WO2016005593A1 - Antibodies binding axl - Google Patents
Antibodies binding axl Download PDFInfo
- Publication number
- WO2016005593A1 WO2016005593A1 PCT/EP2015/065900 EP2015065900W WO2016005593A1 WO 2016005593 A1 WO2016005593 A1 WO 2016005593A1 EP 2015065900 W EP2015065900 W EP 2015065900W WO 2016005593 A1 WO2016005593 A1 WO 2016005593A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- region
- nos
- cdr2
- cdrl
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/39558—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68031—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being an auristatin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68033—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a maytansine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68035—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a pyrrolobenzodiazepine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6855—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from breast cancer cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6857—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from lung cancer cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6869—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from a cell of the reproductive system: ovaria, uterus, testes, prostate
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/18—Drugs for disorders of the alimentary tract or the digestive system for pancreatic disorders, e.g. pancreatic enzymes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P11/00—Drugs for disorders of the respiratory system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/10—Drugs for disorders of the urinary system of the bladder
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P13/00—Drugs for disorders of the urinary system
- A61P13/12—Drugs for disorders of the urinary system of the kidneys
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/04—Drugs for skeletal disorders for non-specific disorders of the connective tissue
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P21/00—Drugs for disorders of the muscular or neuromuscular system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/30—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants from tumour cells
- C07K16/3061—Blood cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/575—Immunoassay; Biospecific binding assay; Materials therefor for cancer
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2121/00—Preparations for use in therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/33—Crossreactivity, e.g. for species or epitope, or lack of said crossreactivity
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/77—Internalization into the cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
Definitions
- the present invention relates to antibodies binding AXL, immunoconjugates, compositions comprising such antibodies or immunoconjugates, and uses of said antibodies and immunoconjugates.
- the TAM subfamily of mammalian Receptor Tyrosine Kinases consists of AXL, Tyro3 and Mer.
- AXL is a 104-140 kDa transmembrane protein which has transforming abilities [1].
- AXL can be activated upon binding of its ligand, the vitamin K-dependent growth arrest-specific factor 6 (Gas6). Gas6 binding to AXL leads to AXL dimerization, autophosphorylation and subsequent activation of intracellular signaling pathways, such as the PI3K/AKT, mitogen-activated protein kinase (MAPK), STAT and NF- ⁇ cascades [2].
- PI3K/AKT the PI3K/AKT
- MAPK mitogen-activated protein kinase
- STAT NF- ⁇ cascades
- AXL enhances tumor cell motility, invasion, migration, and is involved in epithelial-to-mesenchymal transition (EMT) [3]. Furthermore, AXL expression has been implicated in resistance to chemotherapy and targeted therapy, such as Epidermal Growth Factor Recptor (EGFR) targeted therapy (Wilson 2014, Brand 2013, Zhang 2012) or inhibitors of the B-raf (BRAF) pathway (Muller, 2014).
- EGFR Epidermal Growth Factor Recptor
- BRAF B-raf pathway
- the extracellular domain of TAM receptor family members is composed of a combination of two N-terminal immunoglobulin (Ig)-like domains and two fibronectin Type III (FNIII) repeats [1].
- the ligand Gas6 binds to the Ig-like domains I and II of AXL [14].
- AXL Upregulation of AXL has been reported in a variety of cancers, including gastric, prostate, ovarian, and lung cancer [1]. Furthermore, AXL is overexpressed in breast and pancreatic cancers and is significantly associated with higher metastasis frequency and with poor overall survival [2].
- Targeted inhibition of RTKs may be effective as anti-tumor and/or metastatic therapy.
- Such targeted inhibition of AXL and/or the ligand Gas6 comprises both small molecules and anti-AXL antibodies [3].
- Anti-AXL antibodies have been described that attenuate non-small cell lung carcinoma xenograft growth in vivo by downregulation of receptor expression, reducing tumor cell proliferation and inducing apoptosis [4].
- various monoclonal antibodies have been described that block binding of the ligand Gas6 to AXL [2], [5], and [7].
- Anti-AXL antibodies have been described previously [8]-[13]. However, a need for anti- AXL antibodies having improved anti-tumor activity remains. Sum m a ry of I nve nt ion
- the present invention relates to an antibody which binds to AXL, wherein the antibody, does not compete for AXL binding with the ligand Growth Arrest-Specific 6 (Gas6).
- the present invention relates to a bispecific antibody comprising a first binding region of an antibody according to the invention, and a second binding region which binds a different target or epitope than said first antigen-binding region.
- the present invention relates to an immunoconjugate comprising the antibody or bispecific antibody according to the invention, and a therapeutic moiety, such as a cytotoxic agent, a chemotherapeutic drug, a cytokine, an immunosuppressant, antibiotic, or a radioisotope.
- a therapeutic moiety such as a cytotoxic agent, a chemotherapeutic drug, a cytokine, an immunosuppressant, antibiotic, or a radioisotope.
- the present invention relates to a composition
- a composition comprising the antibody, bispecific antibody, or immunoconjugate according to the invention.
- the present invention relates to a pharmaceutical composition
- a pharmaceutical composition comprising the antibody, bispecific antibody, or immunoconjugate according to the invention, and a pharmaceutically acceptable carrier.
- the present invention relates to a nucleic acid construct encoding an antibody according to the invention.
- the present invention relates to an expression vector comprising one or more nucleic acid constructs according to the invention.
- the present invention relates to a host cell comprising a vector according to the invention.
- the present invention relates to a hybridoma which produces the antibody according to the invention.
- the present invention relates to the antibody, bispecific antibody, or immunoconjugate according to the invention for use as a medicament.
- the present invention relates to the antibody, bispecific antibody, or immunoconjugate according to the invention for use in the treatment of cancer.
- the present invention relates to a method of treatment of cancer comprising administering the antibody, bispecific antibody, immunoconjugate, composition, or pharmaceutical composition according to the invention, to a subject in need thereof.
- the present invention relates to a method of diagnosing a disease characterized by involvement or accumulation of AXL-expressing cells, comprising administering an antibody, bispecific antibody, immunoconjugate, composition, or a pharmaceutical composition according to the invention, to a subject, optionally wherein the antibody is labeled with a detectable agent, and wherein the amount of AXL-expressing cells correlates with or is indicative of disease.
- the present invention relates to a method for inhibiting growth and/or proliferation of a tumor cell expressing AXL, comprising administration, to an individual in need thereof, of an antibody, bispecific antibody, immunoconjugate, composition, or pharmaceutical composition according to the invention.
- the present invention relates to a method for producing an antibody according to the invention, the method comprising the steps a) culturing a host cell or hybridoma according to the invention, and b) purifying the antibody from the culture media.
- the present invention relates to a diagnostic composition comprising an antibody or bispecific antibody according to the invention.
- the present invention relates to a method for detecting the presence of AXL antibody, or a cell expressing AXL, in a sample comprising the steps of a) contacting the sample with an antibody, bispecific antibody, immunoconjugate according to the invention, under conditions that allow for formation of a complex between the antibody, bispecific antibody, or immunoconjugate and AXL; and b) analyzing whether a complex has been formed.
- the present invention relates to a kit for detecting the presence of AXL antigen, or a cell expressing AXL, in a sample comprising i) an antibody, bispecific antibody, or immunoconjugate according to the invention; and ii) instructions for use of the kit.
- the present invention relates to an anti-idiotypic antibody which binds to an anti- AXL antibody according to the invention, s Br ief Descript ion of Figu res
- Figure 1 Binding curves of anti-AXL antibodies to HEK293 cells transfected with (A) human AXL-ECD, (B) cynomolgus AXL-ECD, or (C) mouse AXL-ECD. Data shown are mean fluorescence intensities (MFI) of one representative experiment, as described in Example 2.
- FIG. 2 Binding of anti-AXL antibodies to mouse-human AXL chimeras was performed as described in Example 3. The following Homo sapiens AXL (hsAXL) and Mus musculus AXL (mmAXL) chimeric proteins were tested: (A) hsAXL and mock, (B) hsAXL-mmECD, (C) hsAXL-mmlgl, (D) hsAXL-mmlg2, (E) hsAXL- mmFNl, (F) hsAXL-mmFN2.
- hsAXL Homo sapiens AXL
- mmAXL Mus musculus AXL
- FIG. 3 Anti-AXL antibody-dependent cell-mediated cytotoxicity in A431 cells. Antibody-dependent cell-mediated cytotoxicity by anti-AXL antibodies in A431 cells was determined as described in Example 4.
- FIG. 4 Binding characteristics of AXL antibody-drug conjugates (AXL-ADCs). Binding of AXL-ADCs on HEK293T cells transiently transfected with human AXL was determined as described in Example 5. Data shown are mean fluorescence intensities (M FI) of one representative experiment.
- Figure 5 In vitro cytotoxicity induced by AXL antibody-drug conjugates. Induction of cytotoxicity by AXL antibody-drug conjugates was determined as explained in Example 6.
- FIG. 6 Antibody VH and VL variants that allow binding to AXL. Antibodies with identical VL or VH regions were aligned and differences in VH ( Figures A-D) or VL ( Figure E) sequences, respectively, were identified and indicated by boxes in the figures. CD regions are underlined.
- Figure 8 Anti-tumor activity by MMAE-conjugated AXL antibodies in a therapeutic LCLC-103H xenograft model as described in Example 9.
- Figure 9 Immunohistochemical staining of frozen PAXF1657 tumor sections (pancreas cancer PDX model) using a pool of AXL monoclonal antibodies as described in Example 10.
- Figure 10 Average tumor size after therapeutic treatment with AXL-ADCs the PAXF1657 model.
- An unconjugated AXL Humab (C) and an untargeted ADC (D) do not show anti-tumor activity, indicating that the therapeutic capacity of AXL-ADCs was dependent on the cytotoxic activity of MMAE and on target binding, error bars represent S.E.M..
- FIG. 11 Binding of anti-AXL antibodies to mouse-human AXL chimeras was performed as described in Example 11. The following Homo sapiens AXL (hsAXL) and Mus musculus AXL (mmAXL) chimeric proteins were tested: (A) hsAXL and mock, (B) hsAXL-mmECD, (C) hsAXL-mmlgl, (D) hsAXL-mmlg2, (E) hsAXL-mmFNl, (F) hsAXL-mmFN2.
- Figure 12 Binding of human Gas6 (hGas6) on A431 cells that had been pre-incubated with antibodies binding to the Igl domain of AXL. Data shown are mean fluorescence intensities (MFI) of one representative experiment.
- MFI mean fluorescence intensities
- Figure 13 Anti-tumor activity of MMAE-conjugated AXL antibodies in a therapeutic A431 xenograft model, that produces high levels of endogeneous Gas6, as described in Example 13. Panels A and B show results from 2 independent experiments.
- Figure 14 Anti-tumor activity of MMAE-conjugated AXL antibodies in a therapeutic LCLC-103H xenograft model, that expresses low levels of endogenous Gas6, as described in Example 13. Panels A and B show results from 2 independent experiments.
- Figure 15 Induction of cytotoxicity by AXL-ADCs in A431 cells (A) and M DA-M B231 cells (B) was determined as described in Example 8.
- FIG. 16 AXL staining in thyroid, esophageal, ovarian, breast, lung, pancreatic, cervical and endometrial cancer.
- the average AXL staining intensity (OD) of AXL-positive cells is plotted on the X- axis, and the percentage of AXL-positive tumor cells is plotted on the Y-axis.
- Each dot represents a tumor core, derived from an individual patent.
- Figure 17 Representative examples of AXL-immunostained tumor cores for different tumor indication.
- FIG. 18 AXL antibodies specifically bind AXL but not to other TAM receptor family members. Binding of HuMab-AXL antibodies to HEK293 cells transfected with human AXL (A), human MER (B), human TYR03 (C), or untransfected HEK293 cells (D). To confirm proper expression of transfected cells, untransfected HEK293F cells and cells transfected with AXL (E), MER (F), or TYR03 (G) were stained with MER- and TYR03-specific antibodies. Data shown are mean fluorescence intensities (MFI) of one representative experiment, as described in Example 15.
- MFI mean fluorescence intensities
- FIG. 19 Detection of AXL antibodies on the plasma membrane of tumor cell lines that had been incubated with AXL-antibodies for 1 hour at 4°C, followed by an overnight incubation 4°C or 37°C.
- AXL-antibodies for 1 hour at 4°C, followed by an overnight incubation 4°C or 37°C.
- C and D Calu-1 cells
- FIG 20 Geomean fluorescence intensity of LCLC-103H cells after incubation with AXL antibodies that had been complexed to Fab-TAM RA/QSY7. lgGl-bl2 and Fab-TAMRA/QSY7 alone were included as negative controls.
- Figure 21 (A) Average tumor size after therapeutic treatment with lgGl-AXL-107-vcMMAE in the esophageal cancer PDX model ES0195. lgGl-bl2 and lgGl-bl2-MMAE were included as isotype control antibody and isotype control ADC, respectively.
- B Tumor size in individual mice on day 32 after injection of MDA-MB-231-luc D3H2LN tumor cells in the mammary fat pads of female SCID mice. * p ⁇ 0.05; ** p ⁇ 0.0001
- Figure 22 Therapeutic effect of AXL-ADCs in a patient-derived cervical cancer xenograft model.
- lgGl-bl2 and lgGl-bl2-MMAE were included as isotype control antibody and isotype control ADC, respectively.
- FIG. 23 Therapeutic activity of AXL-ADCs in an orthotopic breast cancer xenograft model.
- A Average tumor size after therapeutic treatment with lgGl-AXL-183-vcMMAE or lgGl-AXL-726-vcMMAE in an orthotopic MDA-MB-231-luc D3H2LN xenograft model.
- lgGl-bl2 and lgGl-bl2-MMAE were included as isotype control antibody and isotype control ADC, respectively.
- B Tumor size in individual mice on day 32 after injection of MDA-MB-231-luc D3H2LN tumor cells in the mammary fat pads of female SCID mice. * p ⁇ 0.001.
- FIG. 24 Cytotoxicity of lgGl-AXL-107-vcMMAE in human tumor cell lines with different levels of AXL expression on the plasma membrane.
- AXL expression in the plasma membrane of human tumor cell lines was assessed using Qifikit analysis, and the cytotoxicity of lgGl-AXL-107-vcMMAE was expressed as the percentage of viable tumor cells that remained in the cell cultures after exposure to 1 ⁇ g/mL lgGl-AXL-107-vcMMAE.
- the present invention relates to an antibody which binds to AXL, wherein the antibody, does not compete for AXL binding with the ligand Growth Arrest-Specific 6 (Gas6).
- antibody as used herein is intended to refer to an immunoglobulin molecule, a fragment of an immunoglobulin molecule, or a derivative of either thereof, which has the ability to specifically bind to an antigen under typical physiological and/or tumor-specific conditions with a half-life of significant periods of time, such as at least about 30 minutes, at least about 45 minutes, at least about one hour, at least about two hours, at least about four hours, at least about 8 hours, at least about 12 hours, about 24 hours or more, about 48 hours or more, about 3, 4, 5, 6, 7 or more days, etc., or any other relevant functionally-defined period (such as a time sufficient to induce, promote, enhance, and/or modulate a physiological response associated with antibody binding to the antigen and/or time sufficient for the antibody to be internalized).
- significant periods of time such as at least about 30 minutes, at least about 45 minutes, at least about one hour, at least about two hours, at least about four hours, at least about 8 hours, at least about 12 hours, about 24 hours or more, about 48 hours or
- the binding region (or binding domain which may be used herein, both having the same meaning) which interacts with an antigen, comprises variable regions of both the heavy and light chains of the immunoglobulin molecule.
- the constant regions of the antibodies (Abs) may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (such as effector cells) and components of the complement system such as Clq, the first component in the classical pathway of complement activation.
- the term antibody as used herein includes fragments of an antibody that retain the ability to specifically interact, such as bind, to the antigen. It has been shown that the antigen-binding function of an antibody may be performed by fragments of a full-length antibody.
- binding fragments encompassed within the term "antibody” include (i) a Fab' or Fab fragment, a monovalent fragment consisting of the VL, VH, CL and CHI domains, or a monovalent antibody as described in [15]; (ii) F(a b') 2 fragments, bivalent fragments comprising two Fab fragments linked by a disulfide bridge at the hinge region; (iii) an Fd fragment consisting essentially of the VH and CHI domains; (iv) an Fv fragment consisting essentially of the VL and VH domains of a single arm of an antibody, (v) a dAb fragment [16], which consists essentially of a VH domain and is also called domain antibody [17]; (vi) camelid or nanobodies [18] and (vii) an isolated complementarity determining region (CD ).
- a Fab' or Fab fragment a monovalent fragment consisting of the VL, VH, CL and CHI domains, or a monovalent
- the two domains of the Fv fragment, VL and VH are coded for by separate genes, they may be joined, using recombinant methods, by a synthetic linker that enables them to be made as a single protein chain in which the VL and VH regions pair to form monovalent molecules (known as single chain antibodies or single chain Fv (scFv), see for instance [19] and [20]).
- single chain antibodies are encompassed within the term antibody unless otherwise noted or clearly indicated by context.
- fragments are generally included within the meaning of antibody, they collectively and each independently are unique features of the present invention, exhibiting different biological properties and utility.
- antibody also includes polyclonal antibodies, monoclonal antibodies (mAbs), antibody-like polypeptides, such as chimeric antibodies and humanized antibodies, as well as 'antibody fragments' or 'fragments thereof retaining the ability to specifically bind to the antigen (antigen-binding fragments) provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques, and retaining the ability to be conjugated to a toxin.
- mAbs monoclonal antibodies
- antibody-like polypeptides such as chimeric antibodies and humanized antibodies
- antigen-binding fragments provided by any known technique, such as enzymatic cleavage, peptide synthesis, and recombinant techniques, and retaining the ability to be conjugated to a toxin.
- An antibody as generated can possess any isotype.
- immunoglobulin heavy chain or "heavy chain of an immunoglobulin” as used herein is intended to refer to one of the heavy chains of an immunoglobulin.
- a heavy chain is typically comprised of a heavy chain variable region (abbreviated herein as VH) and a heavy chain constant region (abbreviated herein as CH) which defines the isotype of the immunoglobulin.
- the heavy chain constant region typically is comprised of three domains, CHI, CH2, and CH3.
- immunoglobulin as used herein is intended to refer to a class of structurally related glycoproteins consisting of two pairs of polypeptide chains, one pair of light (L) low molecular weight chains and one pair of heavy (H) chains, all four potentially inter-connected by disulfide bonds.
- the structure of immunoglobulins has been well characterized (see for instance [21]). Within the structure of the immunoglobulin, the two heavy chains are inter-connected via disulfide bonds in the so-called "hinge region". Equally to the heavy chains each light chain is typically comprised of several regions; a light chain variable region (abbreviated herein as VL) and a light chain constant region.
- VL light chain variable region
- CL light chain constant region
- VH and VL regions may be further subdivided into regions of hypervariability (or hypervariable regions which may be hypervariable in sequence and/or form of structurally defined loops), also termed complementarity determining regions (CDRs), interspersed with regions that are more conserved, termed framework regions (FRs).
- CDRs complementarity determining regions
- FRs framework regions
- Each VH and VL is typically composed of three CDRs and four FRs, arranged from amino- terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4.
- CDR sequences are defined according to IMGT (see [22] and [23]).
- antigen-binding region refers to a region of an antibody which is capable of binding to the antigen.
- the antigen can be any molecule, such as a polypeptide, e.g. present on a cell, bacterium, or virion.
- the terms "antigen” and “target” may, unless contradicted by the context, be used interchangeably in the context of the present invention.
- binding refers to the binding of an antibody to a predetermined antigen or target, typically with a binding affinity corresponding to a K D of about 10 "6 M or less, e.g. 10 "7 M or less, such as about 10 s M or less, such as about 10 "9 M or less, about 10 10 M or less, or about 10 11 M or even less when determined by for instance surface plasmon resonance (SPR) technology in a BIAcore 3000 instrument using the antigen as the ligand and the protein as the analyte, and binds to the predetermined antigen with an affinity corresponding to a K D that is at least ten-fold lower, such as at least 100 fold lower, for instance at least 1,000 fold lower, such as at least 10,000 fold lower, for instance at least 100,000 fold lower than its affinity for binding to a non-specific antigen (e.g., BSA, casein) other than the predetermined antigen or a closely-related antigen.
- a non-specific antigen e.g., BSA, case
- K D (M)
- M the dissociation equilibrium constant of a particular antibody- antigen interaction
- k d (sec 1 ), as used herein, refers to the dissociation rate constant of a particular antibody-antigen interaction. Said value is also referred to as the k 0ff value or off-rate.
- k a (M 1 x sec "1 ), as used herein, refers to the association rate constant of a particular antibody-antigen interaction. Said value is also referred to as the k on value or on-rate.
- K A (M 1 ), as used herein, refers to the association equilibrium constant of a particular antibody-antigen interaction and is obtained by dividing k a by k d .
- AXL refers to the protein entitled AXL, which is also referred to as UFO or JTKll, a 894 amino acid protein with a molecular weight of 104-140 kDa that is part of the subfamily of mammalian TAM Receptor Tyrosine Kinases (RTKs). The molecular weight is variable due to potential differences in glycosylation of the protein.
- the AXL protein consists of two extracellular immunoglobulin-like (Ig-like) domains on the N-terminal end of the protein, two membrane-proximal extracellular fibronectin type III (FNIII) domains, a transmembrane domain and an intracellular kinase domain.
- AXL is activated upon binding of its ligand Gas6, by ligand-independent homophilic interactions between AXL extracellular domains ,by autophosphorylation in presence of reactive oxygen species [24] or by transactivation through EGFR (Meyer, 2013), and is aberrantly expressed in several tumor types.
- the AXL protein is encoded by a nucleic acid sequence encoding the amino acid sequence shown in SEQ ID NO:130 (human AXL protein: Swissprot P30530; cynomolgus AXL protein: Genbank accession HB387229.1)).
- ligand-independent homophilic interactions refers to association between two AXL molecules (expressed on neighboring cells) that occurs in absence of the ligand.
- antibody binding AXL refers to any antibody binding an epitope on the extracellular part of AXL.
- epitope means a protein determinant capable of specific binding to an antibody.
- Epitopes usually consist of surface groupings of molecules such as amino acids, sugar side chains or a combination thereof and usually have specific three dimensional structural characteristics, as well as specific charge characteristics. Conformational and non-conformational epitopes are distinguished in that the binding to the former but not the latter is lost in the presence of denaturing solvents.
- the epitope may comprise amino acid residues which are directly involved in the binding, and other amino acid residues, which are not directly involved in the binding, such as amino acid residues which are effectively blocked or covered by the specific antigen binding peptide (in other words, the amino acid residue is within the footprint of the specific antigen binding peptide).
- ligand refers to a substance, such as a hormone, peptide, ion, drug or protein, that binds specifically and reversibly to another protein, such as a receptor, to form a larger complex.
- Ligand binding to a receptor may alter its chemical conformation, and determines its functional state. For instance, a ligand may function as agonist or antagonist.
- Gas6 refers to a 721 amino acid protein, with a molecular weight of 75-80 kDa, that functions as a ligand for the TAM family of receptors, including AXL.
- Gas6 is composed of an N-terminal region containing multiple gamma- carboxyglutamic acid residues (Gla), which are responsible for the specific interaction with the negatively charged phospholipid membrane.
- Ga gamma- carboxyglutamic acid residues
- Gas6 may also be termed as the "ligand to AXL”.
- monoclonal antibody refers to a preparation of antibody molecules of single molecular composition.
- a monoclonal antibody composition displays a single binding specificity and affinity for a particular epitope.
- human monoclonal antibody refers to antibodies displaying a single binding specificity which have variable and constant regions derived from human germline immunoglobulin sequences.
- the human monoclonal antibodies may be produced by a hybridoma which includes a B cell obtained from a transgenic or transchromosomal non-human animal, such as a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene, fused to an immortalized cell.
- a hybridoma which includes a B cell obtained from a transgenic or transchromosomal non-human animal, such as a transgenic mouse, having a genome comprising a human heavy chain transgene and a light chain transgene, fused to an immortalized cell.
- maximal antibody binding in the presence of Gas6 is at least 90%, such as at least 95%, such as at least 97%, such as at least 99%, such as 100%, of binding in absence of Gas6, as determined by the method disclosed in Example 2.
- the antibody does not compete for AXL binding with the ligand Gas6, wherein the competing for binding is determined in an assay comprising the steps of
- the antibody does not compete for binding with the ligand Gas6, wherein the competing for binding is determined in an assay comprising the steps of
- the antibody has a binding affinity (K D ) in the range of 0.3xl0 "9 to 63xl0 "9 M to AXL, and wherein said binding affinity is measured using a Bio-layer Interferometry using soluble AXL extracellular domain.
- the binding affinity may be determined as described in Example 2.
- the antibody has a binding affinity of 0.3xl0 "9 to 63xl0 "9 M to the antigen, wherein the binding affinity is determined by a method comprising the steps of;
- soluble recombinant AXL extracellular domain refers to an AXL extracellular domain that has been expressed recombinantly. Due to absence of the transmembrane and intracellular domain, recombinant AXL extracellular domain is not attached to a, e.g. cell surface and stays in solution. It is well-known how to express a protein recombinantly, see e.g.
- the antibody has a dissociation rate of 6.9x10 s s "1 to 9.7xl0 "3 s _1 to AXL, and wherein the dissociation rate is measured by Bio-layer Interferometry using soluble recombinant AXL extracellular domain.
- the binding affinity may be determined as described above (and in Example 2).
- the antibody has a dissociation rate of 6.9x10 s s "1 to 9.7xl0 "3 s _1 to AXL, and wherein the dissociation rate is measured by a method comprising the steps of
- dissociation rate refers to the rate at which an antigen-specific antibody bound to its antigen, dissociates from that antigen, and is expressed as s 1 .
- dissociation rate refers to the antibody binding AXL dissociates from the recombinant extracellular domain of AXL, and is expressed as s 1 .
- AXL is human AXL.
- the a mino acid sequence of AXL is according to Swissprot P30530.
- AXL is cynomolgus monkey AXL (Genbank accession HB387229.1).
- the antibody comprises at least one binding region comprising varia ble heavy chain (VH) CDRl, CDR2, and CDR3 sequences having at least 95%, such as at least 96%, such as at least 97%, such as at least 98%, such as at least 99%, sequence identity to sequences are selected from the group consisting of:
- VH varia ble heavy chain
- the antibody comprises at least one binding region comprising variable heavy chain (VH) CDRl, CDR2, and CDR3 sequences having at most 5 mutations or substitutions, such as at most 4 mutations or substitutions, such as at most 3 mutations or substitutions, such as at most 2 mutations or substitutions, such as at most 1 mutation or substitution, in total across the CDR sequences in said variable heavy chain selected from the group consisting of:
- VH variable heavy chain
- the mutations or su bstitutions may be of conservative, physical or functional amino acids such that mutations or su bstitutions do not change the epitope or prefera bly do not modify binding affinity to the epitope more than 30 %, such as more than 20 % or such as more than 10% .
- the conservative, physical or functional amino acids are selected from the 20 natural amino acids i.e. Arg, His, Lys, Asp, Glu, Ser, Thr, Asn, Gin, Cys, Gly, Pro, Ala, lie, Leu, Met, Phe, Trp, Tyr and Val.
- the antibody comprises at least one binding region comprising varia ble heavy chain (VH) CDR1, CDR2, and CDR3 sequences are selected from the group consisting of;
- VH varia ble heavy chain
- the VH CDRl, CDR2, and CDR3 are selected from either a), d), g), or k).
- the at least one binding region comprises a VH region and a variable light chain (VL) region having at least 95 %, such as at least 97%, such as at least 99%, such as 100%, sequence identity with the sequences independently selected from the group consisting of;
- VL variable light chain
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively [733];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 53, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively [154];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively [154-M103L];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively, [171];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 65, GAS, and 66, respectively, [172];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 70, GAS, and 71, respectively, [181];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183]; j) a VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183-N52Q];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 81, AAS, and 82, respectively, [187];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 86, GAS, and 87, respectively, [608-01];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 91, GAS, and 92, respectively, [610-01];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively, [613];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 10, DAS, and 102, respectively, [613-08];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 106, GAS, and 107, respectively, [620-06];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726-M101L];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 41, 42, and 43, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 44, AAS, and 45, respectively, [140];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively, and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 128, XAS, wherein X is D or G, and 129, respectively, [613 / 613-08];
- a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 119, and 120, respectively; and a VL region comprising CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148 / 140];
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 123, 124, and 125, respectively; and a VL region comprising CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively [171 / 172 / 181]; and
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 121, 109, and 122, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively [726 / 187];
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:93, 126, and 127, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively [613 / 608-01 / 610-01 / 620-06].
- the at least one binding region comprises a VH region and a variable light chain (VL) region having, at most 5 mutations or substitutions selected from conservative, physical or functional amino acids, such as at most 4 mutations or substitutions selected from conservative, physical or functional amino acids, such as at most 3 mutations or substitutions selected from conservative, physical or functional amino acids, such as at most 2 mutations selected from conservative, physical or functional amino acids or substitutions, such as at most 1 mutation or substitution selected from a conservative, physical or functional amino acid, in total across the CDR sequences in said variable heavy chain and variable light chain selected from the group consisting of;
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107];
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148];
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively [733];
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 53, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively [154]
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively, [171];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 65, GAS, and 66, respectively, [172];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 70, GAS, and 71, respectively, [181];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183-N52Q];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 81, AAS, and 82, respectively, [187];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 86, GAS, and 87, respectively, [608-01];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 91, GAS, and 92, respectively, [610-01];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively, [613];
- a VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 10, DAS, and 102, respectively, [613-08]; p) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 106, GAS, and 107, respectively, [620-06];
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726];
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726-M101L];
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 41, 42, and 43, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 44, AAS, and 45, respectively, [140];
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively, and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 128, XAS, wherein X is D or G, and 129, respectively, [613 / 613-08];
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 119, and 120, respectively; and a VL region comprising CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148 / 140];
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 123, 124, and 125, respectively; and a VL region comprising CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively [171 / 172 / 181]; and
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 121, 109, and 122, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively [726 / 187];
- VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:93, 126, and 127, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively [613 / 608-01 / 610-01 / 620-06].
- mutations or substitutions of up to five mutations or substitutions are allowed across the three CDR sequences in the variable heavy chain and variable light chain.
- the up to five mutations or substitutions may be distributed across the three CDR sequences of the variable heavy chain and the three CDR sequences of the variable light chain.
- the up to five mutations or substitutions may be distributed across the six CDR sequences of the binding region.
- the mutations or substitutions may be of conservative, physical or functional amino acids such that mutations or substitutions do not change the epitope or preferably do not modify binding affinity to the epitope more than 30 %, such as more than 20 % or such as more than 10% .
- the conservative, physical or functional amino acids are selected from the 20 natural amino acids found i.e, Arg, His, Lys, Asp, Glu, Ser, Thr, Asn, Gin, Cys, Gly, Pro, Ala, lie, Leu, Met, Phe, Trp, Tyr and Val.
- the at least one binding region comprises a VH region and a variable light chain (VL) region selected from the group consisting of;
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively [733];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 53, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively [154];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively [154-M103L];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively, [171];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 65, GAS, and 66, respectively, [172];
- a VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 70, GAS, and 71, respectively, [181]; i) a VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183-N52Q];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 81, AAS, and 82, respectively, [187];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 86, GAS, and 87, respectively, [608-01];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 91, GAS, and 92, respectively, [610-01];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 93, 94, and 95, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively, [613];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 98, 99, and 100, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 10, DAS, and 102, respectively, [613-08];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 106, GAS, and 107, respectively, [620-06];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726-M101L];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 41, 42, and 43, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 44, AAS, and 45, respectively, [140];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 119, and 120, respectively; and a VL region comprising CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148 / 140];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 123, 124, and 125, respectively; and a VL region comprising CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively [171 / 172 / 181]; and
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 121, 109, and 122, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively [726 / 187]; and
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.:93, 126, and 127, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively [613 / 608-01 / 610-01 / 620-06].
- the at least one binding region comprises a VH region and a VL region selected from the group consisting of;
- VH region comprising SEQ ID No: 16 and a VL region comprising SEQ ID No: 18 [183]; g) a VH region comprising SEQ ID No: 25 and a VL region comprising SEQ ID No: 26 [613]; h) a VH region comprising SEQ ID No: 31 and a VL region comprising SEQ ID No: 33
- VH region comprising SEQ ID No: 3 and a VL region comprising SEQ ID No: 4 [140]; j) a VH region comprising SEQ ID No:8 and a VL region comprising SEQ ID No:9 [154-
- VH region comprising SEQ ID No:12 and a VL region comprising SEQ ID No:13 [172]; I) a VH region comprising SEQ ID No:14 and a VL region comprising SEQ ID No:15 [181]; m) a VH region comprising SEQ ID No:17 and a VL region comprising SEQ ID No:18 [183-
- the at least one binding region comprises a variable heavy chain (VH) region and a variable light chain (VL) region having at most 10 mutations or substitutions, at most 5 mutations or substitutions, such as at most 4 mutations or substitutions, such as at most 3 mutations or substitutions, such as at most 2 mutations or substitutions, such as at most 1 mutation or substitution, across said variable heavy chain and variable light chain sequences selected from the group consisting of;
- the at least one binding region comprises a VH region and a VL region selected from the group consisting of;
- VH region comprising SEQ ID No: 16 and a VL region comprising SEQ ID No: 18 [183]; g) a VH region comprising SEQ ID No: 25 and a VL region comprising SEQ ID No: 26 [613]; h) a VH region comprising SEQ ID No: 31 and a VL region comprising SEQ ID No: 33
- VH region comprising SEQ ID No:12 and a VL region comprising SEQ ID No:13 [172]; I) a VH region comprising SEQ ID No:14 and a VL region comprising SEQ ID No:15 [181]; m) a VH region comprising SEQ ID No:17 and a VL region comprising SEQ ID No:18 [183-
- VH region comprising SEQ ID No:19 and a VL region comprising SEQ ID No:20 [187]; o) a VH region comprising SEQ ID No:21 and a VL region comprising SEQ ID No:22 [608-
- mutations or substitutions of up to 10 mutations or substitutions are allowed across the variable heavy chain and variable light chain.
- the up to 10 mutations or substitutions may be distributed across the full length of the variable heavy chain and the variable light chain of each binding region.
- the mutations or substitutions may be of conservative, physical or functional amino acids such that the mutations or substitutions do not change the epitope and preferably do not modify binding affinity to the epitope more than 30 %, such as more than 20 % or such as more than 10% .
- the conservative, physical or functional amino acids are selected from the 20 natural amino acids found i.e. Arg, His, Lys, Asp, Glu, Ser, Thr, Asn, Gin, Cys, Gly, Pro, Ala, lie, Leu, Met, Phe, Trp, Tyr and Val.
- the at least one binding region comprises a variable heavy chain (VH) region and a variable light chain (VL) region having at most 10 mutations or substitutions selected from conservative, physical or functional amino acids, at most 5 mutations or substitutions selected from conservative, physical or functional amino acids, such as at most 4 mutations or substitutions selected from conservative, physical or functional amino acids, such as at most 3 mutations or substitutions selected from conservative, physical or functional amino acids, such as at most 2 mutations selected from conservative, physical or functional amino acids or substitutions, such as at most 1 mutation or substitution selected from a conservative, physical or functional amino acid, across said variable heavy chain and variable light chain sequences selected from the group consisting of;
- the at least one binding region comprises a VH region and a VL region selected from the group consisting of;
- VH region comprising SEQ ID No: 16 and a VL region comprising SEQ ID No: 18 [183]; g) a VH region comprising SEQ ID No: 25 and a VL region comprising SEQ ID No: 26 [613]; h) a VH region comprising SEQ ID No: 31 and a VL region comprising SEQ ID No: 33
- VH region comprising SEQ ID No: 3 and a VL region comprising SEQ ID No: 4 [140]; j) a VH region comprising SEQ ID No:8 and a VL region comprising SEQ ID No:9 [154-
- VH region comprising SEQ ID No:12 and a VL region comprising SEQ ID No:13 [172]; I) a VH region comprising SEQ ID No:14 and a VL region comprising SEQ ID No:15 [181]; m) a VH region comprising SEQ ID No:17 and a VL region comprising SEQ ID No:18 [183-
- VH region comprising SEQ ID No:19 and a VL region comprising SEQ ID No:20 [187]; o) a VH region comprising SEQ ID No:21 and a VL region comprising SEQ ID No:22 [608-
- mutations or substitutions of up to 10 mutations or substitutions are allowed across the variable heavy chain and variable light chain.
- the up to 10 mutations or substitutions may be distributed across the variable heavy chain and the variable light chain.
- the up to 10 mutations or substitutions may be distributed across the binding region.
- the mutations or substitutions may be of conservative, physical or functional amino acids such that mutations or substitutions do not change the epitope or modify binding to the epitope.
- the present invention relates to antibodies witch binds to an extracellular domain of AXL without competing or interfering with Gas6 binding to AXL.
- the antibody binds to the extracellular domain Igl-like domain without competing or interfering with Gas6 binding to AXL.
- the antibody binds to the extracellular domain Igl-like and show no more than a 20% reduction in maximal Gas6 binding to AXL.
- the antibody show no more than a 15% reduction in maximal Gas6 binding to AXL.
- the antibody show no more than a 10% reduction in maximal Gas6 binding to AXL.
- the antibody show no more than a 5% reduction in maximal Gas6 binding to AXL.
- the antibody show no more than a 4% reduction in maximal Gas6 binding to AXL In one embodiment, the antibody show no more than a 2% reduction in maximal Gas6 binding to AXL. In one embodiment, the antibody show no more than a 1% reduction in maximal Gas6 binding. In one embodiment the antibody binds to the extracellular domain Ig2-like domain without competing or interfering with Gas6 binding to AXL. In one embodiment, the antibody binds to the extracellular domain Ig2-like and show no more than a 20%, such as no more than 15%, such as no more than 10%, such as no more than 5%, such as no more than 4%, such as no more than 2%, such as no more than 1%, reduction in maximal Gas6 binding to AXL. The embodiment's ability to compete with or reduce Gas6 binding may be determined as disclosed in Example 2 or Example 12. In one embodiment the antibody binds to the extracellular domain Ig2-like domain without competing or interfering with maximal Gas6 binding to AXL.
- the antibody binds to an epitope on AXL which epitope is recognized by an antibody herein described.
- the antibody binds to an epitope within the Igl-like domain of AXL, the epitope comprises or requires the amino acids corresponding to positions L121 to Q129 or T112 to Q124 of human AXL. In one embodiment, the antibody binds to an epitope within the Igl-like domain of AXL, the epitope comprises or requires one or more amino acids corresponding to positions L121 to Q129 or T112 to Q124 of human AXL.
- the epitope comprises one or more amino acid in position L121, G122, H123, Q124, T125, F126, V127, S128, Q129 or more amino acid in position T112, G113, Q114, Y115, Q116, C117, L118,V119, F120, L121, G122, H123, Q124.
- the antibody binds to an epitope within the Ig2-like domain of AXL which epitope comprises or requires the amino acids corresponding to position D170 or the combination of D179 and T182 to 190 of human AXL.
- the antibody binds to an epitope within the Ig2-like domain of AXL which epitope comprises or requires the amino acids corresponding to position D170 or the combination of D179 and one or more amino acids corresponding to positions T182 to R190 of human AXL.
- the epitope comprises one or more amino acid in position T182, A183, P183, G184, H185, G186, P187, Q189 , R190.
- the antibody binds to an epitope within the FNl-like domain of human AXL which epitope comprises or requires the amino acids corresponding to positions Q272 to A287 and G297 to P301 of human AXL.
- the antibody binds to an epitope within the FN2-like domain of human AXL which epitope comprises or requires the amino acids corresponding to positions A359, R386, and Q436 to K439 of human AXL.
- the antibody binds to an epitope within the FNl-like domain of human AXL.
- the antibody binds to an epitope on AXL which epitope is recognized by any one of the antibodies defined by
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively [733];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 53, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively [154];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively [154-M103L];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively, [171];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 65, GAS, and 66, respectively, [172];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 70, GAS, and 71, respectively, [181];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183-N52Q];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 81, AAS, and 82, respectively, [187];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 86, GAS, and 87, respectively, [608-01];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos. : 93, 94, and 95, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 96, GAS, and 97, respectively, [613];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos. : 103, 104, and 105, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 106, GAS, and 107, respectively, [620-06];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos. : 108, 109, and 110, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 112, AAS, and 113, respectively, [726];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos. : 108, 109, and 111, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 112, AAS, and 113, respectively, [726-M101L];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 41, 42, and 43, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 44, AAS, and 45, respectively, [140];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 93, 94, and 95, respectively, and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 128, XAS, wherein X is D or G, and 129, respectively, [613 / 613-08];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 46, 119, and 120, respectively; and a VL region comprising CDRl, CDR2, and CDR3 sequences of SEQ ID Nos. : 49, AAS, and 50, respectively, [148/140];
- VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 123, 124, and 125, respectively; and a VL region comprising CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively [171 / 172 / 181]; and
- w a VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 121, 109, and 122, respectively; and a VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 112, AAS, and 113, respectively [726/187]; and x) a VH region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.:93, 126, and 127, respectively; and a VL region comprising the CDR1, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively [613 / 608-01 / 610-01 / 620-06].
- the antibody comprises a heavy chain of an isotype selected from the group consisting of IgGl, lgG2, lgG3, and lgG4.
- isotype refers to the immunoglobulin class (for instance IgGl, lgG2, lgG3, lgG4, IgD, IgA, IgE, or IgM) or any allotypes thereof, such as IgGlm(za) and IgGlm(f)) that is encoded by heavy chain constant region genes. Further, each heavy chain isotype can be combined with either a kappa ( ⁇ ) or lambda ( ⁇ ) light chain.
- the isotype is IgGl, optionally allotype IgGlm(f).
- the antibody is a full-length monoclonal antibody, optionally a full- length monoclonal lgGl,K antibody.
- full-length antibody when used herein, refers to an antibody (e.g., a parent or variant antibody) which contains all heavy and light chain constant and variable domains corresponding to those that are normally found in a wild-type antibody of that isotype.
- a full-length antibody according to the present invention may be produced by a method comprising the steps of (i) cloning the CDR sequences into a suitable vector comprising complete heavy chain sequences and complete light chain sequence, and (ii) expressing the complete heavy and light chain sequences in suitable expression systems. It is within the knowledge of the skilled person to produce a full-length antibody when starting out from either CDR sequences or full variable region sequences. Thus, the skilled person would know how to generate a full-length antibody according to the present invention.
- the antibody is a human antibody.
- human antibody is intended to include antibodies having variable and framework regions derived from human germline immunoglobulin sequences and a human immunoglobulin constant domain.
- the human antibodies of the invention may include amino acid residues not encoded by human germline immunoglobulin sequences (e.g., mutations, insertions or deletions introduced by random or site-specific mutagenesis in vitro or by somatic mutation in vivo).
- human antibody as used herein, is not intended to include antibodies in which CDR sequences derived from the germline of another non-human species, such as a mouse, have been grafted onto human framework sequences.
- a human antibody is "derived from" a particular germline sequence if the antibody is obtained from a system using human immunoglobulin sequences, for instance by immunizing a transgenic mouse carrying human immunoglobulin genes or by screening a human immunoglobulin gene library, and wherein the selected human antibody is at least 90%, such as at least 95%, for instance at least 96%, such as at least 97%, for instance at least 98%, or such as at least 99% identical in amino acid sequence to the amino acid sequence encoded by the germline immunoglobulin gene.
- a human antibody derived from a particular human germline sequence will display no more than 20 amino acid differences, e.g. no more than 10 amino acid differences, such as no more than 9, 8, 7, 6 or 5, for instance no more than 4, 3, 2, or 1 amino acid difference from the amino acid sequence encoded by the germline immunoglobulin gene.
- the antibody according to the present invention may comprise amino acid modifications in the immunoglobulin heavy and/or light chains.
- amino acids in the Fc region of the antibody may be modified.
- Fc region refers to a region comprising, in the direction from the N- to C-terminal end of the antibody, at least a hinge region, a CH2 region and a CH3 region.
- An Fc region of the antibody may mediate the binding of the immunoglobulin to host tissues or factors, including various cells of the immune system (such as effector cells) and components of the complement system.
- hinge region refers to the hinge region of an immunoglobulin heavy chain.
- the hinge region of a human IgGl antibody corresponds to amino acids 216-230 according to the Eu numbering as set forth in Kabat [26].
- the hinge region may also be any of the other subtypes as described herein.
- CHI region refers to the CHI region of an immunoglobulin heavy chain.
- the CHI region of a human IgGl antibody corresponds to amino acids 118-215 according to the Eu numbering as set forth in Kabat [26].
- the CHI region may also be any of the other subtypes as described herein.
- CH2 region refers to the CH2 region of an immunoglobulin heavy chain.
- the CH2 region of a human IgGl antibody corresponds to amino acids 231-340 according to the Eu numbering as set forth in Kabat [26].
- the CH2 region may also be any of the other subtypes as described herein.
- CH3 region refers to the CH3 region of an immunoglobulin heavy chain.
- the CH3 region of a human IgGl antibody corresponds to amino acids 341-447 according to the Eu numbering as set forth in Kabat [26].
- the CH3 region may also be any of the other subtypes as described herein.
- the antibody is an effector-function-deficient antibody, a stabilized lgG4 antibody or a monovalent antibody.
- the heavy chain has been modified such that the entire hinge region has been deleted.
- sequence of the antibody has been modified so that it does not comprise any acceptor sites for N-linked glycosylation.
- the antibody is a single-chain antibody.
- the present invention relates to a multispecific antibody comprising at least a first binding region of an antibody according to any aspect or embodiment herein described, and a second binding region which binds a different target or epitope than the first binding region.
- multispecific antibody refers to antibodies wherein the binding regions two to at least two, such as at least three, different antigens or at least two, such as at least three, different epitopes on the same antigen.
- the present invention relates to a bispecific antibody comprising a first binding region of an antibody according to any aspect or embodiments herein described, and a second binding region which binds a different target or epitope than the first binding region.
- binding molecules such as antibodies wherein the binding regions of the binding molecule bind to two different antigens or two different epitopes on the same antigen.
- bispecific antibody refers to an antibody having specificities for at least two different, typically non-overlapping, epitopes. Such epitopes may be on the same or different targets. If the epitopes are on different targets, such targets may be on the same cell or different cells, cell types or structures, such as extracellular tissue.
- different target refers to another protein, molecule or the like than AXL or an AXL fragment.
- the bispecific antibody of the present invention is a diabody, a cross-body, such as CrossMabs, or a bispecific antibody obtained via a controlled Fab arm exchange (such as described in [30]).
- bispecific antibodies include but are not limited to (i) IgG-like molecules with complementary CH3 domains to force heterodimerization; (ii) recombinant IgG-like dual targeting molecules, wherein the two sides of the molecule each contain the Fab fragment or part of the Fab fragment of at least two different antibodies; (iii) IgG fusion molecules, wherein full length IgG antibodies are fused to extra Fab fragment or parts of Fab fragment; (iv) Fc fusion molecules, wherein single chain Fv molecules or stabilized diabodies are fused to heavy-chain constant-domains, Fc-regions or parts thereof; (v) Fab fusion molecules, wherein different Fab- fragments are fused together, fused to heavy-chain constant-domains, Fc-regions or parts thereof; and (vi) ScFv-and diabody-based and heavy chain antibodies (e.g., domain antibodies, Nanobodies ® ) wherein different single chain Fv molecules or different diabodies or different heavy chain antibodies (e
- IgG-like molecules with complementary CH3 domains molecules include but are not limited to the Triomab ® (Trion Pharma/Fresenius Biotech, [31]), the Knobs-into-Holes (Genentech, [32]), CrossMAbs (Roche, [33]) and the electrostatically-matched (Amgen, [34] and [35]; Chugai, [36]; Oncomed, [37]), the LUZ-Y (Genentech), DIG-body and PIG-body (Pharmabcine), the Strand Exchange Engineered Domain body (SEEDbody)(EMD Serono, [38]), the Biclonics (Merus), FcAAdp (Regeneron, [39]), bispecific IgGl and lgG2 (Pfizer/Rinat, [40]), Azymetric scaffold (Zymeworks/Merck, [41]), mAb-Fv (Xencor, [42]), bivalent bispecific antibodies (Roche [
- IgG-like dual targeting molecules include but are not limited to Dual Targeting (DT)-lg (GSK/Domantis), Two-in-one Antibody (Genentech), Cross-linked Mabs (Karmanos Cancer Center), mAb2 (F-Star, [44]), ZybodiesTM (Zyngenia), approaches with common light chain (Crucell/Merus, [45]), K Bodies (Novlmmune) and CovX-body (CovX/Pfizer).
- DT Dual Targeting
- GSK/Domantis Two-in-one Antibody
- Cross-linked Mabs Karmanos Cancer Center
- mAb2 F-Star, [44]
- ZybodiesTM Zyngenia
- approaches with common light chain Crucell/Merus, [45]
- K Bodies Novlmmune
- CovX-body CovX/Pfizer
- IgG fusion molecules include but are not limited to Dual Variable Domain (DVD)-lgTM (Abbott, [46]), Dual domain double head antibodies (Unilever; Sanofi Aventis, [47]), IgG-like Bispecific (ImClone/Eli Lilly), Ts2Ab (Medlmmune/AZ) and BsAb (Zymogenetics), HERCULES (Biogen personal, [48]), scFv fusion (Novartis), scFv fusion (Changzhou Adam Biotech Inc, [49]) and TvAb (Roche, [50], [51]).
- DVD Dual Variable Domain
- VFD Dual Variable Domain
- Dual domain double head antibodies Unilever; Sanofi Aventis, [47]
- IgG-like Bispecific ImClone/Eli Lilly
- Ts2Ab Medlmmune/AZ
- BsAb Zymogenetics
- HERCULES Biogen personal, [48]
- Fc fusion molecules include but are not limited to ScFv/Fc Fusions (Academic Institution), SCORPION (Emergent BioSolutions/Trubion, Zymogenetics/BMS), Dual Affinity Retargeting Technology (Fc-DARTTM) (MacroGenics, [52], [53]) and Dual(ScFv)2-Fab (National Research Center for Antibody Medicine - China).
- Fab fusion bispecific antibodies include but are not limited to F(ab)2 (Medarex/AMGEN), Dual-Action or Bis-Fab (Genentech), Dock-and-Lock ® (DNL) (ImmunoMedics), Bivalent Bispecific (Biotecnol) and Fab-Fv (UCB-Celltech).
- ScFv-, diabody-based and domain antibodies include but are not limited to Bispecific T Cell Engager (BiTE ® ) (Micromet, Tandem Diabody (TandabTM) (Affimed), Dual Affinity Retargeting Technology (DART) (MacroGenics), Single-chain Diabody (Academic), TCR-like Antibodies (AIT, ReceptorLogics), Human Serum Albumin ScFv Fusion (Merrimack) and COMBODY (Epigen Biotech), dual targeting nanobodies ® (Ablynx), dual targeting heavy chain only domain antibodies.
- a bispecific antibody according the present invention may be generated by introducing modifications in the constant region of the antibody.
- amino acids of the constant region sequences are herein numbered according to the Eu-index of numbering (described in [26]).
- the terms "Eu-index of numbering” and “Eu numbering as set forth in Kabat” may be used interchangeably and have the same meaning and purpose.
- an amino acid or segment in one sequence that "corresponds to" an amino acid or segment in another sequence is one that aligns with the other amino acid or segment using a standard sequence alignment program such as ALIGN, ClustalW or similar, typically at default settings and has at least 50%, at least 80%, at least 90%, or at least 95% identity to a human IgGl heavy chain. It is well-known in the art how to align a sequence or segment in a sequence and thereby determine the corresponding position in a sequence to an amino acid position according to the present invention.
- amino acid corresponding to positions refers to an amino acid position number in a human IgGl heavy chain.
- the present invention also provides antibodies comprising functional variants of the VL region, VH region, or one or more CDRs of the antibodies of the examples.
- a functional variant of a VL, VH, or CD used in the context of an AXL antibody still allows the antibody to retain at least a substantial proportion (at least about 50%, 60%, 70%, 80%, 90%, 95%, 99% or more) of the affinity/avidity and/or the specificity/selectivity of the parent antibody and in some cases such an AXL antibody may be associated with greater affinity, selectivity and/or specificity than the parent antibody.
- Such functional variants typically retain significant sequence identity to the parent antibody.
- the comparison of sequences and determination of percent identity between two sequences may be accomplished using a mathematical algorithm, which is well-known in the art.
- the VH, VL and/or CDR sequences of variants may differ from those of the parent antibody sequences through mostly conservative substitutions; for instance at least about 35%, about 50% or more, about 60% or more, about 70% or more, about 75% or more, about 80% or more, about 85% or more, about 90% or more, (e.g., about 65-95%, such as about 92%, 93% or 94%) of the substitutions in the variant are conservative amino acid residue replacements.
- the VH, VL and/or CDR sequences of variants may differ from those of the parent antibody sequences through mostly conservative substitutions; for instance 10 or less, such as 9 or less, 8 or less, 7 or less, 6 or less, 5 or less, 4 or less, 3 or less, 2 or less or 1 of the substitutions in the variant are conservative amino acid residue replacements.
- amino acid and “amino acid residue” may herein be used interchangeably, and are not to be understood limiting.
- amino acid may be defined by conservative or non-conservative amino acids, and may therefore be classified accordingly.
- Amino acid residues may also be divided into classes defined by alternative physical and functional properties. Thus, classes of amino acids may be reflected in one or both of the following tables:
- Xaa or X may typically represent any of the 20 naturally occurring amino acids.
- naturally occurring refers to any one of the following amino acid residues; glycine, alanine, valine, leucine, isoleucine, serine, threonine, lysine, arginine, histidine, aspartic acid, asparagine, glutamic acid, glutamine, proline, tryptophan, phenylalanine, tyrosine, methionine, and cysteine.
- K409R or “Lys409Arg” means, that the antibody comprises a substitution of Lysine with Arginine in amino acid position 409.
- the more than one amino acid may be separated by ",” or "/”.
- the substitution of Lysine with Arginine, Alanine, or Phenylalanine in position 409 is: "Lys409Arg,Ala,Phe” or “Lys409Arg/Ala/Phe” or "K409R,A,F” or "K409R/A/F” or "K409 to R, A, or F”.
- a substitution embraces a substitution into any one or the other nineteen natural amino acids, or into other amino acids, such as non-natural amino acids.
- a substitution of amino acid K in position 409 includes each of the following substitutions: 409A, 409C, 409D, 409E, 409F, 409G, 409H, 4091, 409L, 409M, 409N, 409Q, 409R, 409S, 409T, 409V, 409W, 409P, and 409Y. This is, by the way, equivalent to the designation 409X, wherein the X designates any amino acid other than the otiginal amino acid.
- su bstitutions may also be designated K409A, K409C, etc. or K409A,C, etc. or K409A/C/etc. The same applies by analogy to each and every position mentioned herein, to specifically include herein any one of such su bstitutions.
- the antibody according to the invention may also comprise a deletion of an amino acid residue.
- Such deletion may be denoted “del”, and includes, e.g., writing as K409del.
- the Lysine in position 409 has been deleted from the amino acid sequence.
- the bispecific antibody comprises a first and a second heavy chain, each of the first and second heavy chain comprises at least a hinge region, a CH2 and CH3 region, wherein in the first heavy chain at least one of the amino acids in the positions corresponding to positions selected from the group consisting of K409, T366, L368, K370, D399, F405, and Y407 in a human IgGl heavy chain has been substituted, and in the second heavy chain at least one of the amino acids in the positions corresponding to a position selected from the group consisting of F405, T366, L368, K370, D399, Y407, and K409 in a human IgGl heavy chain has been substituted, and wherein the first and the second heavy chains are not substituted in the same positions.
- the amino acid in the position corresponding to K409 in a human IgGl heavy chain is not K, L or M and optionally the amino acid in the position corresponding to F405 in a human IgGl heavy chain is F
- the amino acid in the position corresponding to F405 in a human IgGl heavy chain is not F and the amino acid in the position corresponding to K409 in a human IgGl heavy chain is K.
- the amino acid in the position corresponding to F405 in a human IgGl heavy chain is not F, R, and G
- the amino acids in the positions corresponding to a position selected from the group consisting of; T366, L368, K370, D399, Y407, and K409 in a human IgGl heavy chain has been substituted.
- the amino acid in position corresponding to K409 in a human IgGl heavy chain is another than K, L or M in the first heavy chain, and in the second heavy chain the amino acid in position corresponding to F405 in a human IgGl heavy chain is not F and optionally the amino acid in the position corresponding to K409 in a human IgGl heavy chain is K.
- the amino acid in the position corresponding to F405 in a human IgGl heavy chain is L in said first heavy chain, and the amino acid in the position corresponding to K409 in a human IgGl heavy chain is R in said second heavy chain, or vice versa.
- the amino acid in the position corresponding to K409 in a human IgGl heavy chain is R in the first heavy chain
- the amino acid in the position corresponding to F405 in a human IgGl heavy chain is L in the second heavy chain.
- both the first and the second binding region of the bispecific antibody bind AXL.
- the first binding region comprises a different set of CDR sequences than the second binding region.
- the bispecific antibody comprising a first and a second binding region, and a first and a second heavy chain, wherein the first and the second binding regions each comprise a VH and VL region selected from the group consisting of;
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 51, 52, and 54, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 55, GAS, and 56, respectively. [154-M103L];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively, [171];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 62, 63, and 64, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 65, GAS, and 66, respectively, [172];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 67, 68, and 69, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 70, GAS, and 71, respectively, [181];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 73, and 75, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183-N52Q];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 81, AAS, and 82, respectively, [187];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 86, GAS, and 87, respectively, [608-01];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 91, GAS, and 92, respectively, [610-01];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 94, 95, and 95, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively, [613]; a first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 106, GAS, and 107, respectively, [620-06];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 36, 37, and 38, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 39, GAS, and 40, respectively, [107]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726-M101L];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively, and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively [733];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 41, 42, and 43, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 44, AAS, and 45, respectively, [107];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 51, 52, and 55, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos. : 55, GAS, and 56, respectively. [154];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos. : 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 51, 52, and 54, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos. : 55, GAS, and 56, respectively. [154-M103L];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 57, 58, and 59, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 60, GAS, and 61, respectively, [171];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 62, 63, and 64, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 65, GAS, and 66, respectively, [172];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 67, 68, and 69, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 72, 74, and 75, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos. : 76, ATS, and 77, respectively, [183-N52Q];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos. : 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 78, 79, and 80, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 81, AAS, and 82, respectively, [187];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 83, 84, and 85, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 86, GAS, and 87, respectively, [608-01];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 88, 89, and 90, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 91, GAS, and 92, respectively, [610-01];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 94, 95, and 95, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 96, GAS, and 97, respectively, [613];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 98, 99, and 100, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 101, DAS, and 102, respectively, [613-08];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos. : 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 103, 104, and 105, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 106, GAS, and 107, respectively, [620-06];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 108, 109, and 110, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 112, AAS, and 113, respectively, [726];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 46, 47, and 48, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 49, AAS, and 50, respectively, [148]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos.: 108, 109, and 111, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 112, AAS, and 113, respectively, [726-M101L];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 114, 115, and 116, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.
- a first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 114, 115, and 116, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 57, 58, and 59, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 60, GAS, and 61, respectively, [171];
- nn a first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 114, 115, and 116, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 62, 63, and 64, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ I D Nos. : 65, GAS, and 66, respectively, [172];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 72, 74, and 75, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 76, ATS, and 77, respectively, [183-N52Q];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 78, 79, and 80, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 81, AAS, and 82, respectively, [187];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 83, 84, and 85, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 86, GAS, and 87, respectively, [608-01];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 88, 89, and 90, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 91, GAS, and 92, respectively, [610-01];
- first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 94, 95, and 95, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 96, GAS, and 97, respectively, [613]; v) a first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.:
- ww a first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 103, 104, and 105, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 106, GAS, and 107, respectively, [620-06];
- a first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 110, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726]; and
- yy a first VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 114, 115, and 116, respectively; and a first VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 117, DAS, and 118, respectively, [733]; and a second VH region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 108, 109, and 111, respectively; and a second VL region comprising the CDRl, CDR2, and CDR3 sequences of SEQ ID Nos.: 112, AAS, and 113, respectively, [726-M101L];
- the antibodies according to any aspect or embodiment of the present invention may be conjugated to a therapeutic or diagnostic moiety, such as a cytotoxic agent, a chemotherapeutic drug, a cytokine, an immunosuppressant, antibiotic, or a radioisotope.
- a therapeutic or diagnostic moiety such as a cytotoxic agent, a chemotherapeutic drug, a cytokine, an immunosuppressant, antibiotic, or a radioisotope.
- Such conjugates are referred to herein as “immunoconjugates”.
- Immunoconjugates which include one or more cytotoxins are referred to as "immunotoxins”.
- Antibodies conjugated to a cytotoxic agent, drug or the like are also known as antibody-drug conjugates (ADC).
- ADC antibody-drug conjugates
- An immunoconjugate may have a half-life of sufficient periods of time for the antibody-drug conjugate to be internalized, degraded and induce cell killing by the
- the present invention relates to an immunoconjugate comprising the antibody according to any aspect or embodiment herein described, or a bispecific antibody according to any aspect or embodiment herein described, and a therapeutic moiety, such as a cytotoxic agent, a chemotherapeutic drug, a cytokine, an immunosuppressant, antibiotic, or a radioisotope.
- a therapeutic moiety such as a cytotoxic agent, a chemotherapeutic drug, a cytokine, an immunosuppressant, antibiotic, or a radioisotope.
- the cytotoxic agent, chemotherapeutic drug, cytokine, immunosuppressant, antibiotic, or radioisotope may be conjugated to the antibody or the bispecific antibody via a linker.
- ADCs are often designed such that the cytotoxic payload is inactive when conjugated to the antibody.
- the cytotoxic payload may be released intracellularly upon internalization of the ADC after binding to the plasma-membrane of cells, or alternatively in response to proteolytic activity in the tumor microenvironment.
- the term "internalized” or “internalization” as used herein, refers to a biological process in which molecules such as the antibody according to the present invention, are engulfed by the cell membrane and drawn into the interior of the cell. It may also be referred to as "endocytosis".
- antibodies according to any aspect or embodiment of the present invention may be internalized into the cell upon binding to the target, AXL.
- antibodies which undergo internalization may be suited for conjugation to a cytotoxic agent, drug, or the like, optionally via a linker, which is designed to be cleaved intracellularly.
- the ADC may be delivered to lysosomes in most cases, where effective drug release takes advantage of the catabolic environment found with these organelles. It is typically a linker that connects the antibody with a cytotoxic agent.
- linkers have been designed to be cleaved only in a specific microenvironment found in or on the target tumor cell or in the tumor microenvironment. Examples include linkers that are cleaved by acidic conditions, reducing conditions, or specific proteases.
- Stability of the antibody-linker-drug in circulation is important because this allows antibody-mediated delivery of the drug to specific target cells.
- the long circulating half-life of the ADC provides exposure for several days to weeks post injection.
- Drugs that are conjugated through non-cleavable linkers and protease-cleavable linkers are generally more stable in circulation than disulfide and hydrazone linkers, although the stability of the latter two linkers can be tuned by altering the neighboring chemical structure [6].
- the therapeutic moiety is a cytotoxic agent.
- a cytotoxin or cytotoxic agent includes any agent that is detrimental to (e.g., kills) cells.
- Suitable cytotoxic agents for forming immunoconjugates of the present invention include taxol, tubulysins, duostatins, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, maytansine or an analog or derivative thereof, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin; calicheamicin or analogs or derivatives thereof; antimetabolites (such as met
- rachelmycin or analogs or derivatives of CC-1065
- dolastatin auristatin
- antibiotics such as dactinomycin (formerly actinomycin), bleomycin, daunorubicin (formerly daunomycin), doxorubicin, idarubicin, mithramycin, mitomycin, mitoxantrone, plicamycin, anthramycin (AMC)
- anti-mitotic agents e.g., tubulin-targeting agents
- diphtheria toxin and related molecules such as diphtheria A chain and active fragments thereof and hybrid molecules
- ricin toxin such as ricin A or a deglycosylated ricin A chain toxin
- cholera toxin a Shiga-like toxin
- conjugated molecules include antimicrobial/lytic peptides such as CLIP, Magainin 2, mellitin, Cecropin, and P18; ribonuclease ( Nase), DNase I, Staphylococcal enterotoxin-A, pokeweed antiviral protein, diphtherin toxin, and Pseudomonas endotoxin. See, for example, Pastan et al., Cell 47, 641 (1986) and Goldenberg, Calif. A Cancer Journal for Clinicians 44, 43 (1994).
- Therapeutic agents that may be administered in combination with anti-AXL antibodies or antibody-drug conjugates of the present invention as described elsewhere herein, such as, e.g., anti-cancer cytokines or chemokines, are also candidates for therapeutic moieties useful for conjugation to an antibody disclosed in the present invention.
- cytotoxic agent refers to any agent that is detrimental to (e.g., kills) cells.
- cytotoxic agent refers to any agent that is detrimental to (e.g., kills) cells.
- the cytotoxic agent is linked to said antibody, or fragment thereof, with a cleavable linker, such as /V-succinimydyl 4-(2-pyridyldithio)-pentanoate (SSP), maleimidocaproyl- valine-citrulline-p-aminobenzyloxycarbonyl (mc-vc-PAB) or AV-1 K-lock valine-citrulline.
- a cleavable linker such as /V-succinimydyl 4-(2-pyridyldithio)-pentanoate (SSP), maleimidocaproyl- valine-citrulline-p-aminobenzyloxycarbonyl (mc-vc-PAB) or AV-1 K-lock valine-citrulline.
- cleavable linker refers to a subset of linkers that are catalyzed by specific proteases in the targeted cell or in the tumor microenvironment, resulting in release of the cytotoxic agent.
- Examples of cleavable linkers are linkers based on chemical motifs including disulfides, hydrazones or peptides.
- Another subset of cleavable linker adds an extra linker motif between the cytotoxic agent and the primary linker, i.e. the site that attaches the linker-drug combination to the antibody.
- the extra linker motif is cleavable by a cleavable agent that is present in the intracellular environment (e. g.
- the linker can be, e. g. a peptidyl linker that is cleaved by an intracellular peptidase or protease enzyme, including but not limited to, a lysosomal or endosomal protease.
- the peptidyl linker is at least two amino acids long or at least three amino acids long.
- Cleaving agents can include cathepsins B and D and plasmin, all of which are known to hydrolyze dipeptide drug derivatives resulting in the release of active drug inside the target cells (see e. g. Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123).
- the peptidyl linker cleavable by an intracellular protease is a Val-Cit (valine-citrulline) linker or a Phe-Lys (phenylalanine-lysine) linker (see e.g. US6214345, which describes the synthesis of doxorubicin with the Val-Cit linker).
- Val-Cit valine-citrulline
- Phe-Lys phenylalanine-lysine linker
- the cytotoxic agent is linked to said antibody, or fragment thereof, with a non-cleavable linker, such as succinimidyl-4(/V-maleimidomethyl)cyclohexane-l- carboxylate (MCC) or maleimidocaproyl (MC).
- a non-cleavable linker such as succinimidyl-4(/V-maleimidomethyl)cyclohexane-l- carboxylate (MCC) or maleimidocaproyl (MC).
- noncleavable linker refers to a subset of linkers which, in contrast to cleavable linkers, do not comprise motifs that are specifically and predictably recognized by intracellular or extracellular proteases.
- ADCs based on non-cleavable linkers are not released or cleaved form the antibody until the complete antibody-linker-drug complex is degraded in the lysosomal compartment.
- examples of a non-cleavable linker are thioethers.
- the linker unit is not cleavable and the drug is released by antibody degradation (see [57]). Typically, such a linker is not substantially sensitive to the extracellular environment.
- not su bstantially sensitive to the extracellular environment in the context of a linker means that no more than 20%, typically no more than a bout 15%, more typically no more than a bout 10%, and even more typically no more than a bout 5%, no more than a bout 3%, or no more than about 1% of the linkers, in a sample of antibody drug conjugate compound, are cleaved when the antibody drug conjugate compound is present in an extracellular environment (e.g. plasma ).
- an extracellular environment e.g. plasma
- Whether a linker is not su bstantially sensitive to the extracellular environment can be determined for example by incu bating with plasma the antibody drug conjugate compound for a predetermined time period (e.g. 2, 4, 8, 16 or 24 hou rs) and then quantitating the amount of free drug present in the plasma.
- cytotoxic agent is selected from the group: DNA-targeting agents, e.g. DNA alkylators and cross-linkers, such as calicheamicin, duocarmycin, rachelmycin (CC-1065), pyrrolo[2, l-c] [l,4] benzodiazepines (PBDs), and indolinobenzodiazepine (IGN); microtu bule-targeting agents, such as duostatin, such as duostatin-3, auristatin, such as monomethylauristatin E (M MAE) and monomethylauristatin F (M MAF), dolastatin, maytansine, /V(2')-deacetyl-/V(2')-(3-marcapto-l- oxopropyl)-maytansine (DM 1), and tu bulysin; and nucleoside analogs; or an analogs, derivatives, or prodrugs thereof.
- DNA-targeting agents e.g
- the immunoconjugate comprise a com bination of
- bystander killing effect refers to the effect where the cytotoxic agent that is conjugated to the antibody by either a cleava ble or non-cleava ble linker has the capacity to diffuse across cell membranes after the release from the antibody a nd thereby cause killing of neighboring cells.
- the cytotoxic agent when conjugated by a cleava ble or non-cleavable linker, it may be either the cytotoxic agent only or the cytotoxic agent with a part of the linker that has the bystander kill capacity.
- the capacity to diffuse across cell membranes is related to the hydrophobicity of the the cytotoxic agent or the com bination of the cytotoxic agent and the linker.
- cytotoxic agents may advantageously be membrane-permea ble toxins, such as M MAE that has been released from the antibody by proteases.
- a bystander killing effect may be desira ble.
- no bystander kill capacity refers to the effect where the cytotoxic agent that is conjugated to the antibody by either a cleavable or non-cleavable linker does not have the capacity to diffuse across cell membranes after release from the antibody.
- cytotoxic agents or combinations of the cytotoxic agent with the linker will not be able to kill neighboring cells upon release from the antibody. It is believed without being bound by theory, that such combinations of a cytotoxic agent and either a cleavable or non-cleavable linker will only kill cells expressing the target that the antibody binds.
- a stable link between the antibody and cytotoxic agent is an important factor of an ADC.
- Both cleavable and non-cleavable types of linkers have been proven to be safe in preclinical and clinical trials.
- the cytotoxic agent is chosen from the group of microtubule targeting agents, such as auristatins and maytansinoids.
- microtu bule-targeting agent refers to an agent or drug which inhibits mitosis (cell division).
- Microtubules are structures that are essential for proper separation of DNA during cell division, and microtubule function critically depends on 'dynamic instability', i.e. the process in which microtubule structures are continuously elongated and shortened.
- Microtubule-targeting agents disrupt or stabilize microtubules, which prevents formation of the mitotic spindle, resulting in mitotic arrest and apoptosis.
- the microtubule-targeting agents can be derived from e.g.
- microtubule-targeting agents are paclitaxel, docetaxel, vinblastine, vincristine, vinorelbine, duostatins, auristatins, maytansanoids, tubulysins, and dolastatin.
- the cytotoxic agent is auristatins or auristatin peptide analogs and derivates ([131]; [132]).
- Auristatins have been shown to interfere with microtubule dynamics, GTP hydrolysis and nuclear and cellular division [133] and have anti-cancer [134] and anti-fungal activity [135].
- the auristatin drug moiety may be attached to the antibody via a linker, through the N (amino) terminus or the C (terminus) of the peptidic drug moiety.
- Exemplary auristatin embodiments include the N-terminus-linked monomethyl auristatin drug moieties DE and DF, disclosed in [136] and described in [137].
- the cytotoxic agent is monomethyl auristatin E (MMAE); wherein the antibody is linked to M MAE at the nitrogen (N) on the left-hand side of the chemical structure a bove by the appropriate linker.
- MMAE monomethyl auristatin E
- the cytotoxic agent monomethyl auristatin E (M MAE) is linked to the antibody via a valine-citrulline (VC) linker.
- the cytotoxic agent monomethyl auristatin E is linked to the antibody via a valine-citrulline (VC) linker and the maleimidocaproyi (MC)linker, wherein the com bination of the cytotoxic agent and the linkers has the chemical structure;
- MAb is the antibody
- the cytotoxic agent is monomethyl auristatin F (M MAF);
- the cytotoxic agent monomethyl auristatin F (M MAF) is linked to the antibody via a maleimidocaproyi (mc)-linker, wherein the combination of the cytotoxic agent and linker has the chemical structure
- MAb is the antibody
- the cytotoxic agent is d uostatin3.
- the cytotoxic agent is a DNA-targeting agent.
- DNA-acting agent refers to a specific class of cytotoxic agents which are able to alkylate and/or cross-link DNA.
- IGN agents comprising indolino-benzodiazepinedimers and pyrrolo[2,l-c] [1,4] benzodiazepines (PBDs) which are highly potent by virtue of their ability to alkylate and cross-link DNA.
- PBDs pyrrolo[2,l-c] [1,4] benzodiazepines
- IGN agents comprising indolino-benzodiazepinemonomers which are highly potent by virtue of the ability to alkylate only DNA.
- Duocarmycins are another class of DNA-acting agents. Duocarmycins are small-molecule, synthetic DNA minor groove binding alkylating agents. These compounds are suitable to target solid tumors as well as hematological tumors.
- the immunoconjugate comprises two to four cytotoxic molecules per antibody.
- two to four cytotoxic molecules per antibody may be superior to more heavily loaded conjugates that are cleared more rapidly from the circulation than less loaded conjugates.
- the cytotoxic agent loading is represented by p and is the average number of cytotoxic agent moieties per antibody in a molecule (also designated as the drug to antibody ratio, DA ).
- the cytotoxic agent loading may range from 1 to 20 drug moieties per antibody and may occur on amino acids with useful functional groups such as, but not limited to, amino or sulfhydryl groups, as in lysine or cysteine.
- the number of cytotoxic agents per antibody is from 1 to 8, such as 2 to 7, such as 2 to 6, such as 2 to 5, such as 2 to 4, and such as 2 to 3.
- the immunoconjugate comprises four to eight cytotoxic molecules per antibody. In another embodiment, the immunoconjugate comprises six to ten cytotoxic molecules per antibody. In yet another embodiment, the immunoconjugate comprises 10 to 30, such as 15 to 25, such as 20, cytotoxic molecules per antibody.
- p may be limited by the number of attachment sites on the antibody, for example where the attachment is a cysteine thiol or a lysine.
- the attachment is a cysteine thiol or a lysine.
- antibodies do not contain many free and reactive cysteine thiol groups which may be linked to a drug moiety as most cysteine thiol residues in antibodies exist as disulfide bridges. Therefore, in those embodiments, where the cytotoxic agent is conjugated via a cysteine thiol, the antibody may be reduced with reducing agent such as dithiothreitol (DTT) or tricarbonylethylphosphine (TCEP), under partial or fully reducing conditions, to generate reactive cysteine thiol groups.
- DTT dithiothreitol
- TCEP tricarbonylethylphosphine
- the drug loading for an ADC of the invention ranges from 1 to about 8, as a maximum of 8 free cysteine thiol groups becomes available after (partial) reduction of the antibody (there are 8 cysteines involved in inter-chain disulfide bonding).
- the drug linker moiety is vcMMAE.
- vcM MAE drug linker moiety and conjugation methods are disclosed in [27]; [28]; [145], [146]; and [147], (which are incorporated herein by reference)
- vcMMAE is form by conjugation of the linker mc-vc-PAB and the cytotoxic moiety MMAE, and the vcMMAE drug linker moiety is bound to the anti-AXL antibodies at the cysteine residues using a method similar to those disclosed therein.
- the drug linker moiety is mcMMAF.
- the mcMMAF drug linker moiety and conjugation methods are disclosed in [138]; [139], and [140] (which are incorporated herein by reference), and the mcMMAF drug linker moiety is bound to the anti-AXL antibodies at the cysteine residues using a method similar to those disclosed therein.
- the cytotoxic agent is linked to 1 or 2 lysines within the antibody amino acid sequence by K-LockTM conjugation as described in [58], [148], and [149] , and the duostatin3 (also known as Duo3) is bound to the anti-AXL antibodies at the lysine residues using a method similar to those described therein.
- linker technologies may be used in the anti-AXL antibody drug conjugates of the invention, such as linkers comprising a hydroxyl group.
- the linker is attached to free cysteine residues of the anti-AXL antibody obtained by (partial) reduction of the anti-AXL antibody.
- the linker is mc-vc-PAB and the cytotoxic agent is MMAE; or the linker SSP and the cytotoxic agent is DM1.
- the linker is MMC and the cytotoxic agent is DM1; or the linker is MC and the cytotoxic agent is MMAF.
- the linker is the cleavable linker AV1-K lock and the cytotoxic agent is duostatin3.
- the immunoconjugate comprises the linker mc-vc-PAB, the cytotoxic agent MMAE and an antibody wherein the at least one binding region comprises a VH region and a VL region selected from the group consisting of;
- VH region comprising SEQ ID No: 16 and a VL region comprising SEQ ID No: 18 [183]; g) a VH region comprising SEQ ID No: 25 and a VL region comprising SEQ ID No: 26 [613]; h) a VH region comprising SEQ ID No: 31 and a VL region comprising SEQ ID No: 33
- VH region comprising SEQ ID No: 3 and a VL region comprising SEQ ID No: 4 [140]; j) a VH region comprising SEQ ID No:8 and a VL region comprising SEQ ID No:9 [154-
- VH region comprising SEQ ID No:12 and a VL region comprising SEQ ID No:13 [172]; I) a VH region comprising SEQ ID No:14 and a VL region comprising SEQ ID No:15 [181]; m) a VH region comprising SEQ ID No:17 and a VL region comprising SEQ ID No:18 [183-
- VH region comprising SEQ ID No:19 and a VL region comprising SEQ ID No:20 [187]; o) a VH region comprising SEQ ID No:21 and a VL region comprising SEQ ID No:22 [608-
- an anti-AXL antibody drug conjugate disclosed in the present invention comprises a conjugated nucleic acid or nucleic acid-associated molecule.
- the conjugated nucleic acid is a cytotoxic ribonuclease, an antisense nucleic acid, an inhibitory NA molecule (e.g., a siRNA molecule) or an immunostimulatory nucleic acid (e.g., an immunostimulatory CpG motif-containing DNA molecule).
- an anti-AXL antibody of the invention is conjugated to an aptamer or a ribozyme or a functional peptide analog or derivate thereof.
- anti-AXL antibody drug conjugates comprising one or more radiolabeled amino acids are provided.
- a radiolabeled anti-AXL antibody may be used for both diagnostic and therapeutic purposes (conjugation to radiolabeled molecules is another possible feature).
- Non-limiting examples of labels for polypeptides include 3 H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, and 125 ⁇ , 131 l, and 186 e.
- Methods for preparing radiolabeled amino acids and related peptide derivatives are known in the art (see for instance [59] and [60], [61], [62], [63], [64] and [65]US 5,697,902.
- a radioisotope may be conjugated by a chloramine T method.
- the antibody is conjugated to a radioisotope or to a radioisotope- containing chelate.
- the antibody can be conjugated to a chelator linker, e.g. DOTA, DTPA or tiuxetan, which allows for the antibody to be complexed with a radioisotope.
- the antibody may also or alternatively comprise or be conjugated to one or more radiolabeled amino acids or other radiolabeled molecules.
- a radiolabeled anti-AXL antibody may be used for both diagnostic and therapeutic purposes.
- Non-limiting examples of radioisotopes include 3 H, 14 C, 15 N, 35 S, 90 Y, 99 Tc, 125 l, m ln, 131 l, 186 Re, 213 Bs, 225 Ac and 227 Th.
- Anti-AXL antibodies may also be chemically modified by covalent conjugation to a polymer to for instance increase their circulating half-life.
- exemplary polymers, and methods to attach them to peptides are illustrated in for instance [66]; [67]; [68]; and [69].
- Additional polymers include polyoxyethylated polyols and polyethylene glycol (PEG) (e.g., a PEG with a molecular weight of between about 1,000 and about 40,000, such as between about 2,000 and about 20,000). This may for example be used if the anti-AXL antibody is a fragment.
- PEG polyethylene glycol
- any method known in the art for conjugating the anti-AXL antibody according to the present invention to the conjugated molecule(s), such as those described above, may be employed, including the methods described by [70], [71] and [72].
- Such antibodies may be produced by chemically conjugating the other moiety to the N-terminal side or C-terminal side of the anti-AXL antibody (e.g., an anti-AXL antibody H or L chain) (see, e.g., [73]).
- conjugated antibody derivatives may also be generated by conjugation at internal residues or sugars, or non-naturally occurring amino acids or additional amino acids that have been introduced into the antibody constant domain, where appropriate.
- the agents may be coupled either directly or indirectly to an anti-AXL antibody disclosed in the present invention.
- One example of indirect coupling of a second agent is coupling via a spacer moiety to cysteine or lysine residues in the antibody.
- an anti-AXL antibody is conjugated, via a spacer or linker, to a prodrug molecule that can be activated in vivo to a therapeutic drug. After administration, the spacers or linkers are cleaved by tumor cell-associated enzymes or other tumor-specific conditions, by which the active drug is formed.
- the anti-AXL antibody of the present invention is attached to a chelator linker, e.g. tiuxetan, which allows for the antibody to be conjugated to a radioisotope.
- a chelator linker e.g. tiuxetan
- the invention relates to a composition comprising the antibody, the bispecific antibody, or the immunoconjugate of the invention.
- the invention in another aspect, relates to a pharmaceutical composition
- a pharmaceutical composition comprising the antibody, bispecific or immunoconjugate according to the invention and a pharmaceutical carrier.
- compositions may be formulated with pharmaceutically acceptable carriers or diluents as well as any other known adjuvants and excipients in accordance with conventional techniques such as those disclosed in [81].
- the pharmaceutically accepta ble carriers or diluents as well as any other known adjuvants and excipients should be suitable for the antibody or antibody conjugate of the present invention and the chosen mode of administration. Suitability for carriers and other components of pharmaceutical compositions is determined based on the lack of significant negative impact on the desired biological properties of the chosen compound or pharmaceutical composition of the present invention (e.g., less than a substantial impact (10% or less relative inhibition, 5% or less relative inhibition, etc.) upon antigen binding).
- a pharmaceutical composition of the present invention may also include diluents, fillers, salts, buffers, detergents (e. g., a nonionic detergent, such as Tween-20 or Tween-80), stabilizers (e.g., sugars or protein-free amino acids), preservatives, tissue fixatives, solubilizers, and/or other materials suitable for inclusion in a pharmaceutical composition.
- detergents e. g., a nonionic detergent, such as Tween-20 or Tween-80
- stabilizers e.g., sugars or protein-free amino acids
- preservatives e.g., tissue fixatives, solubilizers, and/or other materials suitable for inclusion in a pharmaceutical composition.
- the actual dosage levels of the active ingredients in the pharmaceutical compositions of the present invention may be varied so as to obtain an amount of the active ingredient which is effective to achieve the desired therapeutic response for a particular patient, composition, and mode of administration, without being toxic to the patient.
- the selected dosage level will depend upon a variety of pharmacokinetic factors including the activity of the particular compositions of the present invention employed, or the amide thereof, the route of administration, the time of administration, the rate of excretion of the particular compound being employed, the duration of the treatment, other drugs, compounds and/or materials used in combination with the particular compositions employed, the age, sex, weight, condition, general health and prior medical history of the patient being treated, and like factors well known in the medical arts.
- the pharmaceutical composition may be administered by any suitable route and mode. Suitable routes of administering a compound of the present invention in vivo and in vitro are well known in the art and may be selected by those of ordinary skill in the art.
- the pharmaceutical composition of the present invention is administered parenterally.
- parenteral administration and “administered parenterally” as used herein refers to modes of administration other than enteral and topical administration, usually by injection, and include epidermal, intravenous, intramuscular, intra-arterial, intrathecal, intracapsular, intraorbital, intracardiac, intradermal, intraperitoneal, intratendinous, transtracheal, subcutaneous, subcuticular, intra-articular, subcapsular, subarachnoid, intraspinal, intracranial, intrathoracic, epidural and intrasternal injection and infusion.
- the pharmaceutical composition of the present invention is administered by intravenous or subcutaneous injection or infusion.
- Pharmaceutically acceptable carriers include any and all suitable solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonicity agents, antioxidants and absorption- delaying agents, and the like that are physiologically compatible with a compound of the present invention.
- aqueous and non-aqueous carriers examples include water, saline, phosphate-buffered saline, ethanol, dextrose, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, corn oil, peanut oil, cottonseed oil, and sesame oil, carboxymethyl cellulose colloidal solutions, tragacanth gum and injectable organic esters, such as ethyl oleate, and/or various buffers.
- Other carriers are well known in the pharmaceutical arts.
- Pharmaceutically acceptable carriers include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- the use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of the present invention is contemplated.
- Proper fluidity may be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- compositions of the present invention may also comprise pharmaceutically acceptable antioxidants for instance (1) water-soluble antioxidants, such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like; (2) oil-soluble antioxidants, such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated hydroxytoluene (BHT), lecithin, propyl gallate, alpha-tocopherol, and the like; and (3) metal-chelating agents, such as citric acid, ethylenediamine tetraacetic acid (EDTA), sorbitol, tartaric acid, phosphoric acid, and the like.
- water-soluble antioxidants such as ascorbic acid, cysteine hydrochloride, sodium bisulfate, sodium metabisulfite, sodium sulfite and the like
- oil-soluble antioxidants such as ascorbyl palmitate, butylated hydroxyanisole (BHA), butylated
- compositions of the present invention may also comprise isotonicity agents, such as sugars, polyalcohols, such as mannitol, sorbitol, glycerol or sodium chloride in the compositions.
- isotonicity agents such as sugars, polyalcohols, such as mannitol, sorbitol, glycerol or sodium chloride in the compositions.
- compositions of the present invention may also contain one or more adjuvants appropriate for the chosen route of administration such as preservatives, wetting agents, emulsifying agents, dispersing agents, preservatives or buffers, which may enhance the shelf life or effectiveness of the pharmaceutical composition.
- adjuvants appropriate for the chosen route of administration such as preservatives, wetting agents, emulsifying agents, dispersing agents, preservatives or buffers, which may enhance the shelf life or effectiveness of the pharmaceutical composition.
- the compounds of the present invention may be prepared with carriers that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and micro-encapsulated delivery systems.
- Such carriers may include gelatin, glyceryl monostearate, glyceryl distearate, biodegradable, biocompatible polymers such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, poly-ortho-esters, and polylactic acid alone or with a wax, or other materials well known in the art. Methods for the preparation of such formulations are generally known to those skilled in the art. See e.g., [82].
- the compounds of the present invention may be formulated to ensure proper distribution in vivo.
- Pharmaceutically acceptable carriers for parenteral administration include sterile aqueous solutions or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion.
- the use of such media and agents for pharmaceutically active substances is known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the pharmaceutical compositions of the present invention is contemplated. Other active or therapeutic compounds may also be incorporated into the compositions.
- compositions for injection must typically be sterile and stable under the conditions of manufacture and storage.
- the composition may be formulated as a solution, micro- emulsion, liposome, or other ordered structure suitable to high drug concentration.
- the carrier may be an aqueous or a non-aqueous solvent or dispersion medium containing for instance water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suita ble mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- the proper fluidity may be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants.
- a coating such as lecithin
- surfactants it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as glycerol, mannitol, sorbitol, or sodium chloride in the composition.
- Prolonged absorption of the injecta ble compositions may be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
- Sterile injectable solutions may be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients e.g.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients e.g. from those enumerated above.
- sterile powders for the preparation of sterile injectable solutions examples of methods of preparation are vacuum-drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- Sterile injectable solutions may be prepared by incorporating the active compound in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by sterilization microfiltration.
- dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above.
- examples of methods of preparation are vacuum-drying and freeze-drying (lyophilization) that yield a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
- the pharmaceutical composition of the present invention may contain one antibody, bispecific antibody or ADC of the present invention, a combination of an antibody, a bispecific antibody or ADC according to the invention with another therapeutic compound, or a combination of compounds of the present invention.
- the present invention relates to a nucleic acid construct encoding one or more sequences set out in Table 1.
- the present invention relates to nucleic acid constructs encoding any one of the sequences set out in SEQ ID Nos.: 1 to 135.
- the nucleic acid construct encodes at least one of the amino acid sequence selected from the group consisting of SEQ ID Nos.: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107,
- the nucleic acid construct encodes at least one of the amino acid sequences selected from the group consisting of SEQ ID Nos.: 46, 47, 48, 49, 50, 36, 37, 38, 39, 40, 114, 115, 116, 117, and 118.
- the invention relates to an expression vector encoding an antibody of the invention.
- the expression vector comprises one or more nucleic acid constructs according to any aspect or embodiment herein described.
- Such expression vectors may in one embodiment be used to express the anti-AXL antibody of the present invention.
- the expressed anti-AXL antibody may subsequently be conjugated to a moiety as described herein.
- the anti-AXL antibody may subsequently be used to generate a bispecific antibody as described herein.
- the expression vector of the invention comprises a nucleic acid sequence encoding one or more of the heavy chain (VH) CDR3 amino acid sequences selected from the group consisting of: SEQ ID Nos.: 38, 43, 48, 53, 54, 59, 64, 69, 75, 80, 85, 90, 95, 100, 105, 110, 111, 116, 120, 122, 125, and 127.
- VH heavy chain
- the expression vector of the invention comprises a nucleic acid sequence encoding one or more of the VH CDR1, CDR2, and CDR3 amino acid sequences selected from the group consisting of: SEQ ID Nos.: 36-38, 41-43, 46-48, 51-54, 57-59, 62-64, 67-69, 72-75, 78- 80, 83-85, 88-90, 93-95, 98-100, 103-105, 108-110, and 114-116.
- the expression vector of the invention comprises a nucleic acid sequence encoding one or more of the light chain (VL) CDR3 amino acid sequences selected from the group consisting of: SEQ ID Nos.: 40, 45, 50, 56, 61, 66, 71, 77, 82, 87, 92, 97, 102, 107, 113, and 118.
- VL light chain
- the expression vector of the invention comprises a nucleic acid sequence encoding one or more of the VH amino acid sequences selected from the group consisting of: SEQ ID Nos.: 1, 3, 5, 7, 8, 10, 12, 14, 16, 17, 19, 21, 23, 25, 27, 29, 31, 32, and 34.
- the expression vector of the invention comprises a nucleic acid sequence encoding one or more of the VL amino acid sequences selected from the group consisting of: SEQ ID Nos.: 2, 4, 6, 9, 11, 13, 15, 18, 20, 22, 24, 26, 28, 30, 33, and 35. In one embodiment, the expression vector of the invention comprises a nucleic acid sequence encoding one or more of the amino acid sequences selected from the group consisting of: SEQ ID Nos.: 1 to 35.
- the expression vector of the invention comprises a nucleic acid sequence encoding variants of one or more of the above amino acid sequences, said variants having at most 25 amino acid modifications, such as 20, such as at most 15, 14, 13, 12, or 11 amino acid modifications, such as 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 amino acid modifications, such as deletions or insertions, preferably substitutions, such as conservative or non-conservative substitutions, or at least 80% identity to any of said sequences, such as at least 85% identity or 90% identity or 95% identity, such as 96% identity or 97% identity or 98% identity or 99% identity to any of the aforementioned amino acid sequences.
- the present invention also relates to nucleic acid sequences different from the above mentioned nucleic acid sequences but which due to the variance of the genetic code encode the same amino acid sequence as an antibody of the present invention.
- the nucleic acid sequence may vary but result in an identical amino acid sequence as any amino acid sequence herein described. It is well-known for the skilled person how to identify such further nucleic acid sequences based on the genetic code.
- the expression vector further comprises a nucleic acid sequence encoding the constant region of a light chain, a heavy chain or both light and heavy chains of an antibody, e.g. a human IgGl, ⁇ monoclonal antibody.
- Such expression vectors as described above may be used for recombinant production of antibodies of the invention.
- An expression vector in the context of the present invention may be any suitable vector, including chromosomal, non-chromosomal, and synthetic nucleic acid vectors (a nucleic acid sequence comprising a suitable set of expression control elements).
- suitable vectors include derivatives of SV40, bacterial plasmids, phage DNA, baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, and viral nucleic acid ( NA or DNA) vectors.
- an anti-AXL antibody-encoding nucleic acid is comprised in a naked DNA or RNA vector, including, for example, a linear expression element (as described in for instance [83]), a compacted nucleic acid vector (as described in for instance [84] and/or [85]), a plasmid vector such as pBR322, pUC 19/18, or pUC 118/119, a "midge" minimally-sized nucleic acid vector (as described in for instance [86]), or as a precipitated nucleic acid vector construct, such as a CaP04-precipitated construct (as described in for instance [87], [88], [89], and [90]).
- a linear expression element as described in for instance [83]
- a compacted nucleic acid vector as described in for instance [84] and/or [85]
- a plasmid vector such as pBR322, pUC 19/18, or pUC 118/119
- the vector is suitable for expression of the anti-AXL antibody in a bacterial cell.
- expression vectors such as BlueScript (Stratagene), pIN vectors ([93], pET vectors (Novagen, Madison Wl) and the like).
- An expression vector may also or alternatively be a vector suitable for expression in a yeast system. Any vector suitable for expression in a yeast system may be employed. Suitable vectors include, for example, vectors comprising constitutive or inducible promoters such as alpha factor, alcohol oxidase and PGH (reviewed in: [94], and [95]).
- a nucleic acid construct and/or vector may also comprises a nucleic acid sequence encoding a secretion/localization sequence, which can target a polypeptide, such as a nascent polypeptide chain, to the periplasmic space or into cell culture media.
- a secretion/localization sequence which can target a polypeptide, such as a nascent polypeptide chain, to the periplasmic space or into cell culture media.
- Such sequences are known in the art, and include secretion leader or signal peptides, organelle targeting sequences (e. g., nuclear localization sequences, E retention signals, mitochondrial transit sequences, chloroplast transit sequences), membrane localization/anchor sequences (e. g., stop transfer sequences, GPI anchor sequences), and the like.
- anti-AXL antibody-encoding nucleic acids may comprise or be associated with any suitable promoter, enhancer, and other expression-facilitating elements.
- suitable promoter, enhancer, and other expression-facilitating elements include strong expression promoters (e. g., human CMV IE promoter/enhancer as well as RSV, SV40, SL3-3, MM TV, and HIV LTR promoters), effective poly (A) termination sequences, an origin of replication for plasmid product in E. coli, an antibiotic resistance gene as selectable marker, and/or a convenient cloning site (e.g., a polylinker).
- Nucleic acids may also comprise an inducible promoter as opposed to a constitutive promoter such as CMV IE (the skilled artisan will recognize that such terms are actually descriptors of a degree of gene expression under certain conditions).
- the anti-AXL-antibody-encoding expression vector may be positioned in and/or delivered to the host cell or host animal via a viral vector.
- the invention relates to a recombinant eukaryotic or prokaryotic host cell, such as a transfectoma, which produces an anti-AXL antibody of the invention as defined herein or a bispecific molecule of the invention as defined herein.
- host cells include yeast, bacterial and mammalian cells, such as CHO or HEK cells or derivatives thereof.
- the present invention provides a cell comprising a nucleic acid stably integrated into the cellular genome that comprises a sequence coding for expression of an anti-AXL antibody of the present invention.
- the present invention provides a cell comprising a non-integrated nucleic acid, such as a plasmid, cosmid, phagemid, or linear expression element, which comprises a sequence coding for expression of an anti-AXL antibody of the invention.
- a non-integrated nucleic acid such as a plasmid, cosmid, phagemid, or linear expression element, which comprises a sequence coding for expression of an anti-AXL antibody of the invention.
- the present invention relates to a host cell comprising a vector according to any aspect and embodiments herein described.
- the anti-AXL antibodies described herein are provided by use of recombinant eukaryotic, prokaryotic or microbial host cell which produces the antibody.
- the invention provides a recombinant host cell, such as a recombinant prokaryotic, recombinant eukaryotic, or recombinant microbial host cell.
- host cells include yeast, bacterial and mammalian cells, such as CHO or HEK-293 cells.
- the host cell comprises a nucleic acid stably integrated into the cellular genome that comprises a sequence coding for expression of an anti-AXL antibody described herein.
- the host cell comprises a nucleic acid stably integrated into the cellular genome that comprise a sequence coding for expression of a first or a second polypeptide described herein.
- the host cell comprises a non-integrated nucleic acid, such as a plasmid, cosmid, phagemid, or linear expression element, which comprises a sequence coding for expression of an anti- AXL antibody, a first or a second polypeptide described herein.
- Recombinant host cell (or simply "host cell”), as used herein, is intended to refer to a cell into which an expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell, but also to the progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term “host cell” as used herein.
- Recombinant host cells include, for example, transfectomas, such as CHO cells, HEK-293 cells, PER.C6, NSO cells, and lymphocytic cells, and prokaryotic cells such as E. coli and other eukaryotic hosts such as plant cells and fungi.
- transfectoma includes recombinant eukaryotic host cells expressing the antibody or a target antigen, such as CHO cells, PER.C6, NSO cells, HEK-293 cells, plant cells, or fungi, including yeast cells.
- an antibody may be obtained from hybridomas prepared from murine splenic B cells obtained from mice immunized with an antigen of interest, for instance in form of cells expressing the antigen on the surface, or a nucleic acid encoding an antigen of interest.
- Monoclonal antibodies may also be obtained from hybridomas derived from antibody-expressing cells of immunized humans or non-human mammals such as rabbits, rats, dogs, primates, etc. Human antibodies may be generated using transgenic or transchromosomal mice, e.g. HuMAb mice, carrying parts of the human immune system rather than the mouse system.
- the HuMAb mouse contains a human immunoglobulin gene minilocus that encodes unrearranged human heavy ( ⁇ and ⁇ ) and ⁇ light chain immunoglobulin sequences, together with targeted mutations that inactivate the endogenous ⁇ and ⁇ chain loci [96]. Accordingly, the mice exhibit reduced expression of mouse IgM or K and in response to immunization, the introduced human heavy and light chain transgenes, undergo class switching and somatic mutation to generate high affinity human lgG, K monoclonal antibodies [96], [97], [98] and [99].
- the preparation of HuMAb mice is described in detail in [100], [101], [102], [103], and [104]. See also [105] to [121]. Splenocytes from these transgenic mice may be used to generate hybridomas that secrete human monoclonal antibodies according to well-known techniques.
- human antibodies of the present invention or antibodies of the present invention from other species may be identified through display-type technologies, including, without limitation, phage display, retroviral display, ribosomal display, mammalian display, yeast display and other techniques known in the art, and the resulting molecules may be subjected to additional maturation, such as affinity maturation, as such techniques are well known in the art.
- the present invention relates to a method for producing an antibody according to any aspect or embodiment herein described, comprising the steps
- the invention relates to the antibody, bispecific antibody, or immunoconjugate or ADC of the present invention, as defined in any aspect or embodiment herein, for use as a medicament.
- the anti-AXL antibodies of the present invention can be used in the treatment or prevention of disorders involving cells expressing AXL.
- the antibodies may be administered to cells in culture, e.g., in vitro or ex vivo, or to human subjects, e.g., in vivo, to treat or prevent disorders involving AXL-expressing cells.
- the term "subject" is typically a human to whom the anti-AXL antibody or ADC is administered. Subjects may for instance include human patients having disorders that may be corrected or ameliorated by modulating AXL function or by killing of the AXL-expressing cell, directly or indirectly.
- the present invention relates to the antibody, bispecific antibody, or immunoconjugate of the present invention, as defined in any aspect or embodiment herein, for use in the treatment of cancer.
- the invention provides a method for modulating AXL-associated signaling in an AXL-expressing cell by contacting the cell with an anti-AXL antibody or ADC according to any aspect or embodiment herein described.
- the invention provides a method for killing an AXL-expressing cell by contacting the cell with an anti-AXL antibody or ADC of the invention.
- antibody-mediated or ADC-mediated crosslinking or clustering e.g., due to the Fc-region of AXL-bound antibodies binding to Fc -expressing cells
- AXL molecules on the surface of a cell can lead to apoptosis of the cell.
- the invention provides a method for killing an AXL-expressing cell by contacting the cell with an AXL-specific antibody or ADC of the invention in the presence of effector cells capable of inducing an Fc-dependent cellular response such as ADCC or ADCP.
- the antibody is typically full-length and of an isotype leading to an ADCC or ADCP response, such as, e.g., an lgGl,K isotype.
- the invention provides a method for killing an AXL-expressing cell by contacting the cell with an AXL -specific antibody or ADC of the invention in the presence of complement proteins, such as complement proteins present in normal human serum, that may be activated and thereby inducing CDC after binding of AXL-specific antibody or ADC to the plasma membrane of AXL-expressing cells.
- complement proteins such as complement proteins present in normal human serum
- the antibody is typically full-length and of an isotype capable of inducing activation of the complement system, such as, e.g., an lgGl,K isotype.
- anti-AXL antibodies of the invention may be characterized by internalization upon binding to AXL, making them suitable for an ADC approach using an ADC as described in any aspect or embodiment described herein.
- the invention provides a method for killing an AXL- expressing cell by contacting the cell with an ADC of the invention which requires internalization and trafficking to lysosomes for specific (i.e. cleavable linker) or non-specific (non-cleavable linker) proteolytic cleavage of the anti-AXL antibody-linker-drug complex.
- the present invention relates to a method for interfering with AXL- mediated regulation of the innate or adaptive immune response, such as by binding of an AXL-specific antibody or ADC according to the invention to AXL-expressing macrophages, dendritic cells or NK cells.
- the invention provides for a method of killing an AXL- expressing cell by contacting the cell with an ADC of the invention wherein the anti-AXL antibody is linked to a therapeutic moiety via a linker allowing for release of the drug once the ADC is internalized, e.g., by a change in pH or reducing conditions.
- Suitable linker technology is known in the art, as described above.
- the present invention provides methods for treating or preventing a disorder involving cells expressing AXL in a subject, which method comprises administration of a therapeutically effective amount of an anti-AXL antibody, bispecific antibody or ADC of the present invention to a subject in need thereof.
- the method typically involves administering to a subject an anti-AXL antibody, a bispecific antibody or ADC according to the present invention in an amount effective to treat or prevent the disorder.
- an anti-AXL antibody or ADC is administered prophylactically in order to reduce the risk of developing cancer, delay the onset of an event in cancer progression or reduce the risk of recurrence when a cancer is in remission and/or a primary tumor has been surgically removed.
- the anti-AXL antibody could, for example, be administered in association with (i.e., before, during, or after) the surgery.
- Prophylactic administration may also be useful in patients wherein it is difficult to locate a tumor that is believed to be present due to other biological factors.
- Cells with high AXL expression are particularly good targets for the anti-AXL antibodies, bispecific antibodies or ADCs of the invention, since more antibodies or ADCs may be bound per tumor cell.
- Tissues that heterogeneously express AXL such as tumor tissue may also be a suitable target for the anti-AXL antibodies, bispecific antibodies, ADCs or anti-AXL-ADCs of the invention.
- the disorder involving cells expressing AXL is cancer, i.e., a tumorigenic disorder, such as a disorder characterized by the presence of tumor cells expressing AXL including, for example, disorders where the cells are from a solid tumor or hematological tumor.
- AXL expression has been described in, e.g., non-small-cell lung cancer (NSCLC; [122]), pancreatic cancer [123], esophageal cancer [124], endometrial cancer [125].
- Exemplary cells expressing AXL thus include cancer cells such as, e.g., cells from non- small cell lung cancer, pancreatic cancer and esophageal cancer.
- the present invention provides methods for treating or preventing cancer comprising administering the antibody, the bispecific antibody, the immunoconjugate, the composition, or the pharmaceutical composition according to the present invention to a subject in need thereof.
- the cancer is a solid tumor expressing AXL or an AXL-expressing hematological cancer.
- the hematological cancer is Acute Myeloid Leukemia (AML).
- the solid tumor expressing AXL is lung cancer or epidermoid carcinoma.
- the present invention relates to methods comprising administration of a therapeutically effective amount of an anti-AXL antibodyor ADC of the present invention to a subject in need thereof.
- the present invention relates to a method for inhibiting growth and/or proliferation of a tumor cell expressing AXL, comprising administration, to an individual in need thereof, of an antibody, bispecific antibody, immunoconjugate, composition, or pharmaceutical composition according to any aspect or embodiment herein described.
- the present invention relates to a method for inhibiting migration and/or invasion of a tumor cell expressing AXL, comprising administration, to an individual in need thereof, of an antibody, bispecific antibody, immunoconjugate, composition, or pharmaceutical composition according to any aspect or embodiment herein described.
- the present invention relates to a method for inhibiting resistance to targeted therapy, such as EGFR- or BRAF-targeted therapy, or to chemotherapeutic agents, comprising administration, to an individual in need thereof, of an antibody, bispecific antibody, immunoconjugate, composition, or pharmaceutical composition according to any aspect or embodiment herein described.
- targeted therapy such as EGFR- or BRAF-targeted therapy
- chemotherapeutic agents comprising administration, to an individual in need thereof, of an antibody, bispecific antibody, immunoconjugate, composition, or pharmaceutical composition according to any aspect or embodiment herein described.
- the present invention relates to a method for targeting or inhbiting tumor-associated macrophages, comprising administration, to an individual in need thereof, of an antibody, bispecific antibody, immunoconjugate, composition, or pharmaceutical composition according to any aspect or embodiment herein described.
- the present invention provides methods for treating or preventing a solid tumor, which method comprises administration of a therapeutically effective amount of an anti-AXL antibody or ADC of the present invention to a subject in need thereof, and wherein the solid tumor is a melanoma, carcinoma, sarcoma, adenoma and/or a glioma.
- the cancer is selected from the group consisting of endometrial/cervical cancer, lung cancer (such as, e.g., small cell lung cancer or non-small cell lung cancer), thyroid cancer, colon cancer, kidney cancer, ovary cancer, breast cancer, esophagus cancer, skin cancer, malignant melanoma and pancreatic cancer.
- the cancer is pancreatic cancer, such as unresectable advanced or metastatic pancreatic cancer. In other separate and specific embodiments, the cancer is endometrial/cervical cancer, or lung cancer. In one embodiment the cancer is a thyroid cancer. In one embodiment the cancer is a colon cancer. In one embodiment the cancer is a kidney cancer. In one embodiment the cancer is ovarian cancer. In one embodiment the cancer is breast cancer such as estrogen receptor alpha negative cancer or estrogen receptor alpha positive. In one embodiment the cancer is triple negative breast cancer (i.e. breast cancer tested negative for estrogen receptors (ER-), progesterone receptors (PR-), and human epidermal growth factor receptor 2 (HER2-). In one embodiment the cancer is esophagus cancer. In one embodiment the cancer is skin cancer.
- the cancer is melanoma such as malignant melanoma.
- the cancer is Acute Myeloid Leukemia (AML).
- AML Acute Myeloid Leukemia
- the cancer is resistant to chemotherapy, thyrosine kinase inhibitors and or BRAF inhibitors.
- the cancer is resistant to EGFR targeted therapy.
- the present invention relates to an antibody binding to the extracellular domain of AXL such as the Igl-like domain of AXL, such as the Ig2-like domain of AXL, such as the FN1 domain of AXL, or such as the FN2 domain of AXL, wherein said antibody is for use as a medicament.
- AXL such as the Igl-like domain of AXL, such as the Ig2-like domain of AXL, such as the FN1 domain of AXL, or such as the FN2 domain of AXL
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is for use as a medicament.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is for use in treatment or prevention of cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is for use in treatment or prevention of thyroid cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is for use in treatment or prevention of colon cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is for use in treatment or prevention of kidney cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is for use in treatment or prevention of ovarian cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is for use in treatment or prevention of breast cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is for use in treatment or prevention of triple negative breast cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is for use in treatment or prevention of esophagus cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is for use in treatment or prevention of skin cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is for use in treatment or prevention of melanoma such as malignant melanoma.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is for use in treatment or prevention of lung cancer (such as, e.g., small cell lung cancer or non-small cell lung cancer (NSCLC)).
- lung cancer such as, e.g., small cell lung cancer or non-small cell lung cancer (NSCLC)
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is for use in treatment or prevention of Acute Myeloid Leukemia (AML).
- AML Acute Myeloid Leukemia
- Said embodiments are provided for the treatment or prevention of cancer.
- Said embodiments may be coupled or linked to a cytotoxic agent to increase the efficacy or effect of the treatment.
- the antibodies disclosed herein may be linked to a cytotoxic agent such as an auristatin (such as, e.g monomethyl auristatin E (MMAE)) to form an immunoconjugate for use as a medicament, such as e.g. for the treatment or prevention of cancer.
- auristatin such as, e.g monomethyl auristatin E (MMAE)
- MMAE monomethyl auristatin E
- the present invention relates to an immunoconjugate comprising an antibody which binds to AXL, wherin the antbody does not compete for AXL binding with the ligand Gas6.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use as a medicament.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of thyroid cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CD 1, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of colon cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of kidney cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of ovarian cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of breast cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CD 1, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of triple negative breast cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of lung cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of esophagus cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of melanoma such as malignant melanoma.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of lung cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 36, 37 and 38, and the VL region comprises the sequences of SEQ ID Nos.: 39, GAS, and 40, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of Acute Myeloid Leukemia.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the antibody is linked to a cytotoxic agent such as an auristatin to form an immunoconjugate.
- a cytotoxic agent such as an auristatin
- the antibody and the cytotoxic agent may be linked by a maleimidocaproyl-valine-citrulline-p-aminobenzyloxycarbonyl (mc-vc-PAB) linker.
- the invention relates to antibodies that bind to the extracellular domain of AXL such as the Ig2-like domain of AXL, wherein said antibody is for use as a medicament.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is for use as a medicament.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is for use in treatment or prevention of cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is for use in treatment or prevention of thyroid cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is for use in treatment or prevention of colon cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is for use in treatment or prevention of kidney cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is for use in treatment or prevention of ovarian cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is for use in treatment or prevention of breast cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is for use in treatment or prevention of triple negative breast cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is for use in treatment or prevention of esophagus cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is for use in treatment or prevention of skin cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is for use in treatment or prevention of melanoma such as malignant melanoma.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50 wherein said antibody is for use in treatment or prevention of lung cancer (such as, e.g., small cell lung cancer or non-small cell lung cancer).
- lung cancer such as, e.g., small cell lung cancer or non-small cell lung cancer.
- the antibody comprises at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is for use in treatment or prevention of Acute Myeloid Leukemia (AML).
- AML Acute Myeloid Leukemia
- Said embodiments are provided for the treatment or prevention of cancer.
- Said embodiments may be coupled or linked with a cytotoxic agent to increase the efficacy or effect of the treatment.
- the antibodies disclosed herein may be linked with a cytotoxic agent such as an auristatin (such as, e.g monomethyl auristatin E (MMAE)) to form an immunoconjugate for use as a medicament, such as e.g. for the treatment or prevention of cancer.
- auristatin such as, e.g monomethyl auristatin E (MMAE)
- MMAE monomethyl auristatin E
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use as a medicament.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for in treatment or prevention of cancer.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of thyroid cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDRl, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of colon cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CD 1, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of kidney cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of ovarian cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of breast cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of triple negative breast cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CD 1, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of lung cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of esophagus cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of melanoma such as malignant melanoma.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50, wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of lung cancer.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the invention relates to an immunoconjugate comprising an antibody comprising at least one binding region comprising a VH region and a VL region, wherein the VH region comprises the CDR1, CDR2 and CDR3 sequences of SEQ ID Nos.: 46, 47 and 48, and the VL region comprises the sequences of SEQ ID Nos.: 49, AAS, and 50 wherein said antibody is linked to monomethyl auristatin E to form an immunoconjugate, and said immunoconjugate is for use in treatment or prevention of Acute Myeloid Leukemia.
- said antibody is linked to monomethyl auristatin E by the linker mc-vc-PAB.
- the antibody is linked to a cytotoxic agent such as an auristatin to form an immunoconjugate.
- a cytotoxic agent such as an auristatin
- the antibody and the cytotoxic agent may be linked by a maleimidocaproyl-valine-citrulline-p-aminobenzyloxycarbonyl (mc-vc-PAB) linker.
- selection of patients to be treated with anti-AXL antibodies is based on the level of AXL expression in a sample, such as a sample containing tumor cells, or by detecting AXL-expressing tumors using labeled anti-AXL antibodies or antibody fragments, e.g., those of the invention.
- Exemplary diagnostic assays for determining AXL-expression using AXL antibodies of the invention are described herein.
- the efficient dosages and dosage regimens for the anti-AXL antibody or ADC depend on the disease or condition to be treated and may be determined by the persons skilled in the art.
- a physician having ordinary skill in the art may readily determine and prescribe the effective amount of the pharmaceutical composition required.
- a pharmaceutical composition it is to be understood also to comprise a composition as such, or vice versa.
- the physician could start doses of the anti-AXL antibody employed in the pharmaceutical composition at levels lower than that required in order to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved.
- a suitable dose of a pharmaceutical composition of the present invention will be that amount of the compound which is the lowest dose effective to produce a therapeutic effect according to a particular dosage regimen. Such an effective dose will generally depend upon the factors described above.
- an "effective amount" for therapeutic use may be measured by its ability to stabilize the progression of disease.
- the ability of a compound to inhibit cancer may, for example, be evaluated in an animal model system predictive of efficacy in human tumors.
- this property of a composition may be evaluated by examining the a bility of the compound to inhibit cell growth or to induce cytotoxicity by in vitro assays known to the skilled practitioner.
- a therapeutically effective amount of a therapeutic compound may decrease tumor size, or otherwise ameliorate symptoms in a subject.
- One of ordinary skill in the art would be able to determine such amounts based on such factors as the subject's size, the severity of the subject's symptoms, and the particular composition or route of administration selected.
- An exemplary, non-limiting range for a therapeutically effective amount of an anti-AXL antibody of the present invention is about 0.1-100 mg/kg, such as about 0.1-50 mg/kg, for example about 0.1-20 mg/kg, such as about 0.1-10 mg/kg, for instance a bout 0.5, about such as 0.3, about 1, about 3 mg/kg, about 5 mg/kg or about 8 mg/kg.
- An exemplary, non-limiting range for a therapeutically effective amount of an anti-AXL ADC of the invention is 0.02-100 mg/kg, such as about 0.02-30 mg/kg, such as about 0.05-10 mg/kg or 0.1-3 mg/kg, for example about 0.5-2 mg/kg.
- Administration may e.g. be intravenous, intramuscular, intraperitoneal, or subcutaneous, and for instance administered proximal to the site of the target.
- Dosage regimens in the above methods of treatment and uses are adjusted to provide the optimum desired response (e.g., a therapeutic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation.
- the efficacy-safety window is optimized by lowering specific toxicity such as for example by lowering the drug-antibody ratio (DAR) and/or mixing of anti-AXL ADC with unlabeled anti-AXL antibody.
- DAR drug-antibody ratio
- the efficacy of the treatment is monitored during the therapy, e.g. at predefined points in time.
- the efficacy may be monitored by measuring the level of AXL in a sample containing tumor cells, by visualization of the disease area, or by other diagnostic methods described further herein, e.g. by performing one or more PET-CT scans, for example using a labeled anti-AXL antibody, fragment or mini-antibody derived from the AXL-specific antibody of the present invention.
- an effective daily dose of a pharmaceutical composition may be administered as two, three, four, five, six or more sub-doses administered separately at appropriate intervals throughout the day, optionally, in unit dosage forms.
- the anti-AXL antibodies are administered by slow continuous infusion over a long period, such as more than 24 hours, in order to minimize any unwanted side effects.
- An effective dose of an anti-AXL antibody, bispecific antibody or ADC of the invention may also be administered using a weekly, biweekly or triweekly dosing period.
- the dosing period may be restricted to, e.g., 8 weeks, 12 weeks or until clinical progression has been established.
- the anti-AXL antibody, bispecific antibody or ADC is administered by infusion in a weekly dosage of between 10 and 500 mg/m 2 , such as between 200 and 400 mg/m 2 .
- Such administration may be repeated, e.g., 1 to 8 times, such as 3 to 5 times.
- the administration may be performed by continuous infusion over a period of from 1 to 24 hours, such as of from 1 to 12 hours.
- the anti-AXL antibody, bispecific antibody or ADC is administered by infusion every three weeks in a dosage of between 10 and 500 mg/m 2 , such as between 50-200 mg/m 2 .
- Such administration may be repeated, e.g., 1 to 8 times, such as 3 to 5 times.
- the administration may be performed by continuous infusion over a period of from 1 to 24 hours, such as of from 1 to 12 hours.
- an anti-AXL ADC is administered as a single dose of about 0.1-10 mg/kg, such as about 1-3 mg/kg, every week or every third week for up to twelve times, up to eight times, or until clinical progression.
- the administration may be performed by continuous infusion over a period of from 1 to 24 hours, such as of from 1 to 12 hours. Such regimens may be repeated one or more times as necessary, for example, after 6 months or 12 months.
- the dosage may be determined or adjusted by measuring the amount of compound of the present invention in the blood upon administration by for instance taking out a biological sample and using anti-idiotypic antibodies which target the antigen binding region of the anti-AXL antibodies of the present invention.
- the anti-AXL antibodies are administered as maintenance therapy, such as, e.g., once a week for a period of six months or more.
- treatment according to the present invention may be provided as a daily dosage of a compound of the present invention in an amount of about 0.1-100 mg/kg, such as 0.2, 0.5, 0.9, 1.0, 1.1, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 40, 45, 50, 60, 70, 80, 90 or 100 mg/kg, per day, on at least one of days 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40, or alternatively, at least one of weeks 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 after initiation of treatment, or any combination thereof, using single or divided doses every 24, 12, 8, 6, 4, or 2 hours, or any combination thereof.
- 0.1-100 mg/kg such as 0.2, 0.5, 0.9, 1.0, 1.1, 1.5, 2, 3, 4,
- compositions may be formulated in dosage unit form for ease of administration and uniformity of dosage.
- Dosage unit form refers to physically discrete units suited as unitary dosages for the subjects to be treated; each unit contains a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier.
- the specification for the dosage unit forms of the present invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity in individuals. Diagnostic applications
- the anti-AXL antibodies of the invention may also be used for diagnostic purposes, using a composition comprising an anti-AXL antibody as described herein. Accordingly, the invention provides diagnostic methods and compositions using the anti-AXL antibodies described herein. Such methods and compositions can be used for purely diagnostic purposes, such as detecting or identifying a disease involving AXL-expressing cells, as well as for monitoring of the progress of therapeutic treatments, monitoring disease progression, assessing status after treatment, monitoring for recurrence of disease, evaluating risk of developing a disease, and the like.
- the anti-AXL antibodies of the present invention are used ex vivo, such as in diagnosing a disease in which cells expressing AXL are indicative of disease or involved in the pathogenesis, by detecting levels of AXL or levels of cells which express AXL on their cell surface in a sample taken from a patient. This may be achieved, for example, by contacting the sample to be tested, optionally along with a control sample, with the anti-AXL antibody under conditions that allow for binding of the antibody to AXL. Complex formation can then be detected (e.g., using an ELISA).
- the level of anti-AXL antibody or anti-AXL antibody-AXL complex is analyzed in both samples and a statistically significant higher level of anti-AXL antibody or anti-AXL antibody-AXL complex in the test sample indicates a higher level of AXL in the test sample compared with the control sample.
- Examples of conventional immunoassays in which anti-AXL antibodies of the present invention can be used include, without limitation, ELISA, IA, FACS assays, plasmon resonance assays, chromatographic assays, tissue immunohistochemistry, Western blot, and/or immunoprecipitation.
- the present invention relates to a method of diagnosing a disease characterized by involvement or accumulation of AXL-expressing cells, comprising administering an antibody, bispecific antibody, immunoconjugate, composition or pharmaceutical composition according to any aspect or embodiment herein described, to a subject, optionally wherein the antibody is labeled with a detectable label, and wherein the amount of AXL-expressing cells correlates with or is indicative of disease.
- the invention relates to a method for detecting the presence of AXL antigen, or a cell expressing AXL, in a sample comprising:
- AXL antigen refers both soluble and cell bound AXL antigen.
- the sample is a tissue sample known or suspected of containing AXL antigen and/or cells expressing AXL.
- in situ detection of AXL expression may be accomplished by removing a histological specimen from a patient, and providing the antibody of the present invention to such a specimen.
- the antibody may be provided by applying or by overlaying the antibody to the specimen, which is then detected using suitable means. It is then possible to determine not only the presence of AXL or AXL-expressing cells, but also the distribution of AXL or AXL- expressing cells in the examined tissue (e.g., in the context of assessing the spread of cancer cells).
- histological methods such as staining procedures
- the anti-AXL antibody can be labeled with a detectable substance to allow AXL-bound antibody to be detected.
- bound (primary) anti-AXL antibody may be detected by a secondary antibody which is labeled with a detectable substance and which binds to the primary antibody.
- a diagnostic composition comprising an antibody or bispecific antibody according to any aspect or embodiments herein described may be used.
- the present invention relates to a diagnostic composition comprising an antibody or bispecific antibody according to any aspect or embodiment herein described.
- the level of AXL in a sample can also be estimated by a competition immunoassay utilizing AXL standards labeled with a detectable substance and an unlabeled anti-AXL antibody.
- a competition immunoassay utilizing AXL standards labeled with a detectable substance and an unlabeled anti-AXL antibody.
- the biological sample, the labeled AXL standard(s) and the anti-AXL antibody are combined, and the amount of labeled AXL standard bound to the unlabeled anti-AXL antibody is determined.
- the amount of AXL in the biological sample is inversely proportional to the amount of labeled AXL standard bound to the anti-AXL antibody.
- Suitable labels for the anti-AXL antibody, secondary antibody and/or AXL standard used in in vitro diagnostic techniques include, without limitation, various enzymes, prosthetic groups, fluorescent materials, luminescent materials, and radioactive materials.
- suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, and acetylcholinesterase
- suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin
- examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride and phycoerythrin
- an example of a luminescent material includes luminol
- suitable radioactive material include 125 l, 131 l, 35 S, and 3 H.
- the anti-AXL antibodies of the invention are used in the in vivo imaging of AXL-expressing tissues such as tumors.
- antibody fragments such as, e.g., (Fab') 2 , Fab and Fab' fragments, are particularly advantageous because of their rapid distribution kinetics.
- In vivo imaging can be performed by any suitable technique.
- an anti-AXL antibody such as, e.g., a fragment
- 99 Tc, 131 l, m ln or other gamma-ray emitting isotope may be used to image anti-AXL antibody accumulation or distribution in AXL-expressing tissues such as tumors with a gamma scintillation camera (e.g., an Elscint Apex 409ECT device), typically using low- energy, high resolution collimator or a low-energy all-purpose collimator.
- a gamma scintillation camera e.g., an Elscint Apex 409ECT device
- typically using low- energy, high resolution collimator or a low-energy all-purpose collimator typically using low- energy, high resolution collimator or a low-energy all-purpose collimator.
- labeling with 89 Zr, 76 Br, 18 F or other positron-emitting radionuclide may be used to image anti-AXL antibody or antibody fragment distribution in tumors using positron emission tomography (PET).
- PET positron emission tomography
- the images obtained by the use of such techniques may be used to assess biodistribution of AXL in a patient, mammal, or tissue, for example in the context of using AXL as a biomarker for the presence of cancer cells.
- Variations on this technique may include the use of magnetic resonance imaging (M I) to improve imaging over gamma camera techniques.
- M I magnetic resonance imaging
- Conventional immunoscintigraphy methods and principles are described in, e.g., [126], [127], and [128].
- such images may also, or alternatively, serve as the basis for surgical techniques to remove tumors.
- in vivo imaging techniques may allow for the identification and localization of a tumor in a situation where a patient is identified as having a tumor (due to the presence of other biomarkers, metastases, etc.), but the tumor cannot be identified by traditional analytical techniques. All of these methods are features of the present invention.
- the in vivo imaging and other diagnostic methods provided by the present invention are particularly useful in the detection of micrometastases in a human patient (e.g., a patient not previously diagnosed with cancer or a patient in a period of recovery/remission from a cancer).
- the present invention provides an in vivo imaging method wherein an anti-AXL antibody of the present invention is conjugated to a detection-promoting radio-opaque agent, the conjugated antibody is administered to a host, such as by injection into the bloodstream, and the presence and location of the labeled antibody in the host is assayed.
- the present invention provides a method for screening for the presence of disease-related cells in a human patient or a biological sample taken from a human patient and/or for assessing the distribution of anti-AXL antibody prior to anti-AXL ADC therapy.
- radioisotopes may be bound to an anti-AXL antibody either directly or indirectly by using an intermediary functional group.
- Useful intermediary functional groups include chelators, such as ethylenediaminetetraacetic acid and diethylenetriaminepentaacetic acid (see for instance [129]).
- diagnostic methods may be performed using anti-AXL antibodies that are conjugated to dyes (such as with the biotin-streptavidin complex), contrast agents, fluorescent compounds or molecules and enhancing agents (e.g. paramagnetic ions) for magnetic resonance imaging (M I) (see, e.g., [130], which describes M RI techniques and the preparation of antibodies conjugated to a MRI enhancing agent).
- dyes such as with the biotin-streptavidin complex
- contrast agents e.g. paramagnetic ions
- fluorescent compounds or molecules e.g. paramagnetic ions
- enhancing agents e.g. paramagnetic ions
- M I magnetic resonance imaging
- diagnostic/detection agents may be selected from agents for use in M RI, and fluorescent compounds.
- a reagent having a long tail to which a multiplicity of chelating groups are attached for binding the ions.
- a tail may be a polymer such as a polylysine, polysaccharide, or another derivatized or derivatizable chain having pendant groups to which may be bound chelating groups such as, e.g., porphyrins, polyamines, crown ethers, bisthiosemicarbazones, polyoximes, and like groups known to be useful for this purpose.
- Chelates may be coupled to anti-AXL antibodies using standard chemistries.
- the present invention provides a diagnostic anti-AXL antibody, wherein the anti- AXL antibody is conjugated to a contrast agent (such as for magnetic resonance imaging, computed tomography, or ultrasound contrast-enhancing agent) or a radionuclide that may be, for example, a gamma-, beta-, alpha-, Auger electron-, or positron-emitting isotope.
- a contrast agent such as for magnetic resonance imaging, computed tomography, or ultrasound contrast-enhancing agent
- a radionuclide that may be, for example, a gamma-, beta-, alpha-, Auger electron-, or positron-emitting isotope.
- the invention relates to a kit for detecting the presence of AXL antigen or a cell expressing AXL, in a sample, comprising:
- the present invention provides a kit for diagnosis of cancer comprising a container comprising an anti-AXL antibody, and one or more reagents for detecting binding of the anti-AXL antibody to AXL.
- Reagents may include, for example, fluorescent tags, enzymatic tags, or other detectable tags.
- the reagents may also include secondary or tertiary antibodies or reagents for enzymatic reactions, wherein the enzymatic reactions produce a product that may be visualized.
- the present invention provides a diagnostic kit comprising one or more anti-AXL antibodies, of the present invention in labeled or unlabeled form in suitable container(s), reagents for the incubations for an indirect assay, and substrates or derivatizing agents for detection in such an assay, depending on the nature of the label. Control reagent(s) and instructions for use also may be included.
- Diagnostic kits may also be supplied for use with an anti-AXL antibody, such as a conjugated/labeled anti-AXL antibody, for the detection of the presence of AXL in a tissue sample or host.
- an anti-AXL antibody such as a conjugated/labeled anti-AXL antibody
- the anti-AXL antibody according to the present invention may also be used as, e.g. part of a, companion diagnostic, for example as the primary antibody in an immunohistochemistry assay designed to detect AXL expression in solid tumor, lymph node or other tissue biopsies.
- the anti-AXL antibodies according to the present invention may be used as the primary antibody in a flow cytometry-based or immunocytochemistry assay to identify AXL-expressing cells in blood, bone marrow, fine needles aspirates, e.g.
- Anti-AXL antibodies according to the present invention may be used to identify soluble AXL, e.g. in an ELISA-based assay.
- Anti-AXL antibodies according to the present invention may be used as a companion diagnostic, for instance as radioconjugates, that can be used for imaging studies in patients.
- an anti-AXL antibody typically may be provided in a lyophilized form in a container, either alone or in conjunction with additional antibodies specific for a target cell or peptide.
- a pharmaceutically acceptable carrier e.g., an inert diluent
- components thereof such as a Tris, phosphate, or carbonate buffer, stabilizers, preservatives, biocides, inert proteins, e.g., serum albumin, or the like
- additional reagents also typically in separate container(s)
- a secondary antibody capable of binding to the AXL-specific Ab which typically is present in a separate container, is also included.
- the second antibody is typically conjugated to a label and formulated in a manner similar to the anti-AXL antibody of the present invention.
- anti-AXL antibodies may be used to define subsets of cancer/tumor cells and characterize such cells and related tumor tissues.
- the invention relates to an anti-idiotypic antibody which binds to an anti-AXL antibody of the invention as described herein.
- An anti-idiotypic (Id) antibody is an antibody which recognizes unique determinants generally associated with the antigen-binding site of an antibody.
- An anti-Id antibody may be prepared by immunizing an animal of the same species and genetic type as the source of an anti-AXL monoclonal antibody with the monoclonal antibody against which an anti-Id is being prepared. The immunized animal typically can recognize and respond to the idiotypic determinants of the immunizing antibody by producing an antibody to these idiotypic determinants (the anti-Id antibody).
- Such antibodies are described in for instance US 4,699,880. Such antibodies are further features of the present invention.
- An anti-Id antibody may also be used as an "immunogen" to induce an immune response in yet another animal, producing a so-called anti-anti-ld antibody.
- An anti-anti-ld antibody may be epitopically identical to the original monoclonal antibody, which induced the anti-Id antibody.
- Anti-Id antibodies may be varied (thereby producing anti-Id antibody variants) and/or derivatized by any suitable technique, such as those described elsewhere herein with respect to AXL-specific antibodies of the present invention.
- a monoclonal anti-Id antibody may be coupled to a carrier such as keyhole limpet hemocyanin (KLH) and used to immunize BALB/c mice.
- Sera from these mice typically will contain anti- anti-ld antibodies that have the binding properties similar, if not identical, to an original/parent anti- AXL antibody.
- KLH keyhole limpet hemocyanin
- SEQ ID NO:132 Homo sapiens AXL MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEES
- SEQ ID NO:133 Homo sapiens AXL MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEES
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- General Health & Medical Sciences (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Cell Biology (AREA)
- Epidemiology (AREA)
- Molecular Biology (AREA)
- Oncology (AREA)
- Biochemistry (AREA)
- Biomedical Technology (AREA)
- Hematology (AREA)
- Physical Education & Sports Medicine (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Urology & Nephrology (AREA)
- Pulmonology (AREA)
- Reproductive Health (AREA)
- Neurology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Rheumatology (AREA)
- Endocrinology (AREA)
- Gastroenterology & Hepatology (AREA)
- Diabetes (AREA)
- Dermatology (AREA)
- Neurosurgery (AREA)
Priority Applications (64)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| ES15738884T ES2774428T3 (es) | 2014-07-11 | 2015-07-10 | Anticuerpos que se unen a AXL |
| US15/325,364 US10512688B2 (en) | 2014-07-11 | 2015-07-10 | Antibodies binding AXL |
| JP2017501287A JP6701162B2 (ja) | 2014-07-11 | 2015-07-10 | Axlに結合する抗体 |
| EP15738884.4A EP3169706B1 (en) | 2014-07-11 | 2015-07-10 | Antibodies binding axl |
| PL15738884T PL3169706T3 (pl) | 2014-07-11 | 2015-07-10 | Przeciwciała wiążące axl |
| DK15738884.4T DK3169706T3 (da) | 2014-07-11 | 2015-07-10 | Antistoffer, der binder axl |
| LTEP15738884.4T LT3169706T (lt) | 2014-07-11 | 2015-07-10 | Antikūnai, besirišantys prie axl |
| SM20200265T SMT202000265T1 (it) | 2014-07-11 | 2015-07-10 | Anticorpi che legano axl |
| AU2015286569A AU2015286569B2 (en) | 2014-07-11 | 2015-07-10 | Antibodies binding AXL |
| KR1020237033792A KR102959637B1 (ko) | 2014-07-11 | 2015-07-10 | Axl에 결합하는 항체 |
| EA201790173A EA201790173A1 (ru) | 2014-07-11 | 2015-07-10 | Антитела, связывающие axl |
| BR112017000316-3A BR112017000316B1 (pt) | 2014-07-11 | 2015-07-10 | Anticorpo, imunoconjugado, composição, célula hospedeira, hibridoma, uso do anticorpo, métodos in vitro para produzir um anticorpo e para detectar a presença de um anticorpo axl ou uma célula que expressa axl, e, kit |
| SG11201610777VA SG11201610777VA (en) | 2014-07-11 | 2015-07-10 | Antibodies binding axl |
| CN201580045131.4A CN107074948B (zh) | 2014-07-11 | 2015-07-10 | 结合axl的抗体 |
| CA2952758A CA2952758A1 (en) | 2014-07-11 | 2015-07-10 | Antibodies binding axl |
| UAA201701193A UA127198C2 (uk) | 2014-07-11 | 2015-07-10 | Антитіло, яке зв'язує axl |
| KR1020177003473A KR102586656B1 (ko) | 2014-07-11 | 2015-07-10 | Axl에 결합하는 항체 |
| MX2016016881A MX370807B (es) | 2014-07-11 | 2015-07-10 | Anticuerpos que se unen a axl. |
| IL296633A IL296633A (en) | 2014-07-11 | 2015-07-10 | Antibodies that bind axl |
| SI201531118T SI3169706T1 (sl) | 2014-07-11 | 2015-07-10 | Protitelesa, ki vežejo AXL |
| NZ728019A NZ728019A (en) | 2014-07-11 | 2015-07-10 | Antibodies binding axl |
| MEP-2020-42A ME03665B (me) | 2014-07-11 | 2015-07-10 | Antitela koja vezuju axl |
| HRP20200283TT HRP20200283T1 (hr) | 2014-07-11 | 2015-07-10 | Protutijela koja se vežu na axl |
| EP19213033.4A EP3763738A1 (en) | 2014-07-11 | 2015-07-10 | Antibodies binding axl |
| RS20200253A RS60012B1 (sr) | 2014-07-11 | 2015-07-10 | Antitela koja vezuju axl |
| CN202210136603.9A CN114621347B (zh) | 2014-07-11 | 2015-07-10 | 结合axl的抗体 |
| IL249512A IL249512B2 (en) | 2014-07-11 | 2015-07-10 | Antibodies binding axl |
| RS20200419A RS60141B1 (sr) | 2015-07-10 | 2016-07-08 | Konjugati antitela specifičnog za axl i lekova za lečenje kancera |
| US15/742,818 US20180326084A1 (en) | 2015-07-10 | 2016-07-08 | Axl-specific antibody-drug conjugates for cancer treatment |
| SI201630699T SI3319993T1 (sl) | 2015-07-10 | 2016-07-08 | AXL-specifični konjugati zdravila s protitelesom za zdravljenje raka |
| EA201890272A EA201890272A1 (ru) | 2015-07-10 | 2016-07-08 | Axl-специфические конъюгаты антитело-лекарственное средство для лечения рака |
| EP16739079.8A EP3319993B1 (en) | 2015-07-10 | 2016-07-08 | Axl-specific antibody-drug conjugates for cancer treatment |
| CA2991805A CA2991805A1 (en) | 2015-07-10 | 2016-07-08 | Axl-specific antibody-drug conjugates for cancer treatment |
| PL16739079T PL3319993T3 (pl) | 2015-07-10 | 2016-07-08 | Specyficzne wobec AXL koniugaty przeciwciało-lek do leczenia raka |
| AU2016292762A AU2016292762B2 (en) | 2015-07-10 | 2016-07-08 | AXL-specific antibody-drug conjugates for cancer treatment |
| HUE16739079A HUE049072T2 (hu) | 2015-07-10 | 2016-07-08 | AXL-specifikus ellenanyag-drog konjugátumok rák kezelésére |
| EP20151844.6A EP3730520A1 (en) | 2015-07-10 | 2016-07-08 | Axl-specific antibody-drug conjugates for cancer treatment |
| SM20200359T SMT202000359T1 (it) | 2015-07-10 | 2016-07-08 | Coniugati anticorpo-farmaco specifici per axl per il trattamento del cancro |
| KR1020187004011A KR20180033523A (ko) | 2015-07-10 | 2016-07-08 | 암 치료를 위한 axl-특이적 항체-약물 접합체 |
| PCT/EP2016/066353 WO2017009258A1 (en) | 2015-07-10 | 2016-07-08 | Axl-specific antibody-drug conjugates for cancer treatment |
| ES16739079T ES2784685T3 (es) | 2015-07-10 | 2016-07-08 | Productos conjugados de anticuerpo-fármaco específicos de AXL para el tratamiento del cáncer |
| MEP-2020-74A ME03772B (me) | 2015-07-10 | 2016-07-08 | Konjugati antitijela specifičnog za axl i lijeka za liječenje kancera |
| HK18114575.4A HK1255412B (en) | 2015-07-10 | 2016-07-08 | Axl-specific antibody-drug conjugates for cancer treatment |
| LTEP16739079.8T LT3319993T (lt) | 2015-07-10 | 2016-07-08 | Axl specifiniai antikūno-vaistokonjugatai, skirti vėžiui gydyti |
| CN201680052378.3A CN108368171A (zh) | 2015-07-10 | 2016-07-08 | 用于癌症治疗的axl特异性抗体-药物缀合物 |
| DK16739079.8T DK3319993T3 (da) | 2015-07-10 | 2016-07-08 | AXL-SPECIFIKKE antistof-lægemiddelkonjugater til kræftbehandling |
| HRP20200551TT HRP20200551T1 (hr) | 2015-07-10 | 2016-07-08 | Axl-specifični konjugati protutijelo-lijek za liječenje raka |
| JP2018500605A JP6892431B2 (ja) | 2015-07-10 | 2016-07-08 | 癌治療用のaxl特異的抗体−薬物コンジュゲート |
| PT167390798T PT3319993T (pt) | 2015-07-10 | 2016-07-08 | Conjugados de anticorpo-fármaco específicos de axl para tratamento de cancro |
| ZA2016/08609A ZA201608609B (en) | 2014-07-11 | 2016-12-13 | Antibodies binding axl |
| IL256790A IL256790B (en) | 2015-07-10 | 2018-01-08 | Axl-specific antibody-drug conjugates for cancer treatment |
| US15/938,961 US10201607B2 (en) | 2014-07-11 | 2018-03-28 | Antibodies binding AXL |
| US16/248,402 US10765743B2 (en) | 2014-07-11 | 2019-01-15 | Antibodies binding AXL |
| US16/270,317 US10500276B2 (en) | 2014-07-11 | 2019-02-07 | Antibodies binding AXL |
| US16/673,383 US20200171152A1 (en) | 2014-07-11 | 2019-11-04 | Antibodies binding axl |
| CY20201100192T CY1122721T1 (el) | 2014-07-11 | 2020-03-04 | Αντισωματα που δεσμευουν αχl |
| CY20201100339T CY1123983T1 (el) | 2015-07-10 | 2020-04-13 | Ειδικα σε axl συζευγματα αντισωματος-φαρμακου για τη θεραπεια καρκινου |
| US16/891,796 US20200397913A1 (en) | 2015-07-10 | 2020-06-03 | Axl-specific antibody-drug conjugates for cancer treatment |
| JP2021088877A JP7428680B2 (ja) | 2015-07-10 | 2021-05-27 | 癌治療用のaxl特異的抗体-薬物コンジュゲート |
| AU2021205074A AU2021205074B2 (en) | 2014-07-11 | 2021-07-15 | Antibodies binding AXL |
| AU2022259847A AU2022259847C1 (en) | 2015-07-10 | 2022-10-28 | AXL-specific antibody-drug conjugates for cancer treatment |
| US18/175,894 US12589150B2 (en) | 2014-07-11 | 2023-02-28 | Antibodies binding AXL |
| JP2024009200A JP2024038480A (ja) | 2015-07-10 | 2024-01-25 | 癌治療用のaxl特異的抗体-薬物コンジュゲート |
| AU2025201717A AU2025201717A1 (en) | 2014-07-11 | 2025-03-10 | Antibodies binding AXL |
Applications Claiming Priority (8)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| DKPA201400380 | 2014-07-11 | ||
| DKPA201400380 | 2014-07-11 | ||
| DKPA201400489 | 2014-09-01 | ||
| DKPA201400489 | 2014-09-01 | ||
| DKPA201400746 | 2014-12-22 | ||
| DKPA201400746 | 2014-12-22 | ||
| DKPA201500283 | 2015-05-12 | ||
| DKPA201500283 | 2015-05-12 |
Related Child Applications (5)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| US15/325,364 A-371-Of-International US10512688B2 (en) | 2014-07-11 | 2015-07-10 | Antibodies binding AXL |
| US15/938,961 Division US10201607B2 (en) | 2014-07-11 | 2018-03-28 | Antibodies binding AXL |
| US16/248,402 Division US10765743B2 (en) | 2014-07-11 | 2019-01-15 | Antibodies binding AXL |
| US16/270,317 Division US10500276B2 (en) | 2014-07-11 | 2019-02-07 | Antibodies binding AXL |
| US16/673,383 Division US20200171152A1 (en) | 2014-07-11 | 2019-11-04 | Antibodies binding axl |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2016005593A1 true WO2016005593A1 (en) | 2016-01-14 |
Family
ID=53673928
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/EP2015/065900 Ceased WO2016005593A1 (en) | 2014-07-11 | 2015-07-10 | Antibodies binding axl |
Country Status (27)
| Country | Link |
|---|---|
| US (6) | US10512688B2 (enExample) |
| EP (2) | EP3169706B1 (enExample) |
| JP (3) | JP6701162B2 (enExample) |
| KR (1) | KR102586656B1 (enExample) |
| CN (2) | CN114621347B (enExample) |
| AU (3) | AU2015286569B2 (enExample) |
| CA (1) | CA2952758A1 (enExample) |
| CY (1) | CY1122721T1 (enExample) |
| DK (1) | DK3169706T3 (enExample) |
| EA (1) | EA201790173A1 (enExample) |
| ES (1) | ES2774428T3 (enExample) |
| HR (1) | HRP20200283T1 (enExample) |
| HU (1) | HUE048667T2 (enExample) |
| IL (2) | IL296633A (enExample) |
| LT (1) | LT3169706T (enExample) |
| ME (1) | ME03665B (enExample) |
| MX (1) | MX370807B (enExample) |
| NZ (1) | NZ728019A (enExample) |
| PL (1) | PL3169706T3 (enExample) |
| PT (1) | PT3169706T (enExample) |
| RS (1) | RS60012B1 (enExample) |
| SG (2) | SG11201610777VA (enExample) |
| SI (1) | SI3169706T1 (enExample) |
| SM (1) | SMT202000265T1 (enExample) |
| UA (1) | UA127198C2 (enExample) |
| WO (1) | WO2016005593A1 (enExample) |
| ZA (1) | ZA201608609B (enExample) |
Cited By (19)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2017009258A1 (en) * | 2015-07-10 | 2017-01-19 | Genmab A/S | Axl-specific antibody-drug conjugates for cancer treatment |
| WO2017180842A1 (en) * | 2016-04-15 | 2017-10-19 | Bioatla, Llc | Anti-axl antibodies, antibody fragments and their immunoconjugates and uses thereof |
| WO2017200493A1 (en) | 2016-05-20 | 2017-11-23 | Agency For Science, Technology And Research | Anti-axl tyrosine kinase receptor antibodies and uses thereof |
| WO2018007592A1 (en) | 2016-07-08 | 2018-01-11 | Genmab A/S | New dosage regimens for antibody drug conjugates based on anti-axl antibodies |
| WO2019051586A1 (en) | 2017-09-13 | 2019-03-21 | National Research Council Of Canada | AXL SPECIFIC ANTIBODIES AND USES THEREOF |
| CN109906381A (zh) * | 2016-08-31 | 2019-06-18 | 新加坡科技研究局 | 鉴别、靶向以及分离人树突细胞(dc)前体“前dc”的方法及其用途 |
| WO2019197506A1 (en) | 2018-04-10 | 2019-10-17 | Genmab A/S | Axl-specific antibodies for cancer treatment |
| US10513509B2 (en) | 2016-05-26 | 2019-12-24 | Recurium Ip Holdings, Llc | EGFR inhibitor compounds |
| WO2019243626A1 (en) | 2018-06-22 | 2019-12-26 | Genmab A/S | Method for producing a controlled mixture of two or more different antibodies |
| WO2020065396A1 (en) | 2018-09-26 | 2020-04-02 | Genmab A/S | Axl-specific antibodies for treatment of non-small cell lung cancer |
| JP2020514302A (ja) * | 2017-01-08 | 2020-05-21 | 浙江昭華生物医薬有限公司 | 抗5t4抗体−薬物複合体およびその使用 |
| WO2020227574A3 (en) * | 2019-05-07 | 2020-12-10 | Board Of Regents, The University Of Texas System | Methods for predicting drug responsiveness in samples from cancer subjects |
| WO2021013746A1 (en) | 2019-07-19 | 2021-01-28 | Genmab A/S | Axl antibody-drug conjugates for use in treating cancer |
| US11040027B2 (en) | 2017-01-17 | 2021-06-22 | Heparegenix Gmbh | Protein kinase inhibitors for promoting liver regeneration or reducing or preventing hepatocyte death |
| WO2021142086A1 (en) | 2020-01-08 | 2021-07-15 | Synthis Therapeutics, Inc. | Alk5 inhibitor conjugates and uses thereof |
| US12115227B2 (en) | 2016-01-13 | 2024-10-15 | Genmab A/S | Formulation for antibody and drug conjugate thereof |
| PL446349A1 (pl) * | 2023-10-11 | 2025-04-14 | Celon Pharma Spółka Akcyjna | Przeciwciała bispecyficzne anty-AXL i anty-PD-L1 oraz ich zastosowanie w terapii, zwłaszcza w leczeniu nowotworu |
| US12384822B2 (en) | 2021-01-29 | 2025-08-12 | Illimis Therapeutics, Inc. | TAM receptor-binding fusion molecule having non-inflammatory phagocytosis inducing activity |
| TWI917874B (zh) | 2016-04-15 | 2026-03-11 | 美商拜奧亞特拉公司 | 抗-axl抗體、抗體片段及其免疫結合物及其用途 |
Families Citing this family (9)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| SMT202000265T1 (it) | 2014-07-11 | 2020-07-08 | Genmab As | Anticorpi che legano axl |
| CN107987163B (zh) * | 2017-12-04 | 2018-11-20 | 杭州尚健生物技术有限公司 | 单克隆抗体9a及其应用 |
| CN110483639A (zh) * | 2018-05-15 | 2019-11-22 | 复旦大学 | 靶向axl的抗体及抗体-药物偶联物及其制备方法和用途 |
| AU2019372436A1 (en) * | 2018-11-01 | 2021-05-20 | Merck Patent Gmbh | Methods of administering anti-TIM-3 antibodies |
| CN118465272B (zh) * | 2019-12-04 | 2025-08-19 | 珠海泰诺麦博制药股份有限公司 | 抗人巨细胞病毒抗体及其用途 |
| JP7669062B2 (ja) * | 2020-08-19 | 2025-04-28 | ファームアブシン・インコーポレイテッド | 変形抗体及びその製造方法 |
| US20250019446A1 (en) * | 2021-06-16 | 2025-01-16 | Shanghai Sinobay Biotechnology Co., Ltd. | Antibody Targeting Axl Protein and Antigen Binding Fragment Thereof, and Preparation Method Therefor and Application Thereof |
| WO2022269605A1 (en) | 2021-06-24 | 2022-12-29 | Yeda Research And Development Co. Ltd. | Combination therapy for the treatment of cancer comprising an anti-egfr antibody and an axl-inhibitor |
| CN119968395A (zh) * | 2022-08-18 | 2025-05-09 | 百进生物科技公司 | 抗axl抗体、其抗原结合片段及其制备和使用方法 |
Citations (82)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4495285A (en) | 1981-10-30 | 1985-01-22 | Kimihiro Shimizu | Plasminogen activator derivatives |
| US4609546A (en) | 1982-06-24 | 1986-09-02 | Japan Chemical Research Co., Ltd. | Long-acting composition |
| US4681581A (en) | 1983-12-05 | 1987-07-21 | Coates Fredrica V | Adjustable size diaper and folding method therefor |
| US4699880A (en) | 1984-09-25 | 1987-10-13 | Immunomedics, Inc. | Method of producing monoclonal anti-idiotype antibody |
| US4735210A (en) | 1985-07-05 | 1988-04-05 | Immunomedics, Inc. | Lymphographic and organ imaging method and kit |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| US5057313A (en) | 1986-02-25 | 1991-10-15 | The Center For Molecular Medicine And Immunology | Diagnostic and therapeutic antibody conjugates |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5102990A (en) | 1989-08-09 | 1992-04-07 | Rhomed Incorporated | Direct radiolabeling of antibodies and other proteins with technetium or rhenium |
| US5101827A (en) | 1985-07-05 | 1992-04-07 | Immunomedics, Inc. | Lymphographic and organ imaging method and kit |
| WO1992022645A1 (en) | 1991-06-14 | 1992-12-23 | Genpharm International, Inc. | Transgenic immunodeficient non-human animals |
| WO1993001227A1 (en) | 1991-07-08 | 1993-01-21 | University Of Massachusetts At Amherst | Thermotropic liquid crystal segmented block copolymer |
| US5194594A (en) | 1990-09-07 | 1993-03-16 | Techniclone, Inc. | Modified antibodies |
| WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5589466A (en) | 1989-03-21 | 1996-12-31 | Vical Incorporated | Induction of a protective immune response in a mammal by injecting a DNA sequence |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US5648471A (en) | 1987-12-03 | 1997-07-15 | Centocor, Inc. | One vial method for labeling antibodies with Technetium-99m |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| US5697902A (en) | 1985-07-05 | 1997-12-16 | Immunomedics, Inc. | Method for imaging and treating organs and tissues |
| WO1998024884A1 (en) | 1996-12-02 | 1998-06-11 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| WO1998050431A2 (en) | 1997-05-02 | 1998-11-12 | Genentech, Inc. | A method for making multispecific antibodies having heteromultimeric and common components |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5973972A (en) | 1995-11-03 | 1999-10-26 | Samsung Electronics, Co., Ltd. | Precharge system for a semiconductor memory device |
| US6077835A (en) | 1994-03-23 | 2000-06-20 | Case Western Reserve University | Delivery of compacted nucleic acid to cells |
| WO2000046147A2 (en) | 1999-02-03 | 2000-08-10 | Biosante Pharmaceuticals, Inc. | Therapeutic calcium phosphate particles and methods of manufacture and use |
| WO2000070087A1 (en) | 1999-05-14 | 2000-11-23 | Copernicus Therapeutics, Inc. | Automated nucleic acid compaction device |
| WO2001009187A2 (en) | 1999-07-29 | 2001-02-08 | Medarex, Inc. | Human monoclonal antibodies to her2/neu |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| WO2002020039A2 (de) | 2000-09-04 | 2002-03-14 | Horst Lindhofer | Verwendung von trifunktionellen bispezifischen und trispezifischen antikörpern zur behandlung von malignem aszites |
| WO2002083180A1 (en) | 2001-03-23 | 2002-10-24 | Syntarga B.V. | Elongated and multiple spacers in activatible prodrugs |
| WO2004010957A2 (en) | 2002-07-31 | 2004-02-05 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| WO2004043493A1 (en) | 2002-11-14 | 2004-05-27 | Syntarga B.V. | Prodrugs built as multiple self-elimination-release spacers |
| WO2005081711A2 (en) | 2003-11-06 | 2005-09-09 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US6989452B2 (en) | 2001-05-31 | 2006-01-24 | Medarex, Inc. | Disulfide prodrugs and linkers and stabilizers useful therefor |
| WO2007018431A2 (en) | 2005-08-05 | 2007-02-15 | Syntarga B.V. | Triazole-containing releasable linkers and conjugates comprising the same |
| WO2007059782A1 (en) | 2005-11-28 | 2007-05-31 | Genmab A/S | Recombinant monovalent antibodies and methods for production thereof |
| WO2007089149A2 (en) | 2006-02-02 | 2007-08-09 | Syntarga B.V. | Water-soluble cc-1065 analogs and their conjugates |
| US7262028B2 (en) | 2002-07-18 | 2007-08-28 | Crucell Holland B.V. | Recombinant production of mixtures of antibodies |
| WO2007110205A2 (en) | 2006-03-24 | 2007-10-04 | Merck Patent Gmbh | Engineered heterodimeric protein domains |
| EP1870459A1 (en) | 2005-03-31 | 2007-12-26 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
| WO2008003116A2 (en) | 2006-07-05 | 2008-01-10 | F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. | Method for engineering immunoglobulins |
| WO2008157379A2 (en) | 2007-06-21 | 2008-12-24 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| WO2009017394A1 (en) | 2007-08-01 | 2009-02-05 | Syntarga B.V. | Substituted cc-1065 analogs and their conjugates |
| WO2009063965A1 (ja) | 2007-11-15 | 2009-05-22 | Chugai Seiyaku Kabushiki Kaisha | Anexelektoに結合するモノクローナル抗体、およびその利用 |
| WO2009080254A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| WO2010015792A1 (en) | 2008-08-06 | 2010-02-11 | Argenta Discovery Limited | Nitrogen containing heterocyclic compounds useful as bifunctional modulators of m3 receptors and beta-2 receptors |
| WO2010062171A2 (en) | 2008-11-03 | 2010-06-03 | Syntarga B.V. | Novel cc-1065 analogs and their conjugates |
| US20100155133A1 (en) | 2005-01-13 | 2010-06-24 | The Wiremold Company | Downward facing receptacle assembly for cable raceway |
| WO2010080538A1 (en) | 2008-12-19 | 2010-07-15 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| EP2220131A1 (en) | 2007-12-14 | 2010-08-25 | Total Petrochemicals Research Feluy | Spunbond nonwovens made from high-cristallinity propylene polymer |
| US20100226923A1 (en) | 2007-10-15 | 2010-09-09 | Sanofi-Aventis | Antibodies that bind il-4 and/or il-13 and their uses |
| WO2010129304A2 (en) | 2009-04-27 | 2010-11-11 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
| WO2010131733A1 (ja) | 2009-05-15 | 2010-11-18 | 中外製薬株式会社 | 抗axl抗体 |
| WO2011014457A1 (en) * | 2009-07-27 | 2011-02-03 | Genentech, Inc. | Combination treatments |
| WO2011028952A1 (en) | 2009-09-02 | 2011-03-10 | Xencor, Inc. | Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens |
| US7951918B2 (en) | 2006-03-17 | 2011-05-31 | Biogen Idec Ma Inc. | Stabilized polypeptide compositions |
| WO2011117329A1 (en) | 2010-03-26 | 2011-09-29 | F. Hoffmann-La Roche Ag | Bispecific, bivalent anti-vegf/anti-ang-2 antibodies |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| WO2011143545A1 (en) | 2010-05-14 | 2011-11-17 | Rinat Neuroscience Corporation | Heterodimeric proteins and methods for producing and purifying them |
| CN102250246A (zh) | 2011-06-10 | 2011-11-23 | 常州亚当生物技术有限公司 | 抗VEGF/PDGFRβ双特异性抗体及其应用 |
| WO2011159980A1 (en) | 2010-06-18 | 2011-12-22 | Genentech, Inc. | Anti-axl antibodies and methods of use |
| WO2012025530A1 (en) | 2010-08-24 | 2012-03-01 | F. Hoffmann-La Roche Ag | Bispecific antibodies comprising a disulfide stabilized - fv fragment |
| WO2012025525A1 (en) | 2010-08-24 | 2012-03-01 | Roche Glycart Ag | Activatable bispecific antibodies |
| WO2012058768A1 (en) | 2010-11-05 | 2012-05-10 | Zymeworks Inc. | Stable heterodimeric antibody design with mutations in the fc domain |
| WO2012175692A1 (en) | 2011-06-22 | 2012-12-27 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Anti-axl antibodies and uses thereof |
| WO2012175691A1 (en) | 2011-06-22 | 2012-12-27 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Anti-axl antibodies and uses thereof |
| WO2013064685A1 (en) | 2011-11-03 | 2013-05-10 | Pierre Fabre Medicament | Antigen binding protein and its use as addressing product for the treatment cancer |
| WO2013090776A1 (en) | 2011-12-15 | 2013-06-20 | The Board Of Trustees Of The Leland Stanford Junior University | Inhibition of axl/gas6 signaling in the treatment of disease |
| WO2013173392A1 (en) | 2012-05-15 | 2013-11-21 | Concortis Biosystems, Corp | Drug-conjugates, conjugation methods, and uses thereof |
Family Cites Families (10)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP1616885B1 (en) | 2003-03-28 | 2012-10-10 | Kyoto Electronics Manufacturing Co., Ltd. | Recombinant antibody recognizing dioxin and gene encoding the antibody |
| EP2097447A4 (en) | 2006-11-15 | 2010-12-29 | Medarex Inc | HUMAN MONOCLONAL ANTIBODIES AGAINST BTLA AND METHODS OF USE |
| JP5397668B2 (ja) | 2008-09-02 | 2014-01-22 | ソニー株式会社 | 記憶素子および記憶装置 |
| US9074192B2 (en) | 2010-01-22 | 2015-07-07 | The Board Of Trustees Of The Leland Stanford Junior University | Inhibition of AXL signaling in anti-metastatic therapy |
| PL2914630T3 (pl) | 2012-11-05 | 2021-09-06 | Pierre Fabre Médicament | Nowe białka wiążące antygen i ich zastosowanie jako produktu ukierunkowanego do leczenia raka |
| US20160106861A1 (en) | 2013-04-26 | 2016-04-21 | Spirogen Sarl | Axl antibody-drug conjugate and its use for the treatment of cancer |
| GB201410825D0 (en) | 2014-06-18 | 2014-07-30 | Bergenbio As | Anti-axl antibodies |
| SMT202000265T1 (it) | 2014-07-11 | 2020-07-08 | Genmab As | Anticorpi che legano axl |
| JP6864953B2 (ja) | 2014-12-09 | 2021-04-28 | アンスティチュ ナショナル ドゥ ラ サンテ エ ドゥ ラ ルシェルシュ メディカル | Axlに対するヒトモノクローナル抗体 |
| PL3319993T3 (pl) | 2015-07-10 | 2020-07-27 | Genmab A/S | Specyficzne wobec AXL koniugaty przeciwciało-lek do leczenia raka |
-
2015
- 2015-07-10 SM SM20200265T patent/SMT202000265T1/it unknown
- 2015-07-10 CA CA2952758A patent/CA2952758A1/en active Pending
- 2015-07-10 EA EA201790173A patent/EA201790173A1/ru unknown
- 2015-07-10 CN CN202210136603.9A patent/CN114621347B/zh active Active
- 2015-07-10 LT LTEP15738884.4T patent/LT3169706T/lt unknown
- 2015-07-10 NZ NZ728019A patent/NZ728019A/en unknown
- 2015-07-10 RS RS20200253A patent/RS60012B1/sr unknown
- 2015-07-10 MX MX2016016881A patent/MX370807B/es active IP Right Grant
- 2015-07-10 SI SI201531118T patent/SI3169706T1/sl unknown
- 2015-07-10 KR KR1020177003473A patent/KR102586656B1/ko active Active
- 2015-07-10 AU AU2015286569A patent/AU2015286569B2/en active Active
- 2015-07-10 CN CN201580045131.4A patent/CN107074948B/zh active Active
- 2015-07-10 PT PT157388844T patent/PT3169706T/pt unknown
- 2015-07-10 WO PCT/EP2015/065900 patent/WO2016005593A1/en not_active Ceased
- 2015-07-10 UA UAA201701193A patent/UA127198C2/uk unknown
- 2015-07-10 EP EP15738884.4A patent/EP3169706B1/en active Active
- 2015-07-10 ES ES15738884T patent/ES2774428T3/es active Active
- 2015-07-10 IL IL296633A patent/IL296633A/en unknown
- 2015-07-10 ME MEP-2020-42A patent/ME03665B/me unknown
- 2015-07-10 IL IL249512A patent/IL249512B2/en unknown
- 2015-07-10 EP EP19213033.4A patent/EP3763738A1/en active Pending
- 2015-07-10 PL PL15738884T patent/PL3169706T3/pl unknown
- 2015-07-10 HU HUE15738884A patent/HUE048667T2/hu unknown
- 2015-07-10 SG SG11201610777VA patent/SG11201610777VA/en unknown
- 2015-07-10 JP JP2017501287A patent/JP6701162B2/ja active Active
- 2015-07-10 DK DK15738884.4T patent/DK3169706T3/da active
- 2015-07-10 SG SG10202006715SA patent/SG10202006715SA/en unknown
- 2015-07-10 US US15/325,364 patent/US10512688B2/en active Active
- 2015-07-10 HR HRP20200283TT patent/HRP20200283T1/hr unknown
-
2016
- 2016-12-13 ZA ZA2016/08609A patent/ZA201608609B/en unknown
-
2018
- 2018-03-28 US US15/938,961 patent/US10201607B2/en active Active
-
2019
- 2019-01-15 US US16/248,402 patent/US10765743B2/en active Active
- 2019-02-07 US US16/270,317 patent/US10500276B2/en active Active
- 2019-11-04 US US16/673,383 patent/US20200171152A1/en not_active Abandoned
-
2020
- 2020-03-04 CY CY20201100192T patent/CY1122721T1/el unknown
- 2020-05-01 JP JP2020080943A patent/JP2020141682A/ja active Pending
-
2021
- 2021-07-15 AU AU2021205074A patent/AU2021205074B2/en active Active
-
2023
- 2023-02-28 US US18/175,894 patent/US12589150B2/en active Active
- 2023-11-24 JP JP2023198745A patent/JP2024026158A/ja active Pending
-
2025
- 2025-03-10 AU AU2025201717A patent/AU2025201717A1/en active Pending
Patent Citations (93)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US4179337A (en) | 1973-07-20 | 1979-12-18 | Davis Frank F | Non-immunogenic polypeptides |
| US4495285A (en) | 1981-10-30 | 1985-01-22 | Kimihiro Shimizu | Plasminogen activator derivatives |
| US4495285B1 (enExample) | 1981-10-30 | 1986-09-23 | Nippon Chemiphar Co | |
| US4609546A (en) | 1982-06-24 | 1986-09-02 | Japan Chemical Research Co., Ltd. | Long-acting composition |
| US4681581A (en) | 1983-12-05 | 1987-07-21 | Coates Fredrica V | Adjustable size diaper and folding method therefor |
| US4699880A (en) | 1984-09-25 | 1987-10-13 | Immunomedics, Inc. | Method of producing monoclonal anti-idiotype antibody |
| US4766106A (en) | 1985-06-26 | 1988-08-23 | Cetus Corporation | Solubilization of proteins for pharmaceutical compositions using polymer conjugation |
| US4735210A (en) | 1985-07-05 | 1988-04-05 | Immunomedics, Inc. | Lymphographic and organ imaging method and kit |
| US5697902A (en) | 1985-07-05 | 1997-12-16 | Immunomedics, Inc. | Method for imaging and treating organs and tissues |
| US5101827A (en) | 1985-07-05 | 1992-04-07 | Immunomedics, Inc. | Lymphographic and organ imaging method and kit |
| US6331175B1 (en) | 1985-07-05 | 2001-12-18 | Immunomedics, Inc. | Method and kit for imaging and treating organs and tissues |
| US5057313A (en) | 1986-02-25 | 1991-10-15 | The Center For Molecular Medicine And Immunology | Diagnostic and therapeutic antibody conjugates |
| US5648471A (en) | 1987-12-03 | 1997-07-15 | Centocor, Inc. | One vial method for labeling antibodies with Technetium-99m |
| US5545807A (en) | 1988-10-12 | 1996-08-13 | The Babraham Institute | Production of antibodies from transgenic animals |
| US5589466A (en) | 1989-03-21 | 1996-12-31 | Vical Incorporated | Induction of a protective immune response in a mammal by injecting a DNA sequence |
| US5102990A (en) | 1989-08-09 | 1992-04-07 | Rhomed Incorporated | Direct radiolabeling of antibodies and other proteins with technetium or rhenium |
| US5633425A (en) | 1990-08-29 | 1997-05-27 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5545806A (en) | 1990-08-29 | 1996-08-13 | Genpharm International, Inc. | Ransgenic non-human animals for producing heterologous antibodies |
| US5569825A (en) | 1990-08-29 | 1996-10-29 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5877397A (en) | 1990-08-29 | 1999-03-02 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5625126A (en) | 1990-08-29 | 1997-04-29 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5770429A (en) | 1990-08-29 | 1998-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5874299A (en) | 1990-08-29 | 1999-02-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5661016A (en) | 1990-08-29 | 1997-08-26 | Genpharm International Inc. | Transgenic non-human animals capable of producing heterologous antibodies of various isotypes |
| US5814318A (en) | 1990-08-29 | 1998-09-29 | Genpharm International Inc. | Transgenic non-human animals for producing heterologous antibodies |
| WO1992003918A1 (en) | 1990-08-29 | 1992-03-19 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5789650A (en) | 1990-08-29 | 1998-08-04 | Genpharm International, Inc. | Transgenic non-human animals for producing heterologous antibodies |
| US5194594A (en) | 1990-09-07 | 1993-03-16 | Techniclone, Inc. | Modified antibodies |
| WO1992022645A1 (en) | 1991-06-14 | 1992-12-23 | Genpharm International, Inc. | Transgenic immunodeficient non-human animals |
| WO1993001227A1 (en) | 1991-07-08 | 1993-01-21 | University Of Massachusetts At Amherst | Thermotropic liquid crystal segmented block copolymer |
| US5635483A (en) | 1992-12-03 | 1997-06-03 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Tumor inhibiting tetrapeptide bearing modified phenethyl amides |
| US5780588A (en) | 1993-01-26 | 1998-07-14 | Arizona Board Of Regents | Elucidation and synthesis of selected pentapeptides |
| WO1994025585A1 (en) | 1993-04-26 | 1994-11-10 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
| US6077835A (en) | 1994-03-23 | 2000-06-20 | Case Western Reserve University | Delivery of compacted nucleic acid to cells |
| US5663149A (en) | 1994-12-13 | 1997-09-02 | Arizona Board Of Regents Acting On Behalf Of Arizona State University | Human cancer inhibitory pentapeptide heterocyclic and halophenyl amides |
| US5973972A (en) | 1995-11-03 | 1999-10-26 | Samsung Electronics, Co., Ltd. | Precharge system for a semiconductor memory device |
| WO1998024884A1 (en) | 1996-12-02 | 1998-06-11 | Genpharm International | Transgenic non-human animals capable of producing heterologous antibodies |
| WO1998050431A2 (en) | 1997-05-02 | 1998-11-12 | Genentech, Inc. | A method for making multispecific antibodies having heteromultimeric and common components |
| WO2000046147A2 (en) | 1999-02-03 | 2000-08-10 | Biosante Pharmaceuticals, Inc. | Therapeutic calcium phosphate particles and methods of manufacture and use |
| WO2000070087A1 (en) | 1999-05-14 | 2000-11-23 | Copernicus Therapeutics, Inc. | Automated nucleic acid compaction device |
| WO2001009187A2 (en) | 1999-07-29 | 2001-02-08 | Medarex, Inc. | Human monoclonal antibodies to her2/neu |
| WO2002020039A2 (de) | 2000-09-04 | 2002-03-14 | Horst Lindhofer | Verwendung von trifunktionellen bispezifischen und trispezifischen antikörpern zur behandlung von malignem aszites |
| WO2002083180A1 (en) | 2001-03-23 | 2002-10-24 | Syntarga B.V. | Elongated and multiple spacers in activatible prodrugs |
| US6989452B2 (en) | 2001-05-31 | 2006-01-24 | Medarex, Inc. | Disulfide prodrugs and linkers and stabilizers useful therefor |
| US7262028B2 (en) | 2002-07-18 | 2007-08-28 | Crucell Holland B.V. | Recombinant production of mixtures of antibodies |
| WO2004010957A2 (en) | 2002-07-31 | 2004-02-05 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US7851437B2 (en) | 2002-07-31 | 2010-12-14 | Seattle Genetics Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US7829531B2 (en) | 2002-07-31 | 2010-11-09 | Seattle Genetics Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| US7659241B2 (en) | 2002-07-31 | 2010-02-09 | Seattle Genetics, Inc. | Drug conjugates and their use for treating cancer, an autoimmune disease or an infectious disease |
| WO2004043493A1 (en) | 2002-11-14 | 2004-05-27 | Syntarga B.V. | Prodrugs built as multiple self-elimination-release spacers |
| WO2005081711A2 (en) | 2003-11-06 | 2005-09-09 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US7498298B2 (en) | 2003-11-06 | 2009-03-03 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US20050238649A1 (en) | 2003-11-06 | 2005-10-27 | Seattle Genetics, Inc. | Monomethylvaline compounds capable of conjugation to ligands |
| US20100155133A1 (en) | 2005-01-13 | 2010-06-24 | The Wiremold Company | Downward facing receptacle assembly for cable raceway |
| EP1870459A1 (en) | 2005-03-31 | 2007-12-26 | Chugai Seiyaku Kabushiki Kaisha | Methods for producing polypeptides by regulating polypeptide association |
| WO2007018431A2 (en) | 2005-08-05 | 2007-02-15 | Syntarga B.V. | Triazole-containing releasable linkers and conjugates comprising the same |
| US7612181B2 (en) | 2005-08-19 | 2009-11-03 | Abbott Laboratories | Dual variable domain immunoglobulin and uses thereof |
| WO2007059782A1 (en) | 2005-11-28 | 2007-05-31 | Genmab A/S | Recombinant monovalent antibodies and methods for production thereof |
| WO2007089149A2 (en) | 2006-02-02 | 2007-08-09 | Syntarga B.V. | Water-soluble cc-1065 analogs and their conjugates |
| US7951918B2 (en) | 2006-03-17 | 2011-05-31 | Biogen Idec Ma Inc. | Stabilized polypeptide compositions |
| WO2007110205A2 (en) | 2006-03-24 | 2007-10-04 | Merck Patent Gmbh | Engineered heterodimeric protein domains |
| WO2008003116A2 (en) | 2006-07-05 | 2008-01-10 | F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. | Method for engineering immunoglobulins |
| WO2008157379A2 (en) | 2007-06-21 | 2008-12-24 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| WO2009017394A1 (en) | 2007-08-01 | 2009-02-05 | Syntarga B.V. | Substituted cc-1065 analogs and their conjugates |
| US20100226923A1 (en) | 2007-10-15 | 2010-09-09 | Sanofi-Aventis | Antibodies that bind il-4 and/or il-13 and their uses |
| WO2009063965A1 (ja) | 2007-11-15 | 2009-05-22 | Chugai Seiyaku Kabushiki Kaisha | Anexelektoに結合するモノクローナル抗体、およびその利用 |
| EP2220131A1 (en) | 2007-12-14 | 2010-08-25 | Total Petrochemicals Research Feluy | Spunbond nonwovens made from high-cristallinity propylene polymer |
| WO2009080254A1 (en) | 2007-12-21 | 2009-07-02 | F. Hoffmann-La Roche Ag | Bivalent, bispecific antibodies |
| WO2009089004A1 (en) | 2008-01-07 | 2009-07-16 | Amgen Inc. | Method for making antibody fc-heterodimeric molecules using electrostatic steering effects |
| WO2010015792A1 (en) | 2008-08-06 | 2010-02-11 | Argenta Discovery Limited | Nitrogen containing heterocyclic compounds useful as bifunctional modulators of m3 receptors and beta-2 receptors |
| WO2010062171A2 (en) | 2008-11-03 | 2010-06-03 | Syntarga B.V. | Novel cc-1065 analogs and their conjugates |
| WO2010080538A1 (en) | 2008-12-19 | 2010-07-15 | Macrogenics, Inc. | Covalent diabodies and uses thereof |
| WO2010129304A2 (en) | 2009-04-27 | 2010-11-11 | Oncomed Pharmaceuticals, Inc. | Method for making heteromultimeric molecules |
| WO2010131733A1 (ja) | 2009-05-15 | 2010-11-18 | 中外製薬株式会社 | 抗axl抗体 |
| US20120121587A1 (en) * | 2009-05-15 | 2012-05-17 | Chugai Seiyaku Kabushiki Kaisha | Anti-axl antibody |
| WO2011014457A1 (en) * | 2009-07-27 | 2011-02-03 | Genentech, Inc. | Combination treatments |
| WO2011028952A1 (en) | 2009-09-02 | 2011-03-10 | Xencor, Inc. | Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens |
| WO2011117329A1 (en) | 2010-03-26 | 2011-09-29 | F. Hoffmann-La Roche Ag | Bispecific, bivalent anti-vegf/anti-ang-2 antibodies |
| WO2011131746A2 (en) | 2010-04-20 | 2011-10-27 | Genmab A/S | Heterodimeric antibody fc-containing proteins and methods for production thereof |
| WO2011143545A1 (en) | 2010-05-14 | 2011-11-17 | Rinat Neuroscience Corporation | Heterodimeric proteins and methods for producing and purifying them |
| WO2011159980A1 (en) | 2010-06-18 | 2011-12-22 | Genentech, Inc. | Anti-axl antibodies and methods of use |
| WO2012025525A1 (en) | 2010-08-24 | 2012-03-01 | Roche Glycart Ag | Activatable bispecific antibodies |
| WO2012025530A1 (en) | 2010-08-24 | 2012-03-01 | F. Hoffmann-La Roche Ag | Bispecific antibodies comprising a disulfide stabilized - fv fragment |
| WO2012058768A1 (en) | 2010-11-05 | 2012-05-10 | Zymeworks Inc. | Stable heterodimeric antibody design with mutations in the fc domain |
| CN102250246A (zh) | 2011-06-10 | 2011-11-23 | 常州亚当生物技术有限公司 | 抗VEGF/PDGFRβ双特异性抗体及其应用 |
| WO2012175692A1 (en) | 2011-06-22 | 2012-12-27 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Anti-axl antibodies and uses thereof |
| WO2012175691A1 (en) | 2011-06-22 | 2012-12-27 | INSERM (Institut National de la Santé et de la Recherche Médicale) | Anti-axl antibodies and uses thereof |
| WO2013064685A1 (en) | 2011-11-03 | 2013-05-10 | Pierre Fabre Medicament | Antigen binding protein and its use as addressing product for the treatment cancer |
| WO2013090776A1 (en) | 2011-12-15 | 2013-06-20 | The Board Of Trustees Of The Leland Stanford Junior University | Inhibition of axl/gas6 signaling in the treatment of disease |
| WO2013173392A1 (en) | 2012-05-15 | 2013-11-21 | Concortis Biosystems, Corp | Drug-conjugates, conjugation methods, and uses thereof |
| WO2013173391A1 (en) | 2012-05-15 | 2013-11-21 | Concortis Biosystems, Corp | Drug-conjugates, conjugation methods, and uses thereof |
| WO2013173393A1 (en) | 2012-05-15 | 2013-11-21 | Concortis Biosystems, Corp | Drug-conjugates, conjugation methods, and uses thereof |
Non-Patent Citations (71)
| Title |
|---|
| ALLEY ET AL., BIOCONJUGATE CHEM., vol. 19, 2008, pages 759 - 765 |
| ALLEY ET AL., CURRENT OPINION IN CHEM. BIO., vol. 4, 2010, pages 529 - 537 |
| ASLANIDIS, C.; P.J. DE JONG, NUCLEIC ACIDS RES, vol. 18, no. 20, 1990, pages 6069 - 74 |
| B. BRAUN, MEDICAL B.V. |
| BARBAS, CF., J MOL BIOL., vol. 230, no. 3, 5 April 1993 (1993-04-05), pages 812 - 23 |
| BENVENISTY; RESHEF, PNAS USA, vol. 83, 1986, pages 9551 - 55 |
| BIRD ET AL., SCIENCE, vol. 242, 1988, pages 423 - 426 |
| BROCHET X, NUCL. ACIDS RES., vol. 36, 2008, pages W503 - 508 |
| CHAFNER AND LONGO: "Cancer Chemotherapy and Biotherapy, 2nd ed.", 1996, LIPPINCOTT RAVEN, article JUNGHANS ET AL., pages: 655 - 686 |
| CHEN, J. ET AL., INTERNATIONAL IMMUNOLOGY, vol. 5, 1993, pages 647 656 |
| CORARO; PEARSON, SOMATIC CELL GENETICS, vol. 7, 1981, pages 603 |
| DAVID ET AL., BIOCHEMISTRY, vol. 13, 1974, pages 1014 |
| DUBOWCHIK; WALKER, PHARM. THERAPEUTICS, vol. 83, 1999, pages 67 - 123 |
| F. AUSUBEL ET AL.: "Current Protocols in Molecular Biology", 1987, GREENE PUBLISHING AND WILEY INTERSCIENCE |
| FISHWILD, D. ET AL., NATURE BIOTECHNOLOGY, vol. 14, 1996, pages 845 851 |
| GENNARO ET AL.: "Remington's Pharmaceutical Sciences, 18th ed.", 1990, MACK PUBLISHING CO., article "Medical Applications of Radioisotopes", pages: 624 - 652 |
| GENNARO: "Remington: The Science and Practice of Pharmacy, 19th ed.", 1995, MACK PUBLISHING CO. |
| GOLDENBERG, CALIF. A CANCER JOURNAL FOR CLINICIANS, vol. 44, 1994, pages 43 |
| GOODMAN ET AL.: "Goodman and Gilman's The Pharmacological Basis Of Therapeutics, 8th ed.", 1990, MACMILLAN PUBLISHING CO. |
| GRANT ET AL., METHODS IN ENZYMOL, vol. 153, 1987, pages 516 - 544 |
| HARDING, F.; LONBERG, N., ANN. N.Y. ACAD. SCI, vol. 764, 1995, pages 536 - 546 |
| HECTOR, CANCER BIOL THER, 2010 |
| HFIZI ET AL., FEBS JOURNAL, vol. 273, 2006, pages 5231 - 5244 |
| HOLT ET AL., TRENDS BIOTECHNOL., vol. 21, no. 11, November 2003 (2003-11-01), pages 484 - 90 |
| HUNTER ET AL., NATURE, vol. 144, 1962, pages 945 |
| HUSTON ET AL., PNAS USA, vol. 85, 1988, pages 5879 - 5883 |
| J.R. ROBINSON: "Sustained and Controlled Release Drug Delivery Systems", 1978, MARCEL DEKKER, INC. |
| KABAT, E.A. ET AL.: "Sequences of proteins of immunological interest, 5th ed.", 1991, NIH PUBLICATION NO. 91-3242, pages: 662,680, |
| KOORSTRA, CANCER BIOL THER, 2009 |
| KORSHUNOV ET AL., CLINICAL SCIENCE, 2012 |
| KOZAK ET AL., GENE, vol. 234, 1999, pages 187 - 208 |
| LECONET ET AL., ONCOGENE, 2013, pages 1 - 10 |
| LECONET ET AL.: "Preclinical validation of AXL receptor as a target for antibody-based pancreatic cancer immunotherapy", ONCOGENE, 13 November 2013 (2013-11-13), pages 5405 - 5414, XP055210840, DOI: 10.1038/onc.2013.487 * |
| LEFRANC MP ET AL., NUCLEIC ACIDS RESEARCH, vol. 27, 1999, pages 209 - 212 |
| LI ET AL., ONCOGENE, vol. 28, 2009, pages 3442 - 3455 |
| LIDA ET AL., ANTICANCER RESEARCH, vol. 34, 2014, pages 1821 - 1828 |
| LINGER ET AL., EXPERT OPIN. THER. TARGETS, vol. 14, no. 10, 2010, pages 1073 - 1090 |
| LONBERG, N. ET AL., NATURE, vol. 368, 1994, pages 856 859 |
| LONBERG, N.: "Handbook of Experimental Pharmacology", vol. 113, 1994, pages: 49 - 101 |
| LONBERG, N.; HUSZAR, D., INTERN. REV. IMMUNOL., vol. 13, 1995, pages 65 - 93 |
| MCDONAGH ET AL., PROTEIN ENG. DESIGN SEL., vol. 19, 2006, pages 299 - 307 |
| NYGREN, J., HISTOCHEM. AND CYTOCHEM., vol. 30, 1982, pages 407 |
| OGAWA ET AL., MOL PHARM, vol. 6, no. 2, 2009, pages 386 - 395 |
| OSAMU KANEMITSU: "Antibody Engineering Handbook", 1994, CHIJIN SHOKAN |
| PACCEZ ET AL., INT. J. CANCER, vol. 134, 2013, pages 1024 - 1033 |
| PAIN ET AL., J. IMMUNOL. METH., vol. 40, 1981, pages 219 |
| PASTAN ET AL., CELL, vol. 47, 1986, pages 641 |
| PAUL, W.,: "Fundamental Immunology, 2nd ed.", 1989, RAVEN PRESS, article "ch.7" |
| PETTIT ET AL., ANTIMICROB. AGENTS AND CHEMOTHER, vol. 42, 1998, pages 2961 - 2965 |
| PEZZUTO ET AL.: "Biotechnology And Pharmacy", 1993, CHAPMAN & HALL, article BROWN ET AL.: "Clinical Use of Monoclonal Antibodies", pages: 227 - 49 |
| REN LIU ET AL: "Induction, regulation, and biologic function of Axl receptor tyrosine kinase in Kaposi sarcoma", JOURNAL OF THE AMERICAN CHEMICAL SOCIETY, AMERICAN CHEMICAL SOCIETY, US, vol. 116, no. 2, 15 July 2010 (2010-07-15), pages 297 - 305, XP002671995, ISSN: 0002-7863, [retrieved on 20100504], DOI: 10.1182/BLOOD-2009-12-257154 * |
| REVETS ET AL., EXPERT OPIN BIOL THER., vol. 5, no. L, January 2005 (2005-01-01), pages LLL-24 |
| SAMBROOK ET AL.: "Molecular Cloning: A laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS, article "ch. 15" |
| SCHAKOWSKI ET AL., MOL THER, vol. 3, 2001, pages 793 - 800 |
| SENTER ET AL., PROCEEDINGS OF THE AMERICAN ASSOCIATION FOR CANCER RESEARCH, vol. 45, no. 623, 28 March 2004 (2004-03-28) |
| SHIEH, NEOPLASIA, 2005 |
| SRIVASTAVA: "Radiolabeled Monoclonal Antibodies For Imaging And Therapy", 1988, PLENUM PRESS |
| SUN ET AL., BIOCONJUGATE CHEM., vol. 16, 2005, pages 1282 - 1290 |
| SUN, ANN ONCOL, 2003 |
| SYKES; JOHNSTON, NAT BIOTECH, vol. 17, 1997, pages 355 - 59 |
| TAYLOR, L. ET AL., INTERNATIONAL IMMUNOLOGY, vol. 6, 1994, pages 579 591 |
| TAYLOR, L. ET AL., NUCLEIC ACIDS RESEARCH, vol. 20, 1992, pages 6287 6295 |
| TUAILLON ET AL., J. IMMUNOL., vol. 152, 1994, pages 2912 2920 |
| VAN HEEKE; SCHUSTER, J BIOL CHEM, vol. 264, 1989, pages 5503 - 5509 |
| VINK, T. ET AL.: "A simple, robust and highly efficient transient expression system for producing antibodies", METHODS, vol. 65, no. 1, 2014, pages 5 - 10 |
| VITETTA, IMMUNOL. TODAY, vol. 14, 1993, pages 252 |
| WARD ET AL., NATURE, vol. 341, 1989, pages 544 - 546 |
| WIGLER ET AL., CELL, vol. 14, 1978, pages 725 |
| WOYKE ET AL., ANTIMICROB. AGENTS AND CHEMOTHER, vol. 45, no. 12, 2001, pages 3580 - 3584 |
| WU ET AL.: "Antibody Engineering", 2010, SPRINGER, article "Generation and Characterization of a Dual Variable Domain Immunoglobulin (DVD-lg) Molecule" |
| YE ET AL., ONCOGENE, 2010, pages 1 - 11 |
Cited By (49)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| AU2016292762B2 (en) * | 2015-07-10 | 2022-07-28 | Genmab A/S | AXL-specific antibody-drug conjugates for cancer treatment |
| CN108368171A (zh) * | 2015-07-10 | 2018-08-03 | 根马布股份公司 | 用于癌症治疗的axl特异性抗体-药物缀合物 |
| WO2017009258A1 (en) * | 2015-07-10 | 2017-01-19 | Genmab A/S | Axl-specific antibody-drug conjugates for cancer treatment |
| US20200397913A1 (en) * | 2015-07-10 | 2020-12-24 | Genmab A/S | Axl-specific antibody-drug conjugates for cancer treatment |
| EP3730520A1 (en) * | 2015-07-10 | 2020-10-28 | Genmab A/S | Axl-specific antibody-drug conjugates for cancer treatment |
| US12115227B2 (en) | 2016-01-13 | 2024-10-15 | Genmab A/S | Formulation for antibody and drug conjugate thereof |
| WO2017121877A1 (en) | 2016-01-13 | 2017-07-20 | Genmab A/S | Axl-specific antibody-drug conjugates for cancer treatment |
| JP2022037170A (ja) * | 2016-01-13 | 2022-03-08 | ゲンマブ エー/エス | 癌治療用のaxl特異的抗体-薬物コンジュゲート |
| US20230321261A1 (en) * | 2016-01-13 | 2023-10-12 | Genmab A/S | Axl-specific antibody-drug conjugates for cancer treatment |
| US11149088B2 (en) | 2016-04-15 | 2021-10-19 | Bioatla, Inc. | Anti-Axl antibodies, antibody fragments and their immunoconjugates and uses thereof |
| TWI844893B (zh) * | 2016-04-15 | 2024-06-11 | 美商拜奧亞特拉公司 | 抗-axl抗體、抗體片段及其免疫結合物及其用途 |
| AU2017248644B2 (en) * | 2016-04-15 | 2019-10-31 | Bioatla, Llc | Anti-Axl antibodies, antibody fragments and their immunoconjugates and uses thereof |
| JP2023011607A (ja) * | 2016-04-15 | 2023-01-24 | バイオアトラ インコーポレイテッド | 抗Axl抗体、抗体断片およびそれらの免疫コンジュゲートならびにそれらの使用 |
| JP7759130B2 (ja) | 2016-04-15 | 2025-10-23 | バイオアトラ インコーポレイテッド | 抗Axl抗体、抗体断片およびそれらの免疫コンジュゲートならびにそれらの使用 |
| JP7161783B2 (ja) | 2016-04-15 | 2022-10-27 | バイオアトラ インコーポレイテッド | 抗Axl抗体、抗体断片およびそれらの免疫コンジュゲートならびにそれらの使用 |
| WO2017180842A1 (en) * | 2016-04-15 | 2017-10-19 | Bioatla, Llc | Anti-axl antibodies, antibody fragments and their immunoconjugates and uses thereof |
| EP3443012B1 (en) * | 2016-04-15 | 2025-11-19 | BioAtla, Inc. | Anti-axl antibodies, antibody fragments and their immunoconjugates and uses thereof |
| TWI771297B (zh) * | 2016-04-15 | 2022-07-21 | 美商拜奧亞特拉公司 | 抗-axl抗體、抗體片段及其免疫結合物及其用途 |
| US11897959B2 (en) | 2016-04-15 | 2024-02-13 | Bioatla, Inc. | Anti-AXL antibodies, antibody fragments and their immunoconjugates and uses thereof |
| JP2020180152A (ja) * | 2016-04-15 | 2020-11-05 | バイオアトラ、エルエルシー | 抗Axl抗体、抗体断片およびそれらの免疫コンジュゲートならびにそれらの使用 |
| JP2024088638A (ja) * | 2016-04-15 | 2024-07-02 | バイオアトラ インコーポレイテッド | 抗Axl抗体、抗体断片およびそれらの免疫コンジュゲートならびにそれらの使用 |
| JP2019513784A (ja) * | 2016-04-15 | 2019-05-30 | バイオアトラ、エルエルシー | 抗Axl抗体、抗体断片およびそれらの免疫コンジュゲートならびにそれらの使用 |
| AU2020200324B2 (en) * | 2016-04-15 | 2022-02-24 | Bioatla, Llc | Anti-Axl antibodies, antibody fragments and their immunoconjugates and uses thereof |
| JP7456658B2 (ja) | 2016-04-15 | 2024-03-27 | バイオアトラ インコーポレイテッド | 抗Axl抗体、抗体断片およびそれらの免疫コンジュゲートならびにそれらの使用 |
| TWI917874B (zh) | 2016-04-15 | 2026-03-11 | 美商拜奧亞特拉公司 | 抗-axl抗體、抗體片段及其免疫結合物及其用途 |
| US11306153B2 (en) | 2016-05-20 | 2022-04-19 | Agency For Science, Technology And Research | Anti-AXL tyrosine kinase receptor antibodies and uses thereof |
| WO2017200493A1 (en) | 2016-05-20 | 2017-11-23 | Agency For Science, Technology And Research | Anti-axl tyrosine kinase receptor antibodies and uses thereof |
| US12049460B2 (en) | 2016-05-26 | 2024-07-30 | Recurium Ip Holdings, Llc | EGFR inhibitor compounds |
| US11098030B2 (en) | 2016-05-26 | 2021-08-24 | Recurium Ip Holdings, Llc | EGFR inhibitor compounds |
| US10513509B2 (en) | 2016-05-26 | 2019-12-24 | Recurium Ip Holdings, Llc | EGFR inhibitor compounds |
| WO2018007592A1 (en) | 2016-07-08 | 2018-01-11 | Genmab A/S | New dosage regimens for antibody drug conjugates based on anti-axl antibodies |
| JP2019524713A (ja) * | 2016-07-08 | 2019-09-05 | ゲンマブ エー/エス | 抗axl抗体に基づく抗体薬物コンジュゲートのための新しい投薬レジメン |
| US11249081B2 (en) | 2016-08-31 | 2022-02-15 | Agency For Science, Technology And Research | Methods for the identification, targeting and isolation of human dendritic cell (DC) precursors “pre-DC” and their uses thereof |
| CN109906381A (zh) * | 2016-08-31 | 2019-06-18 | 新加坡科技研究局 | 鉴别、靶向以及分离人树突细胞(dc)前体“前dc”的方法及其用途 |
| EP3507601A4 (en) * | 2016-08-31 | 2020-08-05 | Agency for Science, Technology and Research | METHODS FOR THE IDENTIFICATION, TARGETING AND ISOLATION OF "PRE-DC" HUMAN DENDRITIC CELL (DC) PRECURSORS, AND USES OF THESE LATEST |
| JP2020514302A (ja) * | 2017-01-08 | 2020-05-21 | 浙江昭華生物医薬有限公司 | 抗5t4抗体−薬物複合体およびその使用 |
| US11040027B2 (en) | 2017-01-17 | 2021-06-22 | Heparegenix Gmbh | Protein kinase inhibitors for promoting liver regeneration or reducing or preventing hepatocyte death |
| US11739154B2 (en) | 2017-09-13 | 2023-08-29 | National Research Council Of Canada | AXL-specific antibodies and uses thereof |
| CN111263770A (zh) * | 2017-09-13 | 2020-06-09 | 加拿大国家研究委员会 | Axl-特异性抗体及其用途 |
| WO2019051586A1 (en) | 2017-09-13 | 2019-03-21 | National Research Council Of Canada | AXL SPECIFIC ANTIBODIES AND USES THEREOF |
| US20210070869A1 (en) * | 2018-04-10 | 2021-03-11 | Genmab A/S | Axl-specific antibodies for cancer treatment |
| WO2019197506A1 (en) | 2018-04-10 | 2019-10-17 | Genmab A/S | Axl-specific antibodies for cancer treatment |
| WO2019243626A1 (en) | 2018-06-22 | 2019-12-26 | Genmab A/S | Method for producing a controlled mixture of two or more different antibodies |
| WO2020065396A1 (en) | 2018-09-26 | 2020-04-02 | Genmab A/S | Axl-specific antibodies for treatment of non-small cell lung cancer |
| WO2020227574A3 (en) * | 2019-05-07 | 2020-12-10 | Board Of Regents, The University Of Texas System | Methods for predicting drug responsiveness in samples from cancer subjects |
| WO2021013746A1 (en) | 2019-07-19 | 2021-01-28 | Genmab A/S | Axl antibody-drug conjugates for use in treating cancer |
| WO2021142086A1 (en) | 2020-01-08 | 2021-07-15 | Synthis Therapeutics, Inc. | Alk5 inhibitor conjugates and uses thereof |
| US12384822B2 (en) | 2021-01-29 | 2025-08-12 | Illimis Therapeutics, Inc. | TAM receptor-binding fusion molecule having non-inflammatory phagocytosis inducing activity |
| PL446349A1 (pl) * | 2023-10-11 | 2025-04-14 | Celon Pharma Spółka Akcyjna | Przeciwciała bispecyficzne anty-AXL i anty-PD-L1 oraz ich zastosowanie w terapii, zwłaszcza w leczeniu nowotworu |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12589150B2 (en) | Antibodies binding AXL | |
| AU2022259847B2 (en) | AXL-specific antibody-drug conjugates for cancer treatment | |
| HK40045319A (en) | Antibodies binding axl | |
| HK40076909A (en) | Antibodies binding axl | |
| KR102959637B1 (ko) | Axl에 결합하는 항체 | |
| HK1238271B (en) | Antibodies binding axl | |
| HK1238271A1 (en) | Antibodies binding axl | |
| HK1255412B (en) | Axl-specific antibody-drug conjugates for cancer treatment |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 15738884 Country of ref document: EP Kind code of ref document: A1 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 249512 Country of ref document: IL |
|
| ENP | Entry into the national phase |
Ref document number: 2952758 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/A/2016/016881 Country of ref document: MX |
|
| ENP | Entry into the national phase |
Ref document number: 2017501287 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 15325364 Country of ref document: US |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01A Ref document number: 112017000316 Country of ref document: BR |
|
| ENP | Entry into the national phase |
Ref document number: 2015286569 Country of ref document: AU Date of ref document: 20150710 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 20177003473 Country of ref document: KR Kind code of ref document: A |
|
| REEP | Request for entry into the european phase |
Ref document number: 2015738884 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: A201701193 Country of ref document: UA Ref document number: 2015738884 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 201790173 Country of ref document: EA |
|
| ENP | Entry into the national phase |
Ref document number: 112017000316 Country of ref document: BR Kind code of ref document: A2 Effective date: 20170106 |
|
| WWR | Wipo information: refused in national office |
Ref document number: 1020237033792 Country of ref document: KR |
|
| WWR | Wipo information: refused in national office |
Ref document number: 1020237033792 Country of ref document: KR |
|
| WWC | Wipo information: continuation of processing after refusal or withdrawal |
Ref document number: 1020237033792 Country of ref document: KR |