be used.
- mammalian host cells include but are not limited to CHO, VERY, BHK, Hela, COS, MDCK, 293, 3T3, W138, BT483, Hs578T, HTB2, BT2O and T47D, NSO (a murine myeloma cell line that does not endogenously produce any functional immunoglobulin chains), SP20, CRL7O3O and HsS78Bst cells.
- Human cell lines developed by immortalizing human lymphocytes can be used to recombinantly produce monoclonal antibodies.
- the human cell line PER.C6®. (Crucell, Netherlands) can be used to recombinantly produce monoclonal antibodies.
- Additional cell lines which may be used as hosts for expression of recombinant antibodies include, but are not limited to, insect cells (e.g. Sf21 /Sf9, Trichoplusia ni Bti-Tn5b1 -4) or yeast cells (e.g. S. cerevisiae, Pichia, US7326681 ; etc.), plants cells (US20080066200); and chicken cells (WO20081421 24).
- insect cells e.g. Sf21 /Sf9, Trichoplusia ni Bti-Tn5b1 -4
- yeast cells e.g. S. cerevisiae, Pichia, US7326681 ; etc.
- plants cells e.g. S. cerevisiae, Pichia, US7326681 ; etc.
- plants cells e.g. S. cerevisiae, Pichia, US7326681 ; etc.
- chicken cells WO20081421 24.
- antibodies of the invention are expressed in a cell line with stable expression of the antibody.
- Stable expression can be used for long-term, high-yield production of recombinant proteins.
- cell lines which stably express the antibody molecule may be generated.
- Host cells can be transformed with an appropriately engineered vector that include expression control elements (e.g., promoter, enhancer, transcription terminators, polyadenylation sites, etc.), and a selectable marker gene. Following the introduction of the foreign DNA, cells may be allowed to grow for 1 -2 days in an enriched media, and then are switched to a selective media.
- expression control elements e.g., promoter, enhancer, transcription terminators, polyadenylation sites, etc.
- the selectable marker in the recombinant plasmid confers resistance to the selection and allows cells that stably integrated the plasmid into their chromosomes to grow and form foci which in turn can be cloned and expanded into cell lines. Methods for producing stable cell lines with a high yield are well known in the art and reagents are generally available commercially.
- antibodies of the invention are expressed in a cell line with transient expression of the antibody. Transient transfection is a process in which the nucleic acid introduced into a cell does not integrate into the genome or chromosomal DNA of that cell. It is in fact maintained as an extra-chromosomal element, e.g. as an episome, in the cell. Transcription processes of the nucleic acid of the episome are not affected and a protein encoded by the nucleic acid of the episome is produced.
- the cell line is maintained in cell culture medium and conditions well known in the art resulting in the expression and production of monoclonal antibodies.
- the mammalian cell culture media is based on commercially available media formulations, including, for example, DMEM or Ham's F1 2.
- the cell culture media is modified to support increases in both cell growth and biologic protein expression.
- the terms "cell culture medium,” “culture medium,” and “medium formulation” refer to a nutritive solution for the maintenance, growth, propagation, or expansion of cells in an artificial in vitro environment outside of a multicellular organism or tissue.
- Cell culture medium may be optimized for a specific cell culture use, including, for example, cell culture growth medium which is formulated to promote cellular growth, or cell culture production medium which is formulated to promote recombinant protein production.
- the terms nutrient, ingredient, and component are used interchangeably herein to refer to the constituents that make up a cell culture medium.
- the cell lines are maintained using a fed batch method.
- fed batch method refers to a method by which a cell culture is supplied with additional nutrients after first being incubated with a basal medium.
- a fed batch method may include adding supplemental media according to a determined feeding schedule within a given time period.
- a “fed batch cell culture” refers to a cell culture wherein the cells, typically mammalian, and culture medium are supplied to the culturing vessel initially and additional culture nutrients are fed, continuously or in discrete increments, to the culture during culturing, with or without periodic cell and/or product harvest before termination of culture.
- the cell culture medium used and the nutrients contained therein are known to one of skill in the art.
- the cell culture medium includes a basal medium and at least one hydrolysate, e.g., soy-based hydrolysate, a yeast-based hydrolysate, or a combination of the two types of hydrolysates resulting in a modified basal medium.
- the additional nutrients may include only a basal medium, such as a concentrated basal medium, or may include only hydrolysates, or concentrated hydrolysates.
- Suitable basal media include, but are not limited to Dulbecco's Modified Eagle's Medium (DMEM), DME/F12, Minimal Essential Medium (MEM), Basal Medium Eagle (BME), RPMI 1640, F-10, F-12, a-Minimal Essential Medium (a-MEM), Glasgow's Minimal Essential Medium (G-MEM), PF CHO (see, e.g., CHO protein free medium (Sigma) or EX-CELLTM 325 PF CHO Serum-Free Medium for CHO Cells Protein-Free (SAFC Bioscience), and Iscove's Modified Dulbecco's Medium.
- DMEM Dulbecco's Modified Eagle's Medium
- MEM Minimal Essential Medium
- BME Basal Medium Eagle
- RPMI 1640 F-10, F-12
- a-MEM a-Minimal Essential Medium
- G-MEM Glasgow's Minimal Essential Medium
- PF CHO see, e.g., CHO protein free medium
- basal media examples include BME Basal Medium (Gibco-lnvitrogen; see also Eagle, H (1965) Proc. Soc. Exp. Biol. Med. 89, 36); Dulbecco's Modified Eagle Medium (DMEM, powder) (Gibco-lnvitrogen (# 31 600); see also Dulbecco and Freeman (1 959) Virology. 8:396; Smith et al. (1960) Virology. 1 2:185. Tissue Culture Standards Committee, In Vitro 6:2, 93); CMRL 1066 Medium (Gibco- lnvitrogen (#1 1530); see also Parker et al. (1957) Special Publications, N.Y. Academy of Sciences, 5:303).
- the basal medium may be serum-free, meaning that the medium contains no serum (e.g., fetal bovine serum (FBS), horse serum, goat serum, or any other animal-derived serum known to one skilled in the art) or animal protein free media or chemically defined media.
- serum e.g., fetal bovine serum (FBS), horse serum, goat serum, or any other animal-derived serum known to one skilled in the art
- animal protein free media e.g., cow serum, goat serum, or any other animal-derived serum known to one skilled in the art
- the basal medium may be modified in order to remove certain non-nutritional components found in standard basal medium, such as various inorganic and organic buffers, surfactant(s), and sodium chloride. Removing such components from basal cell medium allows an increased concentration of the remaining nutritional components, and may improve overall cell growth and protein expression.
- omitted components may be added back into the cell culture medium containing the modified basal cell medium according to the requirements of the cell culture conditions.
- the cell culture medium contains a modified basal cell medium, and at least one of the following nutrients, an iron source, a recombinant growth factor; a buffer; a surfactant; an osmolarity regulator; an energy source; and non-animal hydrolysates.
- the modified basal cell medium may optionally contain amino acids, vitamins, or a combination of both amino acids and vitamins.
- the modified basal medium further contains glutamine, e.g, L-glutamine, and/or methotrexate.
- Antibody production can be conducted in large quantity by a bioreactor process using fed-batch, batch, perfusion or continuous feed bioreactor methods known in the art.
- Large-scale bioreactors have at least 1000 liters of capacity, in one embodiment about 1 ,000 to 100,000 liters of capacity. These bioreactors may use agitator impellers to distribute oxygen and nutrients.
- Small scale bioreactors refers generally to cell culturing in no more than approximately 1 00 liters in volumetric capacity, and can range from about 1 liter to about 100 liters.
- single-use bioreactors SUV may be used for either large-scale or small-scale culturing.
- Temperature, pH, agitation, aeration and inoculum density will vary depending upon the host cells used and the recombinant protein to be expressed.
- a recombinant protein cell culture may be maintained at a temperature between 30 °C and 45 °C.
- the pH of the culture medium may be monitored during the culture process such that the pH stays at an optimum level, which may be for certain host cells, within a pH range of 6.0 to 8.0.
- An impeller driven mixing may be used for such culture methods for agitation.
- the rotational speed of the impeller may be approximately 50 to 200 cm/sec tip speed, but other airlift or other mixing/aeration systems known in the art may be used, depending on the type of host cell being cultured.
- aeration is provided to maintain a dissolved oxygen concentration of approximately 20% to 80% air saturation in the culture, again, depending upon the selected host cell being cultured.
- a bioreactor may sparge air or oxygen directly into the culture medium.
- Other methods of oxygen supply exist, including bubble-free aeration systems employing hollow fiber membrane aerators.
- Monoclonal antibodies or antibody fragments can be isolated from antibody phage libraries generated using the techniques described in McCafferty et al. (1 990) Nature. 348:552-554; Clackson et al. (1 991 ) Nature. 352:624-628 and Marks et al. (1 991 ) J. Mol. Biol. 222:581 -597.
- antibodies can be isolated by screening a recombinant combinatorial antibody library.
- a scFv phage display library prepared using human VL and VH cDNAs prepared from mRNA derived from human lymphocytes. Methodologies for preparing and screening such libraries are known in the art.
- kits for generating phage display libraries e.g., the Pharmacia Recombinant Phage Antibody System, catalog no. 27- 9400-01 ; and the Stratagene SurfZAPTM phage display kit, catalog no. 24061 2
- methods and reagents particularly amenable for use in generating and screening antibody display libraries can be found in, for example, US Patent Nos.
- phage display methods functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them.
- phage can be utilized to display antigen-binding domains expressed from a repertoire or combinatorial antibody library (e.g., human or murine).
- Phage expressing an antigen binding domain that binds the antigen of interest can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead.
- Phage used in these methods are typically filamentous phage including fd and M13 binding domains expressed from phage with Fab, Fv or disulfide stabilized Fv antibody domains recombinantly fused to either the phage gene III or gene VIII protein.
- the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including human antibodies, humanized antibodies, or any other desired antigen binding fragment, and expressed in any desired host, including mammalian cells, insect cells, plant cells, yeast, and bacteria, e.g., as described in detail below.
- techniques to recombinantly produce Fab, Fab' and F(ab')2 fragments can also be employed using methods known in the art such as those disclosed in PCT publication WO 92/22324; Mullinax et al. (1992) BioTechniques. 12(6):864-869; and Better et al. (1 988) Science. 240:1041 -1043.
- an antibody molecule may be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigens Protein A or Protein G, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
- chromatography e.g., ion exchange, affinity, particularly by affinity for the specific antigens Protein A or Protein G, and sizing column chromatography
- centrifugation e.g., centrifugation, differential solubility, or by any other standard technique for the purification of proteins.
- the antibodies of the present invention or fragments thereof may be fused to heterologous polypeptide sequences (referred to herein as "tags") to facilitate purification.
- the antibody can be produced intracellular ⁇ , in the periplasmic space, or directly secreted into the medium. If the antibody is produced intracellular ⁇ , as a first step, the particulate debris, either host cells or lysed fragments, is removed, for example, by centrifugation or ultrafiltration. Carter et al. (1992) Bio/Technology. 1 0:163-167 describe a procedure for isolating antibodies which are secreted into the periplasmic space of E. coli. Where the antibody is secreted into the medium, supernatants from such expression systems are generally first concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. A protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the growth of adventitious contaminants.
- a protease inhibitor such as PMSF may be included in any of the foregoing steps to inhibit proteolysis and antibiotics may be included to prevent the
- the antibody composition prepared from the cells can be purified using, for example, hydroxylapatite chromatography, hydrophobic interaction chromatography, ion exchange chromatography, gel electrophoresis, dialysis, and/or affinity chromatography either alone or in combination with other purification steps.
- the suitability of protein A as an affinity ligand depends on the species and isotype of any immunoglobulin Fc domain that is present in the antibody and will be understood by one of skill in the art.
- the matrix to which the affinity ligand is attached is most often agarose, but other matrices are available. Mechanically stable matrices such as controlled pore glass or poly(styrenedivinyl)benzene allow for faster flow rates and shorter processing times than can be achieved with agarose.
- the Bakerbond ABX resin J.T. Baker, Phillipsburg, NJ
- Other techniques for protein purification such as fractionation on an ion-exchange column, ethanol precipitation, Reverse Phase HPLC, chromatography on silica, chromatography on heparin, SEPHAROSE chromatography on an anion or cation exchange resin (such as a polyaspartic acid column), chromatofocusing, SDS-PAGE, and ammonium sulfate precipitation are also available depending on the antibody to be recovered.
- the mixture that includes the antibody of interest and contaminants may be subjected to low pH hydrophobic interaction chromatography using an elution buffer at a pH between about 2.5 - 4.5, and performed at low salt concentrations (e.g., from about 0 - 0.25 M salt).
- antibodies of the invention that are substantially purified/isolated.
- these isolated/purified recombinantly expressed antibodies may be administered to a patient to mediate a prophylactic or therapeutic effect.
- a prophylactic is a medication or a treatment designed and used to prevent a disease, disorder or infection from occurring.
- a therapeutic is concerned specifically with the treatment of a particular disease, disorder or infection.
- a therapeutic dose is the amount needed to treat a particular disease, disorder or infection.
- these isolated/purified antibodies may be used to diagnose influenza virus infection, for example, influenza B virus infection, or, in other embodiments, influenza A and influenza B virus infection.
- Human antibodies can be generated using methods well known in the art. Human antibodies avoid some of the problems associated with antibodies that possess murine or rat variable and/or constant regions. The presence of such murine or rat derived proteins can lead to the rapid clearance of the antibodies or can lead to the generation of an immune response against the antibody by a patient.
- Human antibodies can be derived by in vitro methods. Suitable examples include but are not limited to phage display (Medlmmune (formerly CAT), Morphosys, Dyax, Biosite/Medarex, Xoma, Symphogen, Alexion (formerly Proliferon), Affimed) ribosome display (Medlmmune (formerly CAT)), yeast display, and the like.
- the phage display technology See e.g., US Patent No. 5,969, 108) can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors.
- antibody V domain genes are cloned in-frame into either a major or minor coat protein gene of a filamentous bacteriophage, such as M13 or fd, and displayed as functional antibody fragments on the surface of the phage particle.
- a filamentous bacteriophage such as M13 or fd
- selections based on the functional properties of the antibody also result in selection of the gene encoding the antibody exhibiting those properties.
- the phage mimics some of the properties of the B-cell.
- Phage display can be performed in a variety of formats, reviewed in, e.g., Johnson and Chiswell (1993) Current Opinion in Structural Biology. 3:564- 571 .
- V-gene segments can be used for phage display.
- Clackson et al. (1991 ) Nature. 352:624-628 (1991 ) isolated a diverse array of anti-oxazolone antibodies from a small random combinatorial library of V genes derived from the spleens of immunized mice.
- a repertoire of V genes from unimmunized human donors can be constructed and antibodies to a diverse array of antigens (including self-antigens) can be isolated essentially following the techniques described by Marks et al. (1 991 ) J. Mol. Biol. 222:581 -597, or Griffith et al. (1 993) EMBO J. 12:725-734. See, also, U.S. Pat. Nos. 5,565,332 and 5,573,905.
- human antibodies may also be generated by in vitro activated B cells (see U.S. Pat. Nos. 5,567,610 and 5,229,275).
- Immunoglobulin genes undergo various modifications during maturation of the immune response, including recombination between V, D and J gene segments, isotype switching, and hypermutation in the variable regions. Recombination and somatic hypermutation are the foundation for generation of antibody diversity and affinity maturation, but they can also generate sequence liabilities that may make commercial production of such immunoglobulins as therapeutic agents difficult or increase the immunogenicity risk of the antibody.
- mutations in CDR regions are likely to contribute to improved affinity and function, while mutations in framework regions may increase the risk of immunogenicity. This risk can be reduced by reverting framework mutations to germline while ensuring that activity of the antibody is not adversely impacted.
- the diversification processes may also generate some structural liabilities or these structural liabilities may exist within germline sequences contributing to the heavy and light chain variable domains. Regardless of the source, it may be desirable to remove potential structural liabilities that may result in instability, aggregation, heterogeneity of product, or increased immunogenicity. Examples of undesirable liabilities include unpaired cysteines (which may lead to disulfide bond scrambling, or variable sulfhydryl adduct formation), N-linked glycosylation sites (resulting in heterogeneity of structure and activity), as well as deamidation (e.g. NG, NS), isomerization (DG), oxidation (exposed methionine), and hydrolysis (DP) sites.
- unpaired cysteines which may lead to disulfide bond scrambling, or variable sulfhydryl adduct formation
- N-linked glycosylation sites resulting in heterogeneity of structure and activity
- deamidation e.g. NG, NS
- DG isomerization
- the antibody sequence can be mutated back to the germline sequence.
- Such corrective mutations can occur at one, two, three or more positions, or a combination of any of the mutated positions, using standard molecular biological techniques.
- the present antibodies are antibody fragments or antibodies that include these fragments.
- the antibody fragment includes a portion of the full length antibody, which generally is the antigen binding or variable region thereof.
- Examples of antibody fragments include Fab, Fab', F(ab') 2 , Fd and Fv fragments, diabodies; linear antibodies (U.S. Pat. No. 5,641 ,870) and single-chain antibody molecules.
- Fab, Fv and scFv antibody fragments can all be expressed in and secreted from E. coli, thus allowing the facile production of large amounts of these fragments.
- the antibody fragments can be isolated from the antibody phage libraries discussed above.
- Fab'-SH fragments can also be directly recovered from E. coli and chemically coupled to form F(ab') 2 fragments (Carter et al. (1992) Bio/Technology. 10:163-1 67).
- F(ab') 2 fragments can be isolated directly from recombinant host cell culture.
- the antibody of choice is a single-chain Fv fragment (scFv).
- the antibody is not a Fab fragment.
- Fv and scFv are the only species with intact combining sites that are devoid of constant regions; thus, they are suitable for reduced nonspecific binding during in vivo use.
- scFv fusion proteins may be constructed to yield fusion of an effector protein at either the amino or the carboxy terminus of an scFv.
- the present antibodies are domain antibodies, e.g., antibodies containing the small functional binding units of antibodies, corresponding to the variable regions of the heavy (VH) or light (VL) chains of human antibodies.
- domain antibodies include, but are not limited to, those of Domantis (see, for example, WO04/058821 ; WO04/081 026; WO04/003019; WO03/002609; U.S. Patent Nos. 6,291 ,1 58; 6,582,915; 6,696,245; and 6,593,081 ).
- the present antibodies are linear antibodies.
- Linear antibodies include a pair of tandem Fd segments (VH- CH1 -VH-CH 1 ) which form a pair of antigen-binding regions. See, Zapata et al. (1 995) Protein Eng. 8(1 0):1057-1 062.
- the present invention also encompasses further modifications and, their variants and fragments thereof, of the antibodies of the invention including one or more amino acid residues and/or polypeptide substitutions, additions and/or deletions in the variable light (VL) domain and/or variable heavy (VH) domain and/or Fc region and post translational modifications. Included in these modifications are antibody conjugates wherein an antibody has been covalently attached to a moiety. Moieties suitable for attachment to the antibodies include but are not limited to, proteins, peptides, drugs, labels, and cytotoxins.
- a modified antibody may have an amino acid sequence having at least 25%, 35%, 45%, 55%, 65%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% amino acid sequence identity or similarity with the amino acid sequence of either the heavy or light chain variable domain of an antibody as described herein.
- an altered antibody may have an amino acid sequence having at least 25%, 35%, 45%, 55%, 65%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% amino acid sequence identity or similarity with the amino acid sequence of the heavy or light chain CDR-1 , CDR-2, or CDR-3 of an antibody as described herein.
- an altered antibody may have an amino acid sequence having at least 25%, 35%, 45%, 55%, 65%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% amino acid sequence identity or similarity with the amino acid sequence of the heavy or light chain FR1 , FR2, FR3 or FR4 of an antibody as described herein.
- altered antibodies are generated by one or more amino acid alterations (e.g., substitutions, deletion and/or additions) introduced in one or more of the variable regions of the antibody.
- the amino acid alterations are introduced in the framework regions.
- One or more alterations of framework region residues may result in an improvement in the binding affinity of the antibody for the antigen. This may be especially true when these changes are made to humanized antibodies wherein the framework region may be from a different species than the CDR regions.
- framework region residues to modify include those which non-covalently bind antigen directly (Amit et al. (1 986) Science. 233:747-753); interact with/effect the conformation of a CDR (Chothia et al. (1 987) J.
- from about one to about five framework residues may be altered. Sometimes, this may be sufficient to yield an antibody mutant suitable for use in preclinical trials, even where none of the hypervariable region residues have been altered. Normally, however, an altered antibody will include additional hypervariable region alteration(s).
- alanine scanning mutagenesis (Cunningham and Wells (1 989) Science. 244: 1081 - 1 085).
- one or more of the hypervariable region residue(s) are replaced by alanine or polyalanine residue(s) to alter the interaction of the amino acids with the target antigen.
- Those hypervariable region residue(s) demonstrating functional sensitivity to the substitutions then are refined by introducing additional or other mutations at or for the sites of substitution.
- the site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be predetermined.
- the Ala-mutants produced this way are screened for their biological activity as described herein.
- the substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g. a humanized or human antibody).
- a parent antibody e.g. a humanized or human antibody.
- the resulting variant(s) selected for further development will have improved biological properties relative to the parent antibody from which they are generated.
- a convenient way for generating such substitutional variants involves affinity maturation using phage display (Hawkins et al. (1992) J. Mol. Biol. 254:889-896 and Lowman et al. (1991 ) Biochemistry. 30(45):10832-10837)). Briefly, several hypervariable region sites (e.g., 6-7 sites) are mutated to generate all possible amino acid substitutions at each site.
- the antibody mutants thus generated are displayed in a monovalent fashion from filamentous phage particles as fusions to the gene III product of M13 packaged within each particle.
- the phage-displayed mutants are then screened for their biological activity (e.g., binding affinity) as herein disclosed.
- Mutations in antibody sequences may include substitutions, deletions, including internal deletions, additions, including additions yielding fusion proteins, or conservative substitutions of amino acid residues within and/or adjacent to the amino acid sequence, but that result in a "silent" change, in that the change produces a functionally-equivalent antibody.
- Conservative amino acid substitutions may be made on the basis of similarity in polarity, charge, solubility, hydrophobicity, hydrophilicity, and/or the amphipathic nature of the residues involved.
- non-polar (hydrophobic) amino acids include alanine, leucine, isoleucine, valine, proline, phenylalanine, tryptophan, and methionine; polar neutral amino acids include glycine, serine, threonine, cysteine, tyrosine, asparagine, and glutamine; positively charged (basic) amino acids include arginine, lysine, and histidine; and negatively charged (acidic) amino acids include aspartic acid and glutamic acid.
- glycine and proline are residues that can influence chain orientation. Non-conservative substitutions will entail exchanging a member of one of these classes for a member of another class.
- non- classical amino acids or chemical amino acid analogs can be introduced as a substitution or addition into the antibody sequence.
- Non-classical amino acids include, but are not limited to, the D-isomers of the common amino acids, a -amino isobutyric acid, 4-aminobutyric acid, Abu, 2-amino butyric acid, ⁇ -Abu, ⁇ -Ahx, 6-amino hexanoic acid, Aib, 2-amino isobutyric acid, 3- amino propionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosine, citrulline, cysteic acid, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, ⁇ -alanine, fluoro-amino acids, designer amino acids such as ⁇ -methyl amino acids, Ca-methyl amino acids, Na-methyl amino acids, and amino acid analog
- any cysteine residue not involved in maintaining the proper conformation of the antibody also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking.
- cysteine bond(s) may be added to the antibody to improve its stability (particularly where the antibody is an antibody fragment such as an Fv fragment).
- variants of the Fc region enhance or diminish effector function of the antibody
- variants of the Fc region e.g., amino acid substitutions and/or additions and/or deletions
- modify or diminish effector function of the antibody See e.g., U.S. Patent Nos. 5,624,821 ; 5,885,573; 6,538, 1 24; 7,317,091 ; 5,648,260; 6,538, 124; WO 03/074679; WO 04/029207; WO 04/099249; WO 99/58572; US Publication No. 2006/01 341 05; 2004/01 321 01 ; 2006/0008883 and may alter the pharmacokinetic properties (e.g. half-life) of the antibody (see, U.S.
- the antibodies of the invention include an altered Fc region (also referred to herein as "variant Fc region") in which one or more alterations have been made in the Fc region in order to change functional and/or pharmacokinetic properties of the antibodies.
- Such alterations may result in a decrease or increase of Clq binding and complement dependent cytotoxicity (CDC) or of FcyR binding, for IgG, and antibody-dependent cellular cytotoxicity (ADCC), or antibody dependent cell-mediated phagocytosis (ADCP).
- CDC complement dependent cytotoxicity
- ADCC antibody-dependent cellular cytotoxicity
- ADCP antibody dependent cell-mediated phagocytosis
- the present invention encompasses the antibodies described herein with variant Fc regions wherein changes have been made to fine tune the effector function, enhancing or diminishing, providing a desired effector function.
- the antibodies of the invention include a variant Fc region (i.e., Fc regions that have been altered as discussed below).
- Antibodies of the invention having a variant Fc region are also referred to here as "Fc variant antibodies.”
- Fc variant antibodies As used herein native refers to the unmodified parental sequence and the antibody with a native Fc region is herein referred to as a "native Fc antibody”.
- Fc variant antibodies can be generated by numerous methods well known to one skilled in the art. Non-limiting examples include, isolating antibody coding regions (e.g., from hybridoma) and making one or more desired substitutions in the Fc region of the isolated antibody coding region.
- the antigen-binding portion (e.g., variable regions) of an antibody may be sub-cloned into a vector encoding a variant Fc region.
- the variant Fc region exhibits a similar level of inducing effector function as compared to the native Fc region.
- the variant Fc region exhibits a higher induction of effector function as compared to the native Fc.
- the effector function of an antibody is modified through changes in the Fc region, including but not limited to, amino acid substitutions, amino acid additions, amino acid deletions and changes in post-translational modifications to Fc amino acids (e.g. glycosylation).
- the methods described below may be used to fine tune the effector function of a present antibody, a ratio of the binding properties of the Fc region for the FcR (e.g., affinity and specificity), resulting in a therapeutic antibody with the desired properties.
- Fc region includes the polypeptides that make up the constant region of an antibody excluding the first constant region immunoglobulin domain.
- Fc refers to the last two constant region immunoglobulin domains of IgA, IgD, and IgG, and the last three constant region immunoglobulin domains of IgE and IgM, and the flexible hinge N-terminal to these domains.
- IgA and IgM Fc may include the J chain.
- Fc includes immunoglobulin domains Cgamma2 and Cgamma3 (Cy2 and Cy3) and the hinge between Cgammal (Cy1 ) and Cgamma2 (Cy2).
- the human IgG heavy chain Fc region is can be defined to include residues C226 or P230 to its carboxyl-terminus, wherein the numbering is according to the EU index as set forth in Kabat.
- Fc may refer to this region in isolation, or this region in the context of an antibody, antibody fragment, or Fc fusion protein. Polymorphisms have been observed at a number of different Fc positions, including but not limited to positions 270, 272, 312, 31 5, 356, and 358 as numbered by the EU index, and thus slight differences between the presented sequence and sequences in the prior art may exist.
- Fc variant antibodies exhibit altered binding affinity for one or more Fc receptors including, but not limited to FcRn, FcyRI (CD64) including isoforms FcyRIA, FcyRIB, and FcyRIC; FcyRII (CD32 including isoforms FcyRIIA, FcyRIIB, and FcyRIIC); and FcyRIII (CD16, including isoforms FcyRIIIA and FcyRIIIB) as compared to an native Fc antibody.
- FcRn FcRn
- FcyRI CD64
- FcyRII CD32 including isoforms FcyRIIA, FcyRIIB, and FcyRIIC
- FcyRIII CD16, including isoforms FcyRIIIA and FcyRIIIB
- an Fc variant antibody has enhanced binding to one or more Fc ligand relative to a native Fc antibody.
- the Fc variant antibody exhibits increased or decreased affinity for an Fc ligand that is at least 2 fold, or at least 3 fold, or at least 5 fold, or at least 7 fold, or at least 1 0 fold, or at least 20 fold, or at least 30 fold, or at least 40 fold, or at least 50 fold, or at least 60 fold, or at least 70 fold, or at least 80 fold, or at least 90 fold, or at least 100 fold, and up to 25 fold, or up to 50 fold, or up to 75 fold, or up to 1 00 fold, or up to 200 fold, or is between 2 fold and 10 fold, or between 5 fold and 50 fold, or between 25 fold and 1 00 fold, or between 75 fold and 200 fold, or between 100 and 200 fold, more or less than a native Fc antibody.
- Fc variant antibodies exhibit affinities for an Fc ligand that are at least 90%, at least 80%, at least 70%, at least 60%, at least 50%, at least 40%, at least 30%, at least 20%, at least 10%, or at least 5% more or less than an native Fc antibody.
- an Fc variant antibody has increased affinity for an Fc ligand.
- an Fc variant antibody has decreased affinity for an Fc ligand.
- an Fc variant antibody has enhanced binding to the Fc receptor FCYRI I IA. In another specific embodiment, an Fc variant antibody has enhanced binding to the Fc receptor FCYRI I B. In a further specific embodiment, an Fc variant antibody has enhanced binding to both the Fc receptors FCYRI I IA and FCYRI I B. In certain embodiments, Fc variant antibodies that have enhanced binding to FCYRI I IA do not have a concomitant increase in binding the FCYRI I B receptor as compared to a native Fc antibody. In a specific embodiment, an Fc variant antibody has reduced binding to the Fc receptor FCYRI I IA. In a further specific embodiment, an Fc variant antibody has reduced binding to the Fc receptor FCYRI I B.
- an Fc variant antibody exhibiting altered affinity for FCYRI I IA and/or FCYRI I B has enhanced binding to the Fc receptor FcRn.
- an Fc variant antibody exhibiting altered affinity for FCYRI I IA and/or FCYRI I B has altered binding to C1 q relative to a native Fc antibody.
- Fc variant antibodies exhibit affinities for FCYRI I IA receptor that are at least 2 fold, or at least 3 fold, or at least 5 fold, or at least 7 fold, or a least 10 fold, or at least 20 fold, or at least 30 fold, or at least 40 fold, or at least 50 fold, or at least 60 fold, or at least 70 fold, or at least 80 fold, or at least 90 fold, or at least 100 fold, or up to 50 fold, or up to 60 fold, or up to 70 fold, or up to 80 fold, or up to 90 fold, or up to 100 fold, or up to 200 fold, or are between 2 fold and 10 fold, or between 5 fold and 50 fold, or between 25 fold and 100 fold, or between 75 fold and 200 fold, or between 100 and 200 fold, more or less than an native Fc antibody.
- Fc variant antibodies exhibit affinities for FCYRI I IA that are at least 90%, at least 80%, at least 70%, at least 60%, at least 50%, at least 40%, at least 30%, at least 20%, at least 10%, or at least 5% more or less than an native Fc antibody.
- Fc variant antibodies exhibit affinities for FcyRIIB receptor that are at least 2 fold, or at least 3 fold, or at least 5 fold, or at least 7 fold, or a least 10 fold, or at least 20 fold, or at least 30 fold, or at least 40 fold, or at least 50 fold, or at least 60 fold, or at least 70 fold, or at least 80 fold, or at least 90 fold, or at least 100 fold, or up to 50 fold, or up to 60 fold, or up to 70 fold, or up to 80 fold, or up to 90 fold, or up to 100 fold, or up to 200 fold, or are between 2 fold and 10 fold, or between 5 fold and 50 fold, or between 25 fold and 100 fold, or between 75 fold and 200 fold, or between 100 and 200 fold, more or less than an native Fc antibody.
- Fc variant antibodies exhibit affinities for FcyRIIB that are at least 90%, at least 80%, at least 70%, at least 60%, at least 50%, at least 40%, at least 30%, at least 20%, at least 10%, or at least 5% more or less than an native Fc antibody.
- Fc variant antibodies exhibit increased or decreased affinities to C1 q relative to a native Fc antibody.
- Fc variant antibodies exhibit affinities for C1 q receptor that are at least 2 fold, or at least 3 fold, or at least 5 fold, or at least 7 fold, or at least 10 fold, or at least 20 fold, or at least 30 fold, or at least 40 fold, or at least 50 fold, or at least 60 fold, or at least 70 fold, or at least 80 fold, or at least 90 fold, or at least 100 fold, or up to 50 fold, or up to 60 fold, or up to 70 fold, or up to 80 fold, or up to 90 fold, or up to 100 fold, or up to 200 fold, or are between 2 fold and 10 fold, or between 5 fold and 50 fold, or between 25 fold and 100 fold, or between 75 fold and 200 fold, or between 100 and 200 fold, more or less than an native Fc antibody.
- Fc variant antibodies exhibit affinities for C1 q that are at least 90%, at least 80%, at least 70%, at least 60%, at least 50%, at least 40%, at least 30%, at least 20%, at least 10%, or at least 5% more or less than an native Fc antibody.
- an Fc variant antibody exhibiting altered affinity for Ciq has enhanced binding to the Fc receptor FcRn.
- an Fc variant antibody exhibiting altered affinity for C1 q has altered binding to FCYRI I IA and/or FcyRIIB relative to a native Fc antibody.
- ADCC antibody- dependent cell-mediated cytotoxicity
- FcRs Fc receptors
- cytotoxic cells e.g., Natural Killer (NK) cells, neutrophils, and macrophages
- NK Natural Killer
- IgG antibodies directed to the surface of cells "arm" the cytotoxic cells and are required for such killing. Lysis of the cell is extracellular, requires direct cell-to-cell contact, and does not involve complement.
- CDC complement dependent cytotoxicity
- ADCP antibody dependent cell-mediated phagocytosis
- Fc variant antibodies are characterized by in vitro functional assays for determining one or more FcyR mediated effector cell functions.
- Fc variant antibodies have similar binding properties and effector cell functions in in vivo models (such as those described and disclosed herein) as those in in vitro based assays.
- the present invention does not exclude Fc variant antibodies that do not exhibit the desired phenotype in in vitro based assays but do exhibit the desired phenotype in vivo.
- an antibody having an Fc variant has enhanced cytotoxicity or phagocytosis activity (e.g., ADCC, CDC and ADCP) relative to an antibody with a native Fc region.
- an Fc variant antibody has cytotoxicity or phagocytosis activity that is at least 2 fold, or at least 3 fold, or at least 5 fold or at least 10 fold or at least 50 fold or at least 100 fold, or up to 50 fold, or up to 75 fold, or up to 1 00 fold, or up to 200 fold, or is between 2 fold and 1 0 fold, or between 5 fold and 50 fold, or between 25 fold and 100 fold, or between 75 fold and 200 fold, or between 100 and 200 fold, greater than that of a native Fc antibody.
- an Fc variant antibody has reduced cytotoxicity or phagocytosis activity relative to a native Fc antibody.
- an Fc variant antibody has cytotoxicity or phagocytosis activity that is at least 2 fold, or at least 3 fold, or at least 5 fold or at least 1 0 fold or at least 50 fold or at least 100 fold, or up to 50 fold, or up to 75 fold, or up to 100 fold, or up to 200 fold, or is between 2 fold and 10 fold, or between 5 fold and 50 fold, or between 25 fold and 1 00 fold, or between 75 fold and 200 fold, or between 100 and 200 fold, lower than that of a native Fc antibody.
- Fc variant antibodies exhibit decreased ADCC activities as compared to a native Fc antibody.
- Fc variant antibodies exhibit ADCC activities that are at least 2 fold, or at least 3 fold, or at least 5 fold or at least 1 0 fold or at least 50 fold or at least 100 fold, or up to 50 fold, or up to 75 fold, or up to 100 fold, or up to 200 fold, or is between 2 fold and 10 fold, or between 5 fold and 50 fold, or between 25 fold and 100 fold, or between 75 fold and 200 fold, or between 100 and 200 fold, less than that of a native Fc antibody.
- Fc variant antibodies exhibit ADCC activities that are reduced by at least 10%, or at least 20%, or by at least 30%, or by at least 40%, or by at least 50%, or by at least 60%, or by at least 70%, or by at least 80%, or by at least 90%, or by at least 100%, or by at least 200%, or by at least 300%, or by at least 400%, or by at least 500%, relative to a native Fc antibody.
- Fc variant antibodies have no detectable ADCC activity.
- the reduction and/or ablatement of ADCC activity may be attributed to the reduced affinity Fc variant antibodies exhibit for Fc ligands and/or receptors.
- Fc variant antibodies exhibit increased ADCC activities as compared to a native Fc antibody.
- Fc variant antibodies exhibit ADCC activities that are at least 2 fold, or at least 3 fold, or at least 5 fold or at least 1 0 fold or at least 50 fold or at least 100 fold greater than that of a native Fc antibody.
- Fc variant antibodies exhibit ADCC activities that are increased by at least 10%, or at least 20%, or by at least 30%, or by at least 40%, or by at least 50%, or by at least 60%, or by at least 70%, or by at least 80%, or by at least 90%, or by at least 100%, or by at least 200%, or by at least 300%, or by at least 400%, or by at least 500% relative to a native Fc antibody.
- the increased ADCC activity may be attributed to the increased affinity Fc variant antibodies exhibit for Fc ligands and/or receptors.
- an Fc variant antibody has enhanced binding to the Fc receptor FCYRI I IA and has enhanced ADCC activity relative to a native Fc antibody. In other embodiments, the Fc variant antibody has both enhanced ADCC activity and enhanced serum half-life relative to a native Fc antibody. In another specific embodiment, an Fc variant antibody has reduced binding to the Fc receptor FCYRI I IA and has reduced ADCC activity relative to a native Fc antibody. In other embodiments, the Fc variant antibody has both reduced ADCC activity and enhanced serum half-life relative to a native Fc antibody.
- the cytotoxicity is mediated by CDC wherein the Fc variant antibody has either enhanced or decreased CDC activity relative to a native Fc antibody.
- the complement activation pathway is initiated by the binding of the first component of the complement system (C1 q) to a molecule, an antibody for example, complexed with a cognate antigen.
- C1 q the first component of the complement system
- a CDC assay e.g. as described in Gazzano-Santoro et al. (1996) J. Immunol. Methods, 202:163, may be performed.
- antibodies of the invention exhibit increased CDC activity as compared to a native Fc antibody.
- Fc variant antibodies exhibit CDC activity that is at least 2 fold, or at least 3 fold, or at least 5 fold or at least 10 fold or at least 50 fold or at least 100 fold, or up to 50 fold, or up to 75 fold, or up to 100 fold, or up to 200 fold, or is between 2 fold and 10 fold, or between 5 fold and 50 fold, or between 25 fold and 100 fold, or between 75 fold and 200 fold, or between 100 and 200 fold more than that of an native Fc antibody.
- Fc variant antibodies exhibit CDC activity that is increased by at least 10%, or at least 20%, or by at least 30%, or by at least 40%, or by at least 50%, or by at least 60%, or by at least 70%, or by at least 80%, or by at least 90%, or by at least 100%, or by at least 200%, or by at least 300%, or by at least 400%, or by at least 500% relative to a native Fc antibody.
- the increase of CDC activity may be attributed to the increased affinity Fc variant antibodies exhibit for Cl q.
- Antibodies of the invention may exhibit increased CDC activity as compared to a native Fc antibody by virtue of COMPLEGENT® Technology (Kyowa Hakko Kirin Co., Ltd.), which enhances one of the major mechanisms of action of an antibody, CDC.
- COMPLEGENT® Technology Kyowa Hakko Kirin Co., Ltd.
- isotype chimerism in which portions of lgG3, an antibody's isotype, are introduced into corresponding regions of lgG1 , the standard isotype for therapeutic antibodies
- COMPLEGENT® Technology significantly enhances CDC activity beyond that of either lgG1 or lgG3, while retaining the desirable features of lgG1 , such as ADCC, PK profile and Protein A binding.
- it can be used together with POTELLIGENT® Technology, creating an even superior therapeutic Mab (ACCRETAMAB®) with enhanced ADCC and CDC activities
- Fc variant antibody of the invention may have enhanced ADCC activity and enhanced serum half-life relative to a native Fc antibody.
- Fc variant antibody of the invention may CDC activity and enhanced serum half-life relative to a native Fc antibody.
- Fc variant antibody of the invention may have enhanced ADCC activity, enhanced CDC activity and enhanced serum half-life relative to a native Fc antibody.
- the serum half-life of proteins having Fc regions may be increased by increasing the binding affinity of the Fc region for FcRn.
- antibody half-life as used herein means a pharmacokinetic property of an antibody that is a measure of the mean survival time of antibody molecules following their administration. Antibody half-life can be expressed as the time required to eliminate 50 percent of a known quantity of immunoglobulin from the patient's body (or other mammal) or a specific compartment thereof, for example, as measured in serum, i.e., circulating half-life, or in other tissues. Half-life may vary from one immunoglobulin or class of immunoglobulin to another. In general, an increase in antibody half-life results in an increase in mean residence time (MRT) in circulation for the antibody administered.
- MRT mean residence time
- the increase in half-life allows for the reduction in amount of drug given to a patient as well as reducing the frequency of administration.
- a salvage receptor binding epitope into the antibody (especially an antibody fragment) as described in U.S. Pat. No. 5,739,277, for example.
- the term "salvage receptor binding epitope” refers to an epitope of the Fc region of an IgG molecule (e.g., lgG1 , lgG2, lgG3, or lgG4) that is responsible for increasing the in vivo serum half-life of the IgG molecule.
- antibodies of the invention with increased half-lives may be generated by modifying amino acid residues identified as involved in the interaction between the Fc and the FcRn receptor (see, for examples, US Patent Nos. 6,821 ,505 and 7,083,784; and WO 09/058492).
- the half-life of antibodies of the invention may be increase by conjugation to PEG or Albumin by techniques widely utilized in the art.
- antibodies having Fc variant regions of the invention have an increased half- life of about 5%, about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 60%, about 65%, about 70%, about 80%, about 85%, about 90%, about 95%, about 100%, about 125%, about 1 50% or more as compared to an antibody having a native Fc region.
- antibodies having Fc variant regions have an increased half-life of about 2 fold, about 3 fold, about 4 fold, about 5 fold, about 10 fold, about 20 fold, about 50 fold or more, or up to about 1 0 fold, about 20 fold, or about 50 fold, or between 2 fold and 10 fold, or between 5 fold and 25 fold, or between 1 5 fold and 50 fold, as compared to an antibody with a native Fc region.
- the present invention provides Fc variants, wherein the Fc region includes a modification (e.g., amino acid substitutions, amino acid insertions, amino acid deletions) at one or more positions selected from 221 , 225, 228, 234, 235, 236, 237, 238, 239, 240, 241 , 243, 244, 245, 247, 250, 251 , 252, 254, 255, 256, 257, 262, 263, 264, 265, 266, 267, 268, 269, 279, 280, 284, 292, 296, 297, 298, 299, 305, 308, 313, 316, 318, 320, 322, 325, 326, 327, 328, 329, 330, 331 , 332, 333, 334, 339, 341 , 343, 370, 373, 378, 392, 416, 419, 421 , 428, 433, 434, 435, 436, 440, and 443 as numbered by the EU
- the Fc region may include a modification at additional and/or alternative positions known to one skilled in the art (see, e.g., U.S. Patents 5,624,821 ; 6,277,375; 6,737,056; 7,083,784; 7,317,091 ; 7,217,797; 7,276,585; 7,355,008; 2002/014731 1 ; 2004/0002587; 2005/0215768; 2007/0135620; 2007/0224188; 2008/0089892; WO 94/29351 ; and WO 99/58572).
- the present invention provides an Fc variant, wherein the Fc region includes at least one substitution selected from 221 K, 221 Y, 225E, 225K, 225W, 228P, 234D, 234E, 234N, 234Q, 234T, 234H, 234Y, 234I, 234V, 234F, 235A, 235D, 235R, 235W, 235P, 235S, 235N, 235Q, 235T, 235H, 235Y, 235I, 235V, 235E, 235F, 236E, 237L, 237M, 237P, 239D, 239E, 239N, 239Q, 239F, 239T, 239H, 239Y, 240I, 240A, 240T, 240M, 241 W, 241 L, 241 Y, 241 E, 241 R.
- the Fc region includes at least one substitution selected from 221 K, 221 Y,
- the Fc region may include additional and/or alternative amino acid substitutions known to one skilled in the art including but not limited to those exemplified in Tables 2, and 6-10 of US 6,737,056; the tables presented in Figure 41 of US 2006/024298; the tables presented in Figures 5, 12, and 1 5 of US 2006/235208; the tables presented in Figures 8, 9 and 1 0 of US 2006/0173170 and the tables presented in Figures 8, 9 and 10 Of WO 09/058492.
- the present invention provides an Fc variant antibody, wherein the Fc region includes at least one modification (e.g., amino acid substitutions, amino acid insertions, amino acid deletions) at one or more positions selected from 228, 234, 235 and 331 as numbered by the EU index as set forth in Kabat.
- the modification is at least one subsitution selected from 228P, 234F, 235E, 235F, 235Y, and 331 S as numbered by the EU index as set forth in Kabat.
- the present invention provides an Fc variant antibody, wherein the Fc region is an lgG4 Fc region and includes at least one modification at one or more positions selected from 228 and 235 as numbered by the EU index as set forth in Kabat.
- the Fc region is an lgG4 Fc region and the non-naturally occurring amino acids are selected from 228P, 235E and 235Y as numbered by the EU index as set forth in Kabat.
- the present invention provides an Fc variant, wherein the Fc region includes at least one non-naturally occurring amino acid at one or more positions selected from 239, 330 and 332 as numbered by the EU index as set forth in Kabat.
- the modification is at least one substitution selected from 239D, 330L, 330Y, and 332E as numbered by the EU index as set forth in Kabat.
- the present invention provides an Fc variant antibody, wherein the Fc region includes at least one non-naturally occurring amino acid at one or more positions selected from 252, 254, and 256 as numbered by the EU index as set forth in Kabat.
- the modification is at least one substitution selected from 252Y, 254T and 256E as numbered by the EU index as set forth in Kabat.
- the modification is three substitutions 252Y, 254T and 256E as numbered by the EU index as set forth in Kabat (known as "YTE"), see U.S. 7,083,784.
- the effector functions elicited by IgG antibodies strongly depend on the carbohydrate moiety linked to the Fc region of the protein (Ferrara et al. (2006) Biotechnology and Bioengineering. 93:851 -861 ).
- glycosylation of the Fc region can be modified to increase or decrease effector function (see for examples, Umana et al. (1999) Nat. Biotechnol. 17:176-180; Davies et al. (2001 ) Biotechnol Bioeng. 74:288-294; Shields et al. (2002) J Biol Chem. 277:26733-26740; Shinkawa et al. (2003) J Biol Chem.
- the Fc regions of antibodies of the invention include altered glycosylation of amino acid residues.
- the altered glycosylation of the amino acid residues results in lowered effector function.
- the altered glycosylation of the amino acid residues results in increased effector function.
- the Fc region has reduced fucosylation.
- the Fc region is afucosylated (see for examples, U.S. Patent Application Publication No.2005/0226867).
- these antibodies with increased effector function, specifically ADCC as generated in host cells (e.g., CHO cells, Lemna minor) engineered to produce highly defucosylated antibody with over 100-fold higher ADCC compared to antibody produced by the parental cells (Mori et al. (2004) Biotechnol Bioeng. 88:901 -908; Cox et al. (2006) Nat Biotechnol. 24:1591 -7).
- the Fc regions of antibodies of the invention include an altered sialylation profile compared to the native Fc region. In one embodiment, the Fc regions of antibodies of the invention include an increased sialylation profile compared to the native Fc region. In another embodiment, the Fc regions of antibodies of the invention include a decreased sialylation profile compared to the native Fc region.
- the Fc variants of the present invention may be combined with other known Fc variants such as those disclosed in Ghetie et al. (1997) Nat Biotech. 15:637-40; Duncan et al. (1988) Nature. 332:563-564; Lund et al. (1991 ) J. Immunol. 147:2657-2662; Lund et al. (1992) Mol Immunol. 29:53-59; Alegre et al. (1994) Transplantation. 57:1 537-1543; Hutchins et al. (1995) Proc Natl. Acad. Sci. USA. 92:1 1980-1 1984; Jefferis et al. (1995) Immunol Lett.
- modified glycosylation in the variable region can alter the affinity of the antibody for antigen.
- the glycosylation pattern in the variable region of the present antibodies is modified.
- an aglycoslated antibody can be made (i.e., the antibody lacks glycosylation).
- Glycosylation can be altered to, for example, increase the affinity of the antibody for antigen.
- carbohydrate modifications can be accomplished by, for example, altering one or more sites of glycosylation within the antibody sequence.
- one or more amino acid substitutions can be made that result in elimination of one or more variable region framework glycosylation sites to thereby eliminate glycosylation at that site.
- Such aglycosylation may increase the affinity of the antibody for antigen.
- Such an approach is described in further detail in U.S. Patent Nos. 5,714,350 and 6,350,861 .
- One or more amino acid substitutions can also be made that result in elimination of a glycosylation site present in the Fc region (e.g., Asparagine 297 of IgG).
- aglycosylated antibodies may be produced in bacterial cells which lack the necessary glycosylation machinery.
- the antibodies of the invention are conjugated or covalently attached to a substance using methods well known in the art.
- the attached substance is a therapeutic agent, a detectable label (also referred to herein as a reporter molecule) or a solid support.
- Suitable substances for attachment to antibodies include, but are not limited to, an amino acid, a peptide, a protein, a polysaccharide, a nucleoside, a nucleotide, an oligonucleotide, a nucleic acid, a hapten, a drug, a hormone, a lipid, a lipid assembly, a synthetic polymer, a polymeric microparticle, a biological cell, a virus, a fluorophore, a chromophore, a dye, a toxin, a hapten, an enzyme, an antibody, an antibody fragment, a radioisotope, solid matrixes, semi-solid matrixes and combinations thereof.
- Methods for conjugation or covalently attaching another substance to an antibody are well known in the art.
- the antibodies of the invention are conjugated to a solid support.
- Antibodies may be conjugated to a solid support as part of the screening and/or purification and/or manufacturing process.
- antibodies of the invention may be conjugated to a solid support as part of a diagnostic method or composition.
- a solid support suitable for use in the present invention is typically substantially insoluble in liquid phases. A large number of supports are available and are known to one of ordinary skill in the art.
- solid supports include solid and semi-solid matrixes, such as aerogels and hydrogels, resins, beads, biochips (including thin film coated biochips), microfluidic chip, a silicon chip, multi-well plates (also referred to as microtitre plates or microplates), membranes, conducting and non-conducting metals, glass (including microscope slides) and magnetic supports.
- solid and semi-solid matrixes such as aerogels and hydrogels, resins, beads, biochips (including thin film coated biochips), microfluidic chip, a silicon chip, multi-well plates (also referred to as microtitre plates or microplates), membranes, conducting and non-conducting metals, glass (including microscope slides) and magnetic supports.
- solid supports include silica gels, polymeric membranes, particles, derivatized plastic films, glass beads, cotton, plastic beads, alumina gels, polysaccharides such as Sepharose, poly(acrylate), polystyrene, poly(acrylamide), polyol, agarose, agar, cellulose, dextran, starch, FICOLL, heparin, glycogen, amylopectin, mannan, inulin, nitrocellulose, diazocellulose, polyvinylchloride, polypropylene, polyethylene (including poly(ethylene glycol)), nylon, latex bead, magnetic bead, paramagnetic bead, superparamagnetic bead, starch and the like.
- polysaccharides such as Sepharose, poly(acrylate), polystyrene, poly(acrylamide), polyol, agarose, agar, cellulose, dextran, starch, FICOLL, heparin, glycogen, amylopectin,
- the solid support may include a reactive functional group, including, but not limited to, hydroxyl, carboxyl, amino, thiol, aldehyde, halogen, nitro, cyano, amido, urea, carbonate, carbamate, isocyanate, sulfone, sulfonate, sulfonamide, sulfoxide, etc., for attaching the antibodies of the invention.
- a reactive functional group including, but not limited to, hydroxyl, carboxyl, amino, thiol, aldehyde, halogen, nitro, cyano, amido, urea, carbonate, carbamate, isocyanate, sulfone, sulfonate, sulfonamide, sulfoxide, etc.
- a suitable solid phase support can be selected on the basis of desired end use and suitability for various synthetic protocols.
- resins generally useful in peptide synthesis may be employed, such as polystyrene ⁇ e.g., PAM-resin obtained from Bachem Inc., Peninsula Laboratories, etc.), POLYHIPETM resin (obtained from Aminotech, Canada), polyamide resin (obtained from Peninsula Laboratories), polystyrene resin grafted with polyethylene glycol (TentaGelTM, Rapp Polymere, Tubingen, Germany), polydimethyl-acrylamide resin (available from Milligen/Biosearch, California), or PEGA beads (obtained from Polymer Laboratories).
- polystyrene ⁇ e.g., PAM-resin obtained from Bachem Inc., Peninsula Laboratories, etc.
- POLYHIPETM resin obtained from Aminotech, Canada
- polyamide resin obtained from Peninsula Laboratories
- the antibodies of the invention are conjugated to labels for purposes of diagnostics and other assays wherein the antibody and/or its associated ligand may be detected.
- a label conjugated to an antibody and used in the present methods and compositions described herein is any chemical moiety, organic or inorganic, that exhibits an absorption maximum at wavelengths greater than 280 nm, and retains its spectral properties when covalently attached to an antibody.
- Labels include, without limitation, a chromophore, a fluorophore, a fluorescent protein, a phosphorescent dye, a tandem dye, a particle, a hapten, an enzyme and a radioisotope.
- the antibodies are conjugated to a fluorophore.
- fluorophores used to label antibodies of the invention include, without limitation; a pyrene (including any of the corresponding derivative compounds disclosed in US Patent 5,1 32,432), an anthracene, a naphthalene, an acridine, a stilbene, an indole or benzindole, an oxazole or benzoxazole, a thiazole or benzothiazole, a 4-amino-7-nitrobenz-2-oxa-1 , 3-diazole (NBD), a cyanine (including any corresponding compounds in US Patent Nos.
- oxazines include resorufins (including any corresponding compounds disclosed in 5,242,805), aminooxazinones, diaminooxazines, and their benzo-substituted analogs.
- the fluorophores conjugated to the antibodies described herein include xanthene (rhodol, rhodamine, fluorescein and derivatives thereof) coumarin, cyanine, pyrene, oxazine and borapolyazaindacene.
- fluorophores are sulfonated xanthenes, fluorinated xanthenes, sulfonated coumarins, fluorinated coumarins and sulfonated cyanines.
- dyes sold under the tradenames, and generally known as, ALEXA FLUOR®, DyLight, CY® Dyes, BODIPY®, OREGON GREEN®, PACIFIC BLUETM, IRDYE®, FAM, FITC, and ROXTM.
- the choice of the fluorophore attached to the antibody will determine the absorption and fluorescence emission properties of the conjugated antibody.
- Physical properties of a fluorophore label that can be used for antibody and antibody bound ligands include, but are not limited to, spectral characteristics (absorption, emission and stokes shift), fluorescence intensity, lifetime, polarization and photo-bleaching rate, or combination thereof. All of these physical properties can be used to distinguish one fluorophore from another, and thereby allow for multiplexed analysis.
- the fluorophore has an absorption maximum at wavelengths greater than 480 nm.
- the fluorophore absorbs at or near 488 nm to 514 nm (particularly suitable for excitation by the output of the argon-ion laser excitation source) or near 546 nm (particularly suitable for excitation by a mercury arc lamp).
- a fluorophore can emit in the NIR (near infrared region) for tissue or whole organism applications.
- Other desirable properties of the fluorescent label may include cell permeability and low toxicity, for example if labeling of the antibody is to be performed in a cell or an organism (e.g., a living animal).
- an enzyme is a label and is conjugated to an antibody described herein.
- Enzymes are desirable labels because amplification of the detectable signal can be obtained resulting in increased assay sensitivity.
- the enzyme itself does not produce a detectable response but functions to break down a substrate when it is contacted by an appropriate substrate such that the converted substrate produces a fluorescent, colorimetric or luminescent signal.
- Enzymes amplify the detectable signal because one enzyme on a labeling reagent can result in multiple substrates being converted to a detectable signal.
- the enzyme substrate is selected to yield the preferred measurable product, e.g. colorimetric, fluorescent or chemiluminescence. Such substrates are extensively used in the art and are well known by one skilled in the art.
- colorimetric or fluorogenic substrate and enzyme combination uses oxidoreductases such as horseradish peroxidase and a substrate such as 3,3'-diaminobenzidine (DAB) and 3-amino-9-ethylcarbazole (AEC), which yield a distinguishing color (brown and red, respectively).
- oxidoreductases such as horseradish peroxidase and a substrate such as 3,3'-diaminobenzidine (DAB) and 3-amino-9-ethylcarbazole (AEC), which yield a distinguishing color (brown and red, respectively).
- DAB 3,3'-diaminobenzidine
- AEC 3-amino-9-ethylcarbazole
- colorimetric oxidoreductase substrates that yield detectable products include, but are not limited to: 2,2-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid) (ABTS), o-phenylenediamine (OPD), 3,3',5,5'-tetramethylbenzidine (TMB), o- dianisidine, 5-aminosalicylic acid, 4-chloro-1 -naphthol.
- Fluorogenic substrates include, but are not limited to, homovanillic acid or 4-hydroxy-3- methoxyphenylacetic acid, reduced phenoxazines and reduced benzothiazines, including Amplex ® Red reagent and its variants (U.S. Pat. No.
- Peroxidase substrates that are tyramides represent a unique class of peroxidase substrates in that they can be intrinsically detectable before action of the enzyme but are "fixed in place” by the action of a peroxidase in the process described as tyramide signal amplification (TSA).
- TSA tyramide signal amplification
- a colorimetric (and in some cases fluorogenic) substrate and enzyme combination uses a phosphatase enzyme such as an acid phosphatase, an alkaline phosphatase or a recombinant version of such a phosphatase in combination with a colorimetric substrate such as 5-bromo- 6-chloro-3-indolyl phosphate (BCIP), 6-chloro-3-indolyl phosphate, 5-bromo-6- chloro-3-indolyl phosphate, p-nitrophenyl phosphate, or o-nitrophenyl phosphate or with a fluorogenic substrate such as 4-methylumbelliferyl phosphate, 6,8-difluoro-7-hydroxy-4-methylcoumarinyl phosphate (DiFMUP, U.S.
- a fluorogenic substrate such as 4-methylumbelliferyl phosphate, 6,8-difluoro-7-hydroxy-4-methylcoumarinyl phosphate (DiFMUP, U.
- Glycosidases in particular beta-galactosidase, beta-glucuronidase and beta- glucosidase, are additional suitable enzymes.
- Appropriate colorimetric substrates include, but are not limited to, 5-bromo-4-chloro-3-indolyl beta-D- galactopyranoside (X-gal) and similar indolyl galactosides, glucosides, and glucuronides, o-nitrophenyl beta-D-galactopyranoside (ONPG) and p- nitrophenyl beta-D-galactopyranoside.
- fluorogenic substrates include resorufin beta-D-galactopyranoside, fluorescein digalactoside (FDG), fluorescein diglucuronide and their structural variants (U.S. Pat. Nos. 5,208, 148; 5,242,805; 5,362,628; 5,576,424 and 5,773,236), 4-methylumbelliferyl beta-D-galactopyranoside, carboxyumbelliferyl beta-D- galactopyranoside and fluorinated coumarin beta-D-galactopyranosides (U.S. Pat. No. 5,830,912).
- Additional enzymes include, but are not limited to, hydrolases such as cholinesterases and peptidases, oxidases such as glucose oxidase and cytochrome oxidases, and reductases for which suitable substrates are known.
- Enzymes and their appropriate substrates that produce chemiluminescence are preferred for some assays. These include, but are not limited to, natural and recombinant forms of luciferases and aequorins. Chemiluminescence- producing substrates for phosphatases, glycosidases and oxidases such as those containing stable dioxetanes, luminol, isoluminol and acridinium esters are additionally useful.
- haptens such as biotin
- Biotin is useful because it can function in an enzyme system to further amplify the detectable signal, and it can function as a tag to be used in affinity chromatography for isolation purposes.
- an enzyme conjugate that has affinity for biotin is used, such as avidin-HRP. Subsequently a peroxidase substrate is added to produce a detectable signal.
- Haptens also include hormones, naturally occurring and synthetic drugs, pollutants, allergens, affector molecules, growth factors, chemokines, cytokines, lymphokines, amino acids, peptides, chemical intermediates, nucleotides and the like.
- fluorescent proteins may be conjugated to the antibodies as a label.
- fluorescent proteins include green fluorescent protein (GFP) and the phycobiliproteins and the derivatives thereof.
- the fluorescent proteins, especially phycobiliprotein, are particularly useful for creating tandem dye labeled labeling reagents. These tandem dyes include a fluorescent protein and a fluorophore for the purposes of obtaining a larger stokes shift wherein the emission spectra is farther shifted from the wavelength of the fluorescent protein's absorption spectra. This is particularly advantageous for detecting a low quantity of antigen in a sample wherein the emitted fluorescent light is maximally optimized, in other words little to none of the emitted light is reabsorbed by the fluorescent protein.
- the fluorescent protein and fluorophore function as an energy transfer pair wherein the fluorescent protein emits at the wavelength that the fluorophore absorbs at and the fluorphore then emits at a wavelength farther from the fluorescent proteins than could have been obtained with only the fluorescent protein.
- a particularly useful combination is the phycobiliproteins disclosed in US Patent Nos. 4,520,1 10; 4,859,582; 5,055,556 and the sulforhodamine fluorophores disclosed in US Patent No. 5,798,276, or the sulfonated cyanine fluorophores disclosed in US Patent Nos. 6,977,305 and 6,974,873; or the sulfonated xanthene derivatives disclosed in US Patent No.
- the fluorophore functions as the energy donor and the fluorescent protein is the energy acceptor.
- the label is a radioactive isotope.
- suitable radioactive materials include, but are not limited to, iodine ( 121 l, 123 l, 125 l, 131 l), carbon ( 1 C), sulfur ( 35 S), tritium ( 3 H), indium ( 111 ln, 112 ln, 113m ln, 115m ln), technetium ( 99 Tc, 99m Tc), thallium ( 201 Ti), gallium ( 68 Ga, 67 Ga), palladium ( 103 Pd), molybdenum ( 99 Mo), xenon ( 135 Xe), fluorine ( 18 F), 153 Sm, 177 Lu, 159 Gd, 1 9 Pm, 1 0 La, 175 Yb, 166 Ho, 90 Y, 7 Sc
- the antibodies and antigen binding fragments thereof of the invention and variants thereof may be used for the treatment of influenza B virus infection, for the prevention of influenza B virus infection; for the detection, diagnosis and/or prognosis of influenza B virus infection; or combinations thereof.
- the antibodies and antigen binding fragments thereof of the inventions and variants thereof may be used for the treatment of influenza A and influenza B infection, for the prevention of influenza A and influenza B; for the detection, diagnosis and/or prognosis of influenza A and influenza B infection; or combinations thereof.
- Methods of diagnosis may include contacting an antibody or an antibody fragment with a sample.
- samples may be tissue samples taken from, for example, nasal passages, sinus cavities, salivary glands, lung, liver, pancreas, kidney, ear, eye, placenta, alimentary tract, heart, ovaries, pituitary, adrenals, thyroid, brain or skin.
- the methods of detection, diagnosis, and/or prognosis may also include the detection of an antigen/antibody complex.
- the invention provides a method of treating a subject by administering to the subject an effective amount of an antibody or an antigen binding fragment thereof, according to the invention, or a pharmaceutical composition that includes the antibody or antigen binding fragment thereof.
- the antibody or antigen binding fragment thereof is substantially purified (i.e., substantially free from substances that limit its effect or produce undesired side-effects).
- the antibody or antigen binding fragment thereof of the invention is administered postexposure, or after the subject has been exposed to influenza B virus or is infected with influenza B virus.
- the antibody or antigen binding fragment thereof of the invention is administered post-exposure, or after the subject has been exposed to influenza B virus of Yamagata and/or Victoria lineage or is infected with influenza B virus of Yamagata and/or Victoria lineage. In one embodiment, the antibody or antigen binding fragment thereof of the invention is administered post-exposure, or after the subject has been exposed to at least one influenza A virus subtype; influenza B virus of Yamagata lineage; influenza B virus of Victoria lineage, or combinations thereof; or is infected with at least one influenza A virus subtype and/or influenza B virus of Yamagata and/or Victoria lineage.
- the antibody or antigen binding fragment thereof of the invention is administered pre-exposure, or to a subject that has not yet been exposed to influenza B virus or is not yet infected with influenza B virus. In another embodiment, the antibody or antigen binding fragment thereof of the invention is administered pre-exposure, or to a subject that has not yet been exposed to influenza B virus of Yamagata and/or Victoria lineage or is not yet infected with influenza B virus of Yamagata and/or Victoria lineage.
- the antibody or antigen binding fragment thereof of the invention is administered pre-exposure, or to a subject that has not yet been exposed to influenza A virus; influenza B virus of Yamagata lineage; influenza B virus of Victoria lineage; or combinations thereof, or is not yet infected with influenza A virus; influenza B virus of Yamagata lineage; influenza of Victoria lineage; or combinations thereof.
- the antibody or antigen binding fragment thereof of the invention is administered to a subject that is sero-negative for one or more influenza B viruses. In one embodiment, the antibody or antigen binding fragment thereof of the invention is administered to a subject that is seronegative for one or more influenza B virus lineages. In one embodiment, the antibody or antigen binding fragment thereof of the invention is administered to a subject that is sero-negative for one or more influenza A subtypes and/or one or more influenza B viruses.
- the antibody or antigen binding fragment thereof of the invention is administered to a subject that is sero-positive for one or more one or more influenza B viruses. In another embodiment, the antibody or antigen binding fragment thereof of the invention is administered to a subject that is sero-positive for one or more one or more influenza B virus lineages. In another embodiment, the antibody or antigen binding fragment thereof of the invention is administered to a subject that is sero-positive for one or more one or more influenza A virus subtypes and/or one or more influenza B viruses. In one embodiment, the antibody or antigen binding fragment thereof of the invention is administered to a subject within 1 , 2, 3, 4, 5 days of infection or symptom onset. In another embodiment, the antibody or antigen binding fragment thereof of the invention can be administered to a subject after 1 , 2, 3, 4, 5, 6, or 7 days, and within 2, 3, 4, 5, 6, 7, 8, 9 or 1 0 days after infection or symptom onset.
- the method reduces influenza B virus infection in a subject. In another embodiment, the method reduces influenza A virus infection and/or influenza B virus infection in a subject. In another embodiment, the method prevents, reduces the risk or delays influenza B virus infection in a subject. In another embodiment, the method prevents, reduces the risk or delays influenza A and/or influenza B virus infection in a subject.
- the subject is an animal. In one embodiment, the subject is a mammal. In a more particular embodiment, the subject is human. In one embodiment, the subject includes, but is not limited to, one who is particularly at risk of or susceptible to influenza A and/or influenza B virus infection, including, for example, an immunocompromised subject. Treatment can be a single dose schedule or a multiple dose schedule and the antibody or antigen binding fragment thereof of the invention can be used in passive immunization or active vaccination.
- the antibody or antigen binding fragment thereof of the invention is administered to a subject in combination with one or more antiviral medications.
- the antibody or antigen binding fragment thereof of the invention is administered to a subject in combination with one or more small molecule antiviral medications.
- Small molecule antiviral medications include neuraminidase inhibitors such as oseltamivir (TAMIFLU®), zanamivir (RELENZA®) and adamantanes such as Amantadine and rimantadine.
- the invention provides a composition for use as a medicament for the prevention or treatment of an influenza A and/or influenza B virus infection.
- the invention provides the use of an antibody or antigen binding fragment thereof of the invention and/or a protein having an epitope to which an antibody or antigen binding fragment thereof of the invention binds in the manufacture of a medicament for treatment of a subject and/or diagnosis in a subject.
- Antibodies and fragments thereof as described in the present invention may also be used in a kit for the diagnosis of influenza A virus infection; influenza B virus infection; or combinations thereof. Further, epitopes capable of binding an antibody of the invention may be used in a kit for monitoring the efficacy of vaccination procedures by detecting the presence of protective anti-influenza A and/or influenza B virus antibodies. Antibodies, antibody fragment, or variants and derivatives thereof, as described in the present invention may also be used in a kit for monitoring vaccine manufacture with the desired immunogenicity.
- the invention also provides a method of preparing a pharmaceutical composition, which includes the step of admixing a monoclonal antibody with one or more pharmaceutically-acceptable carriers, wherein the antibody is a monoclonal antibody according to the invention described herein.
- Various delivery systems are known and can be used to administer the antibody or antigen binding fragment thereof of the invention, including, but not limited to, encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the antibody or antibody fragment, receptor-mediated endocytosis, construction of a nucleic acid as part of a retroviral or other vector, etc.
- Methods of introduction include, but are not limited to, intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes.
- the vaccine can be administered as a DNA vaccine, for example using electroporation technology, including, but not limited to, in vivo electroporation.
- compositions may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents, including, but not limited to small molecule antiviral compositions. Administration can be systemic or local. Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent. In yet another embodiment, the composition can be delivered in a controlled release system.
- compositions include a therapeutically effective amount of an antibody or antigen binding fragment thereof of the invention, and a pharmaceutically acceptable carrier.
- pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized
- carrier refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered.
- Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
- Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
- the composition if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like.
- the composition can be formulated as a
- Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc.
- the pharmaceutical composition contains a therapeutically effective amount of the antibody or antigen binding fragment thereof, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient.
- the formulation should suit the mode of administration.
- the dosage administered to a patient is between about 0.1 mg/kg to 100 mg/kg of the patient's body weight.
- CD22+ lgG+ B cells were sorted from cryopreserved peripheral blood mononuclear cells (PBMCs) of a donor selected for high neutralizing titers against both B/Florida/4/2006 Yamagata lineage (B/FLA/06) and B/Brisbane/60/2008 Victoria Lineage (B/BNE/08) and immortalized at 3 cells/well using Epstein Barr Virus (EBV), CpG oligodeoxynucleotide 2006 and feeder cells.
- PBMCs peripheral blood mononuclear cells
- EBV Epstein Barr Virus
- NA activity was measured by adding a fluorescently-labelled substrate, methylumbelliferyl-N-acetyl neuraminic acid (MU-NANA) (Sigma) at 25 ⁇ /well (10 ⁇ ) and plates were read with a fluorometer.
- MU-NANA methylumbelliferyl-N-acetyl neuraminic acid
- Three B cell clones (FBC-39, FBD-56, and FBD-94) were found to have neutralization activity against both influenza B Victoria and Yamagata lineages.
- the VH and VL genes of these clones were sequenced, and cloned into lgG1 expression vectors.
- Recombinant antibodies were produced by transient transfection of mammalian cell lines derived from Human Embryonic Kidney (HEK) or Chinese Hamster Ovary (CHO) cells. Supernatants from transfected cells were collected after 7-1 0 days of culture, and antibodies (IgG) were affinity purified by Protein A chromatography, and dialyzed into Phosphate Buffered Saline (PBS).
- HEK Human Embryonic Kidney
- CHO Chinese Hamster Ovary
- F In the FBC-39 antibody VL, there was only one non-germline framework residue: F at position 87 in the light chain, wherein the germlined amino acid is Y (or L87F(Y)), as numbered by Kabat (position 1 03 for IMGT numbering).
- the germlined sequence is referred to herein as FBC-39-L87Y.
- the non- germlined sequence is referred to as FBC-39-L87F.
- a variant was constructed in which all 12 of the non-germlined Kabat defined framework residues were reverted to the germline amino acid. This antibody construct demonstrated a significant reduction in the neutralizing activity and breadth of coverage for the Victoria lineage influenza B viruses, implying that one or more of the non-germline residue(s) are important for activity.
- Non-germlined framework residues located at positions H27, H28, and H30, are in an area defined as the VH framework 1 by the Kabat system although they are considered part of the HCDR-1 by the IMGT system.
- Antibody variants were generated by reverting all non-germlined Kabat defined framework amino acids to their respective germline residues, except for these three positions: H27L(F), H28S(T), H30L(S), which were "wobbled" between germline residue and non-germline residue to generate seven heavy chain variants: FBC-39 LSL, FBC-39 FSL; FBC-39 LTL; FBC-39 FTL; FBC-39-FSS; FBC-39-LTS; FBC-39- FTS, in which the germline residues are underlined, such that FBC-39 FTS contains the three germlined amino acids, and FBC-39 LSL contains the three wildtype residues at positions H27, H28, and H30.
- the germline residue N at H82 created a potential deamidation site (NS) in the VH. Consequently, this was substituted with the wildtype S of FBC-39 in all seven variants, FBC-39 LSL, FBC-39 FSL, FBC- 39 LTL, FBC-39 FTL, FBC-39-FSS, FBC-39-LTS, and FBC-39-FTS. Additionally, all seven of the FBC-39 variants share the same light chain sequence (FBC-39-L87Y), which differs from the FBC-39 light chain by one amino acid.
- the resulting antibody variants were expressed and purified as described above and further characterized.
- Example 2 The isolated anti-HA antibodies bind to both influenza B HA lineages
- HA ELISA binding assay was performed to determine the binding and cross-reactivity of the isolated antibodies.
- a 384-well Maxisorb ELISA plate (Nunc) was coated overnight at 4°C with 0.5 ⁇ g/ml of recombinant HA derived from a Yamagata lineage strain B/FLA/06, or a Victoria lineage strain B/BNE/08 in PBS. The plate was washed with PBS containing 0.1 % v/v Tween-20 to remove uncoated protein, and blocking solution containing 1 %(w/v) casein (Thermo Scientific) was added for 1 hour at room temperature.
- the blocking solution was discarded and a 3-fold serial dilution in PBS of each of the anti-HA antibodies (FBC-39, FBD-56, and FBD-94) was added and incubated for 1 hour at room temperature.
- the plate was washed three times and bound antibodies were detected using a peroxidase- conjugated mouse anti-human IgG antibody (Jackson).
- Antibody binding activity was calculated by either measuring the chemiluminescent signal after addition of Supersignal Pico substrate (Thermo Scientific) or by measuring the color change at 450 nm after incubation with Tetramethylbenzidine (TMB) one component substrate (available from Kirkegaard and Perry Laboratories, Inc. (KPL), Gaithersburg, MD) followed by the addition of 2N sulfuric acid to stop the reaction.
- TMB Tetramethylbenzidine
- Table 7 shows the average EC 50 from three independent experiments. All three anti-HA IgGs (FBC-39, FBD-56 and FBD-94) bound recombinant HA from both influenza B lineages. Similar EC 50 values were observed with between all three antibodies against the Yamagata (B/FL/06) HA. A lower EC 5 o was observed with the Victoria (B/BNE/08) for FBD-94 than for either FBD-56 or FBC-39.
- the seven FBC-39 antibody germlined variants were tested for binding activity by ELISA.
- Table 8 shows the binding results of the unpurified anti-HA FBC-39 IgG variants, where the FBC-39 FTS contains the Kabat defined framework germlined amino acids, and the FBC-39 LSL contains the Kabat defined framework germined amino acids except wildtype residues at positions H27, H28, and H30 (Kabat numbering). These results show that all variants bound to the Yamagata lineage (B/FL/06) HA protein, but variants containing an S residue at position H30 lost binding affinity for the Victoria lineage (B/BNE/08) HA protein.
- Four of the variants, FBC-39 LSL, FSL, LTL, and FTL showed equivalent or better binding affinity than FBC-39 to HA proteins from both lineages. Table 8.
- Example 1 A similar microneutralization assay was used as described in Example 1 to test for purified mAb activity.
- MDCK cells that were cultured in MEM medium (Invitrogen) supplemented with antibiotics, glutamine (complete MEM medium) and 1 0% (v/v) fetal bovine serum.
- 60 TCID 50 (50% tissue culture infectious doses) of virus was added to three-fold dilutions of antibody in a 384-well plate in complete MEM medium containing 0.75ug/ml TPCK treated trypsin (Worthington) in duplicate wells, after 30 minutes incubation at room temperature, 2x1 0 4 cells/well were added to the plate.
- NA activity was measured by adding a fluorescently-labelled substrate, methylumbelliferyl-N-acetyl neuraminic acid (MU-NANA) (Sigma) to each well and incubated at 37°C for 1 hr.
- Virus replication represented by NA activity was quantified by reading fluorescence using an Envision Fluorometer (PerkinElmer) using the following settings: excitation 355 nm, emission 460 nm; 10 flashes per well.
- the neutralization titer (50% inhibitory concentration [IC 50 ]) is expressed as the final antibody concentration that reduced the fluorescence signal by 50% compared to cell control wells.
- Influenza B virus strains used in Table 9 are as listed below: B/Lee/40 (B/Lee/40); B/AA/66 (ca B/Ann Arbor/1 /66); B/HK/72 (B/Hong Kong/5/72); B/BJ/97 (ca B/Beijing/243/97 (victoria)), B/HK/01 (B/Hong Kong/330/2001 (victoria)); B/MY/04 (B/Malaysia/2506/2004 (victoria)); B/BNE/08 (ca B/Brisbane/60/2008 (victoria)); B/AA/94 (ca B/Ann
- B/JHB/99 ca B/Johannesburg/5/99 (yamagata)
- B/SC/99 B/Sichuan/379/99
- Table 9 shows the average IC 5 o from two independent experiments.
- the anti- HA antibodies neutralized all the influenza B viruses tested.
- FBD-94 were more potent than the FBC-39, but showed some reduced activity against the B/AA/94 strain.
- a microneutralization assay was performed using similar methodology as described in Example 3.
- cold-adapted (ca) live attenuated influenza vaccine virus was generated by reverse genetics, containing the viral HA and NA genes from the A/chicken/Hong Kong/G9/97 (H9N2) virus in the context of the six internal protein genes of the ca A/Ann Arbor/6/60 (H2N2) virus with similar methodology as described by Jin et al. (2003) Virology. 306:18-24).
- Results of the microneutralization assay are shown in Table 10. Consistent with binding profile, FBC-39 and the variants potentially neutralized the H9N2 virus with biologically relevant IC 5 o values.
- FBC-39 and FBC-39 LTL had the most potent activity with IC 50 values of 0.17 and 0.09 g/ml, respectively.
- the FBD-56, FBD-94, and the control antibodies showed no neutralization activity at the highest concentration tested (50 Mg/ml).
- Yamagata lineage influenza B virus (B/Florida/4/2006; B/FLA/06) and Victoria lineage influenza B virus (B/Malyasia/2506/2004; B/MY/04) were incubated with high concentrations of FBC-39, FBD-56, and FBD-94 (125xlC 50 ) for 1 hour before the mixture of virus and antibody was adsorbed to MDCK cells at 30,000 TCID50 per well in 1 0 x 96-well plates and cultured in the presence of FBC-39, FBD-56, and FBD-94 (10XIC 50 ).
- Putative MARMs exhibiting the cytopathic effect (CPE) on the infected cells up to 3 days after infection were isolated.
- the HA gene were amplified by RT-PCR and subsequently sequenced, and then the isolated virus was confirmed for resistance by microneutralization assay.
- No MARMS were isolated from B/FLA/09 virus when cultured in the presence of FBC-39, FBD-56, or FBD-94.
- B/MY/04 Victoria lineage virus
- MARMS were isolated in the presence of FBD-56 and FBD-94, but not in the presence of FBC-39.
- Sequence analysis revealed that two FBD-56 MARMs contained single amino acid substitution at position 128 from glutamic acid (E) to lysine (K) or valine (V) (Table 1 1 ).
- the FBD-94 MARM harboured a single amino acid substitution at position 128 from E to K (Table 1 1 ).
- a variant of the Yamagata lineage B/Florida/4/2006 containing a single amino acid substitution at position 141 from glycine (G) to E conferred an 8-fold reduction in FBC-39 neutralization compared to the wildtype virus (B/FLA/06).
- B/FLA/09 G141 E variant and Yamagata lineage virus B/Jiangsu/10/2003 (B/JIN/03) a naturally circulating virus that contains an R at position 141 (G141 R)
- MARM isolation was repeated with only the FBC-39 mAb.
- One MARM virus was isolated using the B/FLA/09 G141 E virus with a single amino acid change from G to arginine (R) at position 235 (Table 1 1 ).
- Two B/JIN/03 escape mutant viruses were identified with single amino acid substitutions from serine (S) to isoleucine (I) at position 150, or from E to leucine (L) at position 235 (Table 1 1 ), respectively.
- the amino acid substitution identified in these influenza B MARMs are located in the head region of HA (Wang et al. (2008) J. Virol.
- Antibodies have the potential to clear virus infected cells through Fc-effector function such as antibody dependent cellular cytotoxicity (ADCC), antibody dependent cellular phagocytosis, and complement dependent killing.
- ADCC antibody dependent cellular cytotoxicity
- NK92 human NK cell line
- 96-well plates were coated with 5.0x10 4 TCID50/ well of B/Hong Kong/330/2001 (Victoria) virus stock.
- a serial dilution of FBD-94, FBC-39 as well as Fc-effector null variants that contain two substitutions in the Fc region, L234A and L235A (FBD-94 LALA and FBC-39 LALA) (Hezareh et al. (2001 ) J. Virol. 75(24):1 2161 ) were applied to the virus, and then NK cells were added at 5.0x10 4 cells/well and incubated at 37 ° C for 4 hours.
- Luciferase was detected by the addition of Steady-Glo Reagent (Promega) and measured by envision plate reader.
- Figure 1 shows that both FBD-94 and FBC-39 exhibit a dose dependent influenza B ADCC activity, whereas the LALA variants showed no activity at the same concentrations.
- Example 7 In vivo prophylactic and therapeutic effect of anti-influenza B IgGs in an leathal murine model of influenza infection
- influenza B neutralizing monoclonal antibodies The protective efficacy of influenza B neutralizing monoclonal antibodies was evaluated in a lethal influenza B murine model.
- Prophylactic activity (Figure 2 A-D): To test prophylactic efficacy, six-to-eight week old BALB/c (Harlan Laboratories) mice were administered a single intraperitoneal (IP) injection of either FBC-39 or FBD-94 antibody at doses of 3, 1 , 0.3, or 0.1 mg/kg in 100 ⁇ volumes in groups of eight. For each study, a group of control animals were treated IP with a human isotype non-relevant control IgG at 3 mg/kg in 100 ⁇ volumes.
- IP intraperitoneal
- mice Four hours after dosing, mice were inoculated intranasally with 1 5 times the fifty percent mouse lethal dose (1 5 MLDso) of B/Sichuan/379/99 (Yamagata) (B/Sic/99) or 10 MLD 50 of the B/Hong Kong/330/2001 (Victoria) (B/HK/01 ) in a 50 ⁇ volume. Mice were weighed on the day of virus challenge and monitored daily for weight loss and survival for 14 days (mice with body weight loss ⁇ 25% were euthanized). Both FBC-39 and FBD-94 mAbs conferred protection in a dose-dependent manner.
- FBC-39 and FBD-94 at 0.3 mg/kg or greater provided 90%-100% protection to the animals challenged with B/Sic/99 ( Figure 2 A and B) and B/HK/01 ( Figure 2 C and D).
- FBC-39 and FBD94 at lower dose of 0.1 mg/kg were also highly protective against B/HK/01 with 90% and 80% survival rate, respectively.
- mice were inoculated with 1 0 MLD 50 of B/Sic/99 (Yamagata) or 5 MLD 50 of B/HK/01 (Victoria) and injected with 10, 3, 1 , or 0.3 mg/kg of FBC-39 or FBD-94 two days post infection (pi).
- FBC-39 and FBD-94 provided complete protection to animals challenged with B/Sic/99 when administered at 1 mg/kg or greater ( Figure 3 A and B).
- FBC-39 and FBD-94 at doses of 0.3 mg/kg and greater provided complete protection ( Figure 3 C and D).
- the isotype control mAb given at 10 or 30 mg/kg failed to protect mice with a survival rate of 10% or 20% for B/Sic/99 and B/HK/01 infections, respectively.
- mice were inoculated with 5 MLD 50 of B/HK/01 and IP injected with 3 mg/kg of FBC-39 or FBD-94 initiated at 1 , 2, 3, or 4 days pi.
- FBC-39 protected 100% of mice when administered on day 1 pi, and 80% and 70% on day 2 and 3 pi respectively ( Figure 4 A).
- FBD-94 protected 100% of mice when administered on day 1 and day 2 pi, and 80% and 60% on day 3 and day 4 pi, respectively ( Figure 4 B).
- mice treated with same dose of non-relevant isotype control antibody failed to protect mice with a survival rate of 10%.
- HAI hemagglutination inhibition
- HAI titer was determined to be the minimum effective concentration (nM) of antibody that completely inhibited agglutination.
- Table 12 shows that FBD-94 and FBC39 had HAI activity against all influenza B strains tested, providing evidence of binding to the globular head of the influenza B HA. Other antibodies of the invention show similar activity using HAI assays. Table 12.
- B/Lee/40 (B/Lee/40); B/AA/66 (ca B/Ann Arbor/1/66); B/HK/72 (B/Hong Kong/5/72); B/BJ/97 (ca B/Beijing/243/97 (victoria)), B/HK/01 (B/Hong Kong/330/2001 (victoria)); B/Mal/04 (B/Malaysia 2506/2004 (victoria)); B/OH/05 (B/Ohio/1/2005 (victoria)); B/BNE/08 (ca B/Brisbane/60/2008 (victoria)); B/Yam/88 (B/Yamagata 16/88 (yamagata)); B/AA/94 (ca B/Ann Arbor/2/94 (yamagata)); B/geo/98 (ca B/Georgia 02/98 (yamagata)); B/Ysh/98 (ca B/Yamanashi/166/98 (yamagata)); B/Joh
- SEQ ID NO:2 (FBD-56 VH protein)
- SEQ ID NO:3 (FBD-56 HCDR-1- Kabat): DYAMN
- SEQ ID NO:4 (FBD-56 HCDR-2 - Kabat): VISWDSGRIGYADSVKG
- SEQ ID NO:5 (FBD-56 HCDR-3 - Kabat): DMLAYYSDNSGKKYNVYGMDV
- SEQ ID NO:7 (FBD-56 VL protein) EIVLTQSPATLSLSPGERATLSCRASQSVSTFLAWYQQKPGQAPRLLMYDA SNRATGIPARFSGSGSGTDFTLTISSLEPEDFAIYYCQQRSHWPPIFGQGTR LEIK
- SEQ ID NO:14 (FBD-94 HCDR-2 - Kabat): IISWDSGRIGYADSVRG
- SEQ ID NO:18 (FBD-94 LCDR-1 - Kabat): RASRSITTFLA
- SEQ ID NO:24 (FBC-39 HCDR-2 - Kabat): RIKSNTDGGTTDYAAPVKG
- SEQ ID NO:28 (FBC-39 LCDR-1 - Kabat): RASQDISTWLA
- SEQ ID NO:34 (FBC-39 LSL HCDR-2 - Kabat): RIKSNTDGGTTDYAAPVKG SEQ ID NO:35 (FBC-39 LSL HCDR-3 - Kabat):
- SEQ ID NO:38 (FBC-39 LSL LCDR-1 - Kabat): RASQDISTWLA
- SEQ ID NO:48 (FBC-39 FSL LCDR-1 - Kabat): RASQDISTWLA
- SEQ ID NO:52 FBC-39 LTL VH protein
- SEQ ID NO:54 (FBC-39 LTL HCDR-2 - Kabat): RIKSNTDGGTTDYAAPVKG SEQ ID NO:55 (FBC-39 LTL HCDR-3 - Kabat):
- SEQ ID NO:58 FBC-39 LTL LCDR-1 - Kabat: RASQDISTWLA
- SEQ ID NO:68 (FBC-39 FTL LCDR-1 - Kabat): RASQDISTWLA
- SEQ ID NO: 75 (FBC-39 FSS HCDR-1 - Kabat): RASQDISTWLA
- SEQ ID NO: 80 (FBC-39 FSS HCDR-3 - IMGT):
- SEQ ID NO: 90 FBC-39 LTS VH protein
- SEQ ID NO: 91 FBC-39 LTS HCDR-1 Kabat: RASQDISTWLA
- TTDGPYSDDFRSGYAARYRYFGMDV SEQ ID NO: 97 (FBC-39 LTS VL DNA)
- SEQ ID NO: 110 FBC-39 FTS HCDR-1 - IMGT: GFTFSNAW
- SEQ ID NO:139 FBC-39 LTL HCDR-1 - IMGT: GLTFLNAW SEQ ID NO:140 (FBC-39 LTL HCDR-2 - IMGT): IKSNTDGGTT SEQ ID N0:141 (FBC-39 LTL HCDR-3 - IMGT):
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Virology (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Molecular Biology (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biomedical Technology (AREA)
- Communicable Diseases (AREA)
- Pulmonology (AREA)
- Oncology (AREA)
- General Chemical & Material Sciences (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Behavior & Ethology (AREA)
- Pharmacology & Pharmacy (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Microbiology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Pathology (AREA)
- Cell Biology (AREA)
- Biotechnology (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Priority Applications (21)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN202110634379.1A CN113563462B (zh) | 2014-07-15 | 2015-07-14 | 中和抗乙型流感抗体及其用途 |
| CN201580038244.1A CN106573154B (zh) | 2014-07-15 | 2015-07-14 | 中和抗乙型流感抗体及其用途 |
| EP26150174.6A EP4733317A2 (en) | 2014-07-15 | 2015-07-14 | Neutralizing anti-influenza b antibodies and uses thereof |
| BR112017000640A BR112017000640A2 (pt) | 2014-07-15 | 2015-07-14 | anticorpos neutralizantes do vírus influenza b e suas utilizações |
| US15/325,603 US10294292B2 (en) | 2014-07-15 | 2015-07-14 | Neutralizing anti-influenza B antibodies and uses thereof |
| RU2017104638A RU2711932C2 (ru) | 2014-07-15 | 2015-07-14 | Нейтрализующие антитела к вирусу гриппа B и пути их применения |
| EP15821645.7A EP3169407B1 (en) | 2014-07-15 | 2015-07-14 | Neutralizing anti-influenza b antibodies and uses thereof |
| CN202410982380.7A CN119161468A (zh) | 2014-07-15 | 2015-07-14 | 中和抗乙型流感抗体及其用途 |
| CN202110634430.9A CN113173990B (zh) | 2014-07-15 | 2015-07-14 | 中和抗乙型流感抗体及其用途 |
| MX2017000595A MX392761B (es) | 2014-07-15 | 2015-07-14 | Anticuerpos anti-influenza b neutralizantes y usos de los mismos. |
| CA2954780A CA2954780A1 (en) | 2014-07-15 | 2015-07-14 | Neutralizing anti-influenza b antibodies and uses thereof |
| AU2015289805A AU2015289805B2 (en) | 2014-07-15 | 2015-07-14 | Neutralizing anti-influenza B antibodies and uses thereof |
| JP2017523183A JP6837434B2 (ja) | 2014-07-15 | 2015-07-14 | 抗b型インフルエンザ抗体の中和及びその使用 |
| ES15821645T ES3066455T3 (en) | 2014-07-15 | 2015-07-14 | Neutralizing anti-influenza b antibodies and uses thereof |
| US16/361,653 US10519221B2 (en) | 2014-07-15 | 2019-03-22 | Neutralizing anti-influenza B antibodies and uses thereof |
| US16/676,974 US11174304B2 (en) | 2014-07-15 | 2019-11-07 | Neutralizing anti-influenza B antibodies and uses thereof |
| AU2020233635A AU2020233635B2 (en) | 2014-07-15 | 2020-09-15 | Neutralizing anti-influenza b antibodies and uses thereof |
| US17/499,495 US11787853B2 (en) | 2014-07-15 | 2021-10-12 | Neutralizing anti-influenza b antibodies and uses thereof |
| US18/463,736 US12325740B2 (en) | 2014-07-15 | 2023-09-08 | Neutralizing anti-influenza B antibodies and uses thereof |
| AU2024202231A AU2024202231A1 (en) | 2014-07-15 | 2024-04-08 | Neutralizing anti-influenza b antibodies and uses thereof |
| US19/202,812 US20250263470A1 (en) | 2014-07-15 | 2025-05-08 | Neutralizing anti-influenza b antibodies and uses thereof |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US201462024804P | 2014-07-15 | 2014-07-15 | |
| US62/024,804 | 2014-07-15 |
Related Child Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/325,603 A-371-Of-International US10294292B2 (en) | 2014-07-15 | 2015-07-14 | Neutralizing anti-influenza B antibodies and uses thereof |
| US16/361,653 Division US10519221B2 (en) | 2014-07-15 | 2019-03-22 | Neutralizing anti-influenza B antibodies and uses thereof |
Publications (3)
| Publication Number | Publication Date |
|---|---|
| WO2016011035A2 true WO2016011035A2 (en) | 2016-01-21 |
| WO2016011035A3 WO2016011035A3 (en) | 2016-03-10 |
| WO2016011035A8 WO2016011035A8 (en) | 2016-12-08 |
Family
ID=55079157
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2015/040385 Ceased WO2016011035A2 (en) | 2014-07-15 | 2015-07-14 | Neutralizing anti-influenza b antibodies and uses thereof |
Country Status (11)
| Country | Link |
|---|---|
| US (6) | US10294292B2 (enExample) |
| EP (2) | EP4733317A2 (enExample) |
| JP (4) | JP6837434B2 (enExample) |
| CN (4) | CN113173990B (enExample) |
| AU (3) | AU2015289805B2 (enExample) |
| BR (1) | BR112017000640A2 (enExample) |
| CA (1) | CA2954780A1 (enExample) |
| ES (1) | ES3066455T3 (enExample) |
| MX (3) | MX392761B (enExample) |
| RU (2) | RU2711932C2 (enExample) |
| WO (1) | WO2016011035A2 (enExample) |
Cited By (5)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2016196470A1 (en) * | 2015-06-01 | 2016-12-08 | Medimmune, Llc | Neutralizing anti-influenza binding molecules and uses thereof |
| US10494419B2 (en) | 2013-10-02 | 2019-12-03 | Medimmune, Llc | Neutralizing anti-influenza A antibodies and uses thereof |
| US10519221B2 (en) | 2014-07-15 | 2019-12-31 | Medimmune, Llc | Neutralizing anti-influenza B antibodies and uses thereof |
| WO2021086899A1 (en) * | 2019-10-28 | 2021-05-06 | Regeneron Pharmaceuticals, Inc. | Anti-hemagglutinin antibodies and methods of use thereof |
| US11547756B2 (en) | 2016-01-13 | 2023-01-10 | Medimmune, Llc | Method of treating influenza A |
Families Citing this family (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN112048006B (zh) * | 2020-09-08 | 2021-04-27 | 扬州大学 | 一种替代中和效力测定的elisa方法及其应用 |
| US20250320279A1 (en) * | 2021-11-30 | 2025-10-16 | Sab, Llc | Ungulate-derived polyclonal immunoglobulin specific for influenza virus and uses thereof |
| CN118420751B (zh) * | 2022-07-09 | 2025-04-08 | 东莞市朋志生物科技有限公司 | 抗乙型流感病毒抗体、检测乙型流感病毒的试剂和试剂盒 |
| WO2026055183A1 (en) | 2024-09-03 | 2026-03-12 | Vir Biotechnology, Inc | Antiviral compositions and methods of using the same |
Citations (20)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5885573A (en) | 1993-06-01 | 1999-03-23 | Arch Development Corporation | Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies |
| WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| WO2003074679A2 (en) | 2002-03-01 | 2003-09-12 | Xencor | Antibody optimization |
| WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
| US20040132101A1 (en) | 2002-09-27 | 2004-07-08 | Xencor | Optimized Fc variants and methods for their generation |
| US20060008883A1 (en) | 2003-12-04 | 2006-01-12 | Xencor, Inc. | Methods of generating variant proteins with increased host string content and compositions thereof |
| US20060134105A1 (en) | 2004-10-21 | 2006-06-22 | Xencor, Inc. | IgG immunoglobulin variants with optimized effector function |
| US7083784B2 (en) | 2000-12-12 | 2006-08-01 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| US7326681B2 (en) | 2000-06-28 | 2008-02-05 | Glycofi, Inc. | Methods for producing modified glycoproteins |
| US20080066200A1 (en) | 2006-01-17 | 2008-03-13 | Biolex, Inc. | Compositions and methods for humanization and optimization of n-glycans in plants |
| WO2008142124A1 (en) | 2007-05-21 | 2008-11-27 | Vivalis | Recombinant protein production in avian ebx® cells |
| WO2013007770A1 (en) | 2011-07-14 | 2013-01-17 | Crucell Holland B.V. | Human binding molecules capable of neutralizing influenza a viruses of phylogenetic group 1 and phylogenetic group 2 and influenza b viruses |
| WO2013011347A1 (en) | 2011-07-18 | 2013-01-24 | Institute For Research In Biomedicine | Neutralizing anti-influenza a virus antibodies and uses thereof |
| WO2013086052A2 (en) | 2011-12-05 | 2013-06-13 | Trellis Bioscience, Llc | Antibodies useful in passive influenza immunization |
| WO2013132007A1 (en) | 2012-03-08 | 2013-09-12 | Crucell Holland B.V. | Human binding molecules capable of binding to and neutralizing influenza b viruses and uses thereof |
Family Cites Families (174)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| NL154600B (nl) | 1971-02-10 | 1977-09-15 | Organon Nv | Werkwijze voor het aantonen en bepalen van specifiek bindende eiwitten en hun corresponderende bindbare stoffen. |
| US3817837A (en) | 1971-05-14 | 1974-06-18 | Syva Corp | Enzyme amplification assay |
| US3766162A (en) | 1971-08-24 | 1973-10-16 | Hoffmann La Roche | Barbituric acid antigens and antibodies specific therefor |
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4233402A (en) | 1978-04-05 | 1980-11-11 | Syva Company | Reagents and method employing channeling |
| JPS6033479B2 (ja) | 1980-07-30 | 1985-08-02 | 協和醗酵工業株式会社 | 過酸化水素の定量方法 |
| US4520110A (en) | 1981-10-06 | 1985-05-28 | The Board Of Trustees Of The Leland Stanford Junior University | Fluorescent immunoassay employing a phycobiliprotein labeled ligand or receptor |
| US5055556A (en) | 1981-10-06 | 1991-10-08 | The Board Of Trustees Of The Leland Stanford Jr. Univ. | Fluorescent conjugates for analysis of molecules and cells |
| US4859582A (en) | 1981-10-06 | 1989-08-22 | The Board Of Trustees Of The Leland Stanford Jr. University | Fluorescent conjugates for analysis of molecules and cells |
| JPS5896026A (ja) | 1981-10-30 | 1983-06-07 | Nippon Chemiphar Co Ltd | 新規ウロキナ−ゼ誘導体およびその製造法ならびにそれを含有する血栓溶解剤 |
| US4609546A (en) | 1982-06-24 | 1986-09-02 | Japan Chemical Research Co., Ltd. | Long-acting composition |
| US4542104A (en) | 1983-04-06 | 1985-09-17 | The Board Of Trustees Of The Leland Stanford Jr. Univ. | Phycobiliprotein fluorescent conjugates |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| US5807715A (en) | 1984-08-27 | 1998-09-15 | The Board Of Trustees Of The Leland Stanford Junior University | Methods and transformed mammalian lymphocyte cells for producing functional antigen-binding protein including chimeric immunoglobulin |
| US4603209A (en) | 1984-09-07 | 1986-07-29 | The Regents Of The University Of California | Fluorescent indicator dyes for calcium ions |
| US5981216A (en) | 1985-04-01 | 1999-11-09 | Alusuisse Holdings A.G. | Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| US4714763A (en) | 1985-07-11 | 1987-12-22 | Viomedics Inc. | Novel oxazine-ureas and thiazine urea chromophors as fluorescent labels |
| US4676980A (en) | 1985-09-23 | 1987-06-30 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Target specific cross-linked heteroantibodies |
| GB8601597D0 (en) | 1986-01-23 | 1986-02-26 | Wilson R H | Nucleotide sequences |
| US4812409A (en) | 1986-01-31 | 1989-03-14 | Eastman Kodak Company | Hydrolyzable fluorescent substrates and analytical determinations using same |
| US6548640B1 (en) | 1986-03-27 | 2003-04-15 | Btg International Limited | Altered antibodies |
| US5268486A (en) | 1986-04-18 | 1993-12-07 | Carnegie-Mellon Unversity | Method for labeling and detecting materials employing arylsulfonate cyanine dyes |
| US5569587A (en) | 1986-04-18 | 1996-10-29 | Carnegie Mellon University | Method for labeling and detecting materials employing luminescent arysulfonate cyanine dyes |
| US5627027A (en) | 1986-04-18 | 1997-05-06 | Carnegie Mellon University | Cyanine dyes as labeling reagents for detection of biological and other materials by luminescence methods |
| US4946778A (en) | 1987-09-21 | 1990-08-07 | Genex Corporation | Single polypeptide chain binding molecules |
| US5567610A (en) | 1986-09-04 | 1996-10-22 | Bioinvent International Ab | Method of producing human monoclonal antibodies and kit therefor |
| US4831175A (en) | 1986-09-05 | 1989-05-16 | The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Backbone polysubstituted chelates for forming a metal chelate-protein conjugate |
| US4810636A (en) | 1986-12-09 | 1989-03-07 | Miles Inc. | Chromogenic acridinone enzyme substrates |
| IL85035A0 (en) | 1987-01-08 | 1988-06-30 | Int Genetic Eng | Polynucleotide molecule,a chimeric antibody with specificity for human b cell surface antigen,a process for the preparation and methods utilizing the same |
| US5258498A (en) | 1987-05-21 | 1993-11-02 | Creative Biomolecules, Inc. | Polypeptide linkers for production of biosynthetic proteins |
| GB8717430D0 (en) | 1987-07-23 | 1987-08-26 | Celltech Ltd | Recombinant dna product |
| US4774339A (en) | 1987-08-10 | 1988-09-27 | Molecular Probes, Inc. | Chemically reactive dipyrrometheneboron difluoride dyes |
| US4945171A (en) | 1987-08-10 | 1990-07-31 | Molecular Probes, Inc. | Xanthene dyes having a fused (C) benzo ring |
| US5677425A (en) | 1987-09-04 | 1997-10-14 | Celltech Therapeutics Limited | Recombinant antibody |
| US4849362A (en) | 1988-05-19 | 1989-07-18 | Smithkline Beckman Corporation | Fluorescent intracellular calcium indicators |
| ES2052027T5 (es) | 1988-11-11 | 2005-04-16 | Medical Research Council | Clonacion de secuencias de dominio variable de inmunoglobulina. |
| US5196306A (en) | 1989-03-29 | 1993-03-23 | E. I. Du Pont De Nemours And Company | Method for the detection or quantitation of an analyte using an analyte dependent enzyme activation system |
| US6291158B1 (en) | 1989-05-16 | 2001-09-18 | Scripps Research Institute | Method for tapping the immunological repertoire |
| US6680192B1 (en) | 1989-05-16 | 2004-01-20 | Scripps Research Institute | Method for producing polymers having a preselected activity |
| US6291161B1 (en) | 1989-05-16 | 2001-09-18 | Scripps Research Institute | Method for tapping the immunological repertiore |
| US6291159B1 (en) | 1989-05-16 | 2001-09-18 | Scripps Research Institute | Method for producing polymers having a preselected activity |
| US6291160B1 (en) | 1989-05-16 | 2001-09-18 | Scripps Research Institute | Method for producing polymers having a preselected activity |
| US4981977A (en) | 1989-06-09 | 1991-01-01 | Carnegie-Mellon University | Intermediate for and fluorescent cyanine dyes containing carboxylic acid groups |
| US5132432A (en) | 1989-09-22 | 1992-07-21 | Molecular Probes, Inc. | Chemically reactive pyrenyloxy sulfonic acid dyes |
| US5459276A (en) | 1994-05-20 | 1995-10-17 | Molecular Probes, Inc. | Benzazolylcoumarin-based ion indicators for heavy metals |
| US5501980A (en) | 1994-05-20 | 1996-03-26 | Molecular Probes, Inc. | Benzazolylcoumarin-based ion indicators |
| US5227487A (en) | 1990-04-16 | 1993-07-13 | Molecular Probes, Inc. | Certain tricyclic and pentacyclic-hetero nitrogen rhodol dyes |
| US5433896A (en) | 1994-05-20 | 1995-07-18 | Molecular Probes, Inc. | Dibenzopyrrometheneboron difluoride dyes |
| US5274113A (en) | 1991-11-01 | 1993-12-28 | Molecular Probes, Inc. | Long wavelength chemically reactive dipyrrometheneboron difluoride dyes and conjugates |
| US5229275A (en) | 1990-04-26 | 1993-07-20 | Akzo N.V. | In-vitro method for producing antigen-specific human monoclonal antibodies |
| US6172197B1 (en) | 1991-07-10 | 2001-01-09 | Medical Research Council | Methods for producing members of specific binding pairs |
| GB9015198D0 (en) | 1990-07-10 | 1990-08-29 | Brien Caroline J O | Binding substance |
| US6916605B1 (en) | 1990-07-10 | 2005-07-12 | Medical Research Council | Methods for producing members of specific binding pairs |
| US5208148A (en) | 1990-12-07 | 1993-05-04 | Molecular Probes, Inc. | Lipophilic fluorescent glycosidase substrates |
| US5248782A (en) | 1990-12-18 | 1993-09-28 | Molecular Probes, Inc. | Long wavelength heteroaryl-substituted dipyrrometheneboron difluoride dyes |
| US5451343A (en) | 1991-05-20 | 1995-09-19 | Spectra Group Limited, Inc. | Fluorone and pyronin y derivatives |
| US5187288A (en) | 1991-05-22 | 1993-02-16 | Molecular Probes, Inc. | Ethenyl-substituted dipyrrometheneboron difluoride dyes and their synthesis |
| WO1992022324A1 (en) | 1991-06-14 | 1992-12-23 | Xoma Corporation | Microbially-produced antibody fragments and their conjugates |
| US5576424A (en) | 1991-08-23 | 1996-11-19 | Molecular Probes, Inc. | Haloalkyl derivatives of reporter molecules used to analyze metabolic activity in cells |
| EP0603266B1 (en) | 1991-08-23 | 1999-05-12 | Molecular Probes, Inc. | Use of haloalkyl derivatives of reporter molecules to analyze metabolic activity in cells |
| US5242805A (en) | 1991-08-23 | 1993-09-07 | Molecular Probes, Inc. | Long wavelength lipophilic fluorogenic glycosidase substrates |
| US5316906A (en) | 1991-08-23 | 1994-05-31 | Molecular Probes, Inc. | Enzymatic analysis using substrates that yield fluorescent precipitates |
| US5565332A (en) | 1991-09-23 | 1996-10-15 | Medical Research Council | Production of chimeric antibodies - a combinatorial approach |
| PT1696031E (pt) | 1991-12-02 | 2010-06-25 | Medical Res Council | Produção de auto-anticorpos a partir de reportórios de segmentos de anticorpo e exibidos em fagos |
| US5714350A (en) | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| US5573905A (en) | 1992-03-30 | 1996-11-12 | The Scripps Research Institute | Encoded combinatorial chemical libraries |
| CA2118508A1 (en) | 1992-04-24 | 1993-11-11 | Elizabeth S. Ward | Recombinant production of immunoglobulin-like domains in prokaryotic cells |
| US5808044A (en) | 1993-01-22 | 1998-09-15 | Pharmacia Biotech Inc. | Indocarbocyanine and benzindocarbocyanine phosphoramidites |
| JPH08511420A (ja) | 1993-06-16 | 1996-12-03 | セルテック・セラピューテイクス・リミテッド | 抗 体 |
| US6180377B1 (en) | 1993-06-16 | 2001-01-30 | Celltech Therapeutics Limited | Humanized antibodies |
| US5595721A (en) | 1993-09-16 | 1997-01-21 | Coulter Pharmaceutical, Inc. | Radioimmunotherapy of lymphoma using anti-CD20 |
| US5641870A (en) | 1995-04-20 | 1997-06-24 | Genentech, Inc. | Low pH hydrophobic interaction chromatography for antibody purification |
| US6121022A (en) | 1995-04-14 | 2000-09-19 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US5739277A (en) | 1995-04-14 | 1998-04-14 | Genentech Inc. | Altered polypeptides with increased half-life |
| US5869046A (en) | 1995-04-14 | 1999-02-09 | Genentech, Inc. | Altered polypeptides with increased half-life |
| US6127134A (en) | 1995-04-20 | 2000-10-03 | Carnegie Mellon University | Difference gel electrophoresis using matched multiple dyes |
| US5798276A (en) | 1995-06-07 | 1998-08-25 | Molecular Probes, Inc. | Reactive derivatives of sulforhodamine 101 with enhanced hydrolytic stability |
| US6008373A (en) | 1995-06-07 | 1999-12-28 | Carnegie Mellon University | Fluorescent labeling complexes with large stokes shift formed by coupling together cyanine and other fluorochromes capable of resonance energy transfer |
| ATE219517T1 (de) | 1995-08-18 | 2002-07-15 | Morphosys Ag | Protein-/(poly)peptidbibliotheken |
| SE9504046D0 (sv) | 1995-11-14 | 1995-11-14 | Pharmacia Ab | Method of determining affinity and kinetic properties |
| US6004536A (en) | 1995-11-14 | 1999-12-21 | Molecular Probes, Inc. | Lipophilic cyanine dyes with enchanced aqueous solubilty |
| US6162931A (en) | 1996-04-12 | 2000-12-19 | Molecular Probes, Inc. | Fluorinated xanthene derivatives |
| EP0898596B1 (en) | 1996-04-19 | 2001-08-29 | Amersham Pharmacia Biotech UK Limited | Squarate dyes and their use in fluorescent sequencing method |
| JP2000503773A (ja) | 1996-05-23 | 2000-03-28 | ユニリーバー・ナームローゼ・ベンノートシヤープ | 特異的結合アッセイの改良 |
| US5846737A (en) | 1996-07-26 | 1998-12-08 | Molecular Probes, Inc. | Conjugates of sulforhodamine fluorophores with enhanced fluorescence |
| US5830912A (en) | 1996-11-15 | 1998-11-03 | Molecular Probes, Inc. | Derivatives of 6,8-difluoro-7-hydroxycoumarin |
| US5696157A (en) | 1996-11-15 | 1997-12-09 | Molecular Probes, Inc. | Sulfonated derivatives of 7-aminocoumarin |
| US6071251A (en) | 1996-12-06 | 2000-06-06 | Abbott Laboratories | Method and apparatus for obtaining blood for diagnostic tests |
| US5773236A (en) | 1997-04-25 | 1998-06-30 | Molecule Probes, Inc. | Assay for glutathiane transferase using polyhaloaryl-substituted reporter molecules |
| US5877310A (en) | 1997-04-25 | 1999-03-02 | Carnegie Mellon University | Glycoconjugated fluorescent labeling reagents |
| US6300104B1 (en) | 1997-06-19 | 2001-10-09 | The Regents Of The University Of California | Secretory immunoglobulin produced by single cells and methods for making and using same |
| US6130101A (en) | 1997-09-23 | 2000-10-10 | Molecular Probes, Inc. | Sulfonated xanthene derivatives |
| GB9722131D0 (en) | 1997-10-20 | 1997-12-17 | Medical Res Council | Method |
| US6133445A (en) | 1997-12-17 | 2000-10-17 | Carnegie Mellon University | Rigidized trimethine cyanine dyes |
| US6528624B1 (en) | 1998-04-02 | 2003-03-04 | Genentech, Inc. | Polypeptide variants |
| WO1999051702A1 (en) | 1998-04-08 | 1999-10-14 | Terpetschnig Ewald A | Luminescent compounds |
| US6002003A (en) | 1998-04-14 | 1999-12-14 | Beckman Instruments, Inc. | Cyanine dye activating group with improved coupling selectivity |
| AU3657899A (en) | 1998-04-20 | 1999-11-08 | James E. Bailey | Glycosylation engineering of antibodies for improving antibody-dependent cellular cytotoxicity |
| DE69938054T2 (de) | 1998-11-18 | 2009-02-12 | Genentech, Inc., South San Francisco | Antikörpervarianten mit höheren bindungsaffinitäten im vergleich zu parentalen antikörpern |
| JP3983404B2 (ja) | 1999-01-13 | 2007-09-26 | 本田技研工業株式会社 | レーダ搭載車両用ゲート |
| US7183387B1 (en) | 1999-01-15 | 2007-02-27 | Genentech, Inc. | Polypeptide variants with altered effector function |
| US6737056B1 (en) | 1999-01-15 | 2004-05-18 | Genentech, Inc. | Polypeptide variants with altered effector function |
| KR100940380B1 (ko) | 1999-01-15 | 2010-02-02 | 제넨테크, 인크. | 효과기 기능이 변화된 폴리펩티드 변이체 |
| US20020102208A1 (en) | 1999-03-01 | 2002-08-01 | Paul Chinn | Radiolabeling kit and binding assay |
| MY133346A (en) | 1999-03-01 | 2007-11-30 | Biogen Inc | Kit for radiolabeling ligands with yttrium-90 |
| EP1167382A1 (en) * | 1999-03-31 | 2002-01-02 | Otsuka Pharmaceutical Co., Ltd. | Influenza virus hemagglutinin-binding peptides |
| PT1176195E (pt) | 1999-04-09 | 2013-07-18 | Kyowa Hakko Kirin Co Ltd | Processo para controlar a actividade de uma molécula funcional sob o ponto de vista imunológico |
| ATE435262T1 (de) | 1999-07-02 | 2009-07-15 | Visen Medical Inc | Fluoreszierende cyaninlabels mit einem sulphamidobrückenglied |
| WO2001021624A1 (en) | 1999-09-20 | 2001-03-29 | Fuji Photo Film Co., Ltd. | Compounds for fluorescence labeling |
| US6849425B1 (en) | 1999-10-14 | 2005-02-01 | Ixsys, Inc. | Methods of optimizing antibody variable region binding affinity |
| CA2388245C (en) | 1999-10-19 | 2012-01-10 | Kyowa Kirin Co., Ltd. | The use of serum-free adapted rat cells for producing heterologous polypeptides |
| JP5179689B2 (ja) | 2000-02-11 | 2013-04-10 | メルク パテント ゲゼルシャフト ミット ベシュレンクテル ハフツング | 抗体ベース融合タンパク質の循環系内半減期の増強 |
| AU2001234125A1 (en) | 2000-02-22 | 2001-09-03 | Medical And Biological Laboratories Co., Ltd. | Antibody library |
| ATE352586T2 (de) | 2000-09-29 | 2007-02-15 | Molecular Probes Inc | Modifizierte carbocyaninfarbstoffe und deren konjugate |
| US6946292B2 (en) | 2000-10-06 | 2005-09-20 | Kyowa Hakko Kogyo Co., Ltd. | Cells producing antibody compositions with increased antibody dependent cytotoxic activity |
| US7064191B2 (en) | 2000-10-06 | 2006-06-20 | Kyowa Hakko Kogyo Co., Ltd. | Process for purifying antibody |
| AU2002307037B2 (en) | 2001-04-02 | 2008-08-07 | Biogen Idec Inc. | Recombinant antibodies coexpressed with GnTIII |
| AU2002319402B2 (en) | 2001-06-28 | 2008-09-11 | Domantis Limited | Dual-specific ligand and its use |
| KR100988949B1 (ko) | 2001-10-25 | 2010-10-20 | 제넨테크, 인크. | 당단백질 조성물 |
| US20040002587A1 (en) | 2002-02-20 | 2004-01-01 | Watkins Jeffry D. | Fc region variants |
| US8188231B2 (en) | 2002-09-27 | 2012-05-29 | Xencor, Inc. | Optimized FC variants |
| EP1551875A4 (en) | 2002-06-21 | 2006-06-28 | Biogen Idec Inc | TAMPON PREPARATIONS FOR CONCENTRATING ANTIBODIES AND METHODS FOR USE THEREOF |
| EP1600459A3 (en) | 2002-06-28 | 2005-12-07 | Domantis Limited | Ligand |
| US7175999B2 (en) | 2002-07-11 | 2007-02-13 | The General Hospital Corporation | Polynucleotide and polypeptide fat metabolism regulators and uses thereof |
| US20060235208A1 (en) | 2002-09-27 | 2006-10-19 | Xencor, Inc. | Fc variants with optimized properties |
| US7217797B2 (en) | 2002-10-15 | 2007-05-15 | Pdl Biopharma, Inc. | Alteration of FcRn binding affinities or serum half-lives of antibodies by mutagenesis |
| JP2006523090A (ja) | 2002-12-27 | 2006-10-12 | ドマンティス リミテッド | リガンドに、そしてリガンド受容体に特異的な二重特異性単一ドメイン抗体 |
| EP2368578A1 (en) | 2003-01-09 | 2011-09-28 | Macrogenics, Inc. | Identification and engineering of antibodies with variant Fc regions and methods of using same |
| SI1639011T1 (sl) | 2003-06-30 | 2009-04-30 | Domantis Ltd | Pegilirana protitelesa z enojno domeno (dAb) |
| JP4595810B2 (ja) | 2003-07-23 | 2010-12-08 | 富士レビオ株式会社 | 抗インフルエンザa型ウイルスモノクローナル抗体及び該抗体を用いる免疫測定器具 |
| KR101280094B1 (ko) | 2003-08-11 | 2013-06-28 | 사이단호진한다이비세이부쯔뵤우겐큐우카이 | 점막 면역을 유도할 수 있는 보강제를 함유한 신규한 백신 |
| US20050226867A1 (en) | 2003-10-08 | 2005-10-13 | Kyowa Hakko Kogyo Co., Ltd. | IL-5R-specific antibody composition |
| GB0324368D0 (en) | 2003-10-17 | 2003-11-19 | Univ Cambridge Tech | Polypeptides including modified constant regions |
| PT1692182E (pt) | 2003-11-05 | 2010-05-13 | Roche Glycart Ag | Anticorpos de cd20 com uma afinidade de ligação acrescida ao receptor fc e uma função efectora acrescida |
| EP1706424B1 (en) | 2004-01-12 | 2009-07-22 | Applied Molecular Evolution, Inc. | Fc region variants |
| WO2005092925A2 (en) | 2004-03-24 | 2005-10-06 | Xencor, Inc. | Immunoglobulin variants outside the fc region |
| PL2921500T3 (pl) | 2004-07-10 | 2024-02-05 | The Institute For Cancer Research | Genetycznie zmodyfikowane ludzkie linie komórkowe naturalni zabójcy |
| EA012464B1 (ru) | 2004-08-04 | 2009-10-30 | Эпплайд Молекьюлар Эволюшн, Инк. | Антитело против cd20 и его применение |
| US8802820B2 (en) | 2004-11-12 | 2014-08-12 | Xencor, Inc. | Fc variants with altered binding to FcRn |
| BRPI0517837A (pt) | 2004-11-12 | 2008-10-21 | Xencor Inc | variantes fc com ligação alterada a fcrn |
| US20070135620A1 (en) | 2004-11-12 | 2007-06-14 | Xencor, Inc. | Fc variants with altered binding to FcRn |
| WO2006124269A2 (en) | 2005-05-16 | 2006-11-23 | Amgen Fremont Inc. | Human monoclonal antibodies that bind to very late antigen-1 for the treatment of inflammation and other disorders |
| WO2007005786A2 (en) | 2005-06-30 | 2007-01-11 | Centocor, Inc. | Methods and compositions with enhanced therapeutic activity |
| US7910708B2 (en) | 2005-10-21 | 2011-03-22 | Novartis Ag | Anti-IL13 human antibodies |
| EP2455100A3 (en) | 2005-11-07 | 2012-11-07 | The Rockefeller University | Reagents, methods and systems for selecting a cytotoxic antibody or variant thereof |
| WO2007109742A2 (en) | 2006-03-21 | 2007-09-27 | Weaver David T | Methods for humanizing antibodies and humanized antibodies made thereby |
| US7615220B2 (en) | 2006-04-07 | 2009-11-10 | Regeneron Pharmaceuticals, Inc. | High affinity human antibodies to human IL-18 receptor |
| JP2009537147A (ja) | 2006-05-15 | 2009-10-29 | シー レーン バイオテクノロジーズ, エルエルシー | インフルエンザウイルスに対する中和抗体 |
| EP2059532B1 (en) | 2006-09-07 | 2012-12-26 | Crucell Holland B.V. | Human binding molecules capable of neutralizing influenza virus h5n1 and uses thereof |
| LT2769992T (lt) | 2006-10-02 | 2021-04-12 | Regeneron Pharmaceuticals, Inc. | Didelio afiniškumo žmogaus antikūnai, atpažįstantys žmogaus il-4 receptorių |
| AU2007325872B2 (en) | 2006-11-08 | 2012-12-13 | Macrogenics West, Inc. | TES7 and antibodies that bind thereto |
| RU2448979C2 (ru) | 2006-12-14 | 2012-04-27 | Ридженерон Фармасьютикалз, Инк. | Антитела человека к дельта-подобному лиганду-4 человека |
| GB0700133D0 (en) | 2007-01-04 | 2007-02-14 | Humabs Llc | Human cytomegalovirus neutralising antibodies and use thereof |
| JP5346820B2 (ja) | 2007-03-13 | 2013-11-20 | エイチユーエムエイビーエス・リミテッド・ライアビリティ・カンパニー | H5n1亜型a型インフルエンザウィルスに対する抗体 |
| ITTO20080204A1 (it) | 2008-03-17 | 2009-09-18 | Pomona Biotechnologies Llc | Anticorpi monoclonali atti a reagire con una pluralita di sottotipi del virus influenzale a |
| ITTO20080398A1 (it) | 2008-05-27 | 2009-11-28 | Pomona Biotechnologies Llc | Anticorpi monoclonali aventi proprieta' di cross-neutralizzazione omosubtipica per virus influenzali di tipo a sottotipo h1 |
| US8871207B2 (en) | 2008-07-25 | 2014-10-28 | Humabs, LLC | Neutralizing anti-influenza A virus antibodies and uses thereof |
| CA2733218A1 (en) | 2008-07-25 | 2010-01-28 | Institute For Research In Biomedicine | Neutralizing anti-influenza a virus antibodies and uses thereof |
| US20120128684A1 (en) | 2008-08-25 | 2012-05-24 | Burnham Institute For Medical Research | Conserved Hemagglutinin Epitope, Antibodies to the Epitope and Methods of Use |
| WO2010054007A1 (en) | 2008-11-07 | 2010-05-14 | Fabrus Llc | Combinatorial antibody libraries and uses thereof |
| US9534042B2 (en) * | 2010-09-03 | 2017-01-03 | Fujita Health University | Influenza virus-neutralizing antibody and screening method therefor |
| EP2652496B1 (en) | 2010-12-13 | 2018-01-17 | The University of Utah Research Foundation | Vaccine antigens that direct immunity to conserved epitopes |
| HK1200102A1 (en) | 2011-09-20 | 2015-07-31 | 西奈山医学院 | Influenza virus vaccines and uses thereof |
| WO2013044203A2 (en) | 2011-09-23 | 2013-03-28 | THE UNITED STATES OF AMERICA, as represented by THE SECRETARY, DEPTARTMENT OF HEALTH & HUMAN SERVICES | Novel influenza hemagglutinin protein-based vaccines |
| ES2749349T3 (es) | 2011-11-07 | 2020-03-19 | Medimmune Llc | Proteínas de unión multiespecíficas y multivalentes y usos de las mismas |
| JP6386465B2 (ja) * | 2012-11-13 | 2018-09-05 | ジェネンテック, インコーポレイテッド | 抗ヘマグルチニン抗体及び使用方法 |
| KR20140118682A (ko) | 2013-03-29 | 2014-10-08 | (주)셀트리온 | 2 이상의 인플루엔자 a 바이러스 중화 결합 분자를 포함하는 조성물 |
| RU2536956C1 (ru) | 2013-08-05 | 2014-12-27 | Федеральное государственное бюджетное учреждение "Научно-исследовательский институт пульмонологии Федерального медико-биологического агентства" | Противовирусное однодоменное мини-антитело, нуклеотидная последовательность, экспрессирующий рекомбинантный вирусный вектор, фармацевтическая композиция и способ профилактики или терапии гриппа типа а |
| PT3052192T (pt) | 2013-10-02 | 2020-09-24 | Medimmune Llc | Anticorpos neutralizantes anti-influenza a e suas utilizações |
| CA2954780A1 (en) * | 2014-07-15 | 2016-01-21 | Medimmune, Llc | Neutralizing anti-influenza b antibodies and uses thereof |
| EP3960761A1 (en) | 2015-06-01 | 2022-03-02 | MedImmune, LLC | Neutralizing anti-influenza binding molecules and uses thereof |
| IL304940A (en) | 2016-01-13 | 2023-10-01 | Medimmune Llc | A method for treating type A influenza |
| EP3419663A1 (en) | 2016-02-24 | 2019-01-02 | Visterra, Inc. | Formulations of antibody molecules to influenza virus |
-
2015
- 2015-07-14 CA CA2954780A patent/CA2954780A1/en active Pending
- 2015-07-14 MX MX2017000595A patent/MX392761B/es unknown
- 2015-07-14 EP EP26150174.6A patent/EP4733317A2/en active Pending
- 2015-07-14 BR BR112017000640A patent/BR112017000640A2/pt not_active Application Discontinuation
- 2015-07-14 AU AU2015289805A patent/AU2015289805B2/en active Active
- 2015-07-14 ES ES15821645T patent/ES3066455T3/es active Active
- 2015-07-14 CN CN202110634430.9A patent/CN113173990B/zh active Active
- 2015-07-14 CN CN201580038244.1A patent/CN106573154B/zh active Active
- 2015-07-14 CN CN202110634379.1A patent/CN113563462B/zh active Active
- 2015-07-14 US US15/325,603 patent/US10294292B2/en active Active
- 2015-07-14 JP JP2017523183A patent/JP6837434B2/ja active Active
- 2015-07-14 RU RU2017104638A patent/RU2711932C2/ru active
- 2015-07-14 RU RU2020100073A patent/RU2739952C2/ru active
- 2015-07-14 WO PCT/US2015/040385 patent/WO2016011035A2/en not_active Ceased
- 2015-07-14 EP EP15821645.7A patent/EP3169407B1/en active Active
- 2015-07-14 CN CN202410982380.7A patent/CN119161468A/zh active Pending
-
2017
- 2017-01-13 MX MX2022006558A patent/MX2022006558A/es unknown
- 2017-01-13 MX MX2022006561A patent/MX2022006561A/es unknown
-
2019
- 2019-03-22 US US16/361,653 patent/US10519221B2/en active Active
- 2019-11-07 US US16/676,974 patent/US11174304B2/en active Active
-
2020
- 2020-09-15 AU AU2020233635A patent/AU2020233635B2/en active Active
-
2021
- 2021-02-09 JP JP2021018692A patent/JP7209754B2/ja active Active
- 2021-10-12 US US17/499,495 patent/US11787853B2/en active Active
-
2023
- 2023-01-10 JP JP2023001445A patent/JP7453430B2/ja active Active
- 2023-09-08 US US18/463,736 patent/US12325740B2/en active Active
-
2024
- 2024-03-07 JP JP2024034654A patent/JP2024069341A/ja active Pending
- 2024-04-08 AU AU2024202231A patent/AU2024202231A1/en active Pending
-
2025
- 2025-05-08 US US19/202,812 patent/US20250263470A1/en active Pending
Patent Citations (23)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US5225539A (en) | 1986-03-27 | 1993-07-06 | Medical Research Council | Recombinant altered antibodies and methods of making altered antibodies |
| US5624821A (en) | 1987-03-18 | 1997-04-29 | Scotgen Biopharmaceuticals Incorporated | Antibodies with altered effector functions |
| US5648260A (en) | 1987-03-18 | 1997-07-15 | Scotgen Biopharmaceuticals Incorporated | DNA encoding antibodies with altered effector functions |
| US5885573A (en) | 1993-06-01 | 1999-03-23 | Arch Development Corporation | Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies |
| US6277375B1 (en) | 1997-03-03 | 2001-08-21 | Board Of Regents, The University Of Texas System | Immunoglobulin-like domains with increased half-lives |
| US6194551B1 (en) | 1998-04-02 | 2001-02-27 | Genentech, Inc. | Polypeptide variants |
| US6538124B1 (en) | 1998-04-02 | 2003-03-25 | Genentech, Inc. | Polypeptide variants |
| WO1999058572A1 (en) | 1998-05-08 | 1999-11-18 | Cambridge University Technical Services Limited | Binding molecules derived from immunoglobulins which do not trigger complement mediated lysis |
| US7326681B2 (en) | 2000-06-28 | 2008-02-05 | Glycofi, Inc. | Methods for producing modified glycoproteins |
| US7083784B2 (en) | 2000-12-12 | 2006-08-01 | Medimmune, Inc. | Molecules with extended half-lives, compositions and uses thereof |
| US7317091B2 (en) | 2002-03-01 | 2008-01-08 | Xencor, Inc. | Optimized Fc variants |
| WO2003074679A2 (en) | 2002-03-01 | 2003-09-12 | Xencor | Antibody optimization |
| US20040132101A1 (en) | 2002-09-27 | 2004-07-08 | Xencor | Optimized Fc variants and methods for their generation |
| WO2004029207A2 (en) | 2002-09-27 | 2004-04-08 | Xencor Inc. | Optimized fc variants and methods for their generation |
| WO2004099249A2 (en) | 2003-05-02 | 2004-11-18 | Xencor, Inc. | Optimized fc variants and methods for their generation |
| US20060008883A1 (en) | 2003-12-04 | 2006-01-12 | Xencor, Inc. | Methods of generating variant proteins with increased host string content and compositions thereof |
| US20060134105A1 (en) | 2004-10-21 | 2006-06-22 | Xencor, Inc. | IgG immunoglobulin variants with optimized effector function |
| US20080066200A1 (en) | 2006-01-17 | 2008-03-13 | Biolex, Inc. | Compositions and methods for humanization and optimization of n-glycans in plants |
| WO2008142124A1 (en) | 2007-05-21 | 2008-11-27 | Vivalis | Recombinant protein production in avian ebx® cells |
| WO2013007770A1 (en) | 2011-07-14 | 2013-01-17 | Crucell Holland B.V. | Human binding molecules capable of neutralizing influenza a viruses of phylogenetic group 1 and phylogenetic group 2 and influenza b viruses |
| WO2013011347A1 (en) | 2011-07-18 | 2013-01-24 | Institute For Research In Biomedicine | Neutralizing anti-influenza a virus antibodies and uses thereof |
| WO2013086052A2 (en) | 2011-12-05 | 2013-06-13 | Trellis Bioscience, Llc | Antibodies useful in passive influenza immunization |
| WO2013132007A1 (en) | 2012-03-08 | 2013-09-12 | Crucell Holland B.V. | Human binding molecules capable of binding to and neutralizing influenza b viruses and uses thereof |
Non-Patent Citations (28)
| Title |
|---|
| "Current Protocols in Molecular Biology", vol. 1, 1998, GREEN PUBLISHING ASSOCIATES, INC. AND JOHN WILEY AND SONS, INC., pages: 6.3.1 - 6.3.6,2.10.3 |
| "Oxford Dictionary Of Biochemistry And Molecular Biology", 2000, OXFORD UNIVERSITY PRESS |
| "The Dictionary of Cell and Molecular Biology", 1999, ACADEMIC PRESS |
| AMIT ET AL., SCIENCE, vol. 233, 1986, pages 747 - 753 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| CHOTHIA ET AL., J. MOL. BIOL., vol. 196, 1987, pages 901 - 917 |
| CUNNINGHAMWELLS, SCIENCE, vol. 244, 1989, pages 1081 - 1085 |
| DREYFUS ET AL., SCIENCE, vol. 337, no. 6100, 14 September 2012 (2012-09-14), pages 1343 - 1348 |
| HAMMERLING ET AL.: "Monoclonal Antibodies and T-Cell Hybridomas", 1981, ELSEVIER, pages: 563 - 681 |
| HARLOW ET AL.: "Antibodies: A Laboratory Manual", 1988, COLD SPRING HARBOR LABORATORY PRESS |
| HAWKINS ET AL., J. MOL. BIOL., vol. 254, 1992, pages 889 - 896 |
| HUSTON ET AL., PROC. NATL. ACAD. SCI. USA, vol. 85, 1988, pages 5879 - 5883 |
| JUO, PEI-SHOW: "the Concise Dictionary of Biomedicine and Molecular Biology", 2002, CRC PRESS |
| KOHLER ET AL., NATURE, vol. 256, 1975, pages 495 |
| KUTMEIER ET AL., BIOTECHNIQUES, vol. 17, 1994, pages 242 |
| LEFRANC ET AL., DEV COMP IMMUNOL., vol. 27, no. 1, 2003, pages 55 - 77 |
| LOWMAN ET AL., BIOCHEMISTRY, vol. 30, no. 45, 1991, pages 10832 - 10837 |
| MOORE ET AL., CYTOTECHNOLOGY, vol. 17, 1995, pages 1 - 11 |
| NEDDLEMANWUNSCH, J. MOL. BIOL., vol. 48, 1970, pages 443 |
| PEARSONLIPMAN, PROC. NATL ACAD. SCI. USA, vol. 85, 1988, pages 2444 |
| SAMBROOK ET AL.: "Molecular Cloning, A Laboratory Manual", 1990, COLD SPRING HARBOR LABORATORY |
| SMITHWATERMAN, ADS APP. MATH., vol. 2, 1981, pages 482 |
| THOMPSON ET AL., JAMA, vol. 292, 2004, pages 1333 - 1340 |
| WANG ET AL., J. VIROL., vol. 82, no. 6, 2008, pages 3011 - 20 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WILSON ET AL., NATURE, vol. 289, 1981, pages 366 - 373 |
| ZAPATA ET AL., PROTEIN ENG., vol. 8, no. 10, 1995, pages 1057 - 1062 |
| ZHOU ET AL., CLIN INFECT. DIS., vol. 54, 2012, pages 1427 - 1436 |
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US12492240B2 (en) | 2013-10-02 | 2025-12-09 | Medimmune, Llc | Neutralizing anti-influenza A antibodies and uses thereof |
| US10494419B2 (en) | 2013-10-02 | 2019-12-03 | Medimmune, Llc | Neutralizing anti-influenza A antibodies and uses thereof |
| US11932682B2 (en) | 2013-10-02 | 2024-03-19 | Medimmune, Llc | Neutralizing anti-influenza A antibodies and uses thereof |
| US11186627B2 (en) | 2013-10-02 | 2021-11-30 | Medimmune, Llc | Neutralizing anti-influenza A antibodies and uses thereof |
| US11787853B2 (en) | 2014-07-15 | 2023-10-17 | Medimmune, Llc | Neutralizing anti-influenza b antibodies and uses thereof |
| US10519221B2 (en) | 2014-07-15 | 2019-12-31 | Medimmune, Llc | Neutralizing anti-influenza B antibodies and uses thereof |
| US12325740B2 (en) | 2014-07-15 | 2025-06-10 | Medimmune, Llc | Neutralizing anti-influenza B antibodies and uses thereof |
| US11174304B2 (en) | 2014-07-15 | 2021-11-16 | Medimmune, Llc | Neutralizing anti-influenza B antibodies and uses thereof |
| US10882897B2 (en) | 2015-06-01 | 2021-01-05 | Medimmune, Llc | Neutralizing anti-influenza binding molecules and uses thereof |
| US11524993B2 (en) | 2015-06-01 | 2022-12-13 | Medimmune, Llc | Neutralizing anti-influenza binding molecules and uses thereof |
| EP3960761A1 (en) * | 2015-06-01 | 2022-03-02 | MedImmune, LLC | Neutralizing anti-influenza binding molecules and uses thereof |
| US11926657B2 (en) | 2015-06-01 | 2024-03-12 | Medimmune, Llc | Neutralizing anti-influenza binding molecules and uses thereof |
| WO2016196470A1 (en) * | 2015-06-01 | 2016-12-08 | Medimmune, Llc | Neutralizing anti-influenza binding molecules and uses thereof |
| US10442854B2 (en) | 2015-06-01 | 2019-10-15 | Medimmune, Llc | Neutralizing anti-influenza binding molecules and uses thereof |
| US11547756B2 (en) | 2016-01-13 | 2023-01-10 | Medimmune, Llc | Method of treating influenza A |
| US12357692B2 (en) | 2016-01-13 | 2025-07-15 | Medimmune, Llc | Method of treating influenza A |
| US11773156B2 (en) | 2019-10-28 | 2023-10-03 | Regeneron Pharmaceuticals, Inc. | Anti-hemagglutinin antibodies and methods of use thereof |
| WO2021086899A1 (en) * | 2019-10-28 | 2021-05-06 | Regeneron Pharmaceuticals, Inc. | Anti-hemagglutinin antibodies and methods of use thereof |
| AU2020374878B2 (en) * | 2019-10-28 | 2025-10-16 | Regeneron Pharmaceuticals, Inc. | Anti-hemagglutinin antibodies and methods of use thereof |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12492240B2 (en) | Neutralizing anti-influenza A antibodies and uses thereof | |
| US12325740B2 (en) | Neutralizing anti-influenza B antibodies and uses thereof | |
| HK40061870A (en) | Neutralizing anti-influenza b antibodies and uses thereof | |
| HK40057425A (en) | Neutralizing anti-influenza b antibodies and uses thereof | |
| HK40120900A (zh) | 中和抗乙型流感抗体及其用途 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15821645 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 2954780 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15325603 Country of ref document: US |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 122021018536 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2017523183 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2017/000595 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017000640 Country of ref document: BR |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015821645 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2015821645 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2017104638 Country of ref document: RU Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2015289805 Country of ref document: AU Date of ref document: 20150714 Kind code of ref document: A |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15821645 Country of ref document: EP Kind code of ref document: A2 |
|
| ENP | Entry into the national phase |
Ref document number: 112017000640 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170112 |
|
| WWG | Wipo information: grant in national office |
Ref document number: 2015821645 Country of ref document: EP |