WO2010025421A2 - Modulators of myc, methods of using the same, and methods of identifying agents that modulate myc - Google Patents
Modulators of myc, methods of using the same, and methods of identifying agents that modulate myc Download PDFInfo
- Publication number
- WO2010025421A2 WO2010025421A2 PCT/US2009/055443 US2009055443W WO2010025421A2 WO 2010025421 A2 WO2010025421 A2 WO 2010025421A2 US 2009055443 W US2009055443 W US 2009055443W WO 2010025421 A2 WO2010025421 A2 WO 2010025421A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- myc
- sequence
- agent
- cell
- vaccine
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/39—Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
- A61P31/06—Antibacterial agents for tuberculosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/14—Antivirals for RNA viruses
- A61P31/16—Antivirals for RNA viruses for influenza or rhinoviruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P33/00—Antiparasitic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/001—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof by chemical synthesis
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/82—Translation products from oncogenes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/20—Fusion polypeptide containing a tag with affinity for a non-protein ligand
- C07K2319/21—Fusion polypeptide containing a tag with affinity for a non-protein ligand containing a His-tag
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Definitions
- vaccines containing dead microorganisms e.g. the influenza and cholera vaccines
- vaccines containing attenuated microorganisms e.g. the MMR vaccine
- vaccines containing toxoids e.g. the DPT vaccine
- vaccines containing subunits of the pathogen e.g. the HPV vaccine
- nucleic acid e.g. RNA and DNA
- Vaccine adjuvants are agents that stimulate the immune system and increase the response of the immune system to a vaccine.
- a peptide that up-regulates the expression of a MYC gene, the activity of a Myc polypeptide, or a combination thereof comprising: (a) a transporter peptide sequence; (b) a MYC sequence; and optionally (c) one or more molecules that link the transporter peptide sequence and the MYC sequence.
- the peptide has Formula (I): transporter peptide sequence -MYC sequence.
- the peptide has Formula (II): transporter peptide sequence-X-MYC sequence, wherein -X- is a molecule that links the transporter peptide sequence and the MYC sequence.
- the peptide has Formula (II): transporter peptide sequence-X-MYC sequence, wherein in X is at least one amino acid.
- the peptide has the following amino acid sequence:
- compositions that induces an immune response comprising a fusion peptide comprising: (a) a transporter peptide sequence; (b) a MYC sequence; and optionally (c) one or more molecules that link the transporter peptide sequence and the MYC sequence.
- the peptide has Formula (I): transporter peptide sequence -MYC sequence.
- the peptide has Formula (II): transporter peptide sequence-X-MYC sequence, wherein -X- is a molecule that links the transporter peptide sequence and the MYC sequence.
- the peptide has Formula (II): transporter peptide sequence-X-MYC sequence, wherein in X is at least one amino acid.
- the peptide has the following amino acid sequence:
- the composition further comprises an antigen, antigenic moiety, or a combination thereof.
- the antigen is a dead microorganism, an attenuated microorganism, a toxoid, a subunit of a pathogen, a nucleic acid, a polymer of nucleic acids, or combinations thereof.
- the antigen is derived from: hepatitis A; hepatitis B; polio: measles: mumos: rubella; diphtheria; pertussis; tetanus; influenza; varicella zoster virus; rotavirus; meningococcal; pneumonia; smallpox; cholera; bubonic plague; yellow fever; tuberculosis; human papillomavirus; or combinations thereof.
- the composition further comprises an antigenic moiety derived from a pathogen selected from: hepatitis A ; hepatitis B ; polio ; measles ; mumps ; rubella ; diphtheria ; pertussis ; tetanus ; influenza ; varicella zoster virus ; rotavirus ; meningococcal ; pneumonia ; smallpox ; cholera ; bubonic plague; yellow fever ; tuberculosis ; human papillomavirus; or combinations thereof.
- the composition further comprises an antigenic moiety derived from a neoplastic cell.
- the composition is formulated for topical administration.
- a method of inducing an immune response comprising administering to an individual in need thereof: (a) a vaccine against at least one antigen, and (b) a fusion peptide comprising: (a) a transporter peptide sequence; (b) a MYC sequence; and optionally (c) one or more molecules that link the transporter peptide sequence and the MYC sequence.
- the peptide has Formula (I): transporter peptide sequence -MYC sequence.
- the peptide has Formula (II): transporter peptide sequence-X-MYC sequence, wherein -X- is a molecule that links the transporter peptide sequence and the MYC sequence.
- the peptide has Formula (II): transporter peptide sequence-X-MYC sequence, wherein in X is at least one amino acid.
- the peptide has the following amino acid sequence:
- the vaccine is selected from the group consisting of: hepatitis A vaccine; hepatitis B vaccine; polio vaccine; measles vaccine; mumps vaccine; rubella vaccine; diphtheria vaccine; pertussis vaccine; tetanus vaccine; influenza vaccine; varicella zoster virus vaccine; rotavirus vaccine; meningococcal vaccine; pneumonia vaccine; smallpox vaccine; cholera vaccine; bubonic plague vaccine; yellow fever vaccine; tuberculosis vaccine; human paplomavirus vaccine; a cancer vaccine; or combinations thereof.
- the vaccine is administered before, after, or simultaneously with the agent that increases the nucleic concentration of a Myc polypeptide.
- the agent is a fusion peptide comprising: (a) a transporter peptide sequence; (b) a MYC sequence; and optionally (c) one or more molecules that link the transporter peptide sequence and the MYC sequence.
- the peptide has Formula (I): transporter peptide sequence -MYC sequence.
- the peptide has Formula (II): transporter peptide sequence-X-MYC sequence, wherein -X- is a molecule that links the transporter peptide sequence and the MYC sequence. In some embodiments, the peptide has Formula (II): transporter peptide sequence-X-MYC sequence, wherein in X is at least one amino acid.
- the peptide has the following amino acid sequence: MRKKRRQRRRMDFFRVVENQQPPATMPLNVSFTNRNYDLD YDSVQPYFYCDEEENFYQQQQSEL QPPAPSEDIWKKFELLPTPPLSPSRRSGLCSPSYV AVTPFSLRGDNDGGGGSFSTADQLEMVTELLGG DMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNP ARGHSVCSTSSL YLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVLHEETPPT TSSDSEEEQEDEEEID VVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPST RKDYP AAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHNVLERQRRNELKRSFF ALRDQIP
- the cell is a leukocyte. In some embodiments, the cell is a T-cell. In some embodiments, the cell is a B-cell. In some embodiments, the cell is a memory T-cell. [0009] Disclosed herein, in certain embodiments, is a method of decreasing the viability of a cell, comprising administering to an individual in need thereof an agent that down- regulates the expression of MYC, decreases the activity of a Myc peptide, or a combination thereof.
- a method of treating a disorder characterized by the under-expression of a MYC gene or a deficit in the activity of a Myc polypeptide comprising administering to an individual in need thereof an agent that up-regulates the expression of MYC, increases the activity of a Myc peptide, or a combination thereof.
- the agent is a fusion peptide comprising: (a) a transporter peptide sequence; (b) a MYC sequence; and optionally (c) one or more molecules that link the transporter peptide sequence and the MYC sequence.
- the peptide has Formula (I): transporter peptide sequence -MYC sequence.
- the peptide has Formula (II): transporter peptide sequence-X-MYC sequence, wherein -X- is a molecule that links the transporter peptide sequence and the MYC sequence.
- the peptide has Formula (II): transporter peptide sequence-X-MYC sequence, wherein in X is at least one amino acid.
- the peptide has the following amino acid sequence:
- a method of treating a disorder characterized by the over-expression of a MYC gene or the excess activity of a Myc polypeptide comprising, administering to an individual in need thereof an agent that down- regulates the expression of MYC, decreases the activity of a Myc peptide, or a combination thereof.
- a method of identifying an agent that up-regulates the expression of a MYC gene, and/or the activity of a Myc polypeptide comprising: (a) contacting a plurality of anergic B-cells with an agent; and (b) following contact with the agent, detecting and/or measuring the level of expression of one or more cell surface markers in the cell culture, wherein the presence of the cell surface marker is indicative a non-anergic B-cell.
- the anergic B- cells are obtained from mice with the phenotype BCR HEL /sHEL.
- the cell surface marker is: IgM, IgMa, IgMb, B220, CD21/35, CD23, CD24 (HSA), CD40, CD69, CD80 and/or CD86 (B7- 2).
- the level of expression of a cell surface marker is measured by contacting the plurality of cells with a detectable antibody or detectable antigen that binds to the cell surface marker.
- a method of identifying an agent that up-regulates the expression of a MYC gene, and/or the activity of a Myc polypeptide comprising: (a) contacting a plurality of factor-dependent cells with an agent; and (b) following contact with the agent, detecting and measuring the level of expansion of the plurality of cells.
- the factor-dependent cells are lymphoid cells.
- the factor-dependent cells are: IL-2 7" , IL-3 7" , IL-4 “ ' “ , IL-5 “ ' “ , IL-6 “ ' “ , IL-7 7” , IL-8 7” , IL-9 7” , IL-10 “ ' “ , IL- 11 “ ' “ , IL- 12 “ ' “ , or any combinations thereof.
- the factor- dependent cells are derived from: CTLL-2 cells or BAF/3 cells.
- a method of identifying an agent that up-regulates the expression of a MYC gene, and/or the activity of a Myc polypeptide comprising: (a) transforming a plurality of cells with a reporter construct, comprising: a reporter gene operably linked to an E-box se ⁇ uence encoded in a myc-responsive promoter; (b) contacting the plurality of cells with an agent; and (c) following contact with the agent, detecting and measuring the level of expression of the reporter gene.
- the cells are lymphoid cells.
- the myc-responsive promoter is an ornithine decarboxylase promoter.
- the reporter gene is a ⁇ -galactosidase gene, a ⁇ -lactamase gene, a horseradish peroxidase gene, an alkaline phosphatase gene, a thymidine kinase gene, a xanthine phosphoribotransferase gene, a tyrosinase gene, a cytosine deaminase gene, an antibiotic resistance gene, or a gene having a fluorescent expression product.
- agents capable of modulating e.g., activating, increasing, inducing, supplementing, decreasing, or inhibiting
- agents are utilized to increase an immune response.
- agents are used to decrease an immune response.
- the term "vaccine” means a composition comprising antigens and/or antigenic moieties administered to a mammal in order to elicit an immune response.
- the antigen or antigenic moiety is a live or attenuated microorganism, a natural product purified from a microorganism (e.g. a subunit of a protein, peptide, polysaccharide, and a nucleic acid), a synthetic product designed to mimic a component of the microorganism, a genetically engineered protein, peptide, or polysaccharide, a patient's own tumor cells, a natural product purified from a tumor cell (e.g.
- Prostate Specific Antigen gp96, GM2, GD2, GD3, carcinoembryonic antigen, MART-I, and tyrosinase
- a synthetic molecule designed to mimic a component of a tumor cell e.g. sialyl Tn
- the term vaccine includes current vaccines, and any novel and/or modified vaccines developed.
- lymphoid tissue means tissue associated with the lymphatic system.
- lymphoid tissue includes tissue obtained from the lymph nodes, tonsils, spleen, bone marrow, and thymus.
- lymphocyte refers to all immature, mature, undifferentiated and differentiated white lymphocyte populations including tissue specific and specialized varieties. It encompasses, by way of non- limiting example, B-cells, T-cells, NKT cells, and NK cells. In some embodiments, lymphocytes include all B-cell lineages including pre-B-cells, Progenitor B cells, Early Pro-B cells, Late Pro-B cells, Large Pre-B cells, Small Pre-B cells, Immature B cells, Mature B cells, plasma B-cells, memory B-cells, B-I cells, B-2 cells and anergic AN1/T3 cell populations.
- B-cell refers to, by way of non- limiting example, a pre-B-cell, Progenitor B cell, Early Pro- B cell, Late Pro-B cell, Large Pre-B cell, Small Pre-B cell, Immature B cell, Mature B cell, plasma B-cell, memory B-cell, B-I cell, B-2 cells and anergic AN1/T3 cell populations.
- the term B- cell includes a B-cell that expresses an immunoglobulin heavy chain and/or light chain on its cells surface.
- the term B-cell includes a B-cell that expresses and secretes an immunoglobulin heavy chain and/or light chain.
- the term B-cell includes a cell that binds an antigen on its cell-surface.
- B-cells or AN1/T3 cells are utilized in the processes described.
- such cells are optionally substituted with any animal cell suitable for expressing, capable of expressing (e.g., inducible expression), or capable of being differentiated into a cell suitable for expressing an antibody including, e.g., a hematopoietic stem cell, a B-cell, a pre-B-cell, a Progenitor B cell, a Early Pro-B cell, a Late Pro-B cell, a Large Pre-B cell, a Small Pre-B cell, an Immature B cell, a Mature B cell, a plasma B-cell, a memory B-cell, a B-I cell, a B-2 cell, an anergic B-cell, or an anergic AN1/T3 cell.
- the term "immune response” includes the identification and neutralization of pathogens and/or tumor cells.
- the immune response is the adaptive immune response.
- the adaptive immune response includes the development of immunological memory.
- the terms "antibody” and “antibodies” refer to any form of a natural occurring (but isolated and/or purified), engineered or synthetic antibody, including monoclonal antibodies, polyclonal antibodies, bi- specific antibodies, multispecific antibodies, grafted antibodies, human antibodies, humanized antibodies, synthetic antibodies, chimeric antibodies, camelized antibodies, single-chain Fvs (scFv), single chain antibodies, Fab fragments, F(ab') fragments, disulfide-linked Fvs (sdFv), intrabodies, and anti-idiotypic (anti- Id) antibodies and antigen-binding fragments of any of the above.
- antibodies include immunoglobulin molecules and immunologically active fragments of immunoglobulin molecules, i.e., molecules that contain an antigen binding site.
- Immunoglobulin molecules are of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG i , IgG 2, IgG 3; IgG 4; IgA t and IgA 2) or subclass.
- the terms "antibody” and immunoglobulin are used interchangeably in the broadest sense.
- an antibody is part of a larger molecule, formed by covalent or non-covalent association of the antibody with one or more other proteins or peptides.
- the antibodies herein include monoclonal, polyclonal, recombinant, chimeric, humanized, bi- specific, grafted, human, and fragments thereof including antibodies altered by any means to be less immunogenic in humans.
- the monoclonal antibodies and fragments, etc., herein include “chimeric” antibodies and "humanized” antibodies.
- chimeric antibodies include a portion of the heavy and/or light chain that is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, so long as they exhibit the desired biological activity (U.S. Pat. No. 4,816,567); Morrison et al. Proc. Natl Acad. ScL 81:6851-6855 (1984).
- a chimeric antibody contains variable regions derived from a mouse and constant regions derived from human in whom the constant region contains sequences homologous to both human IgG2 and human IgG4.
- "Humanized" forms of non-human (e.g., murine) antibodies or fragments are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab') 2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin.
- Humanized antibodies include, grafted antibodies or CDR grafted antibodies wherein part or all of the amino acid sequence of one or more complementarily determining regions (CDRs) derived from a non-human animal antibody is grafted to an appropriate position of a human antibody while maintaining the desired binding specificity and/or affinity of the original non-human antibody.
- CDRs complementarily determining regions
- corresponding non-human residues replace Fv framework residues of the human immunoglobulin.
- humanized antibodies comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences. These modifications are made to further refine and optimize antibody performance.
- the humanized antibody comprises substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
- all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence.
- the term "antigen” refers to a substance that elicits the production of an antibody.
- antigenic moiety means the portion of a molecule, organism (e.g., a bacteria, virus), or cell to which an antibody binds (or complements).
- self antigen refers to an antigen that originates from within an animal, tissue, or cell.
- a self antigen comprises an endogenous antigen.
- a self antigen comprises an endogenous antigen produced by an endogenous retrovirus.
- self antigens comprise neo-self antigens, microbially or parasite encoded neo-self antigens, or other neo-self antigens expressed as a result of genetic alteration to an animal or cell following whole-body irradiation and HSC transplantation (which re-starts the immune system and allows the new antigen to be considered "self).
- a chimeric mouse expresses a neo-self antigen.
- auto-antigen refers to an antigen that comprises an epitope of a self antigen or an immunologically reactive epitope that mimics that of a self antigen.
- auto antigen comprises antigens to which autoantibodies are produced.
- an auto antigen comprises an endogenous antigen wherein the animal from which the endogenous antigen originated is or was once immunologically tolerant to the antigen.
- adjuvant refers to a state wherein lymphocytes are inactive (e.g. they do not respond to the binding of an antigen).
- the lymphocyte is a B-cell.
- a B-cell becomes anergic following exposure to a circulating soluble self-antigen. In some embodiments, a B-cell becomes anergic following exposure to a soluble circulating antigen. In some embodiments, the antigen is soluble hen egg lysozyme (sHEL).
- amino acid refers to naturally occurring and non-naturally occurring amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids.
- Naturally encoded amino acids are the 20 common amino acids (alanine, arginine, asparagine, aspartic acid, cysteine, glutamine, glutamic acid, glycine, histidine, isoleucine, leucine, lysine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine) and pyro lysine and selenocysteine.
- Amino acid analogs refers to agents that have the same basic chemical structure as a naturally occurring amino acid, i.e., an ⁇ carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, such as, homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium.
- Such analogs have modified R groups (such as, norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid.
- amino acids are referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, are referred to by their commonly accepted single-letter codes.
- polypeptide peptide
- protein are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to naturally occurring amino acid polymers as well as amino acid polymers in which one or more amino acid residues is a non-naturally occurring amino acid, e.g., an amino acid analog. The terms encompass amino acid chains of any length, including full length proteins, wherein the amino acid residues are linked by covalent peptide bonds.
- a Myc polypeptide comprises an amino acid sequence that is at least 40% to 100% identical, e.g., at least 40%, 45%. 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 40% to about 100% identical to the sequence of NCBI Accession Numbers NP002458.2.
- a Myc polypeptide comprises a polypeptide sequence of 40 amino acids or more in length that is at least 50% to
- a Myc polypeptide comprises a polypeptide sequence of 40 amino acids or more in length that is at least 50% to 100% identical, e.g., at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 50% to about 100% identical to the sequence of NCBI Accession Numbers NP002458.2.
- Myc polypeptide means a polymer of 439 amino acids, a Myc polypeptide that has not undergone any post-translational modifications, and/or a Myc polypeptide that has undergone post-translational modifications.
- the Myc polypeptide is 48,804 kDa. In certain instances, the Myc polypeptide contains a basic Helix-Loop-Helix Leucine Zipper (bHLH/LZ) domain. In certain instances, the Myc polypeptide is a transcription factor (e.g. Transcription Factor 64). In certain instances, the Myc polypeptide binds to a sequence comprising CACGTG (i.e. an E-box sequence). [0033] The term "nucleic acid" refers to deoxyribonucleotides, deoxyribonucleosides, ribonucleosides, or ribonucleotides and polymers thereof in either single- or double-stranded form.
- the term encompasses nucleic acids containing known analogues of natural nucleotides which have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless specifically limited otherwise, the term also refers to oligonucleotide analogs including PNA (peptidonucleic acid), analogs of DNA used in antisense technology (phosphorothioates, phosphoroamidates, and the like). Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (including but not limited to, degenerate codon substitutions) and complementary sequences as well as the sequence explicitly indicated.
- degenerate codon substitutions are achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al, Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al, J. Biol. Chem. 260:2605-2608 (1985); and Cassol et al (1992); Rossolini et al, MoI. Cell. Probes 8:91-98 (1994)).
- the terms "MYC” and "MYC gene” are synonyms. They refer to a nucleic acid sequence that encodes a Myc polypeptide.
- a MYC gene comprises a nucleotide sequence of at least 120 nucleotides that is at least 60% to 100% identical or homologous, e.g., at least 60, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 70% to about 100% identical to sequences of NCBI Accession Number NM 002467.
- the MYC gene is a proto- oncogene.
- a MYC gene is found on chromosome 8, at 8q24.21.
- a MYC gene begins at 128,816,862 bp frompter and ends at 128,822,856 bp Prompter. In certain instances, a MYC gene is about 6 kb. In certain instances, a MYC gene encodes at least eight separate mRNA sequences - 5 alternatively spliced variants and 3 unspliced variants. [0035] To determine the percent homology of two amino acid sequences or of two nucleic acids, the sequences can be aligned for optimal comparison purposes (e.g., gaps are introduced in the sequence of a first amino acid or nucleic acid sequence for optimal alignment with a second amino or nucleic acid sequence).
- the amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions can then be compared.
- a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position.
- Gapped BLAST is utilized as described in Altschul et al. (1997) Nucleic Acids Res. 25:3389-3402.
- the default parameters of the respective programs e.g., XBLAST and NBLAST
- XBLAST and NBLAST are used. See the website of the National Center for Biotechnology Information for further details (on the World Wide Web at ncbi.nlm.nih.gov).
- Proteins suitable for use in the methods described herein also includes proteins having between 1 to 15 amino acid changes, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acid substitutions, deletions, or additions, compared to the amino acid sequence of any protein described herein.
- the altered amino acid sequence is at least 75% identical, e.g., 77%, 80%, 82%, 85%, 88%, 90%, 92%, 95%, 97%, 98%, 99%, or 100% identical to the amino acid sequence of any protein inhibitor described herein.
- sequence-variant proteins are suitable for the methods described herein as long as the altered amino acid sequence retains sufficient biological activity to be functional in the compositions and methods described herein.
- substitutions should be conservative amino acid substitutions.
- a "conservative amino acid substitution” is illustrated by a substitution among amino acids within each of the following groups: (1) glycine, alanine, valine, leucine, and isoleucine, (2) phenylalanine, tyrosine, and tryptophan, (3) serine and threonine, (4) aspartate and glutamate, (5) glutamine and asparagine, and (6) lysine, arginine and histidine.
- the BLOSUM62 table is an amino acid substitution matrix derived from about 2,000 local multiple alignments of protein sequence segments, representing highly conserved regions of more than 500 groups of related proteins (Henikoff et al (1992), Proc. Natl Acad. Sci. USA, 89: 10915- 10919). Accordingly, the BLOSUM62 substitution frequencies are used to define conservative amino acid substitutions that, in some embodiments, are introduced into the amino acid sequences described or disclosed herein. Although it is possible to design amino acid substitutions based solely upon chemical properties (as discussed above), the language "conservative amino acid substitution” preferably refers to a substitution represented by a BLOSUM62 value of greater than -1.
- an amino acid substitution is conservative if the substitution is characterized by a BLOSUM62 value of 0, 1, 2, or 3.
- preferred conservative amino acid substitutions are characterized by a BLOSUM62 value of at least 1 (e.g., 1, 2 or 3), while more preferred conservative amino acid substitutions are characterized by a BLOSUM62 value of at least 2 (e.g., 2 or 3).
- Myc activity refers to binding of a Myc polypeptide to a nucleic acid sequence.
- MYC activity further includes MYC regulation of the transcriptional activity of Myc responsive genes.
- Myc activity induces cell proliferation and/or antibody production.
- activation of Myc and “Myc activation” refer to the induction of Myc activity.
- activation of Myc is induced by over-expression of a Myc polypeptide.
- activation of Myc is induced by transport of a Myc polypeptide into the nucleus of a cell.
- activation of Myc is induced by transport of a Myc polypeptide into a cell.
- RNA template from a DNA sequence (e.g., by transcription) within a cell
- processing of an RNA transcript e.g., by splicing, editing, 5' cap formation, and/or 3' end formation
- translation of an RNA sequence into a polypeptide or protein within a cell e.g., by splicing, editing, 5' cap formation, and/or 3' end formation
- translation of an RNA sequence into a polypeptide or protein within a cell e.g., by splicing, editing, 5' cap formation, and/or 3' end formation
- post-translational modification of a polypeptide or protein within a cell e.g., by post-translational modification of a polypeptide or protein within a cell
- presentation of a polypeptide or protein on the cell surface (6) secretion or release of a polypeptide or protein from a cell.
- endogenous in the context of a cellular protein refers to protein naturally occurring and/or expressed by the cell in the absence of recombinant manipulation; accordingly, the terms “endogenously expressed protein” or “endogenous protein” excludes cellular proteins expressed by means of recombinant technology.
- factor-dependent cell means a cell that is not able to survive and/or proliferate without contact with an exogenous growth factor (e.g. a cytokine). When contacted with the required growth-factors, a factor-dependent cell is able to survive and/or proliferate. In the absence of the required growth- factors, a factor-dependent cell cannot survive (e.g. will undergo apoptosis) and/or proliferate.
- expansion refers to an enlargement in the size of the culture due to the proliferation (i.e. division) of cells in the cell culture. In some embodiments, the cell culture exhibits expansion (i.e.
- the cell culture exhibits negative expansion (i.e. attains a smaller size or the concentration of cell in the culture decreases).
- the expansion of a cell culture is detectable and measurable in any suitable manner (e.g. staining, flow cytometry, fluorescent microscopy, HPLC, confocal microscopy, infrared spectroscopy, autoradiography).
- the phrases "E-box sequence” and “enhancer box sequence” are used interchangeably herein and mean the nucleotide sequence CANNTG, wherein N is any nucleotide. In certain instances, the E-box sequence comprises CACGTG.
- the basic helix-loop-helix domain of a transcription factor encoded by MYC binds to the E-box sequence.
- the E-box sequence is located upstream of a gene (e.g. p21, Bcl-2, or ornithine decarboxylase).
- the binding of the transcription factor encoded by MYC to the E-box sequence allows RNA polymerase to transcribe the gene downstream of the E-box sequence.
- viability means the length of time the cell survives, the rate (or amount) of cellular proliferation, or a combination thereof. In some embodiments, the viability of a cell is increased. In some embodiments, the viability of a cell is decreased.
- the modulation occurs in vivo. In some embodiments, the modulation occurs in vitro. In some embodiments, a method of modulating the viability of a cell comprises modulating the viability of a leukocyte. In some embodiments, the leukocyte is a T-cell. In some embodiments, the leukocyte is a CD4+ T-cell. In some embodiments, the leukocyte is a memory T-cell. [0046] In some embodiments, modulating the viability of a cell comprises modulating the expression of a MYC gene, and/or the activity of a Myc polypeptide.
- modulating the expression of a MYC gene, and/or the activity of a Myc polypeptide directly or indirectly results in the modulation of a gene or polypeptide regulated by MYC.
- the gene or polypeptide directly or indirectly regulated by a MYC transcription factor is: neurogranin, MEF-2c, gfi-1, cyclin D2, CDK4, Egr-2, Nab-2, TGIF, NF-kB plO5, Carma-1, Al or Bcl-2.
- modulating the viability of a cell means increasing the viability of a cell.
- increasing the viability of a cell means: increasing the length of time the cell survives (e.g. as compared to an identical or similar unmodulated cell of the same type), increasing the rate or amount of cellular proliferation (e.g. as compared to an identical or similar unmodulated cell of the same type), or a combination thereof.
- increasing the viability of a cell comprises contacting a cell with an agent that increases the nucleic concentration of a Myc polypeptide. In some embodiments, increasing the viability of a cell comprises contacting a cell with: an exogenous Myc polypeptide, an agent that increases the expression of a MYC gene, and an agent that increases the activity of a Myc polypeptide, or a combination thereof (the "MYC Increasing Agent"). In some embodiments, the MYC Increasing Agent is a small molecule, a peptide, an antibody, or a combination thereof.
- a method of increasing the viability of a cell comprises contacting a cell with the MYC Increasing Agent.
- the MYC Increasing Agent is an exogenous Myc polypeptide.
- the MYC Increasing Agent is a fusion peptide comprising (a) a transporter peptide sequence; (b) a MYC sequence; and optionally (c) one or more molecules that link the transporter peptide sequence and the MYC sequence.
- the MYC Increasing Agent is a fusion peptide comprising (a) a TAT sequence; and (b) a MYC sequence.
- a method of increasing the viability of a cell comprises contacting a cell with the MYC Increasing Agent.
- the MYC Increasing Agent is an antagonist of a MAD- 1 gene.
- the down-regulation of a MAD- 1 gene and/or polypeptide upregulates the expression of a MYC gene and/or a polypeptide encoded by a MYC gene.
- a method of increasing the viability of a cell comprises contacting a cell with the MYC Increasing Agent.
- the MYC Increasing Agent is an antagonist of a Mxi- 1 gene.
- the down-regulation of a Mxi- 1 gene and/or polypeptide upregulates the expression of a MYC gene and/or a polypeptide encoded by a MYC gene.
- a method of increasing the viability of a cell further comprises identifying the MYC Increasing Agent.
- the method of identifying the MYC Increasing Agent comprises identifying an agent that reverses anergy in a B-cell.
- the method of identifying the MYC Modulating Agent comprises identifying an agent that increases the viability of a factor- dependent cell in the absence of a required growth factor.
- the method of identifying the MYC Increasing Agent comprises identifying an agent that induces expression of a reporter gene under the control of a MYC responsive promoter (e.g. an E-box sequence).
- the viability of a cell is increased by about 1 to about 20 times (e.g. as compared to an identical or similar unmodulated cell of the same type). In some embodiments, following contact with the MYC Increasing Agent the viability of a cell is increased by about 1 to about 15 times (e.g. as compared to an identical or similar unmodulated cell of the same type). In some embodiments, following contact with the MYC Increasing Agent the viability of a cell is increased by about 1 to about 10 times (e.g. as compared to an identical or similar unmodulated cell of the same type).
- the viability of a cell is increased by about 1 to about 5 times (e.g. as compared to an identical or similar unmodulated cell of the same type). In some embodiments, following contact with the MYC Increasing Agent the viability of a cell is increased by about 1 to about 4 times (e.g. as compared to an identical or similar unmodulated cell of the same type). In some embodiments, following contact with the MYC Increasing Agent the viability of a cell is increased by 1 to about 2 times (e.g. as compared to an identical or similar unmodulated cell of the same type).
- the cell is a T-cell.
- the T-cell is a memory T-cell.
- modulating the viability of a T-cell means extending the life-span of a T-cell.
- extending the life span of a memory T-cell results in a higher concentration of memory T-cells in a body.
- the higher concentration of memory T-cells results in an accelerated primary immune response to antigen.
- the up-regulation of a MYC gene results in a decrease in anergic T-cells.
- the decrease in anergic T-cells results in an accelerated primary immune response to antigen.
- the up-regulation of a MYC gene results in a decrease in the time it takes a T-cell to activate in response to an antigen. In certain instances, the decrease in the time it takes a T- cell to activate in response to an antigen results in an accelerated primary immune response to antigen.
- modulating the viability of a cell means decreasing the viability of a cell.
- decreasing the viability of a cell means: decreasing the length of time the cell survives and decreasing the rate or amount of cellular proliferation (e.g., as compared to an identical or similar unmodulated cell of the same type).
- decreasing the viability of a cell means decreasing the length of time the cell survives and decreasing the rate or amount of cellular proliferation (e.g. as compared to an identical or similar unmodulated cell of the same type).
- decreasing the viability of a cell comprises contacting a cell with an agent that decreases the nucleic concentration of MYC. In some embodiments, decreasing the viability of a cell comprises contacting a cell with: an agent that decreases the expression of a MYC gene, an agent that decreases the activity of a Myc polypeptide, or a combination thereof (the "MYC Decreasing Agent"). In some embodiments, the MYC Decreasing Agent is a small molecule, a biologic, a peptide, an antibody, or a combination thereof.
- a method of decreasing the viability of a cell comprises contacting a cell with the MYC Decreasing Agent.
- the MYC Decreasing Agent is an agonist of a MAD- 1 gene, a MAD-I polypeptide, or a combination thereof.
- the up-regulation of a MAD-I gene and/or polypeptide down-regulates the expression of a MYC gene and/or a polypeptide encoded by a MYC gene.
- a method of modulating the viability of a cell comprises contacting a cell with the MYC Decreasing Agent.
- a method of decreasing the viability of a cell comprises contacting a cell with the MYC Decreasing Agent.
- the MYC Decreasing Agent is: Mxi-lan agonist of a Mxi- 1 gene and a Mxi- 1 polypeptide, or a combination thereof.
- the up-regulation of a Mxi- 1 gene and/or polypeptide down-regulates the expression of a MYC gene and/or a polypeptide encoded by a MYC gene.
- the method of identifying the MYC Decreasing Agent comprises identifying an agent that decreases the viability of a factor-dependent cell when the factor-dependent cell is contacted with the necessary growth factor. In some embodiments, the method of identifying the MYC Decreasing Agent comprises identifying an agent that inhibits expression of a reporter gene under the control of a MYC responsive promoter (e.g. an E-box sequence). [0060] In some embodiments, the viability of a cell is decreased by about 1 to about 25 times (e.g. as compared to an identical or similar unmodulated cell of the same type). In some embodiments, the viability of a cell is decreased by about 1 to about 20 times (e.g.
- the viability of a cell is decreased by about 1 to about 15 times (e.g. as compared to an identical or similar unmodulated cell of the same type). In some embodiments, the viability of a cell is decreased by about 1 to about 10 times (e.g. as compared to an identical or similar unmodulated cell of the same type). In some embodiments, the viability of a cell is decreased by about 1 to about 5 times
- the viability of a cell is decreased by about 1 to about 4 times (e.g. as compared to an identical or similar unmodulated cell of the same type). In some embodiments, the viability of a cell is decreased by about 1 to about 2 times (e.g. as compared to an identical or similar unmodulated cell of the same type).
- the cell is a T-cell. In some embodiments, the T-cell is a memory T-cell. In certain instances, the down -regulation of a MYC gene results in a decreased life-span for the T-cell.
- the decreased life span of a memory T-cell results in a lower concentration of memory T- cells in a body.
- the lower concentration of memory T-cells results in a decelerated primary immune response to antigen, treatment of an autoimmune disorder, and/or immunosuppression.
- the down-regulation of a MYC gene results in an increase in anergic T-cells.
- the increase in anergic T-cells results in a decelerated primary immune response to antigen, treatment of an autoimmune disorder, and/or immunosuppression.
- the down-regulation of a MYC gene results in an increase in the time it takes a T-cell to activate in response to an antigen.
- the increase in the time it takes a T-cell to activate in response to an antigen results in a decelerated primary immune response to antigen, treatment of an autoimmune disorder, and/or immunosuppression.
- the immune response is an adaptive immune response (e.g. memory B-cells and memory T- cells).
- modulating an immune response means increasing (e.g., inducing, supplementing, amplifying) an immune response.
- modulating an immune response means decreasing (e.g., inhibiting or suppressing) an immune response.
- the modulation occurs in vitro.
- the modulation occurs in vivo.
- a method of modulating an immune response comprises modulating the viability of a lymphocyte.
- the lymphocyte is a T-cell.
- the T- cell is a CD4+ T-cell.
- the T-cell is a memory T-cell.
- modulating an immune response comprises modulating the expression of a MYC gene, and/or the activity of a Myc polypeptide.
- modulating the expression of a MYC gene, and/or the activity of a Myc polypeptide directly or indirectly results in the modulation of a gene or polypeptide regulated by MYC.
- the gene or polypeptide directly or indirectly regulated by a MYC transcription factor is neurogranin, MEF-2c, gfi- 1 , cyclin D2, CDK4, Egr-2, Nab-2, TGIF, NF-kB pi 05, Carma-1, Al or Bcl-2.
- the subject is a human.
- modulating an immune response means increasing (e.g., inducing, supplementing, amplifying) an immune response.
- increasing an immune resDonse includes increasing the lifespan of a T-cell, increasing the rate of proliferation by a T-cell, increasing the rate at which a memory T-cell responds to an antigen, decreasing the number of anergic cells, and/or increasing the rate at which a cell ends anergy (e.g. as compared to an identical or similar unmodulated cell of the same type).
- increasing an immune response comprises administering to an individual in need thereof an agent that increases the nucleic concentration of MYC.
- increasing an immune response comprises administering to an individual in need thereof: exogenous MYC, an agent that increases the expression of a MYC gene, and an agent that increases the activity of MYC (the "MYC Increasing Agent").
- the MYC Increasing Agent is a small molecule, a biologic, a peptide, an antibody, or a combination thereof.
- a method of increasing an immune response comprises contacting a cell with the MYC Increasing Agent.
- the MYC Increasing Agent is an exogenous Myc polypeptide.
- the MYC Increasing Agent is a fusion peptide comprising (a) a transporter peptide sequence; (b) a MYC sequence; and optionally (c) one or more molecules that link the transporter peptide sequence and the MYC sequence.
- the MYC Increasing Agent is a fusion peptide comprising (a) a TAT sequence; and (b) a MYC sequence.
- a method of increasing an immune response comprises contacting a cell with the MYC Increasing Agent.
- the MYC Increasing Agent is an antagonist of a MAD- 1 gene.
- the down-regulation of a MAD- 1 gene and/or polypeptide upregulates the expression of a MYC gene and/or a polypeptide encoded by a MYC gene.
- a method of increasing an immune response comprises contacting a cell with the MYC Increasing Agent.
- the MYC Increasing Agent is an antagonist of a Mxi- 1 gene.
- the down-regulation of a Mxi- 1 gene and/or polypeptide upregulates the expression of a MYC gene and/or a polypeptide encoded by a MYC gene.
- an immune response is increased by more than 1 to about 20 times (e.g. as compared to an identical or similar unmodulated immune response of the same type).
- an immune response is increased by more than 1 to about 15 times (e.g. as compared to an identical or similar unmodulated immune response of the same type). In some embodiments, following contact with the MYC Increasing Agent an immune response is increased by more than 1 to about 10 times (e.g. as compared to an identical or similar unmodulated immune response of the same type). In some embodiments, following contact with the MYC Increasing Agent an immune response is increased by more than 1 to about 5 times (e.g. as compared to an identical or similar unmodulated immune response of the same type). In some embodiments, following contact with the MYC Increasing Agent an immune response is increased by more than 1 to about 4 times (e.g.
- an immune resoonse is increased by more than 1 to about 2 times (e.g. as compared to an identical or similar unmodulated immune response of the same type).
- a method of increasing an immune response comprises administering a MYC Increasing Agent to an individual in need thereof.
- an immune response is increased by more than 1 to about 10 times (e.g. as compared to an identical or similar unmodulated immune response of the same type).
- an immune response is increased by more than 1 to about 20 times (e.g. as compared to an identical or similar unmodulated immune response of the same type).
- an immune response is increased by more than 1 to about 15 times (e.g.
- an immune response is increased by more than 1 to about 10 times (e.g. as compared to an identical or similar unmodulated immune response of the same type). In some embodiments, following administration of the MYC Increasing Agent to an individual in need thereof, an immune response is increased by more than 1 to about 5 times (e.g. as compared to an identical or similar unmodulated immune response of the same type). In some embodiments, following administration of the MYC Increasing Agent to an individual in need thereof, an immune response is increased by more than 1 to about 4 times (e.g. as compared to an identical or similar unmodulated immune response of the same type).
- a method of increasing an immune response further comprises coadministering a vaccine.
- the vaccine is administered before, after, or simultaneously with a MYC Increasing Agent.
- the MYC Increasing Agent stimulates the immune system and increases the response of the immune system to a vaccine.
- the MYC Increasing Agent augments an immune response.
- the MYC Increasing Agent acts synergistically with the vaccine.
- the agent is a vaccine adjuvant.
- a vaccine comprises dead microorganisms, attenuated microorganisms, toxoids, subunits of the pathogen, nucleic acids, or combinations thereof.
- the vaccine is a vaccine for hepatitis A; hepatitis B; polio; measles; mumps; rubella; diphtheria; pertussis; tetanus; influenza; varicella zoster virus; rotavirus; influenza; meningococcal disorder; pneumonia; smallpox; cholera; bubonic plague; yellow fever; tuberculosis: human paplomavirus (HPV); malaria; leishmania; Candida albicans; an allergen; or combinations thereof.
- the vaccine is a vaccine for a cancer (e.g.
- a cancer vaccine is a patient-specific vaccine (e.g. the vaccine comprises a patient's own tumor cells).
- a cancer vaccine comprises Prostate Specific Antigen (PSA).
- PSA Prostate Specific Antigen
- a cancer vaccine comprises sialyl Tn (STn).
- a cancer vaccine comprises Heat Shock Proteins (HSPs) (e.g., gp96).
- HSPs Heat Shock Proteins
- a cancer vaccine comprises ganglioside molecules (e.g., GM2, GD2, and GD3).
- a cancer vaccine comprises carcinoembryonic antigen (CEA).
- a cancer vaccine comprises MART-I (also known as Melan-A).
- a cancer vaccine comprises tyrosinase.
- the vaccine is a DNA vaccine.
- the vaccine comprises an antigenic moiety.
- the antigenic moiety is a toxoid, a peptide, a nucleic acid sequence, a polysaccharide, or a combination thereof.
- the antigenic moiety is derived from a pathogen selected from: hepatitis A; hepatitis B; polio; measles; mumps; rubella; diphtheria; pertussis; tetanus; influenza; varicella zoster virus; rotavirus; meningococcal; pneumonia; smallpox; cholera; bubonic plague; yellow fever; tuberculosis; human papillomavirus; or combinations thereof.
- the antigenic moiety is derived a neoplastic cell.
- the antigenic moiety is a nucleic acid or a polymer of nucleic acids.
- a method of increasing an immune response further comprises identifying the MYC Increasing Agent.
- the method of identifying the MYC Increasing Agent comprises identifying an agent that reverses anergy in a B-cell.
- the method of identifying the MYC Increasing Agent comprises identifying an agent that increases the viability of a factor- dependent cell in the absence of a required growth factor. In some embodiments, the method of identifying the MYC Increasing Agent comprises identifying an agent that induces expression of a reporter gene under the control of a MYC responsive promoter (e.g. an E-box sequence). Decreasing an Immune Response
- modulating an immune response means decreasing (e.g., inhibiting or suppressing) an immune response.
- decreasing an immune response includes decreasing the lifespan of a T-cell, decreasing proliferation by a T-cell, decreasing the rate at which a memory T-cell responds to an antigen, increasing the number of anergic cells, and/or decreasing the rate at which a cell ends anergy (e.g. as compared to an identical or similar unmodulated cell of the same type).
- decreasing an immune response comprises administering to an individual in need thereof an agent that decreases the nucleic concentration of MYC.
- decreasing an immune response comprises administering to an individual in need thereof: an agent that decreases the expression of a MYC gene and an agent that decreases the activity of a Myc polypeptide (the "MYC Decreasing Agent").
- the MYC Decreasing Agent is a small molecule, a biologic, a peptide, an antibody, or a combination thereof.
- a method of decreasing an immune response comprises contacting a cell with the MYC Decreasing Agent.
- the MYC Decreasing Agent is: an agonist of a MAD-I gene, a MAD-I polypeptide, or a combination thereof.
- the up-regulation of a MAD-I gene and/or polypeptide down-regulates the expression of a MYC gene and/or a polypeptide encoded by a MYC gene.
- a method of decreasing an immune response comprises contacting a cell with the MYC Decreasing Agent.
- the MYC Decreasing Agent is: Mxi-lan agonist of a Mxi-1 gene and a Mxi-1 polypeptide, or a combination thereof.
- the up-regulation of a Mxi- 1 gene and/or polypeptide down-regulates the expression of a MYC gene and/or a polypeptide encoded by a MYC gene.
- an immune response is decreased by more than 1 to about 25 times (e.g. as compared to an identical or similar unmodulated immune response of the same type). In some embodiments, following contact with the MYC Decreasing Agent an immune response is decreased by more than 1 to about 20 times (e.g. as compared to an identical or similar unmodulated immune response of the same type). In some embodiments, following contact with the MYC Decreasing Agent an immune response is decreased by more than 1 to about 15 times (e.g. as compared to an identical or similar unmodulated immune response of the same type).
- an immune response is decreased by more than 1 to about 10 times (e.g. as compared to an identical or similar unmodulated immune response of the same type). In some embodiments, following contact with the MYC Decreasing Agent an immune response is decreased by more than 1 to about 5 times (e.g. as compared to an identical or similar unmodulated immune response of the same type). In some embodiments, following contact with the MYC Decreasing Agent an immune response is decreased by more than 1 to about 4 times (e.g. as compared to an identical or similar unmodulated immune response of the same type). In some embodiments, following contact with the MYC Decreasing Agent an immune response is decreased by more than 1 to about 2 times (e.g.
- a method of decreasing an immune response comprises administering a MYC Decreasing Agent to an individual in need thereof.
- an immune response is increased by more than 1 to about 25 times (e.g. as compared to an identical or similar unmodulated immune response of the same type).
- following administration of the MYC Decreasing Agent to an individual in need thereof an immune response is increased by more than 1 to about 20 times (e.g. as compared to an identical or similar unmodulated immune response of the same type).
- an immune response is increased bv more than 1 to about 15 times (e.g. as compared to an identical or similar unmodulated immune response of the same type). In some embodiments, following administration of the MYC Decreasing Agent to an individual in need thereof an immune response is increased by more than 1 to about 10 times (e.g. as compared to an identical or similar unmodulated immune response of the same type). In some embodiments, following administration of the MYC Decreasing Agent to an individual in need thereof an immune response is increased by more than 1 to about 5 times (e.g. as compared to an identical or similar unmodulated immune response of the same type).
- a method of decreasing an immune response comprises administering the MYC Decreasing Agent to an individual with an autoimmune disorder. In some embodiments, the MYC Decreasing Agent decreases an immune response.
- the autoimmune disorder is Castleman's Disorder, lupus, multiple sclerosis, scleroderma pigmentosa, Autoimmune Lymphoproliferative Syndrome (ALPS), myesthenia gravis, diabetes, asthma, rheumatoid arthritis, vitiligo, diGeorge's syndrome, Grave's disorder, Crohn's disorder, inflammatory bowel disorder, colitis, orchitis, scleroderma pigmentosa, uveitis, Post- Transplant Lymphoproliferative Disorder (PTLD), or Autoimmune Disorder- Associated Lymphadenopathy (ADAL).
- APS Autoimmune Lymphoproliferative Syndrome
- a method of decreasing an immune response comprises administering the MYC Decreasing Agent to an individual that is receiving, will receive, or has received an organ or bone marrow transplant (the "Transplant").
- the MYC Decreasing Agent decreases an immune response.
- decreasing an immune response in an individual that is receiving, will receive, or has received an organ transplant, or a bone marrow transplant ameliorates and/or prevents an immune response against the Transplant.
- the method of identifying the MYC Decreasing Agent comprises identifying an agent that decreases the viability of a factor-dependent cell when the factor-dependent cell is contacted with the necessary growth factor. In some embodiments, the method of identifying the MYC Decreasing
- Agent comprises identifying an agent that inhibits expression of a reporter gene under the control of a MYC responsive promoter (e.g. an E-box sequence).
- a MYC responsive promoter e.g. an E-box sequence.
- a disorder characterized by an over-expression of MYC or an excess of Myc polypeptide activity are methods of treating a disorder characterized by an under-expression of MYC or a dearth of Myc polypeptide activity.
- the method comprises administering to an individual in need thereof an effective amount of an agent that modulates the expression of a MYC gene, and/or the activity of a Myc polypeptide.
- methods of treating a disorder characterized by an under-expression of MYC or a dearth of Myc polypeptide activity are provided.
- the method comprises administering to an individual in need thereof an effective amount of a MYC Increasing Agent.
- the MYC Increasing Agent is a small molecule, a biologic, a peptide, an antibody, or a combination thereof.
- the method comprises administering to an individual in need thereof an effective amount of a MYC Increasing Agent.
- the MYC Increasing Agent is an exogenous Myc polypeptide.
- the MYC Increasing Agent is a fusion peptide comprising (a) a transporter peptide sequence; (b) a MYC sequence; and optionally (c) one or more molecules that link the transporter peptide sequence and the MYC sequence.
- the MYC Increasing Agent is a fusion peptide comprising (a) a TAT sequence; and (b) a MYC sequence.
- the method comprises administering to an individual in need thereof an effective amount of a MYC Increasing Agent.
- the MYC Increasing Agent is an antagonist of a MAD-I gene.
- the down-regulation of a MAD-I gene and/or polypeptide upregulates the expression of a MYC gene and/or a polypeptide encoded by a MYC gene.
- the method comprises administering to an individual in need thereof an effective amount of a MYC Increasing Agent.
- the MYC Increasing Agent is an antagonist of a Mxi- 1 gene.
- the down-regulation of a Mxi- 1 gene and/or polypeptide upregulates the expression of a MYC gene and/or a polypeptide encoded by a MYC gene.
- the method comprises administering to an individual in need thereof an effective amount of a MYC Decreasing Agent.
- the MYC Decreasing Agent is a small molecule, a biologic, a peptide, an antibody, or a combination thereof.
- the method comprises administering to an individual in need thereof an effective amount of a MYC Decreasing Agent.
- the MYC Decreasing Agent is: an agonist of a MAD-I gene, a MAD-I polypeptide, or a combination thereof.
- the up- regulation of a MAD- 1 gene and/or polypeptide down-regulates the expression of a MYC gene and/or a polypeptide encoded by a MYC gene.
- the method comprises administering to an individual in need thereof an effective amount of a MYC Decreasing Agent.
- a method of modulating the viability of a cell comprises contacting a cell with the MYC Decreasing Agent.
- Mxi-lan agonist of a Mxi-1 gene and a Mxi-1 polypeptide or a combination thereof.
- the up-regulation of a Mxi- 1 gene and/or polypeptide down-regulates the expression of a MYC gene and/or a polypeptide encoded by a MYC gene.
- an indication that an individual over-expresses MYC or that a Myc polypeptide is excessively active is the development of an autoimmune disorder.
- the autoimmune disorder is Castleman's Disease, lupus, multiple sclerosis, scleroderma pigmentosa, Autoimmune Lymphoproliferative Syndrome (ALPS), myesthenia gravis, diabetes, asthma, rheumatoid arthritis, vitiligo, diGeorge's syndrome, Grave's disease, Crohn's disease, inflammatory bowel disease, colitis, orchitis, scleroderma pigmentosa, uveitis, Post-Transplant Lymphoproliferative Disease (PTLD), Autoimmune Disease-Associated Lymphadenopathy (ADAL), rejection of an organ transplant, rejection of a tissue transplant, or combinations thereof.
- APS Autoimmune Lymphoproliferative Syndrome
- PTLD Post-Transplant Lymphoproliferative Disease
- ADAL Autoimmune Disease-Associated Lymphadenopathy
- an indication that an individual under-expresses MYC, or that a Myc polypeptide is minimally active or inactive is an increase in the number of anergic B-cells and/or T-cells.
- the expression of IgM, IgMa, IgMb, B220, CD21/35, CD23, CD24 (HSA), CD40, CD69, CD80 and/or CD86 (B7-2) is down-regulated in anergic B-cells when compared to non-anergic B-cells.
- reversing e.g.
- a method of treating a disorder characterized by aberrant expression of a MYC gene or aberrant activity of a Myc polypeptide comprises identifying an agent that reverses anergy in a B-cell. In some embodiments, a method of treating a disorder characterized by aberrant expression of a MYC gene or aberrant activity of a Myc polypeptide comprises identifying an agent that increases the viability of a factor-dependent cell in the absence of a required growth factor.
- a method of treating a disorder characterized by aberrant expression of a MYC gene or aberrant activity of a Myc polypeptide comprises identifying an agent that decreases the viability of a factor-dependent cell when the factor- dependent cell is contacted with the necessary growth factor. In some embodiments, a method of treating a disorder characterized by aberrant expression of a MYC gene or aberrant activity of a Myc polypeptide comprises identifying an agent that induces expression of a reporter gene under the control of a MYC responsive promoter (e.g. an E-box sequence).
- a MYC responsive promoter e.g. an E-box sequence
- a method of treating a disorder characterized by aberrant expression of a MYC gene or aberrant activity of a Myc polypeptide comprises identifying an agent that inhibits expression of a reporter gene under the control of a MYC responsive promoter (e.g. an E-box sequence).
- a MYC responsive promoter e.g. an E-box sequence
- a fusion peptide comprising (a) a transporter peptide sequence; and (b) a MYC sequence.
- the fusion peptide is a peptide of Formula (I): transporter peptide sequence -MYC sequence.
- a fusion peptide disclosed herein comprises (a) a transporter peptide sequence; (b) a MYC sequence; and (c) one or more molecules that link the transporter peptide sequence and the MYC sequence.
- the fusion peptide is a peptide of Formula (II): transporter peptide sequence-X-MYC sequence, wherein -X- is molecule that links the transporter peptide sequence and the MYC sequence.
- -X- is an amino acid.
- -X- is at least one amino acid.
- a "transporter peptide” means a peptide sequence that promotes peptide penetration into cells and tissues.
- a transporter peptide is TAT.
- a transporter peptide is TAT f48-57] .
- a transporter peptide is TAT [57 _ 48] .
- a "MYC sequence” is a MYC amino acid peptide sequence.
- the Myc polypeptide is a complete Myc polypeptide sequence.
- the Myc polypeptide is a partial Myc polypeptide sequence.
- the MYC is c-MYC.
- the Myc polypeptide sequence comprises SEQ ID NO. 1 :
- a fusion peptide disclosed herein comprises (a) TAT, and (b) c-MYC. In some embodiments, a fusion peptide disclosed herein comprises (a) TAT f48-57] , and (b) c-MYC. In some embodiments, a fusion peptide disclosed herein comprises (a) TAT f57-48] , and (b) c-MYC. [00103] In some embodiments, a fusion peptide disclosed herein comprises (a) TAT, (b) a linker amino acid, and (c) c-MYC.
- a fusion peptide disclosed herein comprises (a) TAT f48-57] , (b) a linker amino acid, and (c) c-MYC. In some embodiments, a fusion peptide disclosed herein comprises (a) TAT f57-48] , (b) a linker amino acid, and (c) c-MYC. [00104] In some embodiments, a fusion peptide disclosed herein further comprises at least one amino acid sequence that facilitates purification of the fusion protein. In some embodiments, a fusion peptide disclosed herein comprises a protein tag. In some embodiments, a fusion peptide disclosed herein comprises a polyhistidine tag.
- a fusion peptide disclosed herein comprises an epitope tag. In some embodiments, a fusion peptide disclosed herein comprises a polyhistidine tag and an epitope tag. In some embodiments, a fusion peptide disclosed herein comprises a 6-histidine tag and a V5 epitope tag. [00105] In some embodiments, the histidine tag is a 6-histidine tag. In some embodiments, the histidine tag comprises the sequence HHHHHH. In some embodiments, a histidine tag is added to a fusion protein disclosed herein by any suitable method. In some embodiments, a TAT-Myc polypeptide sequence is cloned into an expression vector encoding a polyHis-tag. In some embodiments, a polyhistidine tag is added by PCR (i.e., the PCR primers comprise a polyhistine sequence).
- a fusion peptide disclosed herein further comprises at least one protein tag.
- a fusion peptide disclosed herein comprises an epitope tag.
- a fusion peptide disclosed herein further comprises a V5 epitope tag.
- the V5 tag comprises the amino acids: GKPIPNPLLGLDST.
- the V5 tag comprises the amino acids: IPNPLLGLD.
- a V5 tag is added to a fusion protein disclosed herein by any suitable method.
- a TAT-Myc polypeptide sequence is cloned into an expression vector encoding a V5 tag.
- a V5 tag is added by PCR (i.e., the PCR primers comprise a V5 sequence).
- the amino acids are in the D formation.
- the amino acids are in the L formation.
- a first plurality of amino acids are in the D formation and a second plurality are in the L formation.
- the MYC Increasing Agent comprises SEQ ID NO. 2:
- a MYC-TAT fusion peptide disclosed herein is constructed by any suitable method.
- a nucleotide sequence encoding a MYC-TAT fusion peptide is generated by PCR.
- a forward primer for a human MYC sequence comprises an in frame N-terminal 9-amino-acid sequence of the TAT protein transduction domain (i.e., RKKRRQRRR).
- a reverse primer for a human MYC sequence is designed to remove the stop codon.
- the PCR product is cloned into any suitable expression vector (hereinafter, p-TAT-MYC).
- the expression vector comprises a polyhistidine tag and a V5 tag.
- an agent that reverses anergy in a B-cell increases an immune response and/or increases the viability of a cell.
- an agent that reverses anergy in a B-cell up-regulates MYC (e.g. a MYC gene and/or a Myc polypeptide).
- a method of identifying an agent that reverses anergy in a B-cell comprises (a) contacting a plurality of anergic B-cells with an agent; and (b) following contacting the plurality of cells with the agent, detecting and/or measuring the level of expression of one or more cell surface markers (e.g. cell surface markers the presence of which is indicative a non-anergic cell) in the cell culture.
- the cell surface marker is IgM, IgMa, IgMb, B220, CD21/35, CD23, CD24 (HSA), CD40, CD69, CD80 and/or CD86 (B7-2).
- the expression of IgM, IgMa, IgMb, B220, CD21/35, CD23, CD24 (HSA), CD40, CD69, CD80 and/or CD86 (B7-2) is down-regulated in anergic B-cells when compared to non-anergic B-cells.
- reversing (e.g. partially or fully) anergy results in an increase in the expression of IgM, IgMa, IgMb, B220, CD21/35, CD23, CD24 (HSA), CD40, CD69, CD80 and/or CD86 (B7-2).
- a method of identifying an agent that reverses anergy in a B-cell comprises identifying an agent as an agonist of an immune response if expression of a cell surface marker is upregulated (e.g. as compared to an anergic B-cell not contacted with an agent).
- expression of a cell surface marker is upregulated on activated B-cells (when compared to the expression pattern on anergic B-cells) by about 10% to about 100% (e.g. at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%.
- expression of a cell surface marker is upregulated on activated B-cells (when compared to the expression pattern on anergic B-cells) by about 30% to about 100% (e.g. at least 30%, 35%, 40%, 45%. 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 30% to about 100%).
- expression of a cell surface marker is upregulated on activated B-cells (when comoared to the expression pattern on anergic B-cells) by about 50% to about 100% (e.g. at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 50% to about 100%).
- expression of a cell surface marker is upregulated on activated B-cells (when compared to the expression pattern on anergic B-cells)by about 70% to about 100% (e.g.
- a method of identifying an agent that reverses anergy in a B-cell comprises identifying an agent as an antagonist of an immune response if expression of a cell surface marker is downregulated (e.g. as compared to a non-anergic B-cell not contacted with an agent).
- expression of a cell surface marker is downregulated (e.g. as compared to a non-anergic B-cell not contacted with an agent) by about 10% to about 100% (e.g. at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%.
- expression of a cell surface marker is downregulated (e.g. as compared to a non-anergic B-cell not contacted with an agent) by about 30% to about 100% (e.g. at least 30%, 35%, 40%, 45%. 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 30% to about 100%).
- expression of a cell surface marker is downregulated (e.g. as compared to a non-anergic B-cell not contacted with an agent) by about 50% to about 100% (e.g. at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 50% to about 100%).
- expression of a cell surface marker is downregulated (e.g. as compared to a non-anergic B-cell not contacted with an agent) by about 70% to about 100% (e.g.
- expression of a cell surface marker is downregulated (e.g. as compared to a non-anergic B-cell not contacted with an agent) by about 80% to about 100% (e.g. at least 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 80% to about 100%).
- a method of identifying an agent that reverses anergy in a B-cell further comprises comparing (1) the level of expression of the cell surface marker observed in a plurality of anergic B-cells following contacting the plurality of cells with the agent to (2) the level of cell surface marker observed in a control.
- the control is a plurality of anergic B-cells not contacted with an agent.
- a method of identifying an agent that reverses anergy in a B-cell comprises obtaining an anergic B-cell from any suitable source (e.g. a human, a mouse, a rat, or anv mammal " ).
- a method of identifying an agent that reverses anergy in a B-cell comprises obtaining an anergic B-cell from transgenic mice with the phenotype BCR HEL /sHEL.
- BCR HEL mice express a mature B-cell receptor (BCR) for the antigen hen egg lysozyme (HEL).
- HEL BCR is the dominant BCR on the B-cells of the transgenic mice.
- sHEL mice ubiquitously express a transgene for the soluble form of HEL.
- the expression of the HEL transgene is operably linked to a metallothionein promoter.
- the exposure to soluble HEL induces anergy in B-cells.
- U.S. Patent Application Pub. No. 2008/0070256 is hereby incorporated by reference for the methods of constructing the murine models discussed above.
- the anergic B-cells are obtained from the spleen, thymus, bone marrow, lymph nodes, or combinations thereof of the transgenic mice.
- a method of identifying an agent that reverses anergy in a B-cell comprises detecting and/or measuring the level of expression of one or more cell surface markers (e.g. CD86).
- detecting and/or measuring the level of expression of one or more cell surface markers comprises (a) contacting a plurality of anergic B-cells (e.g. a control, or a plurality of anergic B-cells following contact with an agent) with antibodies to a cell surface marker (e.g. antibodies to CD86); (b) washing the cell culture (e.g. rinsing) with buffer (e.g.
- the antibodies are purchased from a commercial supplier. In some embodiments, the antibodies are generated in- house. For methods of generating antibodies, see Kohler et al, Nature, 256:495 (1975); U.S. Pat. No.
- the cell culture is incubated on ice during the contact with the antibodies.
- the antibody is isotopically-labeled, radio- labeled, fluorophore-labeled, or biotinylated.
- the fluorophore is fluorescein.
- the cell surface marker/antibody complex is detectable and/or measurable in any suitable manner (e.g. HPLC, fluorescence microscopy, confocal microscopy, microarray scanners, Surface Plasmon Resonance, infrared spectroscopy, or autoradiography).
- a method of identifying an agent that reverses anergy in a B-cell comprises detecting and/or measuring the level of expression of IgM.
- detecting and/or measuring the level of expression of IgM comprises (a) contacting a cell culture (e.g. a control, or a plurality of anergic B-cells following contact with an agent) with an antigen (e.g. HEL) for a period of time sufficient to allow the antigen to bind to an IgM; (b) washing the cell culture (e.g. rinsing) with buffer (e.g. FACS buffer) after contacting the culture with the antigen; and (c) detecting and/or measuring the amount of antigen and/or antigen/IgM complex.
- the antigen is biotinylated.
- the cell culture is further incubated with a marker having an affinity for biotin (the "Biotin Marker").
- the Biotin Marker is avidin or streptavidin.
- the Biotin Marker is isotopically-labeled, radio-labeled, fluorophore-labeled.
- the fluorophore is phycoerythrin.
- the IgM/antigen/Biotin Marker complex is detectable and/or measurable in any suitable manner (e.g. HPLC, fluorescence microscopy, confocal microscopy, microarray scanners, Surface Plasmon Resonance, infrared spectroscopy, or autoradiography).
- a method of identifying an agent that reverses anergy in a B-cell comprises detecting and/or measuring the level of expression of IgM.
- detecting and/or measuring the level of expression of IgM comprises (a) contacting a cell culture (e.g. a control, or a plurality of anergic B-cells following contact with an agent) with an antigen (e.g. HEL) for a period of time sufficient to allow the antigen to bind to the IgM; (b) washing the cell culture (e.g. rinsing) with buffer (e.g.
- the culture is contacted with dilutions of antibodies to the antigen (e.g. for a period of time sufficient to allow the antibodies to bind to the antigen).
- the cell culture is incubated on ice during contact with the antibodies.
- the cell culture is washed (e.g. rinsed) with buffer (e.g. FACS buffer) after contact with the antibodies.
- the antibody is isotopically-labeled, radio-labeled, fluorophore-labeled, or biotinylated.
- the fluorophore is fluorescein.
- the antigen/antibody and/or IgM/antigen/antibody complex is detectable and/or measurable in any suitable manner (e.g. HPLC, fluorescence microscopy, confocal microscopy, microarray scanners, Surface Plasmon Resonance, infrared spectroscopy, or autoradiography).
- the method further comprises detecting the presence of and/or measuring the amount of the labeled antibody, or of a complex formed between the antibody and the HEL antigen.
- the HEL antigen/antibody complex is detectable and measurable in any suitable manner (e.g. HPLC, fluorescence microscopy, confocal microscopy, microarray scanners, Surface Plasmon Resonance, infrared spectroscopy, or autoradiography). Modulation of Cytokine Function
- a method of identifying an agent that induces (e.g., activates, increases, or supplements) an immune response comprises identifying an agent that replaces and/or augments cytokine function (the "Cytokine Supplementing Agent").
- an agent that replaces and/or augments cytokine function in a factor-dependent cell increases an immune response and/or increases the viability of a cell.
- an agent that replaces and/or augments cytokine function in a factor-dependent cell up-regulates MYC (e.g. a MYC gene and/or a Myc polypeptide).
- the method comprises (a) contacting a plurality of factor-dependent cells with an agent; and (b) following contacting the cell with the agent, detecting and/or measuring the level of expansion of the cell culture.
- the method further comprises identifying an agent as a Cytokine Supplementing Agent if, following contact with the agent, the cell culture expands (e.g. as compared to a cell culture not contacted with an agent). In some embodiments, following contact with the agent the cell culture expands (when compared to a cell culture not contacted with an agent) by about 10% to about 100% (e.g. at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%.
- the cell culture expands (when compared to a cell culture not contacted with an agent) by about 30% to about 100% (e.g. at least 30%, 35%, 40%, 45%. 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 30% to about 100%).
- the cell culture expands (when compared to a cell culture not contacted with an agent) by about 50% to about 100% (e.g. at least 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 50% to about 100%).
- the cell culture expands (when compared to a cell culture not contacted with an agent) by about 70% to about 100% (e.g.
- the cell culture expands (when compared to a cell culture not contacted with an agent) by about 80% to about 100% (e.g. at least 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 80% to about 100%).
- a method of identifying an agent that that replaces and/or augments cytokine function further comprises comparing (1) the level of expansion observed in a plurality of factor-dependent cells following contacting the plurality of cells with an agent to (2) the level of expansion of a control.
- the control is a plurality of factor-dependent cells not contacted with an agent.
- contacting a factor-dependent cell with an agent that replaces and/or augments cytokine function results in the expression of MYC being upregulated. In certain instances, the up-regulation of MYC results in factor-dependent cells that do not require a cytokine for viability.
- the up-regulation of MYC results in factor-dependent cells that proliferate in the absence of a cytokine. In certain instances, the up-regulation of MYC results in factor-dependent cells that do not undergo apoptosis in the absence of a cytokine.
- the factor-dependent cells are lymphoid cells (i.e. derived from cells of the lymphatic system).
- the factor-dependent cells is, by way of non- limiting example, IL- 2-/-, IL-3-/-, IL-4 -/-, IL-5-/-, IL-6-/-, JL-I-I-, IL-8-/-, JL-9-I-, IL-10-/-, IL-11-/-, IL- 12-/-, or any combinations thereof.
- the factor-dependent cells are derived from a cell line selected from, by way of non- limiting example: 2D6; 2E8; lOBlO; ATH8; B13; BAF/3; BALM-4;BCL1; CT.4S; CT6; CTL44; CTLL-2; Dl; DlO; D36;Da; DS-I; Ea3.17; EL4; FL5.12; HT-2; IC-2; Kitt225; KT-3; L4;
- a cell line selected from, by way of non- limiting example: 2D6; 2E8; lOBlO; ATH8; B13; BAF/3; BALM-4;BCL1; CT.4S; CT6; CTL44; CTLL-2; Dl; DlO; D36;Da; DS-I; Ea3.17; EL4; FL5.12; HT-2; IC-2; Kitt225; KT-3; L4;
- the cells are derived from CTLL-2; or BAF/3 cell lines.
- a Cytokine Interfering Agent decreases an immune response and/or decreases the viability of a cell.
- the method comprises (a) contacting a plurality of factor-dependent cells with a required growth factor such that the cell culture expands; (b) contacting the plurality of cells plurality of factor- dependent cells with an agent; and (c) following contacting the plurality of cells plurality of factor-dependent cells with the agent, detecting and/or measuring the level of expansion of the cell culture.
- the method further comprises identifying an agent as cytokine interfering agent if, following contact with the agent, the cell culture contracts (e.g. as compared to a cell culture not contacted with an agent).
- the cell culture contracts following contact with the agent the cell culture contracts (when compared to a cell culture not contacted with an agent) by about 10% to about 100% (e.g. at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%. 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 10% to about 100%).
- the cell culture contracts following contact with the agent the cell culture contracts (when compared to a cell culture not contacted with an agent) by about 30% to about 100% (e.g. at least 30%, 35%, 40%, 45%. 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 30% to about 100%).
- the cell culture contracts following contact with the agent the cell culture contracts (when compared to a cell culture not contacted with an agent) by about 50% to about 100% (e.g.
- the cell culture contracts (when compared to a cell culture not contacted with an agent) by about 70% to about 100% (e.g. at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 50% to about 100%).
- the cell culture contracts (when compared to a cell culture not contacted with an agent) by about 70% to about 100% (e.g. at least 70%, 75%, 80%, 85%, 86%, 87%, 88%, 90%, 91%, 92%, 94%, 95%, 96%, 97%, 98%, or any other percent from about 70% to about 100%).
- a method of identifying an agent that that replaces and/or augments cytokine function further comprises comparing (1) the level of expansion observed in a plurality of factor-dependent cells following contacting the plurality of cells with an agent to (2) the level of expansion of a control.
- the control is a plurality of factor-dependent cells not contacted with an agent.
- contacting a factor-dependent cell with an agent that inhibits and/or interferes with cytokine function results in the expression of MYC being down-regulated.
- the down -regulation of MYC results in factor-dependent cells that require a cytokine for viability.
- the down -regulation of MYC results in factor-dependent cells that do not proliferate in the absence of a cytokine.
- the down -regulation of MYC results in factor-dependent cells that undergo apoptosis in the absence of a cytokine.
- the factor-dependent cells are lymphoid cells (i.e. derived from cells of the lymphatic system).
- the factor-dependent cells is, by way of non- limiting example, IL- 2-I-, IL-3-/-, IL-4 -/-, IL-5-/-, IL-6-/-, IL-I-I-, IL-8-/-, IL-9-/-, IL-IO-/-, IL-11-/-, IL-12-/-, or any combinations thereof.
- the factor-dependent cells are derived from a cell line selected from, by way of non- limiting example: 2D6; 2E8; lOBlO; ATH8; B13; BAF/3; BALM-4;BCL1; CT.4S; CT6; CTL44; CTLL-2; Dl; DlO; D36;Da; DS-I; Ea3.17; EL4; FL5.12; HT-2; IC-2; Kitt225; KT-3; L4; L138.8A; LBRM-33; LyD9; MC/9; MLA-144; Mono Mac 6; Nb2; NKC3; PB-I; Pno; PT-18; Ramos; Sez627; TlO; T88; Tl 165; TALL-103; TF-I; TMD2; TSl; UT-7; XG-I; Y16; or a combination thereof.
- the cells are derived from CTLL-2; or
- the method comprises identifying an agent that modulates the function of a MYC encoded transcription factor.
- the method comprises (a) transforming a plurality of cells in a cell culture with a reporter construct, wherein the reporter construct is a plasmid that comprises a reporter gene, and wherein the expression of the reporter gene is operably linked to one or more E-box sequences; (b) contacting the plurality of cells plurality of cells transformed with the reporter construct with an agent; and (c) following contacting the culture with an agent, detecting and/or measuring the level of expression of the reporter gene.
- the reporter construct is obtained in any suitable manner (e.g. purchased from a vendor or fabricated in-house).
- a method of identifying an agent that modulates the function of a MYC encoded transcription factor further comprises comparing (1) the level of expression of the reporter gene in a plurality of cells transformed with the reporter construct following contact with an agent to (2) the level of the level of expression of the reporter gene in a control.
- the cells are eukaryotic cells. In some embodiments, the eukaryotic cells are human cells. In some embodiments, the cells are human lymphoid cells. In some embodiments, the lymphoid cells are B-cells.
- the reporter construct comprises one or more E-box sequences upstream of a reporter gene. In some embodiments, the one or more E-box sequences are encoded in a mvc-resDonsive promoter sequence and/or are upstream of the myc-responsive promoter.
- promoter sequence means a nucleotide sequence upstream of a gene that allows an RNA polymerase to transcribe the gene.
- myc-responsive promoter means a promoter sequence to which a transcription factor encoded by MYC can bind. In some embodiments, the myc-responsive promoter is the ornithine decarboxylase promoter.
- the reporter gene is a ⁇ -galactosidase gene, a ⁇ -lactamase gene, a horseradish peroxidase gene, an alkaline phosphatase gene, a thymidine kinase gene, a xanthine phosphoribotransferase gene, a tyrosinase gene, a cytosine deaminase gene, an antibiotic resistance gene, or a gene having a fluorescent expression product.
- the gene having a fluorescent expression product is a luciferase gene, or a green fluorescent polypeptide (GFP) gene.
- the method of identifying an agent that modulates the function of a MYC encoded transcription factor further comprises detecting the expression of and/or measuring the amount of expression of the reporter gene.
- the expression of the reporter gene is detectable and measurable in any suitable manner (e.g. fluorescence microscopy).
- the cell culture further comprises serum.
- the serum is fetal bovine serum (FBS); bovine serum; horse serum; human serum; chicken serum; goat serum; porcine serum; rabbit serum; sheep serum; a serum replacement (e.g. Serum Replacement l(Sigma-Aldrich)); or a combination thereof.
- the cell culture further comprises media.
- the media is, by way of non- limiting example, phosphate buffered saline; Earle's Balanced Salts; Hanks' Balanced Salts; Tyrode's Salts; derivatives thereof; or combinations thereof.
- the growth factor is, by way of non- limiting example, a cytokine, epidermal growth factor, or platelet-derived growth factor.
- the cytokine is, by way of non- limiting example, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL- 12, or IL- 13.
- the choice of growth factor is determined based on the type of cell used in the method.
- the method further comprises contacting the plurality of cells with a mitogenic stimulant.
- the mitogenic stimulant is, by way of non- limiting example, an antigen, or a mitogenic antibody.
- the antigen is, by way of non- limiting example, phytohaemagglutinin (PHA), concanavalin A (conA), lipopolysaccharide (LPS), pokeweed mitogen (PWM), or combinations thereof.
- the mitogenic antibody is, by way of non- limiting example, an anti-IgM, an anti-CD40, or combinations thereof.
- the anti-IgM is anti-IgM-F(ab')2.
- the anti-CD40 is anti-CD40 IgM.
- any of the methods described herein further comprise validating in vitro an agent (e.g. an agent identified according to any method described herein) as a regulator of an immune response.
- a method of validating in vitro an agent as a regulator of an immune response comprises (a) contacting the agent with a primary T-cell activation culture; (b) stainins the culture for activation markers; and (c) staining the culture 24 hours after contact with the agent.
- the cell viability is detectable and measurable in any suitable manner (e.g. fluorescence microscopy, flow cytometry, FACS).
- an agent that up-regulates an immune response will cause an increase in activation markers as compared to a control (or the culture before contact with the agent). In certain instances, an agent that down-regulates an immune response will cause a decrease in activation markers as compared to a control (or the culture before contact with the agent).
- any of the methods described herein further comprise validating in vitro an agent as a regulator of an immune response.
- a method of validating in vitro an agent as a regulator of an immune response comprises (a) contacting the agent with a primary T-cell activation culture; (b) staining the culture with CFSE (carboxyfluorescein succinimidyl ester); and (c) staining the culture 72 hours after contact with the agent.
- CFSE indicates cell proliferation.
- a cell incorporates the CFSE.
- a portion (i.e. half) of the CFSE in a cell transfers to a daughter cell following division.
- the amount of CFSE in cell decreases with each division.
- the cell viability is detectable and measurable in any suitable manner (e.g. fluorescence microscopy, flow cytometry, FACS).
- an agent that up-regulates an immune response will cause an increase in cell proliferation as compared to a control (or the culture before contact with the agent).
- an agent that down-regulates an immune response will cause a decrease in cell proliferation as compared to a control (or the culture before contact with the agent).
- any of the methods described herein further comprise validating in vitro an agent as a regulator of an immune response.
- a method of validating in vitro an agent as a regulator of an immune response comprises (a) contacting the agent with a primary T-cell activation culture; (b) staining the culture with 7AAD (7-amino-actinomycin D); and (c) staining the culture 72 hours after contact with the agent.
- 7-AAD indicates cell viability.
- 7-AAD will stain cells with compromised membranes (i.e. unviable cells).
- 7-AAD will not stain cells with uncompromised membranes (i.e. viable cells).
- the cell viability is detectable and measurable in any suitable manner (e.g. fluorescence microscopy, flow cytometry, FACS).
- an agent that up-regulates an immune response will cause an increase in cell viability as compared to a control (or the culture before contact with the agent). In certain instances, an agent that down-regulates an immune response will cause a decrease in cell viability as compared to a control (or the culture before contact with the agent).
- any of the methods described herein further comprise validating in vivo an agent (e.g. an agent identified according to any method described herein) as a regulator of an immune response.
- a method of validating in vivo an agent as a regulator of an immune response comprises (a) immunizing a mammal (e.g. a mouse, rat, rabbit) against an antigen (e.g. OVA peptides, NP-KHL) by administering the antigen to a mouse; (b) administering the agent to the mouse before. during, or after administration of the antigen; (c) obtaining a biological sample (e.g.
- an immune response e.g. the rate of proliferation of memory B-cells and/or T-cells.
- an immune response is detected or measured by detecting and measuring antibody production following the immunization.
- antibody production is assayed once-a-day every day for a week following immunization and then once-a-week thereafter.
- an immune response is detected or measured by detecting and measuring T-cell proliferation upon re-stimulation with the antigen.
- T-cell proliferation is assayed one week after immunization.
- an agent that up-regulates a primary immune response will cause an increase in antibody production and T-cell proliferation as compared to a control (i.e. a mouse not administered the agent).
- an agent that down-regulates a primary immune response will cause a decrease in antibody production and T-cell proliferation as compared to a control (i.e. a mouse not administered the agent).
- any of the methods described herein further comprise validating in vivo an agent (e.g. an agent identified according to any method described herein) as a regulator of an immune response.
- a method of validating in vivo an agent as a regulator of an immune response comprises (a) immunizing a mouse against an antigen (e.g. OVA peptides, NP-KHL) by administering the antigen to the mouse; (b) administering the agent to the mouse before, during, or after administration of the antigen; (c) challenging the mouse with the antigen 3 to 6 months after inoculation; (d) obtaining a biological sample (e.g.
- an antigen e.g. OVA peptides, NP-KHL
- an immune response is detected or measured by detecting and measuring antibody production following immunization.
- antibody production is assayed once-a-day every day for a week following challenge and then once-a-week thereafter.
- an immune response is detected or measured by detecting and measuring T- cell proliferation upon re- stimulation with the antigen.
- T-cell proliferation is assayed one week after challenge.
- an agent that up-regulates a secondary immune response will cause an accelerated immune response (i.e.
- an agent that down-regulates a secondary immune response will cause a decelerated immune response (i.e. a decreased rate of antibody production and T-cell proliferation) following challenge with the antigen as compared to a control (i.e. a mouse not administered the agent).
- agents that modulate an immune response e.g. agents that reverse anergy, agents that modulate cytokine function, and/or agents that modulate the function of a MYC encoded transcription factor.
- the agent is useful in administration to an individual in need thereof.
- the agent is any agent identified bv anv of the methods disclosed herein.
- the agent is any agent that modulates an immune response.
- the agent is a small molecule.
- the agent is RNAi.
- the agent is an agonist of MYC (e.g. a MYC gene and/or a Myc polypeptide).
- the agent is an antagonist of MYC (e.g. a MYC gene and/or a Myc polypeptide).
- MYC e.g. a MYC gene and/or a Myc polypeptide.
- the agent is identified as an agent that modulates the viability of a cell based on the agent's ability to reverse anergy in a B-cell.
- the agent is identified as an agent that that modulates the viability of a cell based on the agent's ability to modulate the viability of factor- dependent cells.
- the agent is identified as an agent that modulates the viability of a cell based on the agent's ability to induce expression of a reporter gene.
- the modulation of the immune response comprises the modulation of the viability of a lymphocyte.
- the lymphocyte is a T-cell.
- the T- cell is a CD4+ T-cell.
- the T-cell is a memory T-cell.
- the viability of a lymphocyte following contact with the agent is more than 1 to about 10 times greater than the viability of a lymphocyte that has not been contacted the agent.
- the agent causes the up-regulation of a MYC gene in a lymphocyte.
- the modulation occurs in vivo.
- the lymphocyte is a T-cell.
- the T- cell is a memory T-cell.
- the up-regulation of a MYC gene results in an extended life-span for the T-cell.
- the extended life span of a memory T-cell results in a higher concentration of memory T-cells in a body.
- the higher concentration of memory T-cells results in an accelerated primary immune response to antigen.
- the up-regulation of a MYC gene results in a decrease in anergic T-cells. In certain instances, the decrease in anergic T-cells results in an accelerated primary immune response to antigen. In certain instances, the up-regulation of a MYC gene results in a decrease in the time it takes a T-cell to activate in response to an antigen. In certain instances, the decrease in the time it takes a T-cell to activate in response to an antigen results in an accelerated primary immune response to antigen.
- the agent is administered before, during, or after administration of a vaccine to an individual.
- the agent stimulates the immune system and increases the response of the immune system to a vaccine.
- agent augments an immune response.
- the agent acts synergistically with the vaccine.
- the agent is a vaccine adjuvant.
- a vaccine comprises dead microorganisms, attenuated microorganisms, toxoids, subunits of the pathogen, nucleic acids, or combinations thereof.
- the vaccine is a vaccine for hepatitis A; hepatitis B; polio; measles; mumps; rubella; diphtheria; pertussis; tetanus; influenza; varicella zoster virus; rotavirus; influenza; meningococcal disorder; pneumonia; smallpox; cholera; bubonic plague; yellow fever; tuberculosis: human paplomavirus; or combinations thereof.
- the vaccine is a vaccine for a cancer (e.g. follicular B-cell Non-Hodgkin's lvmohoma. orostate cancer, multiple myeloma, kidney cancer, cutaneous melanoma, ocular melanoma, and other solid tumors, carcinomas and sarcomas).
- a cancer vaccine is a patient-specific vaccine (e.g. the vaccine comprises a patient's own tumor cells).
- a cancer vaccine comprises Prostate Specific Antigen (PSA).
- a cancer vaccine comprises sialyl Tn (STn).
- a cancer vaccine comprises Heat Shock Proteins (HSPs) (e.g., gp96).
- HSPs Heat Shock Proteins
- a cancer vaccine comprises ganglioside molecules (e.g., GM2, GD2, and GD3).
- a cancer vaccine comprises carcinoembryonic antigen (CEA).
- CEA carcinoembryonic antigen
- a cancer vaccine comprises MART-I (also known as Melan-A).
- a cancer vaccine comprises tyrosinase.
- the vaccine is a DNA vaccine. [00151]
- the antigenic moiety is a toxoid, a peptide, a nucleic acid sequence, a polysaccharide, or a combination thereof.
- the antigenic moiety is derived from a pathogen selected from: hepatitis A; hepatitis B; polio; measles; mumps; rubella; diphtheria; pertussis; tetanus; influenza; varicella zoster virus; rotavirus; meningococcal; pneumonia; smallpox; cholera; bubonic plague; yellow fever; tuberculosis; human papillomavirus; or combinations thereof.
- the antigenic moiety is derived a neoplastic cell. In some embodiments, the antigenic moiety is a nucleic acid or a polymer of nucleic acids. [00152] In certain instances, up-regulating an immune response in an individual receiving vaccination against an antigen results in an increase in the viability and thus concentration of memory T-cells against that antigen. In certain instances, up-regulating an immune response in an individual receiving vaccination against an antigen results in accelerated activation of the T-cell by the antigen. In certain instances, up-regulating an immune response in an individual receiving vaccination against an antigen results in a decrease in T-cells tolerant of the antigen.
- the viability of a lymphocyte administered the agent is more than 1 to about 25 times less than the viability of a lymphocyte that has not been administered the agent.
- the agent causes the down-regulation of a MYC gene in a lymphocyte.
- the modulation occurs in vivo.
- the lymphocyte is a T-cell.
- the T-cell is a memory T-cell.
- the down -regulation of a MYC gene results in a decreased life-span for the T-cell.
- the decreased life span of a memory T-cell results in a lower concentration of memory T-cells in a body.
- the lower concentration of memory T-cells results in a decelerated primary immune response to antigen, treatment of an autoimmune disorder, and/or immunosuppression.
- the down- regulation of a MYC gene results in an increase in anergic T-cells.
- the increase in anergic T-cells results in a decelerated primary immune response to antigen, treatment of an autoimmune disorder, and/or immunosuppression.
- the down-regulation of a MYC gene results in an increase in the time it takes a T-cell to activate in response to an antigen.
- the increase in the time it takes a T-cell to activate in response to an antigen results in a decelerated primary immune response to antigen, treatment of an autoimmune disorder, and/or immunosuppression.
- the agent is administered to an individual with an autoimmune disorder.
- the autoimmune disorder is Castleman's Disease, lupus, multiple sclerosis, scleroderma pigmentosa, Autoimmune Lymphoproliferative Syndrome (ALPS), myesthenia gravis, diabetes, asthma, rheumatoid arthritis, vitiligo, diGeorge's syndrome, Grave's disease, Crohn's disease, inflammatory bowel disease, colitis, orchitis, scleroderma pigmentosa, uveitis, Post-Transplant Lymphoproliferative Disease (PTLD), or Autoimmune Disease-Associated Lymphadenopathy (ADAL).
- PTLD Post-Transplant Lymphoproliferative Disease
- ADAL Autoimmune Disease-Associated Lymphadenopathy
- the agent is administered to an individual that has received an organ transplant, or a bone marrow transplant.
- down-regulating an immune response in an individual that has received an organ or bone marrow transplant ameliorates and/or prevents an immune response against the transplanted organ or bone marrow by the subject's immune system.
- compositions that modulate the immune system in an individual in need thereof, wherein the composition comprises a therapeutically-effective amount of an agent identified by any of the methods disclosed herein.
- the agent is a small molecule.
- the agent is RNAi.
- the agent is a biological molecule (e.g., a peptide, a fusion peptide).
- the agent is a fusion peptide disclosed herein.
- the agent is a fusion peptide comprising (a) a transporter peptide sequence; and (b) a MYC sequence.
- the agent is a fusion peptide of Formula (I): transporter peptide sequence -MYC sequence.
- the agent is identified as an agent that modulates the viability of a cell based on the agent's ability to reverse anergy in a B-cell. In some embodiments, the agent is identified as an agent that that modulates the viability of a cell based on the agent's ability to modulate the viability of factor- dependent cells. In some embodiments, the agent is identified as an agent that modulates the viability of a cell based on the agent's ability to induce expression of a reporter gene.
- the modulation of the immune response comprises the modulation of the viability of a lymphocyte.
- the lymphocyte is a T-cell.
- the T- cell is a CD4+ T-cell.
- the T-cell is a memory T-cell.
- the viability of a lymphocyte following contact with the agent is more than 1 to about 10 times greater than the viability of a lymphocyte that has not been contacted the agent.
- the agent causes the up-regulation of a MYC gene in a lymphocyte.
- the modulation occurs in vivo.
- the lymphocyte is a T-cell.
- the T- cell is a memory T-cell.
- the up-regulation of a MYC gene results in an extended life-span for the T-cell.
- the extended life span of a memory T-cell results in a higher concentration of memory T-cells in a body.
- the higher concentration of memory T-cells results in an accelerated primary immune response to antigen.
- the up-regulation of a MYC gene results in a decrease in anergic T-cells. In certain instances, the decrease in anergic T-cells results in an accelerated primary immune response to antigen. In certain instances, the up-regulation of a MYC gene results in a decrease in the time it takes a T-cell to activate in response to an antigen. In certain instances, the decrease in the time it takes a T-cell to activate in response to an antigen results in an accelerated primary immune response to antigen. [00160] In some embodiments, the agent is administered before, during, or after administration of a vaccine to an individual.
- the agent stimulates the immune system and increases the response of the immune system to a vaccine. In some embodiments, the agent augments an immune response. In some embodiments, the agent acts synergistically with the vaccine. In some embodiments, the agent is a vaccine adjuvant. [00161] In some embodiments, a vaccine comprises dead microorganisms, attenuated microorganisms, toxoids, subunits of the pathogen, nucleic acids, or combinations thereof.
- the vaccine is a vaccine for hepatitis A; hepatitis B; polio; measles; mumps; rubella; diphtheria; pertussis; tetanus; influenza; varicella zoster virus; rotavirus; influenza; meningococcal disease; pneumonia; smallpox; cholera; bubonic plague; yellow fever; tuberculosis: human paplomavirus; or combinations thereof.
- the vaccine is a vaccine for a cancer (e.g.
- a cancer vaccine is a patient-specific vaccine (e.g. the vaccine comprises a patient's own tumor cells).
- a cancer vaccine comprises Prostate Specific Antigen (PSA).
- PSA Prostate Specific Antigen
- a cancer vaccine comprises sialyl Tn (STn).
- a cancer vaccine comprises Heat Shock Proteins (HSPs) (e.g., gp96).
- HSPs Heat Shock Proteins
- a cancer vaccine comprises ganglioside molecules (e.g., GM2, GD2, and GD3).
- a cancer vaccine comprises carcinoembryonic antigen (CEA).
- a cancer vaccine comprises MART-I (also known as Melan-A).
- a cancer vaccine comprises tyrosinase.
- the vaccine is a DNA vaccine.
- the antigenic moiety is a toxoid, a peptide, a nucleic acid sequence, a polysaccharide, or a combination thereof.
- the antigenic moiety is derived from a pathogen selected from: hepatitis A; hepatitis B; polio; measles; mumps; rubella; diphtheria; pertussis; tetanus; influenza; varicella zoster virus; rotavirus; meningococcal; pneumonia; smallpox; cholera; bubonic plague; yellow fever; tuberculosis; human papillomavirus; or combinations thereof.
- the antigenic moiety is derived a neoplastic cell.
- the antigenic moiety is a nucleic acid or a polymer of nucleic acids.
- up-regulating an immune response in an individual receiving vaccination against an antigen results in an increase in the viability and thus concentration of memory T-cells against that antigen. In certain instances, up-regulating an immune response in an individual receiving vaccination against an antigen results in accelerated activation of the T-cell by the antigen. In certain instances, up-regulating an immune response in an individual receiving vaccination against an antigen results in a decrease in T-cells tolerant of the antigen.
- the viability of a lymphocyte administered the agent is more than 1 to about 25 times less than the viability of a lymphocyte that has not been administered the agent.
- the agent causes the down-regulation of a MYC gene in a lymphocyte.
- the modulation occurs in vivo.
- the lymphocyte is a T-cell.
- the T-cell is a memory T-cell.
- the down -regulation of a MYC gene results in a decreased life-span for the T-cell.
- the decreased life span of a memory T-cell results in a lower concentration of memory T-cells in a body.
- the lower concentration of memory T-cells results in a decelerated primary immune response to antigen, treatment of an autoimmune disorder, and/or immunosuppression.
- the down- regulation of a MYC gene results in an increase in anergic T-cells.
- the increase in anergic T-cells results in a decelerated primary immune response to antigen, treatment of an autoimmune disorder, and/or immunosuppression.
- the down-regulation of a MYC gene results in an increase in the time it takes a T-cell to activate in response to an antigen.
- the increase in the time it takes a T-cell to activate in response to an antigen results in a decelerated primary immune response to antigen, treatment of an autoimmune disorder, and/or immunosuppression.
- the agent is administered to an individual with an autoimmune disorder.
- the autoimmune disorder is Castleman's Disease, lupus, multiple sclerosis, scleroderma pigmentosa, Autoimmune Lymphoproliferative Syndrome (ALPS), myesthenia gravis, diabetes, asthma, rheumatoid arthritis, vitiligo, diGeorge's syndrome, Grave's disease, Crohn's disease, inflammatory bowel disease, colitis, orchitis, scleroderma pigmentosa, uveitis, Post-Transplant Lymphoproliferative Disease (PTLD), or Autoimmune Disease-Associated Lymphadenopathy (ADAL).
- APS Autoimmune Lymphoproliferative Syndrome
- down-regulating an immune response in an individual with an autoimmune disorder ameliorates and/or prevents an immune response against self antigens by the subject's immune system.
- the agent is administered to an individual that has received an organ transplant, or a bone marrow transplant.
- down-regulating an immune response in an individual that has received an organ or bone marrow transplant ameliorates and/or prevents an immune response against the transplanted organ or bone marrow by the subject's immune system.
- compositions are formulated in a conventional manner using one or more physiologically acceptable carriers including, e.g., excipients and auxiliaries which facilitate processing of the active compounds into preparations which are suitable for pharmaceutical use.
- physiologically acceptable carriers including, e.g., excipients and auxiliaries which facilitate processing of the active compounds into preparations which are suitable for pharmaceutical use.
- proper formulation is dependent upon the route of administration chosen.
- a pharmaceutical composition refers to a mixture of a compound described herein, with other chemical components, such as carriers, stabilizers, diluents, dispersing agents, suspending agents, thickening agents, and/or excipients. In certain instances, the pharmaceutical composition facilitates administration of the compound to an individual or cell.
- therapeutically effective amounts of compounds described herein are administered in a pharmaceutical composition to an individual having a disorder, disease, or condition to be treated.
- the individual is a human.
- the therapeutic compounds described herein are either utilized singly or in combination with one or more additional therapeutic agents.
- the pharmaceutical formulations described herein are administered to an individual in any manner, including one or more of multiple administration routes, such as, by way of non- limiting example, oral, parenteral (e.g., intravenous, subcutaneous, intramuscular), intranasal, buccal, topical, rectal, or transdermal administration routes.
- the pharmaceutical formulations described herein include, but are not limited to, aqueous liquid dispersions, self-emulsifying dispersions, solid solutions, liposomal dispersions, aerosols, solid dosage forms, powders, immediate release formulations, controlled release formulations, fast melt formulations, tablets, capsules, pills, delayed release formulations, extended release formulations, pulsatile release formulations, multiparticulate formulations, and mixed immediate and controlled release formulations.
- compositions including a compound described herein are optionally manufactured in a conventional manner, such as, by way of example only, by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or compression processes.
- a pharmaceutical compositions described herein includes one or more agents described herein, as an active ingredient in free-acid or free-base form, or in a pharmaceutically acceptable salt form.
- the compounds described herein are utilized as an N-oxide or in a crystalline or amorphous form (i.e., a polymorph).
- an active metabolite or prodrug of a compound described herein is utilized.
- a compound described herein exists as tautomers. All tautomers are included within the scope of the compounds presented herein.
- a compound described herein exists in an unsolvated or solvated form, wherein solvated forms comorise anv pharmaceutically acceptable solvent, e.g., water, ethanol, and the like. The solvated forms of the compounds presented herein are also considered to be disclosed herein.
- a “carrier” includes, in some embodiments, a pharmaceutically acceptable excipient and is selected on the basis of compatibility with compounds disclosed herein, such as, compounds of any of Formulas I-V, and the release profile properties of the desired dosage form.
- exemplary carrier materials include, e.g., binders, suspending agents, disintegration agents, filling agents, surfactants, solubilizers, stabilizers, lubricants, wetting agents, diluents, and the like.
- compositions described herein are formulated as a dosage form.
- a dosage form comprising a compound described herein, e.g., a compound of any of Formulas I-V, suitable for administration to an individual.
- suitable dosage forms include, by way of non- limiting example, aqueous oral dispersions, liquids, gels, syrups, elixirs, slurries, suspensions, solid oral dosage forms, aerosols, controlled release formulations, fast melt formulations, effervescent formulations, lyophilized formulations, tablets, powders, pills, dragees, capsules, delayed release formulations, extended release formulations, pulsatile release formulations, multiparticulate formulations, and mixed immediate release and controlled release formulations.
- the pharmaceutical solid dosage forms described herein optionally include an additional therapeutic compound described herein and one or more pharmaceutically acceptable additives such as a compatible carrier, binder, filling agent, suspending agent, flavoring agent, sweetening agent, disintegrating agent, dispersing agent, surfactant, lubricant, colorant, diluent, solubilizer, moistening agent, plasticizer, stabilizer, penetration enhancer, wetting agent, anti- foaming agent, antioxidant, preservative, or one or more combination thereof.
- a compatible carrier such as those described in Remington's Pharmaceutical Sciences, 20th Edition (2000), a film coating is provided around the formulation of the compound of any of Formula I-V.
- a compound described herein is in the form of a particle and some or all of the particles of the compound are coated. In certain embodiments, some or all of the particles of a compound described herein are microencapsulated. In some embodiment, the particles of the compound described herein are not microencapsulated and are uncoated.
- the pharmaceutical composition described herein is in unit dosage forms suitable for single administration of precise dosages.
- the formulation is divided into unit doses containing appropriate quantities of one or more compound.
- the unit dosage is in the form of a package containing discrete quantities of the formulation.
- Non- limiting examples are packaged tablets or capsules, and powders in vials or ampoules.
- Aqueous suspension comoositions are optionally packaged in single-dose non-reclosable containers.
- multiple-dose re- closeable containers are used.
- multiple dose containers comprise a preservative in the composition.
- formulations for parenteral injection are presented in unit dosage form, which include, but are not limited to ampoules, or in multi-dose containers, with an added preservative.
- the agents and compositions described herein are administered before, during, or after administration of a vaccine.
- the agents and compositions described herein are incorporated into a vaccine.
- the agents and compositions stimulate the immune system and increase the response of the immune system to a vaccine.
- the agents and compositions augment an immune response.
- the agents and compositions act synergistically with the vaccine.
- the agents and compositions are vaccine adjuvants.
- the vaccine formulation comprises an antigen or antigenic moiety (e.g. a protein or polysaccharide from B. pertussis, C. tetani, E. coli, C. diphtheriae, P. Aeruginosa, V. cholerae, H. influenzae, N. meningitidis, S. pneumoniae, N. gonorrhea) and the agent.
- the vaccine further comprises a carrier (e.g. water, saline, PBS), a preservative (e.g. thimerosal, 2-phenoxy ethanol, phenol, benzethonium chloride), a stabilizer (e.g. lactose, monosodium glutamate), an antibiotic, an antioxidant, a pH controlling agent, or combinations thereof.
- a carrier e.g. water, saline, PBS
- a preservative e.g. thimerosal, 2-phenoxy ethanol, phenol, benzethonium chloride
- a MYC fusion polypeptide disclosed herein is administered topically (i.e., the polypeptide is administered to the surface of the skin).
- a MYC fusion polypeptide disclosed herein is administered topically at the site of a vaccine injection.
- a localized antigen depot i.e., a tissue depot formed by vaccine adjuvants (e.g., water- in-oil emulsions, or aluminum salts) that results in the slow and even release of an antigen
- vaccine adjuvants e.g., water- in-oil emulsions, or aluminum salts
- Any suitable formulation is utilized.
- the MYC fusion polypeptide is formulated as a solution, a cream, a lotion, a gel, an ointment, a foam, a microemulsion, or a combination thereof.
- the MYC fusion polypeptide is formulated for delivery via a transdermal patch.
- the MYC fusion polypeptide is formulated for chemical delivery (i.e., a chemical substance (e.g., PEG, ethanol, glycerol monolaurate, sodium dodecyl sulfate, phosphatidyl choline, or urea) is used to facilitate penetration of an active agent across the skin).
- the MYC fusion polypeptide is formulated for delivery via electroporation (i.e., the permeablization of a barrier (e.g., the skin) via application of an electric current).
- the MYC fusion polypeptide is formulated for delivery via sonophoresis (i.e., the permeablization of a barrier (e.g., the skin) via application of ultrasound).
- Creams and Lotions i.e., the permeablization of a barrier (e.g., the skin) via application of ultrasound.
- a MYC fusion polypeptide disclosed herein is formulated as a cream.
- creams are semisolid (e.g., soft solid or thick liquid) formulations that include a MYC fusion polypeptide disclosed herein (e.g., TAT-MYC) dispersed in an oil-in- water emulsion or a water-in-oil emulsion.
- a MYC fusion polypeptide disclosed herein is formulated as a lotion.
- lotions are fluid emulsions (e.g., oil-in- water emulsions or a water-in-oil emulsions).
- the hydrophobic component of a lotion and/or cream is derived from an animal (e.g., lanolin, cod liver oil, and ambergris), plant (e.g., safflower oil, castor oil, coconut oil, cottonseed oil, menhaden oil, palm kernel oil, palm oil, peanut oil, soybean oil, rapeseed oil, linseed oil, rice bran oil, pine oil, sesame oil, or sunflower seed oil), petroleum (e.g., mineral oil, or petroleum jelly), or a combination thereof.
- animal e.g., lanolin, cod liver oil, and ambergris
- plant e.g., safflower oil, castor oil, coconut oil, cottonseed oil, menhaden oil, palm kernel oil, palm oil, peanut oil, soybean oil, rapeseed oil, linseed oil, rice bran oil, pine oil, sesame oil, or sunflower seed oil
- petroleum e.g., mineral oil, or petroleum jelly
- a MYC fusion polypeptide disclosed herein is formulated as an ointment.
- ointments are semisolid preparations that soften or melt at body temperature. Pastes
- a MYC fusion polypeptide disclosed herein is formulated as a paste. In certain instances, pastes contain at least 20% solids. In certain instances, pastes are ointments that do not flow at body temperature.
- Gels [00185] In some embodiments, a MYC fusion polypeptide disclosed herein (e.g., TAT-MYC) is formulated as a gel. In certain instances, gels are semisolid (or semi-rigid) systems consisting of dispersions of large organic molecules dispersed in a liquid. In certain instances, gels are water-soluble and are removed using warm water or saline.
- a MYC fusion polypeptide disclosed herein is formulated as a stick.
- sticks are solid dosage forms that melt at body temperature.
- a stick comprises a wax, a polymer, a resin, dry solids fused into a firm mass, and/or fused crystals.
- a topical formulation of a MYC fusion polypeptide disclosed herein is in the form of a styptic pencil (i.e., a stick prepared by (1) heating crystals until they lose their water of crystallization and become molten, and (2) pouring the molten crystals into molds and allowing them to harden).
- a topical formulation of a MYC fusion polypeptide disclosed herein is in the form of stick wherein the stick comprises a wax (e.g., the wax is melted and poured into appropriate molds in which they solidify in stick form).
- a topical formulation of a MYC fusion polypeptide disclosed herein is in the form of stick wherein the stick comprises a melting base (i.e., a base that softens at body temperature).
- melting bases include, but are not limited to, waxes, oils, polymers and gels.
- a topical formulation of a MYC fusion polypeptide disclosed herein is in the form of stick wherein the stick comprises a moisten base (i.e., a base that is activated by the addition of moisture).
- a MYC fusion polypeptide disclosed herein (e.g., TAT-MYC) is formulated for administration via a patch.
- a topical formulation disclosed herein is dissolved and/or dispersed in a polymer or an adhesive.
- a patch disclosed herein is constructed for continuous, pulsatile, or on demand delivery of a MYC fusion polypeptide disclosed herein (e.g., TAT- MYC).
- a MYC fusion polypeptide disclosed herein is formulated for administration via a wound dressing.
- Wound dressings include, but are not limited to gauzes, transparent film dressings, hydrogels, polyurethane foam dressings, hydrocolloids and alginates. Dermatological Excipients [00190]
- a MYC fusion polypeptide disclosed herein is formulated with a penetration enhancer.
- Penetration enhancers include, but are not limited to, sodium lauryl sulfate, sodium laurate, polyoxyethylene-20-cetyl ether, laureth-9, sodium dodecylsulfate, dioctyl sodium sulfosuccinate, polyoxyethylene-9-lauryl ether (PLE), Tween 80, nonylphenoxypolyethylene (NP-POE), polysorbates, sodium glycocholate, sodium deoxycholate, sodium taurocholate, sodium taurodihydrofusidate, sodium glycodihydrofusidate, oleic acid, caprylic acid, mono- and di-glycerides, lauric acids, acylcholines, caprylic acids, acylcarnitines, sodium caprates, EDTA, citric acid, salicylates, DMSO, decylmethyl sulfoxide, ethanol, isopropanol, propylene glycol, polyethylene glycol, glycerol, propanedio
- a MYC fusion polypeptide disclosed herein is formulated with a gelling (or thickening) agent.
- a topical formulation disclosed herein further comprises from about 0.1% to about 5%, more preferably from about 0.1% to about 3%, and most preferably from about 0.25% to about 2%, of a gelling agent.
- the viscosity of a topical formulation disclosed herein is in the range from about 100 to about 500,000 cP, about 100 cP to about 1,000 cP, about 500 cP to about 1500 cP, about 1000 cP to about 3000 cP, about 2000 cP to about 8,000 cP, about 4,000 cP to about 10,000 cP, about 10,000 cP to about 50,000 cP.
- Suitable gelling agents for use in preparation of the gel topical formulation include, but are not limited to, celluloses, cellulose derivatives, cellulose ethers (e.g., carboxymethylcellulose, ethylcellulose, hydroxyethylcellulose, hydroxymethylcellulose, hydroxypropylmethylcellulose, hydroxypropylcellulose, methylcellulose), guar gum, xanthan gum, locust bean gum, alginates (e.g., alginic acid), silicates, starch, tragacanth, carboxyvinyl polymers, carrageenan, paraffin, petrolatum, acacia (gum arabic), agar, aluminum magnesium silicate, sodium alginate, sodium stearate, bladderwrack, bentonite, carbomer, carrageenan, carbopol, xanthan, cellulose, microcrystalline cellulose (MCC), ceratonia, chondrus, dextrose, furcellaran, gelatin, ghatti gum, gu
- PEG 200- 4500 gum tragacanth, ethyl cellulose, ethylhydroxyethyl cellulose, ethylmethyl cellulose, methyl cellulose, hydroxyethyl cellulose, hydroxyethylmethyl cellulose, hydroxypropyl cellulose, poly(hydroxyethyl methacrylate), oxypolygelatin, pectin, polygeline, povidone, propylene carbonate, methyl vinyl ether/maleic anhydride copolymer (PVM/MA), poly(methoxyethyl methacrylate), poly(methoxyethoxyethyl methacrylate), hydroxypropyl cellulose, hydroxypropylmethyl-cellulose (HPMC), sodium carboxymethyl- cellulose (CMC), silicon dioxide, polyvinylpyrrolidone (PVP: povidone), or combinations thereof.
- PVM/MA methyl vinyl ether/maleic anhydride copolymer
- HPMC sodium carboxymethyl- cellulose
- a MYC fusion polypeptide disclosed herein is formulated with an emollient.
- Emollients include, but are not limited to, castor oil esters, cocoa butter esters, safflower oil esters, cottonseed oil esters, corn oil esters, olive oil esters, cod liver oil esters, almond oil esters, avocado oil esters, palm oil esters, sesame oil esters, squalene esters, kikui oil esters, soybean oil esters, acetylated monoglycerides, ethoxylated glyceryl monostearate, hexyl laurate, isohexyl laurate, isohexyl palmitate, isopropyl palmitate, methyl palmitate, decyloleate, isodecyl oleate, hexadecyl stearate decyl stearate, is
- the benefit experienced by a patient is increased by administering one of the compounds described herein with another therapeutic agent (which also includes a therapeutic regimen) that also has therapeutic benefit.
- another therapeutic agent which also includes a therapeutic regimen
- the overall benefit experienced by the patient is. in some embodiments, additive of the two therapeutic agents or in other embodiments, the patient experiences a synergistic benefit.
- the particular choice of compounds depends upon the diagnosis of the attending physicians and their judgment of the condition of the patient and the appropriate treatment protocol.
- the compounds are optionally administered concurrently (e.g., simultaneously, essentially simultaneously or within the same treatment protocol) or sequentially, depending upon the nature of the disease, disorder, or condition, the condition of the patient, and the actual choice of compounds used.
- the determination of the order of administration, and the number of repetitions of administration of each therapeutic agent during a treatment protocol is based on an evaluation of the disorder being treated and the condition of the patient.
- therapeutically-effective dosages vary when the drugs are used in treatment combinations.
- Methods for experimentally determining therapeutically-effective dosages of drugs and other agents for use in combination treatment regimens are described in the literature. For example, the use of metronomic dosing, i.e., providing more frequent, lower doses in order to minimize toxic side effects, has been described extensively in the literature.
- Combination treatment further includes periodic treatments that start and stop at various times to assist with the clinical management of the patient.
- dosages of the co-administered compounds vary depending on the type of co-drug employed, on the specific drug employed, on the disorder or condition being treated and so forth.
- the compound provided herein is optionally administered either simultaneously with the biologically agent(s), or sequentially. In certain instances, if administered sequentially, the attending physician will decide on the appropriate sequence of therapeutic compound described herein in combination with the additional therapeutic agent.
- the multiple therapeutic agents are optionally administered in any order or even simultaneously.
- the multiple therapeutic agents are optionally provided in a single, unified form, or in multiple forms (by way of example only, either as a single pill or as two separate pills).
- one of the therapeutic agents is optionally given in multiple doses.
- both are optionally given as multiple doses.
- the timing between the multiple doses is any suitable timing, e.g., from more than zero weeks to less than four weeks.
- the additional therapeutic agent is utilized to achieve remission (partial or complete) of a cancer, whereupon the therapeutic agent described herein (e.g., a compound of any one of Formulas I-V) is subsequently administered.
- a dosage regimen to treat, prevent, or ameliorate the condition(s) for which relief is sought is modified in accordance with a variety of factors. These factors include the disorder from which the subject suffers, as well as the age, weight, sex, diet, and medical condition of the subject. Thus, in various embodiments, the dosage regimen actually employed varies and deviates from the dosage regimens set forth herein.
- the pharmaceutical agents which make up the combination therapy disclosed herein are provided in a combined dosage form or in separate dosage forms for substantially simultaneous administration.
- the pharmaceutical agents that make up the combination therapy are administered sequentially, with either therapeutic compound being administered by a regimen calling for two-step administration.
- two-step administration regimen calls for sequential administration of the agents or spaced-apart administration of the separate agents.
- the time period between the multiple administration steps varies, by way of non- limiting example, from a few minutes to several hours, depending upon the properties of each pharmaceutical agent, such as potency, solubility, bioavailability, plasma half- life and kinetic profile of the pharmaceutical agent.
- the compounds described herein also are optionally used in combination with procedures that provide additional or synergistic benefit to the patient.
- patients are expected to find therapeutic and/or prophylactic benefit in the methods described herein, wherein pharmaceutical composition of a compound disclosed herein and /or combinations with other therapeutics are combined with genetic testing to determine whether that individual is a carrier of a gene or gene mutation that is known to be correlated with certain disorders or conditions.
- prophylactic benefit is achieved by administering a therapeutic compound described herein to an individual whose proliferative disorder (e.g., cancer) is in remission (e.g., partial or complete).
- the compounds described herein and combination therapies are administered before, during or after the occurrence of a disorder or condition. Timing of administering the composition containing a compound is optionally varied to suit the needs of the individual treated.
- the compounds are used as a prophylactic and are administered continuously to subjects with a propensity to develop conditions or disorders in order to prevent the occurrence of the disorder or condition.
- the compounds and compositions are administered to an individual during or as soon as possible after the onset of the symptoms. The administration of the compounds is optionally initiated within the first 48 hours of the onset of the symptoms, within the first 6 hours of the onset of the symptoms, or within 3 hours of the onset of the symptoms.
- the initial administration is achieved by any route practical, such as, for example, an intravenous injection, a bolus injection, infusion over 5 minutes to about 5 hours, a pill, a capsule, transdermal patch, buccal delivery, and the like, or combination thereof.
- the compound should be administered as soon as is practicable after the onset of a disorder or condition is detected or suspected, and for a length of time necessary for the treatment of the disorder, such as, for example, from more than 1 month to about 3 months.
- the length of treatment is optionally varied for each subject based on known criteria.
- the compound or a formulation containing the compound is administered for at least 2 weeks, between more than 1 month to about 5 years, or from more than 1 month to about 3 years.
- therapeutic agents are combined with or utilized in combination with one or more of the following therapeutic agents in any combination: Akt selective inhibitors; PI3K inhibitors; polypeptide kinase C (PKC) inhibitors; farnesyltransferase inhibitors; inhibitors of sarco/endoplasmic reticulum Ca2+ ATPase; Ca ++ /calmodulin (CaM)-dependent polypeptide kinase inhibitors; cyclin-dependent kinase inhibitors; PPD (p-phenylenediamine); D609 (tricyclodecan-9-yl xanthogenate); PPl (4-Amino-5-(4- methylphenyl)-7-(t-butyl)pyrazolo[3,4-d]-pyrimidine); AG-879 (alpha-Cyano-(3,5-di-t-butyl-4- hydroxy)thiocinnamide); BAY 11-7082 ((
- Immunosuppressants include, by way of non-limiting example, Sirolimus (rapamycin), cyclosporin, FK506, cypermethrin, deltamethrin, fenvalerate, tyrphostin 8, methotrexate, piceatannol, genistein, tacrolimus, rapamicin, cyclophosphamide, azathioprine, mercaptopurine, mycophenolate, and FTY720.
- Sirolimus rapamycin
- FK506 cyclosporin
- FK506 cypermethrin
- deltamethrin fenvalerate
- tyrphostin 8 methotrexate
- piceatannol genistein
- tacrolimus tacrolimus
- rapamicin rapamicin
- cyclophosphamide azathioprine
- mercaptopurine mycophenolate
- FTY720 FTY720
- Akt selective inhibitors include, by way of non- limiting example, SH4 (lL-6-hydroxymethyl-chiro- inositol 2-R-2-O-methyl-3-O-octadecylcarbonate); SH-5 (D-3-deoxy-2-O-methyl-myo inositol l-(R)-2- methoxy-3-(octadecyloxy) propyl hydrogen phosphate); and SH-6 (D-2,3-dieoxy-myo inositol l-(R)-2- methoxy-3-(octadecyloxy) propyl hydrogen phosphate).
- PI3K inhibitors include, by way of non- limiting example, wortmannin; LY294002 (2-(4- morpholinyl)-8-phenyl-4H-l-benzopyran-4-one); DOOO (Upstate, Milton Keynes, United Kingdom); and D121 (3-phenyl-2-(9H-purin-6-ylsulfanylmethyl)-3H-quinazolin-4-one).
- protein kinase C (PKC) inhibitors include Ro-318220 (3-[l-[3- (amidinothio)propyl]-lH-indoyl-3-yl]-3-(l-methyl-lH- indoyl-3-yl) maleimide methane sulfonate); G ⁇ 6976 (12-(2-cyanoethyl)-6,7,12,13-tetrahydro-13-methyl-5-oxo-5H-indolo(2,3-a)pyrrolo(3,4-c)-carbazole); staurosporin; rottlerin; calphastin C; GF 109203X (3-[l-(Dimethylammopropyl)indol-3-yl]-4-(indol-3- yl)maleimide hydrochloride); hypericin; sphingosine; miltefosine; palmi
- farmesyltransferase inhibitors include L-744,832 (C 2O H 45 N 3 O 6 S 2 2HC1); or Sarasar (SCH66336 or lonafarnib).
- Ca ++ /calmodulin (CaM)-dependent polypeptide kinase inhibitors include: 2-hydroxy-5-(2,5-dihydroxybenzylamino) benzoic acid; KN-62 (l-[N,O-bis(5-isoquinolinesulfonyl)- N-methyl-L- tyrosyl]-4- phenylpiperazine); KN-93 (2-[N-(2-hydroxyethyl)]-N-
- cyclin-dependent kinase inhibitors include: roscovitine (Seliciclib or CYC202); purvalanol A; or indirubin.
- an agent and/or composition described herein is used in the preparation of vaccines for immunization against pathogens (e.g. hepatitis A; hepatitis B; polio; measles; mumps; rubella; diphtheria; pertussis; tetanus; influenza; varicella zoster virus; rotavirus; influenza; meningococcal disease; pneumonia; smallpox; cholera; bubonic plague; yellow fever; tuberculosis: human paplomavirus) wherein an up-regulation of an immune response would be beneficial to said treatment.
- pathogens e.g. hepatitis A; hepatitis B; polio; measles; mumps; rubella; diphtheria; pertussis; tetanus; influenza; varicella zoster virus; rotavirus; influenza; meningococcal disease; pneumonia; smallpox; cholera; bubonic plague; yellow
- an agent described herein is a vaccine adjuvant.
- the volume of a vaccine formulation for injection is from about 50 ⁇ l to about 5ml. In some embodiments, the volume of a vaccine formulation for injection is from about 100 ⁇ l to about 3.5ml. In some embodiments, the volume of a vaccine formulation for injection is from about 200 ⁇ l to about 2ml. In some embodiments, the volume of a vaccine formulation for injection is from about 350 ⁇ l to about ImI. In some embodiments, the volume of a vaccine formulation for injection is about 500 ⁇ l. The volume of the vaccine is determined by the method of administration. In certain instances, the vaccine is administered as a subcutaneous or intradermal injection.
- the vaccine is administered as intramuscular injection. In some embodiments, the vaccine is administered as 1 dose. In some embodiments, the vaccine is administered in multiple doses (e.g. in booster shots).
- an agent and/or composition described herein is used in the preparation of medicaments for the prophylactic and/or therapeutic treatment of disorders that would benefit, at least in part, from a down-regulation of an immune response (e.g. autoimmune disorders, transplant rejection).
- an agent and/or composition described herein is used in a method of treating a disorder (e.g.
- an agent and/or composition described herein is used in a method of prophylactic and/or therapeutic treatment of a disorder that would benefit, at least in part, from a down-regulation of an immune response (e.g. autoimmune disorders, transplant rejection).
- a down-regulation of an immune response e.g. autoimmune disorders, transplant rejection.
- an agent or composition described herein is optionally administered chronically, that is, for an extended period of time, including throughout the duration of the patient's life in order to ameliorate or otherwise control or limit the symptoms of the patient's disorder.
- the administration of an agent or composition described herein is optionally given continuously; alternatively, the dose of drug being administered is temporarily reduced or temporarily suspended for a certain length of time (i.e., a "drug holiday").
- the length of the drug holiday optionally varies between 2 days and 1 year, including by way of example only, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 10 days, 12 days, 15 days. 20 davs. 28 davs. 35 days, 50 days, 70 days, 100 days, 120 days, 150 days, 180 days, 200 days, 250 days, 280 days, 300 days, 320 days, 350 days, or 365 days.
- the dose reduction during a drug holiday includes from 10%- 100%, including, by way of example only, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%.
- a maintenance dose is administered if necessary.
- the dosage or the frequency of administration, or both is reduced, as a function of the symptoms, to a level at which the improved disease, disorder or condition is retained.
- patients require intermittent treatment on a long-term basis upon any recurrence of symptoms.
- the agents or compositions described herein are in unit dosage forms suitable for single administration of precise dosages.
- the formulation is divided into unit doses containing appropriate quantities of an agent or composition described herein.
- the unit dosage is in the form of a package containing discrete quantities of the formulation.
- Non- limiting examples are packaged tablets or capsules, and powders in vials or ampoules.
- aqueous suspension compositions are packaged in single-dose non-reclosable containers. Alternatively, multiple-dose reclosable containers are used, in which case it is typical to include a preservative in the composition.
- formulations for parenteral injection are presented in unit dosage form, which include, but are not limited to ampoules, or in multi dose containers, with an added preservative.
- the daily dosages appropriate for an agent or composition described herein are from about 0.01 to 10.0 mg/kg per body weight. In some embodiments, the daily dosages appropriate for an agent or composition described herein are from about 0.05 to 7.5 mg/kg per body weight. In some embodiments, the daily dosages appropriate for an agent or composition described herein are from about 0.1 to 5.0 mg/kg per body weight. In some embodiments, the daily dosages appropriate for an agent or composition described herein are from about 0.25 to 2.5 mg/kg per body weight.
- the daily dosages appropriate for an agent or composition described herein are from about 0.5 to 1.0 mg/kg per body weight.
- An indicated daily dosage in the larger mammal, including, but not limited to, humans, is in the range from about 0.5 mg to about 100 mg, conveniently administered in divided doses, including, but not limited to, up to four times a day or in extended release form.
- Suitable unit dosage forms for oral administration include from more than 1 to 50 mg active ingredient. The foregoing ranges are merely suggestive, as the number of variables in regard to an individual treatment regime is large, and considerable excursions from these recommended values are not uncommon.
- Such dosages are optionally altered depending on a number of variables, not limited to the activity of the agent or composition described herein used, the disorder or condition to be treated, the mode of administration, the requirements of the individual subject, the severity of the disorder or condition being treated, and the judgment of the practitioner.
- Toxicity and therapeutic efficacy of such therapeutic regimens are optionally determined in cell cultures or experimental animals, including, but not limited to, the determination of the LD50 (the dose lethal to 50% of the population) and the ED50 (the dose therapeutically effective in 50% of the DODulation " ).
- the dose ratio between the toxic and therapeutic effects is the therapeutic index, which is expressed as the ratio between LD50 and ED50.
- An agent or compositions described herein exhibiting high therapeutic indices is preferred.
- the data obtained from cell culture assays and animal studies are optionally used in formulating a range of dosage for use in human.
- the dosage of such an agent or composition described herein lies preferably within a range of circulating concentrations that include the ED50 with minimal toxicity.
- the dosage optionally varies within this range depending upon the dosage form employed and the route of administration utilized.
- a plurality of cells are transformed with a reporter construct.
- the reporter construct has FLuc under control of an ODC promoter.
- the cells are divided into 96 aliquots using a standard 96-well plate. Each well is administered a different small molecule. The small molecule is incubated with the cells for 6 hours. The level of expression of the luciferase is determined using fluorescent microscopy. Agents which induce the expression of the luciferase gene are validated in vitro.
- Plasmid pTAT-Myc-V5-6xHis was made by PCR amplification of the coding regions for human MYC using a forward primer that contains an in frame N-terminal 9-amino-acid sequence of the TAT protein transduction domain of HIV-I (RKKRRQRRR), and a reverse primer that removed the stop codon.
- the PCR product was then cloned into pET101/D-Topo (Invitrogen) vector, which includes a C-terminal V5 epitope and 6x-histidine purification tag.
- BL-21 RARE cells were created by transforming BL-21 StarTM E. coli strain (Invitrogen) with pRARE (CamR), isolated from BL21 Rosetta cells (Novagen), that express tRNAs for AGG, AGA, AUA,
- pTAT-Myc-V5-6xHis was transformed into BL21 RARE cells and grown on TB/Amp/Cam plate at 37°C overnight. An isolated colony was used to inoculate a 5ml TB/Amp/Cam starter culture and grown at 37°C overnight. 1 liter of TB/Amp/Cam broth was inoculated with the 5ml starter culture and grown to an OD600 of 0.5, and induced with 0.5mM IPTG at 37°C for 3 hrs.
- Bacterial cells were pelleted by centrifugation and the cell pellet was resuspended in lysis buffer (8 M urea, 10OmM NaH 2 POz I , 1OmM Tris pH to 8.0) and lysed at room temperature overnight on a shaker. The lysate was cleared by centrifugation at 29,000 x g for 30 min and the supernatant was applied to a nickel nitrilotriacetate affinity column (Qiagen) using gravity flow. The column was washed with 25 volumes of lysis buffer containing 1OmM imidazole followed by elution with lysis buffer containing 10OmM imidazole.
- lysis buffer 8 M urea, 10OmM NaH 2 POz I , 1OmM Tris pH to 8.0
- Protein was concentrated using an Amicon Ultra centrifugal filter device (10,000 MWCO) and dialyzed in a stepwise fashion into dialysis buffer (5OmM NaH 2 PO 4 , 5mM Tris pH 7.0, 45OmM NaCl, 5% glycerol, ImM DTT).
- dialysis buffer 5OmM NaH 2 PO 4 , 5mM Tris pH 7.0, 45OmM NaCl, 5% glycerol, ImM DTT.
- the dialysis went as follows: 2 hours in dialysis buffer containing 4M urea, 2 hours in buffer with 2M urea, then 2 hrs in dialysis buffer alone.
- Protein concentration was measured by Bradford protein assay (Sigma) compared to a standard curve of bovine serum albumin.
- the TAT-MYC fusion peptide is evaluated in vitro as a regulator of an immune response.
- a primary T-cell activation culture is incubated with the TAT-MYC fusion peptide for 72 hours.
- the culture is then stained with CFSE.
- the culture is analyzed by FACS.
- the TAT-MYC fusion peptide is evaluated in vivo as a regulator of an immune response.
- a mouse is immunized against NP-KHL by administering NP-KHL to the mouse.
- the TAT-MYC fusion peptide is administered to the mouse.
- Twenty- four hours after the immunization serum is taken from the mouse. The serum is analyzed for antibodies.
- the TAT- MYC fusion peptide is administered concurrently with immunization, or preceding immunization.
- Example 5 Effect of IM TAT-MYC as a Vaccine Adjuvant
- This will be a double-blind, randomized, placebo-controlled study. It is designed to assess immunological memory following administration of an influenza vaccine and a TAT-MYC fusion peptide.
- Group I will be administered an influenza vaccine and saline.
- Group II will be administered an influenza vaccine and the TAT-MYC fusion peptide.
- Group I will be administered an influenza vaccine and saline.
- Group II will be administered an influenza vaccine and the TAT-MYC fusion peptide.
- Subjects are monitored for 2 hours for negative side-effects. [00244] All individuals in Group I not exhibiting negative side-effects are given one application of the placebo lotion. Individuals are instructed to apply the lotion onto the skin at the site of the vaccination.
- MYC lotion Individuals are instructed to apply the lotion onto the skin at the site of the vaccination.
- T-cell counts are determined and recorded.
- All individuals are challenged with antigens from relevant influenza strains. Blood is drawn for all individuals 1 hour after challenge, 6 hours after challenge, 12 hours after challenge, and 24 hours after challenge. T-cell levels are determined.
- Agent X an agent that dereases the expression of MYC as identified by a method disclosed herein (hereinafter, "Agent X") following weekly subcutaneous dosing in subjects with active rheumatoid arthritis (RA).
- Agent X or placebo On Day 1, subjects will receive a single IV infusion (loading dose) of Agent X or placebo, based on their weight range. Agent X or placebo will be administered intravenously over - 30 minutes using a calibrated, constant-rate infusion pump prior to starting subcutaneous treatment. Approximately 1 hour after the completion of the IV infusion, subjects will receive their assigned subcutaneous dose of Agent X or placebo drawn from a vial or using a pre-filled syringe. Agent X or placebo will be administered by clinical study site staff weekly by the subcutaneous route, at the same dose as the subcutaneous dose on Day 1 for a total of 12 subcutaneous injections. [00253] Subjects will be monitored for adverse events (AEs) throughout the duration of the study.
- AEs adverse events
- Subjects who complete the 12 weeks of subcutaneous dosing of Agent X or placebo are eligible to enter into a long term extension (LTE).
- LTE long term extension
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Public Health (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Virology (AREA)
- Immunology (AREA)
- Communicable Diseases (AREA)
- Molecular Biology (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Rheumatology (AREA)
- Pulmonology (AREA)
- Epidemiology (AREA)
- Mycology (AREA)
- Microbiology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Pain & Pain Management (AREA)
- Physical Education & Sports Medicine (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Biotechnology (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Priority Applications (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| EP09810692.5A EP2318435B1 (en) | 2008-08-28 | 2009-08-28 | Modulators of myc, methods of using the same, and methods of identifying agents that modulate myc |
| ES09810692.5T ES2561599T3 (es) | 2008-08-28 | 2009-08-28 | Moduladores de MYC, métodos de uso de los mismos, y métodos para identificar agentes que modulan MYC |
| HK11111441.9A HK1159643B (en) | 2008-08-28 | 2009-08-28 | Modulators of myc, methods of using the same, and methods of identifying agents that modulate myc |
| CN200980127166.7A CN102089323B (zh) | 2008-08-28 | 2009-08-28 | Myc的调节剂、其使用方法和鉴别调节myc的试剂的方法 |
| AU2009285547A AU2009285547B2 (en) | 2008-08-28 | 2009-08-28 | Modulators of MYC, methods of using the same, and methods of identifying agents that modulate MYC |
| JP2011525258A JP5812861B2 (ja) | 2008-08-28 | 2009-08-28 | Mycの修飾物質、該mycの修飾物質を使用する方法、およびmycを調節する薬剤を同定する方法 |
| EP18154875.1A EP3339321B1 (en) | 2008-08-28 | 2009-08-28 | Modulators of myc, methods of using the same and methods of identifying agents that modulate myc |
| IL301475A IL301475B1 (en) | 2008-08-28 | 2009-08-28 | Laboratory methods for increasing the vitality of immune system cells |
| EP21170329.3A EP3916010A1 (en) | 2008-08-28 | 2009-08-28 | Modulators of myc, methods of using the same and methods of identifying agents that modulate myc |
| CA2735522A CA2735522C (en) | 2008-08-28 | 2009-08-28 | Modulators of myc, methods of using the same, and methods of identifying agents that modulate myc |
| DK09810692.5T DK2318435T3 (en) | 2008-08-28 | 2009-08-28 | Modulators of MYC, methods of using the same, and methods for identifying agents that modulate MYC |
| IL209968A IL209968A (en) | 2008-08-28 | 2010-12-13 | Active Immune System Contains Myc Defragmenter Protein with a Conjugating Peptide |
| IL232432A IL232432A (en) | 2008-08-28 | 2014-05-04 | Modulators of myc and uses thereof in modulating the viability of immune cells |
| IL249700A IL249700B (en) | 2008-08-28 | 2016-12-21 | In vitro methods for increasing viability of immune-cells |
| IL264254A IL264254B (en) | 2008-08-28 | 2019-01-15 | In vitro methods for increasing viability of immune-cells |
| IL276146A IL276146B2 (en) | 2008-08-28 | 2020-07-19 | Laboratory methods for increasing the vitality of the cells of the immune system |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US9270808P | 2008-08-28 | 2008-08-28 | |
| US61/092,708 | 2008-08-28 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2010025421A2 true WO2010025421A2 (en) | 2010-03-04 |
| WO2010025421A3 WO2010025421A3 (en) | 2010-08-19 |
Family
ID=41722332
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2009/055443 Ceased WO2010025421A2 (en) | 2008-08-28 | 2009-08-28 | Modulators of myc, methods of using the same, and methods of identifying agents that modulate myc |
Country Status (11)
| Country | Link |
|---|---|
| US (7) | US8784825B2 (https=) |
| EP (4) | EP2318435B1 (https=) |
| JP (5) | JP5812861B2 (https=) |
| CN (2) | CN102089323B (https=) |
| AU (1) | AU2009285547B2 (https=) |
| CA (1) | CA2735522C (https=) |
| DK (3) | DK3339321T3 (https=) |
| ES (3) | ES2879225T3 (https=) |
| IL (6) | IL301475B1 (https=) |
| SG (1) | SG193831A1 (https=) |
| WO (1) | WO2010025421A2 (https=) |
Cited By (13)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US8784825B2 (en) | 2008-08-28 | 2014-07-22 | Taiga Biotechnologies, Inc. | Modulators of MYC, methods of using the same, and methods of identifying agents that modulate MYC |
| US8883507B2 (en) | 2005-10-18 | 2014-11-11 | The Regents Of The University Of Colorado | Conditionally immortalized long-term hematopoietic stem cells and methods of making and using such cells |
| US8986702B2 (en) | 2008-05-16 | 2015-03-24 | Taiga Biotechnologies, Inc. | Antibodies and processes for preparing the same |
| US9169462B2 (en) | 2008-07-21 | 2015-10-27 | Taiga Biotechnologies, Inc. | Methods for preparing mature erythrocytes from conditionally immortalized hematopoietic stem cells |
| WO2016044416A1 (en) | 2014-09-16 | 2016-03-24 | Sangamo Biosciences, Inc. | Methods and compositions for nuclease-mediated genome engineering and correction in hematopoietic stem cells |
| US9365825B2 (en) | 2013-03-11 | 2016-06-14 | Taiga Biotechnologies, Inc. | Expansion of adult stem cells in vitro |
| US9789135B2 (en) | 2012-07-20 | 2017-10-17 | Taiga Biotechnologies, Inc. | Enhanced reconstitution and autoreconstitution of the hematopoietic compartment |
| US9816074B2 (en) | 2014-07-25 | 2017-11-14 | Sangamo Therapeutics, Inc. | Methods and compositions for modulating nuclease-mediated genome engineering in hematopoietic stem cells |
| US10272115B2 (en) | 2013-03-11 | 2019-04-30 | Taiga Biotechnologies, Inc. | Production and use of red blood cells |
| US10864259B2 (en) | 2017-08-03 | 2020-12-15 | Taiga Biotechnologies, Inc. | Methods and compositions for the treatment of melanoma |
| US11116796B2 (en) | 2016-12-02 | 2021-09-14 | Taiga Biotechnologies, Inc. | Nanoparticle formulations |
| EP3969041A4 (en) * | 2019-05-14 | 2023-05-10 | Taiga Biotechnologies, Inc. | COMPOSITIONS AND METHODS FOR TREATMENT OF T-CELL DEPLETION |
| US12250943B2 (en) | 2019-04-08 | 2025-03-18 | Htyr Acquisition Llc | Compositions and methods for the cryopreservation of immune cells |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2583551A1 (en) * | 2007-03-13 | 2013-04-24 | National Jewish Health | Methods for generation of antibodies |
| JP6163486B2 (ja) * | 2012-07-02 | 2017-07-12 | 大日本住友製薬株式会社 | 癌抗原ペプチド経皮剤 |
| EP2974734B1 (en) | 2013-03-12 | 2018-10-10 | Sumitomo Dainippon Pharma Co., Ltd. | Liquid aqueous composition |
| KR20200036874A (ko) * | 2017-08-03 | 2020-04-07 | 타이가 바이오테크놀로지스, 인코포레이티드 | 암 치료를 위한 방법 및 조성물 |
| ES2905757T3 (es) * | 2017-08-03 | 2022-04-12 | Taiga Biotechnologies Inc | Métodos y composiciones para el tratamiento del melanoma |
| JP7197538B2 (ja) * | 2020-07-03 | 2022-12-27 | タイガ バイオテクノロジーズ,インク. | メラノーマの処置のための方法および組成物 |
| CA3243416A1 (en) | 2022-01-28 | 2023-08-03 | Iovance Biotherapeutics, Inc. | TUMOR INFILTRATION LYMPHOCYTES MODIFIED TO EXPRESS PAYLOADS |
| WO2025101484A1 (en) | 2023-11-06 | 2025-05-15 | Iovance Biotherapeutics, Inc. | Treatment of endometrial cancers with tumor infiltrating lymphocyte therapies |
Family Cites Families (150)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| ZA811368B (en) | 1980-03-24 | 1982-04-28 | Genentech Inc | Bacterial polypedtide expression employing tryptophan promoter-operator |
| US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
| EP0207147A4 (en) | 1984-12-21 | 1988-07-14 | Techniclone Res Partners | METHOD OF ELECTRICAL IMMORTALIZATION OF LYMPHOID CELLS. |
| DE3531430A1 (de) | 1985-09-03 | 1987-03-05 | Biotest Pharma Gmbh | Verfahren zur gewinnung von komponenten aus einer fluessigkeit mit in raeumlich getrennten bereichen vorliegenden komponenten |
| US4963489A (en) | 1987-04-14 | 1990-10-16 | Marrow-Tech, Inc. | Three-dimensional cell and tissue culture system |
| US4900322A (en) | 1986-09-22 | 1990-02-13 | Adams James D | Blood component pooling valve and kit |
| US5476996A (en) | 1988-06-14 | 1995-12-19 | Lidak Pharmaceuticals | Human immune system in non-human animal |
| US5399493A (en) | 1989-06-15 | 1995-03-21 | The Regents Of The University Of Michigan | Methods and compositions for the optimization of human hematopoietic progenitor cell cultures |
| US5804604A (en) | 1989-12-21 | 1998-09-08 | Biogen, Inc. | Tat-derived transport polypeptides and fusion proteins |
| US5670617A (en) | 1989-12-21 | 1997-09-23 | Biogen Inc | Nucleic acid conjugates of tat-derived transport polypeptides |
| US5849288A (en) | 1990-01-15 | 1998-12-15 | Yeda Research And Development Co. Ltd. | Method for production of monoclonal antibodies in chimeric mice or rats having xenogeneic antibody-producing cells |
| US6255458B1 (en) | 1990-08-29 | 2001-07-03 | Genpharm International | High affinity human antibodies and human antibodies against digoxin |
| US5851828A (en) | 1991-03-07 | 1998-12-22 | The General Hospital Corporation | Targeted cytolysis of HIV-infected cells by chimeric CD4 receptor-bearing cells |
| US5912170A (en) | 1991-03-07 | 1999-06-15 | The General Hospital Corporation | Redirection of cellular immunity by protein-tyrosine kinase chimeras |
| US6004811A (en) | 1991-03-07 | 1999-12-21 | The Massachussetts General Hospital | Redirection of cellular immunity by protein tyrosine kinase chimeras |
| IE920716A1 (en) | 1991-03-07 | 1992-09-09 | Gen Hospital Corp | Redirection of cellular immunity by receptor chimeras |
| US6753162B1 (en) | 1991-03-07 | 2004-06-22 | The General Hospital Corporation | Targeted cytolysis of HIV-infected cells by chimeric CD4 receptor-bearing cells |
| US5843728A (en) | 1991-03-07 | 1998-12-01 | The General Hospital Corporation | Redirection of cellular immunity by receptor chimeras |
| AU781922B2 (en) | 1991-12-17 | 2005-06-23 | Genpharm International, Inc. | Transgenic non-human animals capable of producing heterologous antibodies |
| US5289858A (en) | 1991-12-18 | 1994-03-01 | Abbott Laboratories | System for accommodating withdrawal of liquid from a bulk supply |
| US8211422B2 (en) | 1992-03-18 | 2012-07-03 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Chimeric receptor genes and cells transformed therewith |
| ES2123062T3 (es) | 1992-08-21 | 1999-01-01 | Biogen Inc | Polipeptidos de transporte derivados de la proteina tat. |
| US5580760A (en) * | 1993-02-22 | 1996-12-03 | The United States Of America As Represented By The Department Of Health And Human Services | FUSE binding protein and cDNA therefor |
| JPH09500534A (ja) | 1993-07-22 | 1997-01-21 | メルク エンド カンパニー インコーポレーテッド | トランスジェニック動物でのヒトインターロイキン―1βの発現 |
| US5599705A (en) | 1993-11-16 | 1997-02-04 | Cameron; Robert B. | In vitro method for producing differentiated universally compatible mature human blood cells |
| CA2184356A1 (en) | 1994-03-03 | 1995-09-08 | Russell P. Rother | Terminal complement inhibitor fusion genes and proteins |
| US5827642A (en) | 1994-08-31 | 1998-10-27 | Fred Hutchinson Cancer Research Center | Rapid expansion method ("REM") for in vitro propagation of T lymphocytes |
| EP0923284A4 (en) | 1996-01-19 | 2003-03-26 | Allegheny University Of The He | CELLULAR IMMUNOGENES THAT ARE USEFUL AS A VACCINE AGAINST CANCER |
| US6713247B1 (en) | 1996-09-03 | 2004-03-30 | Signal Pharmaceuticials, Inc. | Human CNS cell lines and methods of use therefor |
| CN1263473A (zh) | 1997-05-21 | 2000-08-16 | 利兰·斯坦福青年大学托管委员会 | 增加跨生物膜转运的组合物和方法 |
| EP0893493A3 (de) | 1997-07-21 | 2002-12-04 | Aventis Pharma Deutschland GmbH | Genetisch veränderte Zellen und deren Verwendung in der Prophylaxe oder Therapie von Erkrankungen |
| CN1206044A (zh) | 1997-07-21 | 1999-01-27 | 德国赫彻斯特马里奥罗塞尔有限公司 | 遗传修饰的细胞和它们在预防或治疗疾病中的用途 |
| GB9720585D0 (en) | 1997-09-26 | 1997-11-26 | Smithkline Beecham Biolog | Vaccine |
| WO1999029721A1 (en) | 1997-12-10 | 1999-06-17 | Washington University | Anti-pathogen system and methods of use thereof |
| EP1070757B1 (en) | 1998-04-08 | 2005-02-02 | Shionogi & Co., Ltd. | Methods for isolating osteoclast precursor cells and inducing the differentiation of the same into osteoclasts |
| US6835567B1 (en) | 1998-04-14 | 2004-12-28 | Signal Pharmaceuticals, Inc. | PNS cell lines and methods of use therefor |
| US6451558B1 (en) | 1998-08-03 | 2002-09-17 | Novartis Ag | Genes in the control of hematopoiesis |
| US6913925B1 (en) | 1998-08-12 | 2005-07-05 | Signal Pharmaceuticals Llc | Human mesencephalon cell lines and methods of use therefor |
| AU7497000A (en) | 1999-02-28 | 2000-11-14 | Washington University | Novel transduction molecules and methods for using same |
| WO2000059540A1 (en) | 1999-04-05 | 2000-10-12 | Biocrystal Ltd. | Assay kits and methods for immune complex-mediated activation involving shed antigens |
| US6451601B1 (en) | 1999-04-12 | 2002-09-17 | Modex Therapeutiques, S.A. | Transiently immortalized cells for use in gene therapy |
| EP1175436B1 (en) | 1999-04-12 | 2006-10-11 | Heart Biosystems GmbH | Transiently immortalized cells for use in gene therapy |
| US6358739B1 (en) | 1999-04-12 | 2002-03-19 | Modex Therapeutiques, S.A. | Transiently immortalized cells |
| US6308621B1 (en) | 1999-06-14 | 2001-10-30 | Heidelberger Druckmaschinen Ag | Roller bearing lubrication system and method |
| US7135287B1 (en) | 1999-10-02 | 2006-11-14 | Biosite, Inc. | Human antibodies |
| US7311920B1 (en) | 1999-10-08 | 2007-12-25 | University Of Maryland Biotechnology Institute | Virus coat protein/receptor chimeras and methods of use |
| DE60032927T2 (de) | 1999-11-10 | 2007-11-08 | Rigel Pharmaceuticals, Inc., South San Francisco | Verfahren and zusammenstellungen, die renilla gfp enthalten |
| EP1103615A1 (en) | 1999-11-25 | 2001-05-30 | Universite De Geneve | Vectors capable of immortalizing non-dividing cells and cells immortalized with said vectors |
| US20010049393A1 (en) * | 1999-12-07 | 2001-12-06 | Whitehead Institute For Biomedical Research | Methods for defining MYC target genes and uses thereof |
| WO2001079557A2 (en) | 2000-04-12 | 2001-10-25 | Agensys, Inc. | Gtp-binding protein useful in treatment and detection of cancer |
| WO2001087058A1 (en) | 2000-05-15 | 2001-11-22 | Sonoko Habu | Chimeric mouse having immunity constructed by using human cd34-positive cells and use thereof |
| US20020155127A1 (en) | 2000-06-02 | 2002-10-24 | Danher Wang | Genetic vaccine against human immunodeficiency virus |
| US20030072794A1 (en) | 2000-06-09 | 2003-04-17 | Teni Boulikas | Encapsulation of plasmid DNA (lipogenes™) and therapeutic agents with nuclear localization signal/fusogenic peptide conjugates into targeted liposome complexes |
| US20070248618A1 (en) * | 2004-03-16 | 2007-10-25 | Cohen David I | Tat-Based vaccine Compositions and Methods of Making and Using Same |
| AU2001296354A1 (en) | 2000-09-25 | 2002-04-02 | Baylor College Of Medicine | Improved system for regulation of transgene expression |
| EP1330551A2 (en) | 2000-10-30 | 2003-07-30 | Kalobios, Inc. | Affinity maturation by competitive selection |
| US20040241140A1 (en) | 2000-11-01 | 2004-12-02 | Pavlakis George N. | Expression vectors able to elicit improved immune response and methods of using same |
| JP3753321B2 (ja) | 2000-12-01 | 2006-03-08 | 財団法人実験動物中央研究所 | 異種細胞の生着、分化および増殖に適したマウスの作出方法、該方法により作出されたマウスならびにそのマウスの用途 |
| WO2002057436A2 (en) | 2001-01-19 | 2002-07-25 | Gendel Limited | Red blood cell from a transgenic animal as vehicle for polypeptide delivery |
| US7033744B2 (en) | 2001-03-16 | 2006-04-25 | Naoya Kobayashi | Method for proliferating a liver cell, a liver cell obtained thereby, and use thereof |
| GB0117631D0 (en) | 2001-07-19 | 2001-09-12 | Syngenta Ltd | Improvements in or relating to organic compounds |
| IL160359A0 (en) | 2001-08-31 | 2004-07-25 | Avidex Ltd | Soluble t cell receptor |
| CN100506978C (zh) | 2001-09-21 | 2009-07-01 | 中国人民解放军军事医学科学院野战输血研究所 | 一种新的造血干/祖细胞的富集方法及其体外定向诱导分化 |
| GB0124391D0 (en) | 2001-10-11 | 2001-11-28 | Gene Expression Technologies L | Control of gene expression |
| US20030147887A1 (en) | 2001-11-02 | 2003-08-07 | Shen-Wu Wang | B-cell lymphoma specific antigen for use in diagnosis and treatment of B-cell malignancies |
| EP1321034A1 (en) | 2001-12-21 | 2003-06-25 | Pfizer Products Inc. | Disruption of the phosphodieterase 10 gene |
| US7745140B2 (en) | 2002-01-03 | 2010-06-29 | The Trustees Of The University Of Pennsylvania | Activation and expansion of T-cells using an engineered multivalent signaling platform as a research tool |
| WO2003057171A2 (en) | 2002-01-03 | 2003-07-17 | The Trustees Of The University Of Pennsylvania | Activation and expansion of t-cells using an engineered multivalent signaling platform |
| US20030216315A1 (en) | 2002-02-13 | 2003-11-20 | Duke University | Modulation of immune response by non-peptide binding stress response polypeptides |
| CN1240439C (zh) * | 2002-03-28 | 2006-02-08 | 南京凯基生物科技发展有限公司 | 肿瘤基因开关药物 |
| US7211191B2 (en) | 2004-09-30 | 2007-05-01 | Thermogenesis Corp. | Blood component separation method and apparatus |
| AU2003228517B2 (en) | 2002-04-16 | 2007-06-21 | Dana-Farber Cancer Institute, Inc. | Cancer models |
| GB2387599B (en) | 2002-04-17 | 2005-08-10 | Jason Peter Brown | Methods for producing antibodies |
| CN1659187A (zh) | 2002-05-10 | 2005-08-24 | 新世纪药品有限公司 | 融合铁蛋白在疫苗和其他方面的应用 |
| UA82998C2 (ru) | 2002-05-16 | 2008-06-10 | Бавариан Нордик А/С | Экспрессия генов в модифицированном вирусе коровьей оспы ankara с использованием коровьего поксвирусного промотора аті |
| US8034334B2 (en) | 2002-09-06 | 2011-10-11 | The United States Of America As Represented By The Secretary, Department Of Health And Human Services | Immunotherapy with in vitro-selected antigen-specific lymphocytes after non-myeloablative lymphodepleting chemotherapy |
| CA2501870C (en) | 2002-10-09 | 2013-07-02 | Avidex Limited | Single chain recombinant t cell receptors |
| DE50209178D1 (de) * | 2002-10-11 | 2007-02-15 | Imvision Gmbh | Moduläre Antigen-Transporter Moleküle (MAT-Moleküle) zur Modulierung von Immunreaktionen, zugehörige Konstrukte, Verfahren und Verwendungen |
| US20060154331A1 (en) | 2002-10-15 | 2006-07-13 | Nili Avidan | Erythrocyte differentiation factor, gene encoding same, and methods of use thereof |
| PT1558643E (pt) | 2002-11-09 | 2009-08-24 | Immunocore Ltd | Apresentação de um receptor das células t |
| KR20090046973A (ko) | 2002-11-27 | 2009-05-11 | 아이알엠 엘엘씨 | 암세포에서 세포자멸사를 유도하기 위한 방법 및 조성물 |
| CA2508052A1 (en) | 2002-12-05 | 2004-06-17 | Imperial College Innovations Limited | Control of apoptosis using a complex of an oligonucleotide and a regulatory peptide |
| DE602004008582T2 (de) | 2003-02-17 | 2008-05-21 | Peter Burkhard | Peptidische nanoteilchen als arzneimittelabgabe- und antigen-display-systeme |
| GB0304068D0 (en) | 2003-02-22 | 2003-03-26 | Avidex Ltd | Substances |
| WO2004084805A2 (en) | 2003-03-19 | 2004-10-07 | The J. David Gladstone Institutes | Acetylated tat polypeptides and methods of use thereof |
| TW200502391A (en) | 2003-05-08 | 2005-01-16 | Xcyte Therapies Inc | Generation and isolation of antigen-specific t cells |
| WO2005014785A2 (en) | 2003-06-18 | 2005-02-17 | The George Washington University | Conditionally-immortalized hematopoietic progenitor cell lines |
| WO2005084158A2 (en) | 2003-06-20 | 2005-09-15 | The Regents Of The University Of California | Polypeptide transduction and fusogenic peptides |
| IL161903A0 (en) | 2003-07-17 | 2005-11-20 | Gamida Cell Ltd | Ex vivo progenitor and stem cell expansion for usein the treatment of disease of endodermally- deri ved organs |
| WO2005049073A2 (en) | 2003-11-19 | 2005-06-02 | Survac Aps | Proteins belonging to the bcl-2 family and fragments thereof, and their use in cancer patients |
| US7705049B2 (en) | 2004-01-21 | 2010-04-27 | New York University | Methods for treating non-melanoma cancers with PABA |
| JP2005232148A (ja) | 2004-02-03 | 2005-09-02 | Technion Research & Development Foundation Ltd | 神経保護剤としてプロパルギルアミンの使用 |
| AU2005246073B2 (en) | 2004-05-19 | 2010-10-28 | Adaptimmune Limited | Method of improving T cell receptors |
| ATE417065T1 (de) | 2004-05-19 | 2008-12-15 | Medigene Ltd | Hochaffiner ny-eso-t-zellen-rezeptor |
| ATE475669T1 (de) | 2004-06-29 | 2010-08-15 | Immunocore Ltd | Einen modifizierten t-zellen-rezeptor exprimierende zellen |
| WO2006137836A2 (en) | 2004-08-17 | 2006-12-28 | Research Development Foundation | Bacterial vector systems |
| GB0420963D0 (en) | 2004-09-21 | 2004-10-20 | Reneuron Ltd | Hepatocyte |
| CA2584738A1 (en) | 2004-10-20 | 2006-04-27 | Vitro Diagnostics, Inc. | Generation and differentiation of adult stem cell lines |
| WO2006045064A2 (en) | 2004-10-20 | 2006-04-27 | Whitehead Institute For Biomedical Research | Cultured hematopoietic stem cells and method for expansion and analysis thereof |
| WO2007067183A1 (en) | 2005-12-09 | 2007-06-14 | The Regents Of The University Of California | Derivation of unlimited quantities of neutrophils or monocyte/dendritic cells |
| US20060156422A1 (en) | 2005-01-10 | 2006-07-13 | Medical Research Council | Methods and compositions for the generation of antibodies |
| US20070098715A1 (en) | 2005-03-25 | 2007-05-03 | Seth Ettenberg | Antibodies against the tenascin major antigens |
| US8207136B2 (en) | 2005-04-26 | 2012-06-26 | The Board Of Trustees Of The University Of Illinois | Nucleoside compounds and methods of use thereof |
| WO2006125962A2 (en) | 2005-05-25 | 2006-11-30 | Medigene Limited | T cell receptors which specifically bind to vygfvracl-hla-a24 |
| JP5276982B2 (ja) | 2005-08-26 | 2013-08-28 | ボード オブ トラスティーズ オブ ザ レランド スタンフォード ジュニア ユニバーシティ | オキシトシンの投与による頭痛の処置のための方法 |
| US20070047583A1 (en) | 2005-08-29 | 2007-03-01 | Siemens Aktiengesellschaft | Method for using a short address in a packet header |
| IL296832A (en) | 2005-10-18 | 2022-11-01 | Nat Jewish Health | Process of preparing red blood cells using conditionally immortalized long-term hematopoietic stem cells and erythropoietin |
| CA2626584A1 (en) | 2005-11-04 | 2007-05-18 | Alnylam Pharmaceuticals, Inc. | Compositions and methods for inhibiting expression of nav1.8 gene |
| EP1792627A1 (en) | 2005-12-05 | 2007-06-06 | ImVisioN AG | Modulation of the immune response by administration of intralymphatic transduction allergen (ITAG-)-molecules |
| CN101045914A (zh) | 2006-03-29 | 2007-10-03 | 中国人民解放军军事医学科学院野战输血研究所 | 体外诱导造血干/祖细胞分化为成熟红细胞的方法与应用 |
| US20080070256A1 (en) | 2006-07-26 | 2008-03-20 | National Jewish Medical And Research Center | Non-Human Animal Models for B-cell Non-Hodgkin's Lymphoma and Uses Thereof |
| US8088379B2 (en) | 2006-09-26 | 2012-01-03 | The United States Of America As Represented By The Department Of Health And Human Services | Modified T cell receptors and related materials and methods |
| EP2087000A2 (en) | 2006-09-29 | 2009-08-12 | Immunocore Ltd. | T cell therapies |
| EP2583551A1 (en) | 2007-03-13 | 2013-04-24 | National Jewish Health | Methods for generation of antibodies |
| US20110218210A1 (en) | 2007-11-02 | 2011-09-08 | Taiga Biotechnologies | Compounds for treating abnormal cellular proliferation |
| MX2010010165A (es) | 2008-03-17 | 2010-11-25 | Scripps Research Inst | Procedimientos quimicos y geneticos combinados para generacion de celulas madre pluripotentes inducidas. |
| US20110086424A1 (en) | 2008-05-06 | 2011-04-14 | Advanced Cell Technology, Inc. | Methods for producing enucleated erythroid cells derived from pluripotent stem cells |
| SG10201803982TA (en) | 2008-05-16 | 2018-07-30 | Taiga Biotechnologies Inc | Antibodies and processes for preparing the same |
| WO2009149956A2 (en) | 2008-06-13 | 2009-12-17 | Life & Brain Gmbh | Fusion protein and use thereof |
| SG193145A1 (en) | 2008-07-21 | 2013-09-30 | Taiga Biotechnologies Inc | Differentiated anucleated cells and method for preparing the same |
| CN104588140B (zh) | 2008-07-21 | 2016-06-29 | 贝克顿·迪金森公司 | 密度相分离装置 |
| DK3339321T3 (da) * | 2008-08-28 | 2021-06-21 | Taiga Biotechnologies Inc | Modulatorer af myc, fremgangsmåder til anvendelse af samme og fremgangsmåder til at identificere stoffer der modulerer myc |
| CN108379292A (zh) | 2008-11-06 | 2018-08-10 | 印第安纳大学研究与技术公司 | 增强造血干细胞植入过程的材料和方法 |
| DK2352756T3 (da) | 2008-11-24 | 2012-12-03 | Helmholtz Zentrum Muenchen | Højaffin T-cellereceptor og anvendelse af denne |
| WO2010120169A1 (en) | 2009-04-14 | 2010-10-21 | Itrec B.V. | Hoisting device |
| WO2011100477A2 (en) | 2010-02-10 | 2011-08-18 | Taiga Biotechnologies, Inc. | Antibodies and processes for preparing the same |
| US20120107317A1 (en) | 2010-10-27 | 2012-05-03 | The University Of Hong Kong | Use of cytoplasmic c-myc for regulating immune responses |
| US20120244133A1 (en) | 2011-03-22 | 2012-09-27 | The United States of America, as represented by the Secretary, Department of Health and | Methods of growing tumor infiltrating lymphocytes in gas-permeable containers |
| TWI623618B (zh) | 2011-07-12 | 2018-05-11 | 傳斯堅公司 | Hbv聚合酶突變體 |
| AU2012309830B2 (en) | 2011-09-15 | 2017-03-30 | The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | T cell receptors recognizing HLA-A1- or HLA-Cw7-restricted mage |
| BR112014006596A2 (pt) | 2011-09-21 | 2017-03-28 | Yissum Res Dev Co | nanopartícula que encapsula uma pluralidade de nanocarreadores, composição, uso de uma nanopartícula, kit, sistema de entrega, processo para obter uma nanopartícula, e, processo de nanoaspersão para obter as nanopartículas |
| EP2844743B1 (en) | 2012-05-03 | 2021-01-13 | Fred Hutchinson Cancer Research Center | Enhanced affinity t cell receptors and methods for making the same |
| EP2852380A4 (en) | 2012-05-23 | 2016-01-20 | Univ Ohio State | LIPID-COATED ALBUMIN NANOPARTICLE COMPOSITIONS AND METHOD FOR THE PREPARATION AND METHOD OF USE THEREOF |
| DE102012209673A1 (de) | 2012-06-08 | 2013-12-24 | Artcline Gmbh | Verfahren zum Herstellen einer Leukozytenpräparation und Leukozytenpräparation |
| US9789135B2 (en) | 2012-07-20 | 2017-10-17 | Taiga Biotechnologies, Inc. | Enhanced reconstitution and autoreconstitution of the hematopoietic compartment |
| KR102499753B1 (ko) | 2012-07-27 | 2023-02-16 | 더 보오드 오브 트러스티스 오브 더 유니버시티 오브 일리노이즈 | T 세포 수용체 조작 |
| US20150209406A1 (en) | 2012-09-07 | 2015-07-30 | Massachusetts Eye And Ear Infirmary | Methods and compositions for regenerating hair cells and/or supporting cells |
| US20140109246A1 (en) | 2012-09-24 | 2014-04-17 | The Regents Of The University Of Colorado, A Body Corporate | Methods of generating xenochimaeric mice with tumor and hematopoietic system from the same heterologous species |
| GB2508414A (en) | 2012-11-30 | 2014-06-04 | Max Delbrueck Centrum | Tumour specific T cell receptors (TCRs) |
| EP2961415B1 (en) | 2013-03-01 | 2021-01-06 | The United States of America, as represented by The Secretary, Department of Health and Human Services | Methods of producing enriched populations of tumor-reactive t cells from tumor |
| EP3628322A1 (en) | 2013-03-01 | 2020-04-01 | The United States of America, as represented by the Secretary, Department of Health and Human Services | Cd8+ t cells that also express pd-1 and/or tim-3 for the treatment of cancer |
| US10272115B2 (en) | 2013-03-11 | 2019-04-30 | Taiga Biotechnologies, Inc. | Production and use of red blood cells |
| US9365825B2 (en) | 2013-03-11 | 2016-06-14 | Taiga Biotechnologies, Inc. | Expansion of adult stem cells in vitro |
| KR20200138445A (ko) | 2014-04-24 | 2020-12-09 | 보드 오브 리전츠, 더 유니버시티 오브 텍사스 시스템 | 입양 세포 요법 생성물을 생성하기 위한 유도 만능 줄기 세포의 응용 |
| WO2016105542A2 (en) | 2014-12-24 | 2016-06-30 | Neximmune, Inc | Nanoparticle compositions and methods for immunotherapy |
| EP3355922A2 (en) | 2015-10-02 | 2018-08-08 | Dana Farber Cancer Institute, Inc. | Combination therapy of bromodomain inhibitors and checkpoint blockade |
| EP3889176A1 (en) | 2016-01-15 | 2021-10-06 | Berkeley Lights, Inc. | Methods of producing patient-specific anti-cancer therapeutics and methods of treatment therefor |
| EP3548425B1 (en) | 2016-12-02 | 2023-03-29 | Taiga Biotechnologies, Inc. | Nanoparticle formulations |
| WO2018104909A2 (en) | 2016-12-09 | 2018-06-14 | St. Jude Children's Research Hospital | Dna methylation profiling for t-cell immunotherapy |
| US10149898B2 (en) | 2017-08-03 | 2018-12-11 | Taiga Biotechnologies, Inc. | Methods and compositions for the treatment of melanoma |
-
2009
- 2009-08-28 DK DK18154875.1T patent/DK3339321T3/da active
- 2009-08-28 JP JP2011525258A patent/JP5812861B2/ja active Active
- 2009-08-28 SG SG2013064928A patent/SG193831A1/en unknown
- 2009-08-28 US US12/550,166 patent/US8784825B2/en active Active
- 2009-08-28 ES ES18154875T patent/ES2879225T3/es active Active
- 2009-08-28 CA CA2735522A patent/CA2735522C/en active Active
- 2009-08-28 EP EP09810692.5A patent/EP2318435B1/en active Active
- 2009-08-28 CN CN200980127166.7A patent/CN102089323B/zh not_active Expired - Fee Related
- 2009-08-28 EP EP21170329.3A patent/EP3916010A1/en not_active Withdrawn
- 2009-08-28 EP EP18154875.1A patent/EP3339321B1/en active Active
- 2009-08-28 IL IL301475A patent/IL301475B1/en unknown
- 2009-08-28 DK DK15175802.6T patent/DK2966084T3/en active
- 2009-08-28 DK DK09810692.5T patent/DK2318435T3/en active
- 2009-08-28 ES ES15175802.6T patent/ES2681478T3/es active Active
- 2009-08-28 ES ES09810692.5T patent/ES2561599T3/es active Active
- 2009-08-28 AU AU2009285547A patent/AU2009285547B2/en active Active
- 2009-08-28 WO PCT/US2009/055443 patent/WO2010025421A2/en not_active Ceased
- 2009-08-28 CN CN201410479685.2A patent/CN104353066B/zh active Active
- 2009-08-28 EP EP15175802.6A patent/EP2966084B1/en active Active
-
2010
- 2010-12-13 IL IL209968A patent/IL209968A/en active IP Right Grant
-
2013
- 2013-02-26 US US13/777,967 patent/US8828723B2/en active Active
-
2014
- 2014-05-04 IL IL232432A patent/IL232432A/en active IP Right Grant
- 2014-08-15 US US14/461,105 patent/US9775897B2/en active Active
-
2015
- 2015-04-02 JP JP2015075703A patent/JP6167130B2/ja active Active
-
2016
- 2016-12-21 IL IL249700A patent/IL249700B/en active IP Right Grant
-
2017
- 2017-06-26 JP JP2017123838A patent/JP6484293B2/ja active Active
- 2017-09-27 US US15/717,675 patent/US10556006B2/en active Active
-
2019
- 2019-01-15 IL IL264254A patent/IL264254B/en active IP Right Grant
- 2019-02-15 JP JP2019025374A patent/JP6817353B2/ja active Active
-
2020
- 2020-01-14 US US16/742,150 patent/US11369678B2/en active Active
- 2020-07-19 IL IL276146A patent/IL276146B2/en unknown
- 2020-12-24 JP JP2020214507A patent/JP7208965B2/ja active Active
-
2022
- 2022-05-20 US US17/750,029 patent/US20220362377A1/en not_active Abandoned
-
2024
- 2024-01-26 US US18/423,395 patent/US12496341B2/en active Active
Non-Patent Citations (2)
| Title |
|---|
| None |
| See also references of EP2318435A4 |
Cited By (32)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9796961B2 (en) | 2005-10-18 | 2017-10-24 | The Regents Of The University Of Colorado | Conditionally immortalized long-term stem cells and methods of making and using such cells |
| US8883507B2 (en) | 2005-10-18 | 2014-11-11 | The Regents Of The University Of Colorado | Conditionally immortalized long-term hematopoietic stem cells and methods of making and using such cells |
| US9150831B2 (en) | 2005-10-18 | 2015-10-06 | The Regents Of The University Of Colorado | Conditionally immortalized long-term stem cells and methods of making and using such cells |
| US10760055B2 (en) | 2005-10-18 | 2020-09-01 | National Jewish Health | Conditionally immortalized long-term stem cells and methods of making and using such cells |
| US10442853B2 (en) | 2008-05-16 | 2019-10-15 | Taiga Biotechnologies, Inc. | Antibodies and processes for preparing the same |
| US8986702B2 (en) | 2008-05-16 | 2015-03-24 | Taiga Biotechnologies, Inc. | Antibodies and processes for preparing the same |
| US11667695B2 (en) | 2008-05-16 | 2023-06-06 | Taiga Biotechnologies, Inc. | Antibodies and processes for preparing the same |
| US9428571B2 (en) | 2008-05-16 | 2016-08-30 | Taiga Biotechnologies, Inc. | Antibodies and processes for preparing the same |
| US9169462B2 (en) | 2008-07-21 | 2015-10-27 | Taiga Biotechnologies, Inc. | Methods for preparing mature erythrocytes from conditionally immortalized hematopoietic stem cells |
| US12496341B2 (en) | 2008-08-28 | 2025-12-16 | Htyr Acquisition Llc | Methods for reducing anergy in lymphocytes using modulators of MYC |
| US11369678B2 (en) | 2008-08-28 | 2022-06-28 | Taiga Biotechnologies, Inc. | Compositions and methods for modulating immune cells |
| US9775897B2 (en) | 2008-08-28 | 2017-10-03 | Taiga Biotechnologies, Inc. | Modulators of MYC and methods of using the same |
| US8784825B2 (en) | 2008-08-28 | 2014-07-22 | Taiga Biotechnologies, Inc. | Modulators of MYC, methods of using the same, and methods of identifying agents that modulate MYC |
| US10556006B2 (en) | 2008-08-28 | 2020-02-11 | Taiga Biotechnologies, Inc. | Compositions and methods for modulating an immune response |
| US8828723B2 (en) | 2008-08-28 | 2014-09-09 | Taiga Biotechnologies, Inc. | Modulators of MYC, methods of using the same, and methods of identifying agents that modulate MYC |
| US9789135B2 (en) | 2012-07-20 | 2017-10-17 | Taiga Biotechnologies, Inc. | Enhanced reconstitution and autoreconstitution of the hematopoietic compartment |
| US10206952B2 (en) | 2012-07-20 | 2019-02-19 | Taiga Biotechnologies, Inc. | Enhanced reconstitution and autoreconstitution of the hematopoietic compartment |
| US10953048B2 (en) | 2012-07-20 | 2021-03-23 | Taiga Biotechnologies, Inc. | Enhanced reconstitution and autoreconstitution of the hematopoietic compartment |
| US10272115B2 (en) | 2013-03-11 | 2019-04-30 | Taiga Biotechnologies, Inc. | Production and use of red blood cells |
| US10087420B2 (en) | 2013-03-11 | 2018-10-02 | Taiga Biotechnologies, Inc. | Expansion of adult stem cells in vitro |
| US10786534B2 (en) | 2013-03-11 | 2020-09-29 | Taiga Biotechnologies, Inc. | Production and use of red blood cells |
| US9365825B2 (en) | 2013-03-11 | 2016-06-14 | Taiga Biotechnologies, Inc. | Expansion of adult stem cells in vitro |
| US9816074B2 (en) | 2014-07-25 | 2017-11-14 | Sangamo Therapeutics, Inc. | Methods and compositions for modulating nuclease-mediated genome engineering in hematopoietic stem cells |
| US10435677B2 (en) | 2014-09-16 | 2019-10-08 | Sangamo Therapeutics, Inc. | Genetically modified human cell with a corrected mutant sickle cell mutation |
| EP3878948A1 (en) | 2014-09-16 | 2021-09-15 | Sangamo Therapeutics, Inc. | Methods and compositions for nuclease-mediated genome engineering and correction in hematopoietic stem cells |
| WO2016044416A1 (en) | 2014-09-16 | 2016-03-24 | Sangamo Biosciences, Inc. | Methods and compositions for nuclease-mediated genome engineering and correction in hematopoietic stem cells |
| US11116796B2 (en) | 2016-12-02 | 2021-09-14 | Taiga Biotechnologies, Inc. | Nanoparticle formulations |
| US12344658B2 (en) | 2016-12-02 | 2025-07-01 | HTYR Acquistion LLC | Nanoparticle formulations |
| US10864259B2 (en) | 2017-08-03 | 2020-12-15 | Taiga Biotechnologies, Inc. | Methods and compositions for the treatment of melanoma |
| US12250943B2 (en) | 2019-04-08 | 2025-03-18 | Htyr Acquisition Llc | Compositions and methods for the cryopreservation of immune cells |
| EP3969041A4 (en) * | 2019-05-14 | 2023-05-10 | Taiga Biotechnologies, Inc. | COMPOSITIONS AND METHODS FOR TREATMENT OF T-CELL DEPLETION |
| US12370217B2 (en) | 2019-05-14 | 2025-07-29 | Htyr Acquisition Llc | Compositions and methods for treating T cell exhaustion |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US12496341B2 (en) | Methods for reducing anergy in lymphocytes using modulators of MYC | |
| AU2012216462B2 (en) | Modulators of MYC, methods of using the same, and methods of identifying agents that modulate MYC | |
| HK40054473A (en) | Modulators of myc, methods of using the same and methods of identifying agents that modulate myc | |
| AU2015205879A1 (en) | Modulators of MYC, methods of using the same, and methods of identifying agents that modulate MYC | |
| HK1257269B (en) | Modulators of myc, methods of using the same and methods of identifying agents that modulate myc | |
| HK1219491B (en) | Modulators of myc, methods of using the same and methods of identifying agents that modulate myc | |
| HK1159643B (en) | Modulators of myc, methods of using the same, and methods of identifying agents that modulate myc |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200980127166.7 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 09810692 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009285547 Country of ref document: AU Ref document number: 209968 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009810692 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2009285547 Country of ref document: AU Date of ref document: 20090828 Kind code of ref document: A |
|
| ENP | Entry into the national phase |
Ref document number: 2011525258 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2735522 Country of ref document: CA |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2048/DELNP/2011 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 232432 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 249700 Country of ref document: IL |