WO2008094708A2 - Activin-actriia antagonists and uses for treating or preventing breast cancer - Google Patents
Activin-actriia antagonists and uses for treating or preventing breast cancer Download PDFInfo
- Publication number
- WO2008094708A2 WO2008094708A2 PCT/US2008/001429 US2008001429W WO2008094708A2 WO 2008094708 A2 WO2008094708 A2 WO 2008094708A2 US 2008001429 W US2008001429 W US 2008001429W WO 2008094708 A2 WO2008094708 A2 WO 2008094708A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- actriia
- activin
- amino acid
- breast cancer
- polypeptide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/71—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/179—Receptors; Cell surface antigens; Cell surface determinants for growth factors; for growth regulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/177—Receptors; Cell surface antigens; Cell surface determinants
- A61K38/1796—Receptors; Cell surface antigens; Cell surface determinants for hormones
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K45/00—Medicinal preparations containing active ingredients not provided for in groups A61K31/00 - A61K41/00
- A61K45/06—Mixtures of active ingredients without chemical characterisation, e.g. antiphlogistics and cardiaca
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/08—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease
- A61P19/10—Drugs for skeletal disorders for bone diseases, e.g. rachitism, Paget's disease for osteoporosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P43/00—Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/10—Transferases (2.)
- C12N9/12—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Y—ENZYMES
- C12Y207/00—Transferases transferring phosphorus-containing groups (2.7)
- C12Y207/11—Protein-serine/threonine kinases (2.7.11)
- C12Y207/1103—Receptor protein serine/threonine kinase (2.7.11.30)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5011—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing antineoplastic activity
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/573—Immunoassay; Biospecific binding assay; Materials therefor for enzymes or isoenzymes
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
- G01N33/57415—Specifically defined cancers of breast
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/32—Fusion polypeptide fusions with soluble part of a cell surface receptor, "decoy receptors"
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/90—Enzymes; Proenzymes
- G01N2333/91—Transferases (2.)
- G01N2333/912—Transferases (2.) transferring phosphorus containing groups, e.g. kinases (2.7)
- G01N2333/91205—Phosphotransferases in general
Definitions
- Breast cancer is the most common type of cancer among women in Western countries, affecting more than 180,000 women in the U.S. each year.
- the disease arises in the mammary gland, which is made up of a branching duct system.
- Each mammary gland, or breast contains 15 to 20 sections called lobes, and each lobe contains a series of branched ducts that drain into the nipple.
- Epithelial cells that line each duct are responsible for milk production.
- Invasive breast cancer is thought to originate from normal epithelium of the terminal duct/lobular unit through a series of increasingly abnormal proliferative lesions. Once the tumor acquires the ability to metastasize, breast cancer cells spread to other organs, making treatment increasingly more difficult.
- Metastases to the bone are commonly associated with severe pain, loss of bone, and increased risk of fractures.
- Many anti-estrogenic therapies used in the treatment of breast cancer are also associated with accelerated bone loss.
- adjuvant therapy consists of cytotoxic chemotherapy and/or endocrine therapy. Although chemotherapy has been effective in treating various types of malignancies, many anti-neoplastic compounds induce undesirable side effects. Additionally, many tumors either fail to respond or become resistant to chemotherapy and endocrine therapies. While adjuvant therapy has improved the mortality rate among breast cancer patients, the 10-year survival rate for patients with the most common histopathological types of invasive breast cancer is still only 35-50% (Weigelt et al. 2005 Nat. Rev. Cancer 5: 591- 602).
- the disclosure relates to the use of activin antagonists, as well as ActRIIa antagonists, to treat or prevent breast cancer or bone loss associated with breast cancer.
- the disclosure provides methods for treating or preventing breast cancer using a soluble form of ActRIIa that acts as an inhibitor of activin. While soluble ActRIIa may affect cancer cell growth or survival through a mechanism other than activin antagonism, desirable therapeutic agents may nonetheless be selected on the basis of activin antagonism or ActRIIa antagonism or both. Such agents are referred to collectively as activin- ActRIIa antagonists.
- the disclosure provides methods for using activin-ActRIIa antagonists, including, for example, activin-binding ActRIIa polypeptides, anti-activin antibodies, anti-ActRIIa antibodies, activin- or ActRIIa-targeted small molecules and aptamers, and nucleic acids that decrease expression of activin and ActRIIa, to treat or prevent breast cancer in patients in need thereof.
- activin-ActRIIa antagonists can be used to promote bone growth and increase bone density.
- such antagonists can also be used to treat or prevent breast cancer, breast cancer metastases to the bone and bone loss associated with breast cancer.
- the disclosure provides methods for treating or preventing breast cancer using polypeptides comprising a soluble, activin-binding ActRIIa polypeptide that binds to activin.
- ActRIIa polypeptides may be formulated as a pharmaceutical preparation comprising the activin-binding ActRIIa polypeptide and a pharmaceutically acceptable carrier.
- the activin-binding ActRIIa polypeptide may bind to activin with a K D less than 1 micromolar or less than 100, 10 or 1 nanomolar.
- the activin-binding ActRIIa polypeptide selectively binds activin versus GDFl 1 and/or GDF8, and optionally with a K D that is at least 10-fold, 20-fold or 50-fold lower with respect to activin than with respect to GDFl 1 and/or GDF8. While not wishing to be bound to a particular mechanism of action, it is expected that this degree of selectivity for activin inhibition over GDFl 1/GDF8 inhibition accounts for effects on bone or tumor survival or growth without a consistently measurable effect on muscle. In many embodiments, an ActRIIa polypeptide will be selected for causing less than 15%, less than 10% or less than 5% increase in muscle at doses that achieve desirable effects on cancer cells.
- the composition may be at least 95% pure, with respect to other polypeptide components, as assessed by size exclusion chromatography, and optionally, the composition is at least 98% pure.
- An activin-binding ActRIIa polypeptide for use in such a preparation may be any of those disclosed herein, such as a polypeptide having an amino acid sequence selected from SEQ ID NOs: 2, 3, 7 or 12, or having an amino acid sequence that is at least 80%, 85%, 90%, 95%, 97% or 99% identical to an amino acid sequence selected from SEQ ID NOs: 2, 3, 7, 12 or 13.
- An activin-binding ActRIIa polypeptide may include a functional fragment of a natural ActRIIa polypeptide, such as one comprising at least 10, 20, 30, 50 or 90 or more amino acids of a sequence selected from SEQ ID NOs: 1-3 or a sequence of SEQ ID NO: 2, lacking the C-terminal 10 to 15 amino acids (the "tail").
- a soluble, activin-binding ActRIIa polypeptide may include one or more alterations in the amino acid sequence (e.g., in the ligand-binding domain) relative to a naturally occurring ActRIIa polypeptide.
- altered ActRIIa polypeptides are provided in WO 2006/012627, pp. 59-60, incorporated by reference herein.
- the alteration in the amino acid sequence may, for example, alter glycosylation of the polypeptide when produced in a mammalian, insect or other eukaryotic cell or alter proteolytic cleavage of the polypeptide relative to the naturally occurring ActRIIa polypeptide.
- An activin-binding ActRIIa polypeptide may be a fusion protein that has, as one domain, an ActRIIa polypeptide (e.g., a ligand-binding portion of an ActRIIa) and one or more additional domains that provide a desirable property, such as improved pharmacokinetics, easier purification, enhanced targeting to particular tissues, etc.
- a domain of a fusion protein may enhance one or more of in vivo stability, in vivo half life, uptake/administration, tissue localization or distribution, formation of protein complexes, multimerization of the fusion protein, and/or purification.
- An activin-binding ActRIIa fusion protein may include an immunoglobulin Fc domain (wild-type or mutant) or a serum albumin or other polypeptide portion that provides desirable properties such as improved pharmacokinetics, improved solubility or improved stability.
- an ActRIIa-Fc fusion comprises a relatively unstructured linker positioned between the Fc domain and the extracellular ActRIIa domain.
- This unstructured linker may correspond to the roughly 15 amino acid unstructured region at the C-terminal end of the extracellular domain of ActRIIa (the "tail"), or it may be an artificial sequence of 1, 2, 3, 4 or 5 amino acids or a length of between 5 and 15, 20, 30, 50 or more amino acids that are relatively free of secondary structure, or a mixture of both.
- a linker may be rich in glycine and proline residues and may, for example, contain a single sequence of threonine/serine and glycines or repeating sequences of threonine/serine and glycines (e.g., TG 4 or SG 4 singlets or repeats).
- a fusion protein may include a purification subsequence, such as an epitope tag, a FLAG tag, a polyhistidine sequence, and a GST fusion.
- a soluble ActRIIa polypeptide includes one or more modified amino acid residues selected from: a glycosylated amino acid, a PEGylated amino acid, a farnesylated amino acid, an acetylated amino acid, a biotinylated amino acid, an amino acid conjugated to a lipid moiety, and an amino acid conjugated to an organic derivatizing agent.
- a pharmaceutical preparation may also include one or more additional compounds such as a compound that is used to treat a bone disorder.
- a pharmaceutical preparation is substantially pyrogen free.
- an ActRIIa protein be expressed in a mammalian cell line that mediates suitably natural glycosylation of the ActRIIa protein so as to diminish the likelihood of an unfavorable immune response in a patient.
- Human and CHO cell lines have been used successfully, and it is expected that other common mammalian expression systems will be useful.
- yeast and other cell types have been genetically altered to express mammalian enzymes that catalyze glycosylation, thus allowing the generation of tightly controlled mammalian-like glycosylation on proteins expressed in these non-mammalian cells. These recombinant cell lines may also be used to express the proteins described herein.
- ActRIIa proteins designated ActRIIa-Fc have desirable properties, including selective binding to activin versus GDF8 and/or GDFl 1 , high affinity ligand binding and serum half life greater than two weeks in animal models.
- the invention provides methods for treating or preventing breast cancer using ActRIIa-Fc polypeptides and pharmaceutical preparations comprising such polypeptides and a pharmaceutically acceptable excipient.
- the disclosure provides methods for treating or preventing breast cancer using nucleic acids encoding a soluble activin-binding ActRIIa polypeptide.
- An isolated polynucleotide may comprise a coding sequence for a soluble, activin-binding ActRIIa polypeptide, such as described above.
- an isolated nucleic acid may include a sequence coding for an extracellular domain (e.g., ligand-binding domain) of an ActRIIa and a sequence that would code for part or all of the transmembrane domain and/or the cytoplasmic domain of an ActRIIa, but for a stop codon positioned within the transmembrane domain or the cytoplasmic domain, or positioned between the extracellular domain and the transmembrane domain or cytoplasmic domain.
- an extracellular domain e.g., ligand-binding domain
- an isolated polynucleotide may comprise a full-length ActRIIa polynucleotide sequence such as SEQ ID NO: 4 or 5, or a partially truncated version, said isolated polynucleotide further comprising a transcription termination codon at least six hundred nucleotides before the 3 '-terminus or otherwise positioned such that translation of the polynucleotide gives rise to an extracellular domain optionally fused to a truncated portion of a full-length ActRIIa.
- a preferred nucleic acid sequence is SEQ ID NO: 14.
- Nucleic acids useful in accordance with the methods described herein may be operably linked to a promoter for expression, and the disclosure provides cells transformed with such recombinant polynucleotides.
- the cell is a mammalian cell such as a Chinese hamster ovary (CHO) cell.
- the disclosure also provides methods for making a soluble, activin-binding ActRIIa polypeptide that can be used for treating or preventing breast cancer.
- a method may include expressing any of the nucleic acids (e.g., SEQ ID NO: 4, 5 or 14) disclosed herein in a suitable cell, such as a CHO cell.
- a suitable cell such as a CHO cell.
- Such a method may comprise: a) culturing a cell under conditions suitable for expression of the soluble ActRIIa polypeptide, wherein said cell is transformed with a soluble ActRIIa expression construct; and b) recovering the soluble ActRIIa polypeptide so expressed.
- Soluble ActRIIa polypeptides may be recovered as crude, partially purified or highly purified fractions.
- Purification may be achieved by a series of purification steps, including, for example, one, two or three or more of the following, in any order: protein A chromatography, anion exchange chromatography (e.g., Q sepharose), hydrophobic interaction chromatography (e.g., phenylsepharose), size exclusion chromatography, and cation exchange chromatography.
- anion exchange chromatography e.g., Q sepharose
- hydrophobic interaction chromatography e.g., phenylsepharose
- size exclusion chromatography e.g., cation exchange chromatography
- an activin-ActRIIa antagonist disclosed herein such as a soluble, activin-binding ActRIIa polypeptide, may be used in a method for treating, preventing or inhibiting breast cancer in a subject, including, for example, methods for delaying the onset of breast cancer, inhibiting the progression of breast cancer, reducing tumor size, preventing tumor growth, delaying the onset of metastasis or preventing metastasis, including metastasis to bone.
- the disclosure provides methods for decreasing or inhibiting the growth or survival of breast cancer cells in patients in need thereof.
- a method may comprise administering to a subject in need thereof an effective amount of activin- ActRIIa antagonist.
- the disclosure provides uses of activin-ActRIIa antagonists for making a medicament for the treatment or prevention of breast cancer as described herein.
- the disclosure also relates to combination therapies comprising an activin- ActRIIa antagonist and radiation therapy, chemotherapy (e.g., a cytotoxic agent), and/or endocrine therapy.
- the antagonist may be an ActRIIa-Fc fusion protein, wherein the ActRIIa-Fc fusion protein comprises an amino acid sequence that is at least 90% identical to the amino acid sequence of SEQ ID NO:3.
- the present invention relates to methods of preventing or delaying the onset of breast cancer in patients with one or more breast cancer risk factors. In some embodiments, the invention relates to methods of preventing or delaying the onset of metastatic disease in patients already diagnosed with a primary breast tumor or with a proliferative lesion of the breast.
- the method of preventing or delaying the onset of breast cancer in a human patient may comprise administering to a human patient in need thereof an effective amount of a polypeptide selected from the group consisting of: a) a polypeptide comprising an amino acid sequence at least 90% identical to SEQ ID NO:2; b) a polypeptide comprising an amino acid sequence at least 90% identical to SEQ ID NO:3; and c) a polypeptide comprising at least 50 consecutive amino acids selected from SEQ ID NO: 2.
- inventions relate to a method of inhibiting activin-mediated signaling in a human patient with breast cancer.
- the method comprises administering to the human patient an effective amount of an activin-ActRIIa antagonist.
- the antagonist is a polypeptide selected from the group consisting of: a) a polypeptide comprising an amino acid sequence at least 90% identical to SEQ ID NO:2; b) a polypeptide comprising an amino acid sequence at least 90% identical to SEQ ID NO:3; and c) a polypeptide comprising at least 50 consecutive amino acids selected from SEQ ID NO: 2.
- the disclosure provides a method for identifying an agent that inhibits the growth or survival of cancer cells (e.g., breast cancer cells).
- the method comprises: a) identifying a test agent that binds to activin or a ligand-binding domain of an ActRIIa polypeptide; and b) evaluating the effect of the agent on the proliferation, survival, or apoptosis of cancer cells.
- Figure 1 shows the purification of ActRIIa-hFc expressed in CHO cells.
- the protein purifies as a single, well-defined peak as visualized by sizing column (left panel) and Coomassie stained SDS-PAGE (right panel) (left lane: molecular weight standards; right lane: ActRIIa-hFc).
- Figure 2 shows the binding of ActRIIa-hFc to activin and GDF-1 1 , as measured by
- Figure 3 shows that ActRIIa-mFc treatment greatly reduces the formation of metastatic lesions in a mouse model of metastatic breast cancer.
- Mice were visualized non- invasively (anaesthetized, fluorescent imaging) five weeks after intracardiac injection of luciferase expressing MDA-MB-231 breast cancer cells. 12/14 vehicle treated mice show visible metastatic lesions, while only 4/12 ActRIIa-mFc treated mice show visible lesions.
- TGF-beta The transforming growth factor-beta (TGF-beta) superfamily contains a variety of growth factors that share common sequence elements and structural motifs. These proteins are known to exert biological effects on a large variety of cell types in both vertebrates and invertebrates. Members of the superfamily perform important functions during embryonic development in pattern formation and tissue specification and can influence a variety of differentiation processes, including adipogenesis, myogenesis, chondrogenesis, cardiogenesis, hematopoiesis, neurogenesis, and epithelial cell differentiation. The family is divided into two general branches: the BMP/GDF and the TGF-beta/Activin branches, whose members have diverse, often complementary effects.
- Activins are dimeric polypeptide growth factors that belong to the TGF-beta superfamily. There are three principal activin forms (A, B, and AB) that are homo/heterodimers of two closely related ⁇ subunits (P A P A , P B P B , arid PAP B , respectively).
- the human genome also encodes an activin C and an activin E, which are primarily expressed in the liver, and heterodimeric forms containing Pc or P E are also known.
- activins are unique and multifunctional factors that can stimulate hormone production in ovarian and placental cells, support neuronal cell survival, influence cell-cycle progress positively or negatively depending on cell type, and induce mesodermal differentiation at least in amphibian embryos (DePaolo et al., 1991 , Proc Soc Ep Biol Med. 198:500-512; Dyson et al., 1997, Curr Biol. 7:81 -84; Woodruff, 1998, Biochem Pharmacol. 55:953-963).
- activin B is involved in the regulation of mammary epithelial cell differentiation in mice (Robinson and Hennighausen, 1997 Development 124: 2701-2708).
- activin signaling is antagonized by its related heterodimer, inhibin.
- FSH follicle-stimulating hormone
- Other proteins that may regulate activin bioactivity and/or bind to activin include follistatin (FS), follistatin-related protein (FSRP) and ⁇ 2 - macroglobulin.
- TGF- ⁇ signals are mediated by heteromeric complexes of type I and type II serine/ threonine kinase receptors, which phosphorylate and activate downstream Smad proteins upon ligand stimulation (Massague, 2000, Nat. Rev. MoI. Cell Biol. 1 :169-178).
- type I and type II receptors are transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity.
- Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors.
- Type I and II activin receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors.
- ActRIIa and ActRIIb Two related type II receptors, ActRIIa and ActRIIb, have been identified as the type II receptors for activins (Mathews and Vale, 1991, Cell 65:973-982; Attisano et al., 1992, Cell 68: 97-108). Besides activins, ActRIIa and ActRIIb can biochemically interact with several other TGF- ⁇ family proteins, including BMP7, Nodal, GDF8, and GDFl 1 (Yamashita et al., 1995, J. Cell Biol. 130:217-226; Lee and McPherron, 2001, Proc. Natl. Acad. Sci. 98:9306- 931 1 ; Yeo and Whitman, 2001, MoI.
- ALK4 is the primary type I receptor for activins, particularly for activin A, and ALK-7 may serve as a receptor for activins as well, particularly for activin B.
- a soluble ActRIIa polypeptide which shows substantial preference in binding to activin A as opposed to other TGF-beta family members, such as GDF8 or GDFl 1 , may be used to treat or prevent cancer, particularly breast cancer. While not wishing to be bound to any particular mechanism, it is expected that the effect of sActRIIa is caused primarily by an activin antagonist effect, given the very strong activin binding (picomolar dissociation constant) exhibited by the particular sActRIIa construct used in these studies.
- Activin-ActRIIa antagonists include, for example, activin-binding soluble ActRIIa polypeptides, antibodies that bind to activin (particularly the activin A or B subunits, also referred to as ⁇ A or ⁇ B) and disrupt ActRIIa binding, antibodies that bind to ActRIIa and disrupt activin binding, non-antibody proteins selected for activin or ActRIIa binding (see e.g., WO/2002/088171, WO/2006/055689, and WO/2002/032925 for examples of such proteins and methods for design and selection of same), randomized peptides selected for activin or ActRIIa binding, often affixed to an Fc domain.
- activin binders that block the type I (e.g., a soluble type I activin receptor) and type II (e.g., a soluble type II activin receptor) binding sites, respectively, may be linked together to create a bifunctional binding molecule.
- Nucleic acid aptamers, small molecules and other agents that inhibit the activin- ActRIIa signaling axis may also be used.
- activin-ActRIIa antagonist activity including inhibin (i.e., inhibin alpha subunit), although inhibin does not universally antagonize activin in all tissues, follistatin (e.g., follistatin-288 and follistatin-315), FSRP, activin C, alpha(2)-macroglobulin, and an Ml 08 A (methionine to alanine change at position 108) mutant activin A.
- inhibin i.e., inhibin alpha subunit
- follistatin e.g., follistatin-288 and follistatin-315
- FSRP follistatin
- activin C alpha(2)-macroglobulin
- Ml 08 A methionine to alanine change at position 108 mutant activin A.
- alternative forms of activin particularly those with alterations in the type I receptor binding domain can bind to type II receptors and fail to form an active ternary complex, thus acting as
- nucleic acids such as antisense molecules, siRNAs or ribozymes that inhibit activin A, B, C or E, or, particularly, ActRIIa expression
- the activin-ActRIIa antagonist to be used may exhibit selectivity for inhibiting activin-mediated signaling versus other members of the TGF-beta family, and particularly with respect to GDF8 and GDFl 1. Soluble ActRIIb proteins do bind to activin, however, the wild type protein does not exhibit significant selectivity in binding to activin versus GDF8/11.
- ActRIIb polypeptides as well as altered forms of ActRIIb with different binding properties (see, e.g., WO 2006/012627, pp. 55-59, incorporated herein by reference) may achieve the desired effects on cancer cells.
- Native or altered ActRIIb may be given added specificity for activin by coupling with a second, activin-selective binding agent.
- the terms used in this specification generally have their ordinary meanings in the art, within the context of this invention and in the specific context where each term is used. Certain terms are discussed below or elsewhere in the specification, to provide additional guidance to the practitioner in describing the compositions and methods of the invention and how to make and use them.
- the terms “about” and “approximately” may mean values that are within an order of magnitude, preferably within 5- fold and more preferably within 2-fold of a given value. Numerical quantities given herein are approximate unless stated otherwise, meaning that the term “about” or “approximately” can be inferred when not expressly stated.
- the methods of the invention may include steps of comparing sequences to each other, including wild-type sequence to one or more mutants (sequence variants).
- Such comparisons typically comprise alignments of polymer sequences, e.g., using sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
- sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
- sequence alignment programs and/or algorithms that are well known in the art (for example, BLAST, FASTA and MEGALIGN, to name a few).
- sequence similarity in all its grammatical forms, refers to the degree of identity or correspondence between nucleic acid or amino acid sequences that may or may not share a common evolutionary origin.
- sequence similarity when modified with an adverb such as “highly,” may refer to sequence similarity and may or may not relate to a common evolutionary origin.
- breast cancer refers to any proliferative lesion or proliferative abnormality of the breast including, for example, benign lesions, pre-malignant and malignant lesions, solid tumors, and metastatic disease (both locally metastatic, e.g., stage III, and more widely metastatic, e.g., stage IV).
- Breast cancer includes but is not limited to adenocarcinoma, lobular (small cell) carcinoma, intraductal carcinoma, medullary breast cancer, mucinous breast cancer, tubular breast cancer, papillary breast cancer, Paget's disease, and inflammatory breast cancer.
- Breast cancer also refers to disease in other organs such as lung, liver, and bone, that originated from a metastatic lesion in the breast.
- breast cancer also encompasses both hormone-responsive and hormone-independent cancers.
- hormone-independent breast cancers are characterized by the absence or reduced levels of estrogen and/or progesterone receptors, and these cancers are typically refractory to treatment with antihormonal (especially antiestrogenic) therapies.
- Breast cancers are also categorized on the basis of Her2 expression, with Her2 + tumors having a worse prognosis than Her2 ⁇ tumors.
- ActRIIa refers to a family of activin receptor type Ha (ActRIIa) proteins from any species and variants derived from such ActRIIa proteins by mutagenesis or other modification. Reference to ActRIIa herein is understood to be a reference to any one of the currently identified forms.
- ActRIIa members of the ActRIIa family are generally transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine kinase activity.
- ActRIIa polypeptide includes polypeptides comprising any naturally occurring polypeptide of an ActRIIa family member as well as any variants thereof (including mutants, fragments, fusions, and peptidomimetic forms) that retain a useful activity. See, for example, WO/2006/012627.
- ActRIIa polypeptides include polypeptides derived from the sequence of any known ActRIIa having a sequence at least about 80% identical to the sequence of an ActRIIa polypeptide, and optionally at least 85%, 90%, 95%, 97%, 99% or greater identity.
- an ActRIIaj)olypeptide of the invention may bind to and inhibit the function of an ActRIIa protein and/or activin.
- An ActRIIa polypeptide may be selected for activity in inhibiting cancer cell proliferation or survival in vivo.
- Examples of ActRIIa polypeptides include human ActRIIa precursor polypeptide (SEQ ID NO: 1) and soluble human ActRIIa polypeptides (e.g., SEQ ID NOs: 2, 3, 7 and 12).
- the human ActRIIa precursor protein sequence is as follows:
- the signal peptide is single underlined; the extracellular domain is in bold and the potential N-linked glycosylation sites are double underlined.
- the human ActRIIa soluble (extracellular), processed polypeptide sequence is as follows:
- nucleic acid sequence encoding human ActRIIa precursor protein is as follows (nucleotides 164-1705 of Genbank entry NM_001616):
- the invention relates to methods for treating or preventing breast cancer using soluble ActRIIa polypeptides.
- soluble ActRIIa polypeptide generally refers to polypeptides comprising an extracellular domain of an ActRIIa protein.
- soluble ActRIIa polypeptide includes any naturally occurring extracellular domain of an ActRIIa protein as well as any variants thereof (including mutants, fragments and peptidomimetic forms).
- An activin-binding ActRIIa polypeptide is one that retains the ability to bind to activin, including, for example, activin AA, AB, BB, or forms that include a C or E subunit.
- an activin-binding ActRIIa polypeptide will bind to activin AA with a dissociation constant of 1 nM or less.
- the extracellular domain of an ActRIIa protein binds to activin and is generally soluble, and thus can be termed a soluble, activin-binding ActRIIa polypeptide.
- Examples of soluble, activin- binding ActRIIa polypeptides include the soluble polypeptide illustrated in SEQ ID NOs: 2, 3, 7, 12 and 13.
- SEQ ID NO:7 is referred to as ActRIIa-hFc, and is described further in the Examples.
- Other examples of soluble, activin-binding ActRIIa polypeptides comprise a signal sequence in addition to the extracellular domain of an ActRIIa protein, for example, the honey bee melitin leader sequence (SEQ ID NO: 8), the tissue plaminogen activator
- TPA TAA leader
- SEQ ID NO: 9 TAA leader
- SEQ ID NO: 10 TAA leader
- the ActRIIa- hFc polypeptide illustrated in SEQ ID NO: 13 uses a tPA leader.
- Functionally active fragments of ActRIIa polypeptides can be obtained by screening polypeptides recombinantly produced from the corresponding fragment of the nucleic acid encoding an ActRIIa polypeptide.
- fragments can be chemically synthesized using techniques known in the art such as conventional Merrifield solid phase f-Moc or t-Boc chemistry. The fragments can be produced (recombinantly or by chemical synthesis) and tested to identify those peptidyl fragments that can function as antagonists (inhibitors) of ActRIIa protein or signaling mediated by activin.
- a functional variant of the ActRIIa polypeptides can be obtained by screening libraries of modified polypeptides recombinantly produced from the corresponding mutagenized nucleic acids encoding an ActRIIa polypeptide. The variants can be produced and tested to identify those that can function as antagonists (inhibitors) of ActRIIa protein or signaling mediated by activin.
- a functional variant of the ActRIIa polypeptides comprises an amino acid sequence that is at least 75% identical to an amino acid sequence selected from SEQ ID NOs: 2 or 3. In certain cases, the functional variant has an amino acid sequence at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to an amino acid sequence selected from SEQ ID NOs: 2 or 3.
- Functional variants may be generated by modifying the structure of an ActRIIa polypeptide for such purposes as enhancing therapeutic efficacy, or stability (e.g., ex vivo shelf life and resistance to proteolytic degradation in vivo).
- modified ActRIIa polypeptides when selected to retain activin binding, are considered functional equivalents of the naturally-occurring ActRIIa polypeptides.
- Modified ActRIIa polypeptides can also be produced, for instance, by amino acid substitution, deletion, or addition.
- the present invention contemplates methods for treating or preventing breast cancer using ActRIIa polypeptides having specific mutations that alter the glycosylation of the polypeptide.
- Such mutations may be selected so as to introduce or eliminate one or more glycosylation sites, such as O-linked or N-linked glycosylation sites.
- Asparagine-linked glycosylation recognition sites generally comprise a tripeptide sequence, asparagine-X-threonine or asparagine-X-serine (where "X" is any amino acid) which is specifically recognized by appropriate cellular glycosylation enzymes.
- the alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the wild-type ActRIIa polypeptide (for O-linked glycosylation sites).
- a variety of amino acid substitutions or deletions at one or both of the first or third amino acid positions of a glycosylation recognition site (and/or amino acid deletion at the second position) results in non-glycosylation at the modified tripeptide sequence.
- Another means of increasing the number of carbohydrate moieties on an ActRIIa polypeptide is by chemical or enzymatic coupling of glycosides to the ActRIIa polypeptide.
- the sugar(s) may be attached to (a) arginine and histidine; (b) free carboxyl groups; (c) free sulfhydryl groups such as those of cysteine; (d) free hydroxyl groups such as those of serine, threonine, or hydroxyproline; (e) aromatic residues such as those of phenylalanine, tyrosine, or tryptophan; or (f) the amide group of glutamine. Removal of one or more carbohydrate moieties present on an ActRIIa polypeptide may be accomplished chemically and/or enzymatically.
- Chemical deglycosylation may involve, for example, exposure of the ActRIIa polypeptide to the compound trifluoromethanesulfonic acid, or an equivalent compound. This treatment results in the cleavage of most or all sugars except the linking sugar (N-acetylglucosamine or N-acetylgalactosamine), while leaving the amino acid sequence intact.
- Enzymatic cleavage of carbohydrate moieties on ActRIIa polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases as described by Thotakura et al. (1987) Meth. Enzymol. 138:350.
- the sequence of an ActRIIa polypeptide may be adjusted, as appropriate, depending on the type of expression system used, as mammalian, yeast, insect and plant cells may all introduce differing glycosylation patterns that can be affected by the amino acid sequence of the peptide.
- ActRIIa proteins for use in humans may be expressed in a mammalian cell line that provides proper glycosylation, such as HEK293 or CHO cell lines, although other mammalian expression cell lines are expected to be useful as well.
- This disclosure further contemplates methods of generating mutants, particularly sets of combinatorial mutants of an ActRIIa polypeptide, as well as truncation mutants; pools of combinatorial mutants are especially useful for identifying functional variant sequences.
- the purpose of screening such combinatorial libraries may be to generate, for example, ActRIIa polypeptide variants which bind to activin or other ligands.
- a variety of screening assays are provided below, and such assays may be used to evaluate variants.
- an ActRIIa polypeptide variant may be screened for ability to bind to an ActRIIa ligand, to prevent binding of an ActRIIa ligand to an ActRIIa polypeptide or to interfere with signaling caused by an ActRIIa ligand.
- Cancer cells may refer to cells in a living subject that make up a solid tumor or to cells that have originated from a tumor and that have spread to other sites within a living subject (i.e., metastatic cells). Additionally, cancer cells may refer to cells obtained or derived from a tumor or cancerous growth and that are cultured in vitro. Cancer cells also encompass cell lines that may be cultivated in vitro or used in animal xenograft studies, for example. Cancer cells also refer to cells derived from metastatic cells through cell division following metastasis.
- the cells may be hormone- responsive (e.g., estrogen receptor positive) or hormone-independent (e.g., estrogen receptor negative). Cancer cell proliferation or survival may be assessed in the presence of one or more recombinant ActRIIa ligand proteins (e.g., activin), and cells may be transfected so as to produce an ActRIIa polypeptide and/or variants thereof, and optionally, an ActRIIa ligand. Likewise, an ActRIIa polypeptide may be administered to a mouse or other animal, and one or more measurements, such as tumor size, or the rate of cell proliferation or apoptosis relative to a control, may be assessed.
- ActRIIa ligand proteins e.g., activin
- Combinatorially-derived variants can be generated which have a selective or generally increased potency relative to a naturally occurring ActRIIa polypeptide.
- mutagenesis can give rise to variants which have intracellular half-lives dramatically different than the corresponding wild-type ActRIIa polypeptide.
- the altered protein can be rendered either more stable or less stable to proteolytic degradation or other cellular processes which result in destruction of, or otherwise inactivation of a native ActRIIa polypeptide.
- Such variants, and the genes which encode them can be utilized to alter ActRIIa polypeptide levels by modulating the half-life of the ActRIIa polypeptides.
- a short half-life can give rise to more transient biological effects and, when part of an inducible expression system, can allow tighter control of recombinant ActRIIa polypeptide levels within the cell.
- mutations may be made in the linker (if any) and/or the Fc portion to alter the half-life of the protein.
- a combinatorial library may be produced by way of a degenerate library of genes encoding a library of polypeptides which each include at least a portion of potential ActRIIa polypeptide sequences.
- a mixture of synthetic oligonucleotides can be enzymatically ligated into gene sequences such that the degenerate set of potential ActRIIa polypeptide nucleotide sequences are expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display).
- the library of potential homologs can be generated from a degenerate oligonucleotide sequence.
- Chemical synthesis of a degenerate gene sequence can be carried out in an automatic DNA synthesizer, and the synthetic genes can then be ligated into an appropriate vector for expression.
- the synthesis of degenerate oligonucleotides is well known in the art (see for example, Narang, SA (1983) Tetrahedron 39:3; Itakura et al., (1981) Recombinant DNA, Proc. 3rd Cleveland Sympos. Macromolecules, ed. AG Walton, Amsterdam: Elsevier pp273-289; Itakura et al., (1984) Annu. Rev.
- ActRIIa polypeptide variants can be generated and isolated from a library by screening using, for example, alanine scanning mutagenesis and the like (Ruf et al., (1994) Biochemistry 33: 1565-1572; Wang et al., (1994) J. Biol. Chem. 269:3095-3099; Balint et al., (1993) Gene 137: 109-1 18; Grodberg et al., (1993) Eur. J. Biochem. 218:597- 601 ; Nagashima et al., (1993) J. Biol. Chem.
- Linker scanning mutagenesis is an attractive method for identifying truncated (bioactive) forms of ActRIIa polypeptides.
- a wide range of techniques are known in the art for screening gene products of combinatorial libraries made by point mutations and truncations, and, for that matter, for screening cDNA libraries for gene products having a certain property. Such techniques will be generally adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of ActRIIa polypeptides.
- the most widely used techniques for screening large gene libraries typically comprises cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates relatively easy isolation of the vector encoding the gene whose product was detected.
- Preferred assays include activin binding assays and activin-mediated cell signaling assays.
- ActRIIa polypeptides useful in accordance with the methods described herein may further comprise post-translational modifications in addition to any that are naturally present in the ActRIIa polypeptides.
- modifications include, but are not limited to, acetylation, carboxylation, glycosylation, phosphorylation, lipidation, and acylation.
- the modified ActRIIa polypeptides may contain non-amino acid elements, such as polyethylene glycols, lipids, poly- or mono-saccharide, and phosphates. Effects of such non-amino acid elements on the functionality of an ActRIIa polypeptide may be tested as described herein for other ActRIIa polypeptide variants.
- an ActRIIa polypeptide When an ActRIIa polypeptide is produced in cells by cleaving a nascent form of the ActRIIa polypeptide, post- translational processing may also be important for correct folding and/or function of the protein. Different cells (such as CHO, HeLa, MDCK, WI38, NIH-3T3 or HEK293) have specific cellular machinery and characteristic mechanisms for such post-translational activities and may be chosen to ensure the correct modification and processing of the ActRIIa polypeptides.
- functional variants or modified forms of the ActRIIa polypeptides include fusion proteins having at least a portion of the ActRIIa polypeptides and one or more fusion domains.
- fusion domains include, but are not limited to, polyhistidine, Glu-Glu, glutathione S transferase (GST), thioredoxin, protein A, protein G, an immunoglobulin heavy chain constant region (Fc), maltose binding protein (MBP), or human serum albumin.
- a fusion domain may be selected so as to confer a desired property.
- some fusion domains are particularly useful for isolation of the fusion proteins by affinity chromatography.
- relevant matrices for affinity chromatography such as glutathione-, amylase-, and nickel- or cobalt- conjugated resins are used.
- fusion domain may be selected so as to facilitate detection of the ActRIIa polypeptides.
- detection domains include the various fluorescent proteins (e.g., GFP) as well as "epitope tags," which are usually short peptide sequences for which a specific antibody is available.
- epitope tags for which specific monoclonal antibodies are readily available include FLAG, influenza virus haemagglutinin (HA), and c-myc tags.
- the fusion domains have a protease cleavage site, such as for Factor Xa or Thrombin, which allows the relevant protease to partially digest the fusion proteins and thereby liberate the recombinant proteins therefrom. The liberated proteins can then be isolated from the fusion domain by subsequent chromatographic separation.
- an ActRIIa polypeptide is fused with a domain that stabilizes the ActRIIa polypeptide in vivo (a "stabilizer” domain).
- stabilizing is meant anything that increases serum half life, regardless of whether this is because of decreased destruction, decreased clearance by the kidney, or other pharmacokinetic effect.
- Fusions with the Fc portion of an immunoglobulin are known to confer desirable pharmacokinetic properties on a wide range of proteins. Likewise, fusions to human serum albumin can confer desirable properties. Other types of fusion domains that may be selected include multimerizing (e.g., dimerizing, tetramerizing) domains and functional domains (that confer an additional biological function).
- the present invention provides methods for treating or preventing breast cancer using a fusion protein comprising a soluble extracellular domain of ActRIIa fused to an Fc domain (e.g., SEQ ID NO: 6).
- the Fc domain has one or more mutations at residues such as Asp-265, lysine 322, and Asn-434.
- the mutant Fc domain having one or more of these mutations has reduced ability of binding to the Fc ⁇ receptor relative to a wildtype Fc domain.
- the mutant Fc domain having one or more of these mutations e.g., Asn-434 mutation
- FcRN MHC class I- related Fc-receptor
- an Fc domain may include smaller or larger portions of the constant region of an immunoglobulin, provided that the resulting "Fc domain" retains the ability to dimerize covalently through a disulfide linkage and forms a relative stable, soluble protein.
- an ActRIIa polypeptide may be placed C-terminal to a heterologous domain, or, alternatively, a heterologous domain may be placed C-terminal to an ActRIIa polypeptide.
- the ActRIIa polypeptide domain and the heterologous domain need not be adjacent in a fusion protein, and additional domains or amino acid sequences may be included C- or N-terminal to either domain or between the domains.
- ActRIIa polypeptides useful in accordance with the methods described herein may contain one or more modifications that are capable of stabilizing the ActRIIa polypeptides.
- modifications enhance the in vitro half life of the ActRIIa polypeptides, enhance circulatory half life of the ActRIIa polypeptides or reducing proteolytic degradation of the ActRIIa polypeptides.
- stabilizing modifications include, but are not limited to, fusion proteins (including, for example, fusion proteins comprising an ActRIIa polypeptide and a stabilizer domain), modifications of a glycosylation site (including, for example, addition of a glycosylation site to an ActRIIa polypeptide), and modifications of carbohydrate moiety (including, for example, removal of carbohydrate moieties from an ActRIIa polypeptide).
- fusion proteins including, for example, fusion proteins comprising an ActRIIa polypeptide and a stabilizer domain
- modifications of a glycosylation site including, for example, addition of a glycosylation site to an ActRIIa polypeptide
- carbohydrate moiety including, for example, removal of carbohydrate moieties from an ActRIIa polypeptide.
- stabilizer domain not only refers to a fusion domain (e.g., Fc) as in the case of fusion proteins, but also includes nonproteinaceous modifications such as a carbohydrate moiety, or nonproteinace
- the methods described herein utilize isolated and/or purified forms of the ActRIIa polypeptides, which are isolated from, or otherwise substantially free of, other proteins.
- ActRIIa polypeptides will generally be produced by expression from recombinant nucleic acids.
- nucleic Acids Encoding ActRIIa Polypeptides Provided herein are isolated and/or recombinant nucleic acids encoding any of the
- ActRIIa polypeptides e.g., soluble ActRIIa polypeptides
- SEQ ID NO: 4 encodes the naturally occurring human ActRIIa precursor polypeptide
- SEQ ID NO: 5 encodes the processed extracellular domain of ActRIIa.
- the subject nucleic acids may be single-stranded or double stranded. Such nucleic acids may be DNA or RNA molecules. These nucleic acids may be used, for example, in methods for making ActRIIa polypeptides or as direct therapeutic agents (e.g., in a gene therapy approach).
- the subject nucleic acids encoding ActRIIa polypeptides are further understood to include nucleic acids that are variants of SEQ ID NO: 4 or 5.
- Variant nucleotide sequences include sequences that differ by one or more nucleotide substitutions, additions or deletions, such as allelic variants.
- the invention provides methods for treating or preventing breast cancer using isolated or recombinant nucleic acid sequences that are at least 80%, 85%, 90%, 95%, 97%, 98%, 99% or 100% identical to SEQ ID NO: 4 or 5.
- nucleic acid sequences complementary to SEQ ID NO: 4 or 5, and variants of SEQ ID NO: 4 or 5 are also within the scope of this invention.
- the nucleic acid sequences described herein can be isolated, recombinant, and/or fused with a heterologous nucleotide sequence, or in a DNA library.
- nucleic acids useful in accordance with the methods described herein also include nucleotide sequences that hybridize under highly stringent conditions to the nucleotide sequence designated in SEQ ID NO: 4 or 5, complement sequence of SEQ ID NO: 4 or 5, or fragments thereof.
- SSC sodium chloride/sodium citrate
- the salt concentration in the wash step can be selected from a low stringency of about 2.0 x SSC at 50 °C to a high stringency of about 0.2 x SSC at 50 °C.
- the temperature in the wash step can be increased from low stringency conditions at room temperature, about 22 °C, to high stringency conditions at about 65 °C. Both temperature and salt may be varied, or temperature or salt concentration may be held constant while the other variable is changed.
- the methods described herein utilize nucleic acids which hybridize under low stringency conditions of 6 x SSC at room temperature followed by a wash at 2 x SSC at room temperature. Isolated nucleic acids which differ from the nucleic acids as set forth in SEQ ID NOs:
- nucleotides up to about 3-5% of the nucleotides
- nucleic acids encoding a particular protein may exist among individuals of a given species due to natural allelic variation. Any and all such nucleotide variations and resulting amino acid polymorphisms are within the scope of this invention.
- the recombinant nucleic acids described herein may be operably linked to one or more regulatory nucleotide sequences in an expression construct.
- Regulatory nucleotide sequences will generally be appropriate to the host cell used for expression.
- suitable regulatory sequences are known in the art for a variety of host cells.
- said one or more regulatory nucleotide sequences may include, but are not limited to, promoter sequences, leader or signal sequences, ribosomal binding sites, transcriptional start and termination sequences, translational start and termination sequences, and enhancer or activator sequences. Constitutive or inducible promoters as known in the art are contemplated by the invention.
- the promoters may be either naturally occurring promoters, or hybrid promoters that combine elements of more than one promoter.
- An expression construct may be present in a cell on an episome, such as a plasmid, or the expression construct may be inserted in a chromosome.
- the expression vector contains a selectable marker gene to allow the selection of transformed host cells. Selectable marker genes are well known in the art and will vary with the host cell used.
- the methods described herein utilize an expression vector comprising a nucleotide sequence encoding an ActRIIa polypeptide that is operably linked to at least one regulatory sequence.
- Regulatory sequences are art-recognized and are selected to direct expression of the ActRIIa polypeptide.
- the term regulatory sequence includes promoters, enhancers, and other expression control elements. Exemplary regulatory sequences are described in Goeddel; Gene Expression Technology: Methods in Enzymology, Academic Press, San Diego, CA (1990). For instance, any of a wide variety of expression control sequences that control the expression of a DNA sequence when operatively linked to it may be used in these vectors to express DNA sequences encoding an ActRIIa polypeptide.
- Such useful expression control sequences include, for example, the early and late promoters of SV40, tet promoter, adenovirus or cytomegalovirus immediate early promoter, RSV promoters, the lac system, the trp system, the TAC or TRC system, T7 promoter whose expression is directed by T7 RNA polymerase, the major operator and promoter regions of phage lambda , the control regions for fd coat protein, the promoter for 3-phosphoglycerate kinase or other glycolytic enzymes, the promoters of acid phosphatase, e.g., Pho5, the promoters of the yeast ⁇ -mating factors, the polyhedron promoter of the baculovirus system and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells or their viruses, and various combinations thereof.
- a recombinant nucleic acid described herein can be produced by ligating the cloned gene, or a portion thereof, into a vector suitable for expression in either prokaryotic cells, eukaryotic cells (yeast, avian, insect or mammalian), or both.
- Expression vehicles for production of a recombinant ActRIIa polypeptide include plasmids and other vectors.
- suitable vectors include plasmids of the types: pBR322-derived plasmids, pEMBL- derived plasmids, pEX-derived plasmids, pBTac-derived plasmids and pUC-derived plasmids for expression in prokaryotic cells, such as E. coli.
- Some mammalian expression vectors contain both prokaryotic sequences to facilitate the propagation of the vector in bacteria, and one or more eukaryotic transcription units that are expressed in eukaryotic cells.
- the pcDNAI/amp, pcDNAI/neo, pRc/CMV, pSV2gpt, pSV2neo, pSV2-dhfr, pTk2, pRSVneo, pMSG, pSVT7, pko-neo and pHyg derived vectors are examples of mammalian expression vectors suitable for transfection of eukaryotic cells.
- vectors are modified with sequences from bacterial plasmids, such as pBR322, to facilitate replication and drug resistance selection in both prokaryotic and eukaryotic cells.
- bacterial plasmids such as pBR322
- derivatives of viruses such as the bovine papilloma virus (BPV-I), or Epstein- Barr virus (pHEBo, pREP-derived and p205) can be used for transient expression of proteins in eukaryotic cells.
- BBV-I bovine papilloma virus
- pHEBo Epstein- Barr virus
- examples of other viral (including retroviral) expression systems can be found below in the description of gene therapy delivery systems.
- the various methods employed in the preparation of the plasmids and in transformation of host organisms are well known in the art.
- baculovirus expression systems include pVL-derived vectors (such as pVL1392, pVL1393 and pVL941), pAcUW-derived vectors (such as pAcUWl), and pBlueBac-derived vectors (such as the ⁇ -gal containing pBlueBac III).
- pVL-derived vectors such as pVL1392, pVL1393 and pVL941
- pAcUW-derived vectors such as pAcUWl
- pBlueBac-derived vectors such as the ⁇ -gal containing pBlueBac III.
- a vector will be designed for production of the subject ActRIIa polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif.), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise).
- a vector will be designed for production of the subject ActRIIa polypeptides in CHO cells, such as a Pcmv-Script vector (Stratagene, La Jolla, Calif.), pcDNA4 vectors (Invitrogen, Carlsbad, Calif.) and pCI-neo vectors (Promega, Madison, Wise).
- the subject gene constructs can be used to cause expression of the subject ActRIIa polypeptides in cells propagated in culture, e.g., to produce proteins, including fusion proteins or variant proteins, for purification.
- This disclosure also pertains to a host cell transfected with a recombinant gene including a coding sequence (e.g., SEQ ID NO: 4 or 5) for one or more of the subject ActRIIa polypeptides.
- the host cell may be any prokaryotic or eukaryotic cell.
- an ActRIIa polypeptide described herein may be expressed in bacterial cells such as E. coli, insect cells (e.g., using a baculovirus expression system), yeast, or mammalian cells. Other suitable host cells are known to those skilled in the art.
- a host cell transfected with an expression vector encoding an ActRIIa polypeptide can be cultured under appropriate conditions to allow expression of the ActRIIa polypeptide to occur.
- the ActRIIa polypeptide may be secreted and isolated from a mixture of cells and medium containing the ActRIIa polypeptide.
- the ActRIIa polypeptide may be retained cytoplasmically or in a membrane fraction and the cells harvested, lysed and the protein isolated.
- a cell culture includes host cells, media and other byproducts. Suitable media for cell culture are well known in the art.
- the subject ActRIIa polypeptides can be isolated from cell culture medium, host cells, or both, using techniques known in the art for purifying proteins, including ion-exchange chromatography, gel filtration chromatography, ultrafiltration, electrophoresis, immunoaffinity purification with antibodies specific for particular epitopes of the ActRIIa polypeptides and affinity purification with an agent that binds to a domain fused to the ActRIIa polypeptide (e.g., a protein A column may be used to purify an ActRIIa-Fc fusion).
- the ActRIIa polypeptide is a fusion protein containing a domain which facilitates its purification.
- purification is achieved by a series of column chromatography steps, including, for example, three or more of the following, in any order: protein A chromatography, Q sepharose chromatography, phenylsepharose chromatography, size exclusion chromatography, and cation exchange chromatography.
- the purification could be completed with viral filtration and buffer exchange.
- ActRIIa-hFc protein was purified to a purity of >98% as determined by size exclusion chromatography and >95% as determined by SDS PAGE. This level of purity was sufficient to achieve desirable results in mice, rats and non- human primates.
- a fusion gene coding for a purification leader sequence such as a poly-(His)/enterokinase cleavage site sequence at the N-terminus of the desired portion of the recombinant ActRIIa polypeptide, can allow purification of the expressed fusion protein by affinity chromatography using a Ni 2+ metal resin.
- the purification leader sequence can then be subsequently removed by treatment with enterokinase to provide the purified ActRIIa polypeptide (e.g., see Hochuli et al., (1987) J. Chromatography 411 : 177; and Janknecht et al., PNAS USA 88:8972).
- fusion genes are well known. Essentially, the joining of various DNA fragments coding for different polypeptide sequences is performed in accordance with conventional techniques, employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation.
- the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers.
- PCR amplification of gene fragments can be carried out using anchor primers which give rise to complementary overhangs between two consecutive gene fragments which can subsequently be annealed to generate a chimeric gene sequence (see, for example, Current Protocols in Molecular Biology, eds. Ausubel et al., John Wiley & Sons: 1992). 4. Alternative Activin and ActRIIa Antagonists
- the present disclosure relates to methods for treating or preventing breast cancer using antagonists of activin- ActRIIa signaling.
- soluble ActRIIa polypeptides and particularly Actrlla-Fc, are preferred antagonists, and although such antagonists may affect breast cancer cell growth or survival through a mechanism other than activin antagonism (e.g., activin inhibition may be an indicator of the tendency of an agent to inhibit the activities of a spectrum of molecules, including, perhaps, other members of the TGF -beta superfamily, and such collective inhibition may lead to the desired effect on breast cancer cell growth or survival), other types of activin-ActRIIa antagonists are expected to be useful, including anti-activin (e.g., activin ⁇ A , ⁇ B , ⁇ c and ⁇ ) antibodies, anti-ActRIIa antibodies, antisense, RNAi or ribozyme nucleic acids that inhibit the production of ActRIIa and other inhibitors of activin or ActRIIa, particularly those that disrupt activin-ActRIIa
- ActRIIa polypeptide and which either binds competitively to ligand with the ActRIIa polypeptide or otherwise inhibits ActRIIa-mediated signaling may be used as an antagonist of ActRIIa polypeptide activities.
- an antibody that is specifically reactive with an activin ⁇ A , ⁇ , ⁇ c or ⁇ e polypeptide, or any heterodimer thereof, and which disrupts ActRIIa binding may be used as an antagonist.
- anti-protein/anti-peptide antisera or monoclonal antibodies can be made by standard protocols (see, for example, Antibodies: A Laboratory Manual ed. by Harlow and Lane (Cold Spring Harbor Press: 1988)).
- a mammal such as a mouse, a hamster or rabbit can be immunized with an immunogenic form of the ActRIIa polypeptide, an antigenic fragment which is capable of eliciting an antibody response, or a fusion protein.
- Techniques for conferring immunogenicity on a protein or peptide include conjugation to carriers or other techniques well known in the art.
- An immunogenic portion of an ActRIIa or activin polypeptide can be administered in the presence of adjuvant.
- the progress of immunization can be monitored by detection of antibody titers in plasma or serum.
- Standard ELISA or other immunoassays can be used with the immunogen as antigen to assess the levels of antibodies.
- antibody-producing cells can be harvested from an immunized animal and fused by standard somatic cell fusion procedures with immortalizing cells such as myeloma cells to yield hybridoma cells.
- Hybridoma cells can be screened immunochemically for production of antibodies specifically reactive with an ActRIIa polypeptide and monoclonal antibodies isolated from a culture comprising such hybridoma cells.
- Antibodies may also be generated by screening libraries (e.g., phage display libraries) of antibody variable domains or Fab fragments to identify binders that bind to the selected antigen (e.g., activins or ActRIIa). This in vitro approach is often useful with proteins that are highly conserved between mammals, particularly mice and humans.
- antibody as used herein is intended to include whole antibodies, e.g., of any isotype (IgG, IgA, IgM, IgE, etc), and includes fragments or domains of immunoglobulins which are reactive with a selected antigen.
- Antibodies can be fragmented using conventional techniques and the fragments screened for utility and/or interaction with a specific epitope of interest.
- the term includes segments of proteolytically-cleaved or recombinantly-prepared portions of an antibody molecule that are capable of selectively reacting with a certain protein.
- Non-limiting examples of such proteolytic and/or recombinant fragments include Fab, F(ab') 2 , Fab', Fv, and single chain antibodies (scFv) containing a V[L] and/or V[H] domain joined by a peptide linker.
- the scFv's may be covalently or non- covalently linked to form antibodies having two or more binding sites.
- the term antibody also includes polyclonal, monoclonal, or other purified preparations of antibodies and recombinant antibodies.
- recombinant antibody means an antibody, or antigen binding domain of an immunoglobulin, expressed from a nucleic acid that has been constructed using the techniques of molecular biology, such as a humanized antibody or a fully human antibody developed from a single chain antibody. Single domain and single chain antibodies are also included within the term "recombinant antibody”.
- the methods described herein may utilize an antibody, such as, for example, a monoclonal antibody. Also provided are methods for generating novel antibodies.
- a method for generating a monoclonal antibody that binds specifically to an ActRIIa polypeptide or activin polypeptide may comprise administering to a mouse an amount of an immunogenic composition comprising the antigen polypeptide effective to stimulate a detectable immune response, obtaining antibody-producing cells (e.g., cells from the spleen) from the mouse and fusing the antibody-producing cells with myeloma cells to obtain antibody-producing hybridomas, and testing the antibody-producing hybridomas to identify a hybridoma that produces a monocolonal antibody that binds specifically to the antigen.
- antibody-producing cells e.g., cells from the spleen
- a hybridoma can be propagated in a cell culture, optionally in culture conditions where the hybridoma-derived cells produce the monoclonal antibody that binds specifically to the antigen.
- the monoclonal antibody may be purified from the cell culture.
- the adjective "specifically reactive with” as used in reference to an antibody is intended to mean, as is generally understood in the art, that the antibody is sufficiently selective between the antigen of interest (e.g., an ActRIIa polypeptide) and other antigens that are not of interest that the antibody is useful for, at minimum, detecting the presence of the antigen of interest in a particular type of biological sample. In certain methods employing the antibody, such as therapeutic applications, a higher degree of specificity in binding may be desirable. Monoclonal antibodies generally have a greater tendency (as compared to polyclonal antibodies) to discriminate effectively between the desired antigens and cross- reacting polypeptides. One characteristic that influences the specificity of an antibody:antigen interaction is the affinity of the antibody for the antigen.
- antibodies will have an affinity (a dissociation constant) of about 10 "6 , 10 "7 , 10 "8 , 10 "9 M or less.
- affinity a dissociation constant
- the techniques used to screen antibodies in order to identify a desirable antibody may influence the properties of the antibody obtained. For example, if an antibody is to be used for binding an antigen in solution, it may be desirable to test solution binding. A variety of different techniques are available for testing interaction between antibodies and antigens to identify particularly desirable antibodies.
- Such techniques include ELISAs, surface plasmon resonance binding assays (e.g., the BiacoreTM binding assay, Biacore AB, Uppsala, Sweden), sandwich assays (e.g., the paramagnetic bead system of IGEN International, Inc., Gaithersburg, Maryland), western blots, immunoprecipitation assays, and immunohistochemistry.
- Examples of categories of nucleic acid compounds that are activin or ActRIIa antagonists include antisense nucleic acids, RNAi constructs and catalytic nucleic acid constructs.
- a nucleic acid compound may be single or double stranded.
- a double stranded compound may also include regions of overhang or non-complementarity, where one or the other of the strands is single stranded.
- a single stranded compound may include regions of self-complementarity, meaning that the compound forms a so-called “hairpin” or “stem-loop” structure, with a region of double helical structure.
- a nucleic acid compound may comprise a nucleotide sequence that is complementary to a region consisting of no more than 1000, no more than 500, no more than 250, no more than 100, or no more than 50, 35, 25, 22, 20, 18 or 15 nucleotides of the full-length ActRIIa nucleic acid sequence or activin P A , P B , ⁇ c > or ⁇ nucleic acid sequence.
- the region of complementarity will preferably be at least 8 nucleotides, and optionally about 18 to 35 nucleotides.
- a region of complementarity may fall within an intron, a coding sequence or a noncoding sequence of the target transcript, such as the coding sequence portion.
- a nucleic acid compound will have a length of about 8 to about 500 nucleotides or base pairs in length, and optionally the length will be about 14 to about 50 nucleotides.
- a nucleic acid may be a DNA (particularly for use as an antisense), RNA or RNA:DNA hybrid. Any one strand may include a mixture of DNA and RNA, as well as modified forms that cannot readily be classified as either DNA or RNA.
- a double stranded compound may be DNA:DNA, DNA:RNA or RNA:RNA, and any one strand may also include a mixture of DNA and RNA, as well as modified forms that cannot readily be classified as either DNA or RNA.
- a nucleic acid compound may include any of a variety of modifications, including one or modifications to the backbone (the sugar-phosphate portion in a natural nucleic acid, including internucleotide linkages) or the base portion (the purine or pyrimidine portion of a natural nucleic acid).
- An antisense nucleic acid compound will preferably have a length of about 15 to about 30 nucleotides and will often contain one or more modifications to improve characteristics such as stability in the serum, in a cell or in a place where the compound is likely to be delivered, such as the stomach in the case of orally delivered compounds and the lung for inhaled compounds.
- the strand complementary to the target transcript will generally be RNA or modifications thereof.
- the other strand may be RNA, DNA or any other variation.
- the duplex portion of double stranded or single stranded "hairpin" RNAi construct will generally have a length of 18 to 40 nucleotides in length and optionally about 21 to 23 nucleotides in length, so long as it serves as a Dicer substrate.
- Catalytic or enzymatic nucleic acids may be ribozymes or DNA enzymes and may also contain modified forms.
- Nucleic acid compounds may inhibit expression of the target by about 50%, 75%, 90% or more when contacted with cells under physiological conditions and at a concentration where a nonsense or sense control has little or no effect. Preferred concentrations for testing the effect of nucleic acid compounds are 1, 5 and 10 micromolar. Nucleic acid compounds may also be tested for effects on, for example, the proliferation or survival of breast cancer cells or breast tumors.
- the present invention relates to the use of ActRIIa polypeptides
- soluble ActRIIa polypeptides e.g., soluble ActRIIa polypeptides
- activin polypeptides e.g., soluble ActRIIa polypeptides
- Compounds identified through this screening can be tested to assess their ability to modulate the growth or survival of cancer cells, particularly breast cancer cells, in vivo or in vitro. These compounds can be tested, for example, in animal models such as mouse xenograft models.
- One useful animal model is the murine MDA-MB231 breast cancer model; MDA-MB231 cells are hormone-independent and are prone to metastasize to the bone.
- Other animal models of breast cancer can be generated, for example, by implanting rat neuroblastoma cells (from which the neu oncogene was initially isolated), or neu-transformed N1H-3T3 cells into nude mice, essentially as described by Drebin et al. Proc. Nat. Acad. Sci. USA, 83: 9129- 9133 (1986).
- high-throughput screening of compounds can be carried out to identify agents that perturb activin or ActRIIa-mediated effects on a selected cell line.
- the assay is carried out to screen and identify compounds that specifically inhibit or reduce binding of an ActRIIa polypeptide to activin.
- the assay can be used to identify compounds that enhance binding of an ActRIIa polypeptide to activin.
- the compounds can be identified by their ability to interact with an activin or ActRIIa polypeptide.
- test compounds may be created by any combinatorial chemical method.
- the subject compounds may be naturally occurring biomolecules synthesized in vivo or in vitro.
- Compounds (agents) to be tested for their ability to act as modulators of tissue growth can be produced, for example, by bacteria, yeast, plants or other organisms (e.g., natural products), produced chemically (e.g., small molecules, including peptidomimetics), or produced recombinantly.
- Test compounds contemplated herein include non-peptidyl organic molecules, peptides, polypeptides, peptidomimetics, sugars, hormones, and nucleic acid molecules.
- the test agent is a small organic molecule having a molecular weight of less than about 2,000 Daltons.
- Test compounds can be provided as single, discrete entities, or provided in libraries of greater complexity, such as made by combinatorial chemistry. These libraries can comprise, for example, alcohols, alkyl halides, amines, amides, esters, aldehydes, ethers and other classes of organic compounds. Presentation of test compounds to the test system can be in either an isolated form or as mixtures of compounds, especially in initial screening steps. Optionally, the compounds may be optionally derivatized with other compounds and have derivatizing groups that facilitate isolation of the compounds.
- Non-limiting examples of derivatizing groups include biotin, fluorescein, digoxygenin, green fluorescent protein, isotopes, polyhistidine, magnetic beads, glutathione S transferase (GST), photoactivatible crosslinkers or any combinations thereof.
- the compound of interest is contacted with an isolated and purified ActRIIa polypeptide which is ordinarily capable of binding to activin.
- an isolated and purified ActRIIa polypeptide which is ordinarily capable of binding to activin.
- a composition containing an ActRIIa ligand is then added to the mixture of the compound and ActRIIa polypeptide.
- Detection and quantification of ActRIIa/activin complexes provides a means for determining the compound's efficacy at inhibiting (or potentiating) complex formation between the ActRIIa polypeptide and activin.
- the efficacy of the compound can be assessed by generating dose response curves from data obtained using various concentrations of the test compound.
- a control assay can also be performed to provide a baseline for comparison.
- a composition containing the ActRIIa polypeptide for example, isolated and purified activin is added to a composition containing the ActRIIa polypeptide, and the formation of ActRIIa/activin complex is quantitated in the absence of the test compound.
- reactants may be admixed can be varied, and can be admixed simultaneously.
- cellular extracts and lysates may be used to render a suitable cell-free assay system.
- Complex formation between the ActRIIa polypeptide and activin may be detected by a variety of techniques. For instance, modulation of the formation of complexes can be quantitated using, for example, detectably labeled proteins such as radiolabeled (e.g., 32 P, 35 S, 14 C or 3 H), fluorescently labeled (e.g., FITC), or enzymatically labeled ActRIIa polypeptide or activin, by immunoassay, or by chromatographic detection.
- detectably labeled proteins such as radiolabeled (e.g., 32 P, 35 S, 14 C or 3 H), fluorescently labeled (e.g., FITC), or enzymatically labeled ActRIIa polypeptide or activin, by immunoassay, or by chromatographic detection.
- fluorescence polarization assays and fluorescence resonance energy transfer (FRET) assays may be used for measuring, either directly or indirectly, the degree of interaction between an ActRIIa polypeptide and its binding protein.
- FRET fluorescence resonance energy transfer
- Other suitable modes of detection include, for example, those based on optical waveguides (PCT Publication WO 96/26432 and U.S. Pat. No. 5,677,196), surface plasmon resonance (SPR), surface charge sensors, and surface force sensors.
- An interaction trap assay also known as the "two hybrid assay,” may also be used for identifying agents that disrupt or potentiate interaction between an ActRIIa polypeptide and its binding protein. See for example, U.S. Pat. No. 5,283,317; Zervos et al. (1993) Cell 72:223-232; Madura et al. (1993) J Biol Chem 268:12046-12054; Bartel et al. (1993) Biotechniques 14:920-924; and Iwabuchi et al. (1993) Oncogene 8:1693-1696).
- a reverse two hybrid system may be used to identify compounds (e.g., small molecules or peptides) that dissociate interactions between an ActRIIa polypeptide and its binding protein. See for example, Vidal and Legrain, (1999) Nucleic Acids Res 27:919-29; Vidal and Legrain, (1999) Trends Biotechnol 17:374-81; and U.S. Pat. Nos. 5,525,490; 5,955,280; and 5,965,368.
- compounds are identified by their ability to interact with an ActRIIa or activin polypeptide described herein.
- the interaction between the compound and the ActRIIa or activin polypeptide may be covalent or non-covalent.
- such interaction can be identified at the protein level using in vitro biochemical methods, including photo-crosslinking, radiolabeled ligand binding, and affinity chromatography (Jakoby WB et al., 1974, Methods in Enzymology 46: 1).
- the compounds may be screened in a mechanism based assay, such as an assay to detect compounds which bind to an activin or ActRIIa polypeptide. This may include a solid phase or fluid phase binding event.
- the gene encoding an activin or ActRIIa polypeptide can be transfected with a reporter system (e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein) into a cell and screened against the library optionally by a high throughput screening or with individual members of the library.
- a reporter system e.g., ⁇ -galactosidase, luciferase, or green fluorescent protein
- Other mechanism based binding assays may be used, for example, binding assays which detect changes in free energy. Binding assays can be performed with the target fixed to a well, bead or chip or captured by an immobilized antibody or resolved by capillary electrophoresis. The bound compounds may be detected usually using colorimetric or fluorescence or surface plasmon resonance.
- the present invention provides methods of treating or preventing breast cancer in an individual in need thereof by administering to the individual a therapeutically effective amount of an activin-ActRIIa antagonist, such as, for example, an ActRIIa polypeptide.
- an activin-ActRIIa antagonist such as, for example, an ActRIIa polypeptide.
- These methods may be used for therapeutic as well as prophylactic treatment of humans, particularly females, who have a high risk for developing breast cancer.
- a woman with a high risk for developing breast cancer is a woman whose risk factors confer a greater probability of developing the disease compared to the general population or the population of women within a certain age group.
- Exemplary risk factors include age, family history or genetic makeup, lifestyle habits such as exercise and diet, exposure to radiation or other cancer- causing agents, age at the time the first child was born, genetic changes, and weight gain after menopause.
- a therapeutic that "prevents" a disorder or condition refers to a compound that, in a statistical sample, reduces the occurrence of the disorder or condition in the treated sample relative to an untreated control sample, or delays the onset of one or more symptoms or characteristics of the disorder or condition relative to the untreated control sample.
- preventing breast cancer may refer to the absence of new lesions following treatment, or the absence or delay of metastatic disease.
- treating breast cancer refers to an improvement of one or more symptoms or characteristics of the disease relative to an untreated control or relative to the severity of disease prior to treatment. The term does not necessarily require that the patient receiving the treatment be cured or that the disease be completely eradicated from the patient.
- An agent that treats breast cancer may be an agent that reduces the severity of one or more symptoms or characteristics of the disease. It should be noted that tumor growth and progression is influenced by a variety of factors, including mediators of cell cycle progression and cell division and regulators of cell death, or apoptosis. Accordingly, treating breast cancer may involve a decrease in cancer cell proliferation or a decrease in the rate of cell division. Alternatively or additionally, treating breast cancer may involve a decrease in cancer cell survival, an increase in apoptosis or a diminished occurrence or severity of metastatic breast cancer, particularly metastatic breast cancer of the bone. Accordingly, in certain embodiments, treating breast cancer may involve both a decrease in cell division and an increase in cell death.
- the effectiveness of an agent in treating breast cancer may be determined by observable metrics, such as a lower number of cancer cells compared to a control (either due to decreased proliferation, increased apoptosis, or both), or a decrease in tumor size compared to a control. Therefore treating breast cancer or inhibiting tumor or cancer cell growth is intended to be neutral as to the mechanism by which such a change occurs. Both prevention and treatment may be discerned in the diagnosis provided by a physician or other health care provider and the analysis of the intended result of administration of the therapeutic agent.
- an effect may be evaluated by a decrease or disappearance of measurable disease, and/or the absence of new lesions or the prevention of metastases.
- activin- ActRIla antagonists may significantly reduce or delay breast cancer progression in patients with both noninvasive and invasive breast cancer.
- the antagonists may prevent or reduce the risk of developing breast cancer in healthy women with risk factors for the disease.
- the antagonists may also reduce the risk of breast cancer recurrence in patients with a history of the disease.
- activin-ActRIIa antagonists may be used to prevent or delay the onset of breast cancer in individuals considered to be at risk for developing the disease, and such antagonists may be used in selected patient populations.
- appropriate patient populations include patients with a family history of breast and ovarian cancer, such as female patients where a mother or sister has been diagnosed with the disease. Patients that have mutations in the BRCA 1/2 genes or other genes shown to predispose women to breast and ovarian cancer are also included.
- a patient considered to be at high risk for developing breast cancer but who has not been diagnosed with the disease is treated with an activin-ActRIIa antagonist.
- Such treatment may begin when the patient reaches the age of 30, 35, or 40, or when a female patient is not trying to conceive (i.e., the patient does not plan to nurse an infant) or has reached menopause.
- activin-ActRIIa antagonists inhibit the metastatic spread of a breast cancer cell line introduced into the general circulation, demonstrating that such antagonists may be useful in preventing the metastases of breast tumors.
- Such compounds would be useful in treating any patient that has been diagnosed with breast cancer or suspected of having breast cancer.
- patients that are considering having a preventative, or elective, mastectomy due to an elevated risk of developing a breast tumor may elect instead or in addition to take an activin-ActRIIa antagonist to diminish the risk of metastatic spread of undetected tumors.
- Activin-ActRIIa antagonists disclosed herein, and particularly ActRIIa-Fc proteins may be used to treat or prevent breast cancer in a patient, including patients with solid tumors as well as patients with metastatic cancer. Activin-ActRIIa antagonists may also be administered to human subjects with precancerous or benign lesions of the breast or with any abnormal proliferative lesions including typical hyperplasia, atypical hyperplasia, and noninvasive or in situ carcinoma. The antagonists of the present disclosure are also useful in the treatment or prevention of both hormone-dependent or hormone-responsive cancers (e.g., estrogen receptor positive cancers) and hormone-independent cancers (e.g., estrogen receptor negative or estrogen receptor mutant cancers).
- hormone-dependent or hormone-responsive cancers e.g., estrogen receptor positive cancers
- hormone-independent cancers e.g., estrogen receptor negative or estrogen receptor mutant cancers
- Activin-ActRIIa antagonists are also useful as therapeutic agents for cancers in which growth factors or oncogenes are activated (e.g., breast cancers in which c-erbB-2 (also known as HER-2/Neu) tyrosine kinase is expressed).
- Activin-ActRIIa antagonists may prove to be particularly useful in tumors that express elevated (relative to normal breast tissue-derived cells) levels of activin (e.g., A, AB or B) or elevated levels of ActRIIa or ActRIIb.
- activin-ActRIIa antagonists may be used in combination therapies for the treatment, prevention, or management of breast cancer.
- the antagonists may be administered to patients in combination with radiation and/or surgical treatment as well as with cytotoxic chemotherapy and/or endocrine therapies.
- Such combination treatments may work synergistically and allow reduction of dosage of each of the individual treatments, thereby reducing the detrimental side effects exerted by each treatment at higher dosages.
- malignancies that are refractory to a treatment may respond to a combination therapy of two or more different treatments.
- the disclosure relates to the administration of an activin-ActRIIa antagonist in combination with another conventional anti-neoplastic agent, either concomitantly or sequentially, in order to enhance the therapeutic effect of the anti-neoplastic agent or overcome cellular resistance to such anti-neoplastic agent.
- Pharmaceutical compounds that may be used for combinatory anti-tumor therapy include, merely to illustrate: aminoglutethimide, amsacrine, anastrozole, asparaginase, beg, bicalutamide, bleomycin, buserelin, busulfan, campothecin, capecitabine, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, colchicine, cyclophosphamide, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, dienestrol, diethylstilbestrol, docetaxel, doxorubicin, epirubicin, estradiol, estramustine, etoposide, exemestane, filgrastim, fludarabine, fludrocortisone, fluorouracil, fluoxymesterone, flutamide, gemcitabine, geni
- chemotherapeutic anti-tumor compounds may be categorized by their mechanism of action into, for example, following groups: anti-metabolites/anti-cancer agents, such as pyrimidine analogs (5-fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine) and purine analogs, folate antagonists and related inhibitors (mercaptopurine, thioguanine, pentostatin and 2-chlorodeoxyadenosine (cladribine)); antiproliferative/antimitotic agents including natural products such as vinca alkaloids (vinblastine, vincristine, and vinorelbine), microtubule disruptors such as taxane (paclitaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, epidipodophyllotoxins (etoposide, teniposide), DNA damaging agents (actinomycin, amsacrine, anthra
- pharmaceutical compounds that may be used for combinatory therapy include anti-angiogenesis agents such as (1) inhibitors of release of "angiogenic molecules,” such as bFGF (basic fibroblast growth factor); (2) neutralizers of angiogenic molecules, such as an anti- ⁇ bFGF antibodies; and (3) inhibitors of endothelial cell response to angiogenic stimuli, including collagenase inhibitor, basement membrane turnover inhibitors, angiostatic steroids, fungal-derived angiogenesis inhibitors, platelet factor 4, thrombospondin, arthritis drugs such as D-penicillamine and gold thiomalate, vitamin D3 analogs, alpha-interferon, and the like.
- anti-angiogenesis agents such as (1) inhibitors of release of "angiogenic molecules,” such as bFGF (basic fibroblast growth factor); (2) neutralizers of angiogenic molecules, such as an anti- ⁇ bFGF antibodies; and (3) inhibitors of endothelial cell response to angiogenic stimuli, including collagenase inhibitor, basement membrane turnover inhibitors,
- angiogenesis there are a wide variety of compounds that can be used to inhibit angiogenesis, for example, peptides or agents that block the VEGF-mediated angiogenesis pathway, endostatin protein or derivatives, lysine binding fragments of angiostatin, melanin or melanin-promoting compounds, plasminogen fragments (e.g., Kringles 1-3 of plasminogen), tropoin subunits, antagonists of vitronectin ⁇ v ⁇ 3, peptides derived from Saposin B, antibiotics or analogs (e.g., tetracycline, or neomycin), dienogest-containing compositions, compounds comprising a MetAP-2 inhibitory core coupled to a peptide, the compound EM-138, chalcone and its analogs, and naaladase inhibitors.
- plasminogen fragments e.g., Kringles 1-3 of plasminogen
- tropoin subunits e.g., antagonists of vitro
- administration of the therapeutic antagonists of the invention may be continued while the other therapy is being administered and/or thereafter.
- Administration of the antagonists described herein may be made in a single dose, or in multiple doses.
- administration of the antagonists is commenced at least several days prior to the conventional therapy, while in other instances, administration is begun either immediately before or at the time of the administration of the conventional therapy.
- activin-ActRIIa antagonists described herein are formulated with a pharmaceutically acceptable carrier.
- an ActRIIa polypeptide can be administered alone or as a component of a pharmaceutical formulation (therapeutic composition).
- the subject antagonists may be formulated for administration in any convenient way for use in human or veterinary medicine.
- the methods for treating or preventing or breast cancer as described herein include administering the composition systemically, or locally as an implant or device.
- the therapeutic composition for use in this invention is, of course, in a pyrogen-free, physiologically acceptable form.
- Therapeutically useful agents other than the activin-ActRIIa antagonists which may also optionally be included in the composition as described above, may be administered simultaneously or sequentially with the subject antagonists in the methods of the invention.
- activin-ActRIIa antagonists will be administered parentally.
- Pharmaceutical compositions suitable for parenteral administration may comprise one or more ActRIIa polypeptides in combination with one or more pharmaceutically acceptable sterile isotonic aqueous or nonaqueous solutions, dispersions, suspensions or emulsions, or sterile powders which may be reconstituted into sterile injectable solutions or dispersions just prior to use, which may contain antioxidants, buffers, bacteriostats, solutes which render the formulation isotonic with the blood of the intended recipient or suspending or thickening agents.
- aqueous and nonaqueous carriers examples include water, ethanol, polyols (such as glycerol, propylene glycol, polyethylene glycol, and the like), and suitable mixtures thereof, vegetable oils, such as olive oil, and injectable organic esters, such as ethyl oleate.
- polyols such as glycerol, propylene glycol, polyethylene glycol, and the like
- vegetable oils such as olive oil
- injectable organic esters such as ethyl oleate.
- Proper fluidity can be maintained, for example, by the use of coating materials, such as lecithin, by the maintenance of the required particle size in the case of dispersions, and by the use of surfactants.
- the composition may be encapsulated or injected in a form for delivery to a target tissue site (e.g., mammary epithelium).
- compositions described herein may include a matrix capable of delivering one or more therapeutic compounds (e.g., ActRIIa polypeptides) to a target tissue site (e.g., mammary epithelium), providing a structure for the developing tissue and optimally capable of being resorbed into the body.
- a target tissue site e.g., mammary epithelium
- the matrix may provide slow release of the ActRIIa polypeptides.
- Such matrices may be formed of materials presently in use for other implanted medical applications.
- matrix material is based on biocompatibility, biodegradability, mechanical properties, cosmetic appearance and interface properties.
- Potential matrices for the compositions may be biodegradable and chemically defined calcium sulfate, tricalciumphosphate, hydroxyapatite, polylactic acid and polyanhydrides.
- Other potential materials are biodegradable and biologically well defined, such as bone or dermal collagen.
- Further matrices are comprised of pure proteins or extracellular matrix components.
- Other potential matrices are non-biodegradable and chemically defined, such as sintered hydroxyapatite, bioglass, aluminates, or other ceramics.
- Matrices may be comprised of combinations of any of the above mentioned types of material, such as polylactic acid and hydroxyapatite or collagen and tricalciumphosphate.
- the bioceramics may be altered in composition, such as in calcium-aluminate-phosphate and processing to alter pore size, particle size, particle shape, and biodegradability.
- antagonists described herein can be administered orally, e.g., in the form of capsules, cachets, pills, tablets, lozenges (using a flavored basis, usually sucrose and acacia or tragacanth), powders, granules, or as a solution or a suspension in an aqueous or non-aqueous liquid, or as an oil-in-water or water-in-oil liquid emulsion, or as an elixir or syrup, or as pastilles (using an inert base, such as gelatin and glycerin, or sucrose and acacia) and/or as mouth washes and the like, each containing a predetermined amount of an agent as an active ingredient.
- inert base such as gelatin and glycerin, or sucrose and acacia
- an antagonist may also be administered as a bolus, electuary or paste.
- one or more therapeutic antagonists may be mixed with one or more pharmaceutically acceptable carriers, such as sodium citrate or dicalcium phosphate, and/or any of the following: (1) fillers or extenders, such as starches, lactose, sucrose, glucose, mannitol, and/or silicic acid; (2) binders, such as, for example, carboxymethylcellulose, alginates, gelatin, polyvinyl pyrrolidone, sucrose, and/or acacia; (3) humectants, such as glycerol; (4) disintegrating agents, such as agar-agar, calcium carbonate, potato or tapioca starch, alginic acid, certain silicates, and sodium carbonate; (5) solution retarding agents, such as paraffin; (6) absorption accelerators, such as
- compositions may also comprise buffering agents.
- Solid compositions of a similar type may also be employed as fillers in soft and hard-filled gelatin capsules using such excipients as lactose or milk sugars, as well as high molecular weight polyethylene glycols and the like.
- Liquid dosage forms for oral administration include pharmaceutically acceptable emulsions, microemulsions, solutions, suspensions, syrups, and elixirs.
- the liquid dosage forms may contain inert diluents commonly used in the art, such as water or other solvents, solubilizing agents and emulsifiers, such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene glycol, oils (in particular, cottonseed, groundnut, corn, germ, olive, castor, and sesame oils), glycerol, tetrahydrofuryl alcohol, polyethylene glycols and fatty acid esters of sorbitan, and mixtures thereof.
- the oral compositions can also include adjuvants such as wetting agents, emulsifying and suspending agents,
- Suspensions in addition to the active compounds, may contain suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
- suspending agents such as ethoxylated isostearyl alcohols, polyoxyethylene sorbitol, and sorbitan esters, microcrystalline cellulose, aluminum metahydroxide, bentonite, agar-agar and tragacanth, and mixtures thereof.
- compositions useful in accordance with the methods described herein may also contain adjuvants, such as preservatives, wetting agents, emulsifying agents and dispersing agents. Prevention of the action of microorganisms may be ensured by the inclusion of various antibacterial and antifungal agents, for example, paraben, chlorobutanol, phenol sorbic acid, and the like. It may also be desirable to include isotonic agents, such as sugars, sodium chloride, and the like into the compositions. In addition, prolonged absorption of the injectable pharmaceutical form may be brought about by the inclusion of agents which delay absorption, such as aluminum monostearate and gelatin.
- the dosage regimen suitable for treating or preventing breast cancer will be determined by the attending physician considering various factors which modify the action of the subject compounds of the invention (e.g., ActRIIa polypeptides).
- the various factors include, but are not limited to, the patient's age, sex, and diet, the severity of the disease, time of administration, and other clinical factors.
- the addition of other known growth factors to the final composition may also affect the dosage. Progress can be monitored by periodic assessment of various factors including but not limited to tumor size, stage, or histological grade, estrogen or progesterone receptor status, angioinvasion, and regional lymph node metastasis.
- the clinician may also monitor markers such as levels of the protein uPA/PAIl — high levels of uPA and PAIl are associated with a high risk of metastasis — and Her-2 gene amplification and/or protein expression, which is also associated with metastasis (Weigelt et al. 2005 Nat. Rev. Cancer 5: 591-602). Gene expression profiling may also prove to be helpful in monitoring disease progression (van 't Veer et al. 2002 Nature 415: 530-536 and van de Vijver et al. 2002 N. Engl. J. Med. 347: 1999-2009).
- the present invention also provides methods for treating or preventing breast cancer that involve gene therapy for the in vivo production of ActRIIa polypeptides.
- Such therapy would achieve its therapeutic effect by introduction of the ActRIIa polynucleotide sequences into cells or tissues involved in breast cancer, such as, for example, mammary epithelial cells.
- Delivery of ActRIIa polynucleotide sequences can be achieved using a recombinant expression vector such as a chimeric virus or a colloidal dispersion system.
- Preferred for therapeutic delivery of ActRIIa polynucleotide sequences is the use of targeted liposomes.
- RNA virus such as a retrovirus
- the retroviral vector may be a derivative of a murine or avian retrovirus.
- retroviral vectors in which a single foreign gene can be inserted include, but are not limited to: Moloney murine leukemia virus (MoMuLV), Harvey murine sarcoma virus (HaMuSV), murine mammary tumor virus (MuMTV), and Rous Sarcoma Virus (RSV).
- MoMuLV Moloney murine leukemia virus
- HaMuSV Harvey murine sarcoma virus
- MuMTV murine mammary tumor virus
- RSV Rous Sarcoma Virus
- Retroviral vectors can transfer or incorporate a gene for a selectable marker so that transduced cells can be identified and generated.
- Retroviral vectors can be made target-specific by attaching, for example, a sugar, a glycolipid, or a protein. Preferred targeting is accomplished by using an antibody.
- specific polynucleotide sequences can be inserted into the retroviral genome or attached to a viral envelope to allow target specific delivery of the retroviral vector containing the ActRIIa polynucleotide.
- tissue culture cells can be directly transfected with plasmids encoding the retroviral structural genes gag, pol and env, by conventional calcium phosphate transfection. These cells are then transfected with the vector plasmid containing the genes of interest. The resulting cells release the retroviral vector into the culture medium.
- Another targeted delivery system for ActRIIa polynucleotides is a colloidal dispersion system. Colloidal dispersion systems include macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. The preferred colloidal system of this invention is a liposome.
- Liposomes are artificial membrane vesicles which are useful as delivery vehicles in vitro and in vivo. RNA, DNA and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form (see e.g., Fraley, et al., Trends Biochem. Sci., 6:77, 1981 ). Methods for efficient gene transfer using a liposome vehicle, are known in the art, see e.g., Mannino, et al., Biotechniques, 6:682, 1988.
- the composition of the liposome is usually a combination of phospholipids, usually in combination with steroids, especially cholesterol. Other phospholipids or other lipids may also be used.
- the physical characteristics of liposomes depend on pH, ionic strength, and the presence of divalent cations.
- lipids useful in liposome production include phosphatidyl compounds, such as phosphatidylglycerol, phosphatidylcholine, phosphatidylserine, phosphatidylethanolamine, sphingolipids, cerebrosides, and gangliosides.
- Illustrative phospholipids include egg phosphatidylcholine, dipalmitoylphosphatidylcholine, and distearoylphosphatidylcholine.
- the targeting of liposomes is also possible based on, for example, organ-specificity, cell-specificity, and organelle-specificity and is known in the art.
- Applicants constructed a soluble ActRIIa fusion protein that has the extracellular domain of human ActRIIa fused to a human or mouse Fc domain with a minimal linker in between.
- the constructs are referred to as ActRIIa-hFc and ActRIIa-mFc, respectively.
- ActRIIa-hFc is shown below as purified from CHO cell lines (SEQ ID NO: 7): ILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCF ATWKNISGSIEIVKQG CWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPK PPTGGGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAKTKPREEOYNSTYRVVSVLTVLHODWLNGKEYKCKVSNKALP VPIEKTISKAKGOPREPOVYTLPPSREEMTKNOVSLTCLVKGFYPSDIAVEWESNGOP ENNYKTTPPVLDSDGSFFLYSKLTVDKSRWOOGNVFSCSVMHEALHNHYTOKSLSL SPGK
- HBML Honey bee melitin
- MKFLVNVALVFMVVYISYIYA SEQ ID NO: 8
- Tissue Plasminogen Activator Tissue Plasminogen Activator: MDAMKRGLCCVLLLCGAVFVSP (SEQ ID NO: 9), and
- ActRIIa-hFc and ActRIIa-mFc showed a high affinity for ligands, particularly activin A.
- GDF-11 or Activin A (“ActA") were immobilized on a Biacore CM5 chip using standard amine coupling procedure.
- ActA Activin A
- ActA Activin A
- ActIa-hFc and ActRIIa-mFc proteins were loaded onto the system, and binding was measured.
- ActRIIa-hFc bound to activin with a dissociation constant (K 0 ) of 5x10 12 , and the protein bound to GDFl 1 with a K D of 9.96x10 "9 . See Figure 2.
- ActRIIa-mFc behaved similarly.
- the ActRIIa-hFc was very stable in pharmacokinetic studies. Rats were dosed with 1 mg/kg, 3 mg/kg or 10 mg/kg of ActRIIa-hFc protein and plasma levels of the protein were measured at 24, 48, 72, 144 and 168 hours. In a separate study, rats were dosed at 1 mg/kg, 10 mg/kg or 30 mg/kg.
- ActRIIa-hFc had an 11-14 day serum half life and circulating levels of the drug were quite high after two weeks (1 1 ⁇ g/ml, 1 10 ⁇ g/ml or 304 ⁇ g/ml for initial administrations of 1 mg/kg, 10 mg/kg or 30 mg/kg, respectively.)
- the plasma half life was substantially greater than 14 days and circulating levels of the drug were 25 ⁇ g/ml, 304 ⁇ g/ml or 1440 ⁇ g/ml for initial administrations of 1 mg/kg, 10 mg/kg or 30 mg/kg, respectively.
- Example 2 Characterization of an ActRIIa-hFc Protein ActRIIa-hFc fusion protein was expressed in stably transfected CHO-DUKX BI l cells from a pAID4 vector (SV40 ori/enhancer, CMV promoter), using a tissue plasminogen leader sequence of SEQ ID NO:9.
- the Fc portion is a human IgGl Fc sequence, as shown in SEQ ID NO:7.
- Sialic acid analysis showed that the protein contained, on average, between about 1.5 and 2.5 moles of sialic acid per molecule of ActRIIa-hFc fusion protein.
- This purified protein showed a remarkably long serum half-life in all animals tested, including a half-life of 25-32 days in human patients (see Example 3, below).
- the CHO cell expressed material has a higher affinity for activin B ligand than that reported for an ActRIIa- hFc fusion protein expressed in human 293 cells (del Re et al., J Biol Chem. 2004 Dec 17;279(51):53126-35.).
- the use of the tPa leader sequence provided greater production than other leader sequences and, unlike ActRIIa-Fc expressed with a native leader, provided a highly pure N-terminal sequence. Use of the native leader sequence resulted in two major species of ActRIIa-Fc, each having a different N-terminal sequence.
- Example 2 The protein described in Example 2 was administered to human patients in a randomized, double-blind, placebo-controlled study that was conducted to evaluate, primarily, the safety of the protein in healthy, postmenopausal women. Forty-eight subjects were randomized in cohorts of 6 to receive either a single dose of ActRIIa-hFc or placebo (5 active: 1 placebo). Dose levels ranged from 0.01 to 3.0 mg/kg intravenously (IV) and 0.03 to 0.1 mg/kg subcutaneously (SC). All subjects were followed for 120 days. Subjects were excluded from study participation if they took medications affecting bone metabolism within 6 months of study entry. Safety evaluations were conducted following each cohort to determine dose escalation. In addition to pharmacokinetic (PK) analyses, the biologic activity of ActRIIa-hFc was also assessed by measurement of biochemical markers of bone formation and resorption, and FSH levels.
- PK pharmacokinetic
- AEs Adverse events
- Preliminary analysis of AEs included headache, elevated laboratory values, cold symptoms, emesis or vomiting, intravenous infiltration, and hematoma at injection site.
- PK analysis of ActRIIa-hFc displayed a linear profile with dose, and a mean half-life of approximately 25-32 days.
- the area-under-curve (AUC) for ActRIIa-hFc was linearly related to dose, and the absorption after SC dosing was essentially complete.
- ActRIIa-hFc caused a rapid, sustained dose-dependent increase in serum levels of bone-specific alkaline phosphatase (BAP), which is a marker for anabolic bone growth, and a dose-dependent decrease in C-terminal type 1 collagen telopeptide and tartrate-resistant acid phosphatase 5b levels, which are markers for bone resorption.
- BAP bone-specific alkaline phosphatase
- Other markers, such as PlNP showed inconclusive results.
- BAP levels showed near saturating effects at the highest dosage of drug, indicating that half-maximal effects on this anabolic bone biomarker could be achieved at a dosage of 0.3 mg/kg, with increases ranging up to 3 mg/kg.
- the EC50 is 51,465 (day*ng/ml). These bone biomarker changes were sustained for approximately 120 days at the highest dose levels tested. There was also a dose-dependent decrease in serum FSH levels consistent with inhibition of activin.
- ActRIIa-hFc is an osteoanabolic agent with biological evidence of both an increase in bone formation and a decrease in bone resorption.
- MDA-MB-231 A subline of the human breast cancer cell line MDA-MB-231 (clone 2287, Kang et al. Cancer Cell 2003, vol 3:537-549) was cultured in vitro and cells harvested at a density of 5 x 10 6 cells/ml.
- PIXIMus dual energy x-ray absorptiometry
- Mice were treated with ActRIIa-mFc for 4 weeks and then sacrificed and tibae (both tumor injected and untumored) were collected from each animal. Tibiae were then processed and prepared for microcomputed tomography (microCT) and histological analysis.
- microCT microcomputed tomography
- Intratibial injection of MDA-MB-231 cells into athymic nude mice promoted the development of osteolytic bone lesions in the injected tibia compared to the contralateral leg.
- MicroCT analysis of the proximal tibia demonstrated a 62%, reduction in cancellous bone volume in the MDA-MB-231 bearing tibiae compared to the untumored tibia in PBS vehicle treated mice.
- ActRIIa-mFc treatment led to an increase of 70% or 147% in the na ⁇ ve or tumor bearing tibia respectively compared to vehicle (P ⁇ 0.01 for both).
- ActRIIa-mFc is able to eliminate the bone damage associated with the presence of breast tumor cells in the bone.
- MDA-MB-231 cells can be introduced into mice by intracardiac injection. Cells injected into the left ventricle will migrate through the bloodstream and form metastatic lesions at distal sites.
- a derivative cell line MDA-MB-231- luc-D3H2LN (Caliper Life Sciences) is a luciferase expressing cell line that allows for noninvasive monitoring of metastatic tumor formation using biophotonic imaging technology (Caliper Life Sciences). This model was used to evaluate the potential of ActRIIa-mFc to diminish the formation of metastatic breast cancer lesions.
- MDA-MB-23 l -luc-D3H2LN cells were introduced by intracardiac injection into twenty-six athymic nude mice. Fourteen of the mice were treated with vehicle (Phosphate buffered saline-PBS) and twelve were treated with ActRIIa-mFc (10 mg/kg, twice weekly, subcutaneous injection) starting two weeks prior to tumor administration and continuing through the course of the study. An additional nine mice were mock injected with cells and treated with ActRIIa-mFc. Mice were periodically anaesthetized and visualized for bioluminescent emission to detect the formation of metastatic progression..
- vehicle Phosphate buffered saline-PBS
- ActRIIa-mFc 10 mg/kg, twice weekly, subcutaneous injection
- the ActRIIa-mFc treatment group showed substantially reduced development of metastatic lesions.
- week five twelve of fourteen vehicle treated mice showed multiple, strong fluorescent signals indicative of metastatic spread, while only four of twelve ActRIIa- mFc treated mice showed similar lesions ( Figure 3).
- a quantitation of fluorescence intensity showed a roughly ten-fold decrease in fluorescence signal in the treated mice.
- the ActRIIa-mFc treatment markedly increased survival of the mice.
- all (14/14) of the vehicle treated mice had died or had been euthanized (according to standard procedures for humane treatment of study animals), while only two (2/12) of the ActRIIa-mFc treated mice had died or had been euthanized.
- 3/12 ActRIIa-mFc treated mice had died or had been euthanized, and none of the mock injected mice had died.
- ActRIIa-mFc treatment causes a substantial decrease in the formation of metastatic lesions, and promotes survival, in this model of metastatic breast cancer.
- Example 6 Alternative ActRIIa-Fc Proteins
- ActRIIa variants that may be used according to the methods described herein are described in the International Patent Application published as WO2006/012627 (see e.g., pp. 55-60), incorporated herein by reference in its entirety.
- An alternative construct may have a deletion of the C-terminal tail (the final 15 amino acids of the extracellular domain of ActRIIa. The sequence for such a construct is presented below (Fc portion underlined)(SEQ ID NO: 12):
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Cell Biology (AREA)
- Biochemistry (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Pharmacology & Pharmacy (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Genetics & Genomics (AREA)
- Microbiology (AREA)
- Biotechnology (AREA)
- Gastroenterology & Hepatology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Epidemiology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- Food Science & Technology (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Wood Science & Technology (AREA)
- Toxicology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Engineering & Computer Science (AREA)
- Oncology (AREA)
- Physical Education & Sports Medicine (AREA)
- Biophysics (AREA)
Priority Applications (16)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| MX2009008222A MX2009008222A (es) | 2007-02-01 | 2008-02-01 | Antagonistas de activina-actriia y usos para tratar o prevenir cancer de mama. |
| RU2009132663/15A RU2473362C2 (ru) | 2007-02-01 | 2008-02-01 | АНТАГОНИСТЫ АКТИВИНА-ActRIIa-Fc И ИХ ПРИМЕНЕНИЕ ДЛЯ ЛЕЧЕНИЯ ИЛИ ПРОФИЛАКТИКИ РАКА МОЛОЧНОЙ ЖЕЛЕЗЫ |
| KR1020097017346A KR101526613B1 (ko) | 2007-02-01 | 2008-02-01 | 액티빈-actrⅱa 길항제 및 유방암을 치료 또는 예방하기 위한 이들의 용도 |
| BRPI0806861-5A BRPI0806861A2 (pt) | 2007-02-01 | 2008-02-01 | Antagonistas de ativina-actriia e usos para tratar ou prevenir câncer de mama |
| EP08725118.7A EP2111229B1 (en) | 2007-02-01 | 2008-02-01 | Pharmaceutical compositions comprising Activin-ActRIIA antagonists for use in preventing or treating breast cancer metastasis or breast cancer related bone loss |
| MX2014007015A MX354099B (es) | 2007-02-01 | 2008-02-01 | Antagonistas de activina-actriia y usos para tratar o prevenir cancer de mama. |
| CN200880011264.XA CN101835485B (zh) | 2007-02-01 | 2008-02-01 | 活化素-actriia拮抗剂及在治疗或预防乳腺癌中的用途 |
| HK10104102.5A HK1137146B (en) | 2007-02-01 | 2008-02-01 | Pharmaceutical compositions comprising activin-actriia antagonists for use in preventing or treating breast cancer metastasis or breast cancer related bone loss |
| AU2008211007A AU2008211007B2 (en) | 2007-02-01 | 2008-02-01 | Activin-ActRIIa antagonists and uses for treating or preventing breast cancer |
| JP2009548327A JP5237970B2 (ja) | 2007-02-01 | 2008-02-01 | 乳癌を治療または予防するためのアクチビンActRIIaアンタゴニストおよび使用 |
| KR1020147031360A KR20140137463A (ko) | 2007-02-01 | 2008-02-01 | 액티빈-actrⅱa 길항제 및 유방암을 치료 또는 예방하기 위한 이들의 용도 |
| CA002677007A CA2677007A1 (en) | 2007-02-01 | 2008-02-01 | Activin-actriia antagonists and uses for treating or preventing breast cancer |
| ES08725118T ES2415666T3 (es) | 2007-02-01 | 2008-02-01 | Composiciones farmacéuticas que comprenden antagonistas de Activina-ActRIIa para uso en la prevención o el tratamiento de metástasis de cáncer de mama o pérdida ósea relacionada con el cáncer de mama |
| IL200186A IL200186A (en) | 2007-02-01 | 2009-07-30 | Pharmacotherapy for the treatment or prevention of metastatic breast cancer in a person with an actinic fusion protein iia type receptor - fc |
| IL242168A IL242168A0 (en) | 2007-02-01 | 2015-10-20 | Activin actriia antagonists and uses for the treatment or prevention of breast cancer |
| IL242169A IL242169A0 (en) | 2007-02-01 | 2015-10-20 | Activin actriia antagonists and uses for the treatment or prevention of breast cancer |
Applications Claiming Priority (4)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US89907007P | 2007-02-01 | 2007-02-01 | |
| US60/899,070 | 2007-02-01 | ||
| US54007P | 2007-10-25 | 2007-10-25 | |
| US61/000,540 | 2007-10-25 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2008094708A2 true WO2008094708A2 (en) | 2008-08-07 |
| WO2008094708A3 WO2008094708A3 (en) | 2008-11-06 |
Family
ID=39386169
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2008/001429 Ceased WO2008094708A2 (en) | 2007-02-01 | 2008-02-01 | Activin-actriia antagonists and uses for treating or preventing breast cancer |
Country Status (16)
| Country | Link |
|---|---|
| US (2) | US9526759B2 (enExample) |
| EP (2) | EP2599495A1 (enExample) |
| JP (4) | JP5237970B2 (enExample) |
| KR (2) | KR101526613B1 (enExample) |
| CN (3) | CN103920139B (enExample) |
| AU (1) | AU2008211007B2 (enExample) |
| BR (1) | BRPI0806861A2 (enExample) |
| CA (1) | CA2677007A1 (enExample) |
| ES (1) | ES2415666T3 (enExample) |
| HK (1) | HK1199833A1 (enExample) |
| IL (3) | IL200186A (enExample) |
| MX (2) | MX2009008222A (enExample) |
| RU (2) | RU2473362C2 (enExample) |
| TR (1) | TR200906131T1 (enExample) |
| TW (3) | TWI480048B (enExample) |
| WO (1) | WO2008094708A2 (enExample) |
Cited By (29)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2009158035A2 (en) | 2008-06-26 | 2009-12-30 | Acceleron Pharma Inc. | Methods for dosing an activin-actriia antagonist and monitoring of treated patients |
| US8293881B2 (en) | 2009-06-12 | 2012-10-23 | Acceleron Pharma Inc. | Isolated nucleic acid encoding a truncated ActRIIB fusion protein |
| US8361957B2 (en) | 2008-08-14 | 2013-01-29 | Acceleron Pharma, Inc. | Isolated GDF trap polypeptide |
| US8367611B2 (en) | 2007-09-18 | 2013-02-05 | Acceleron Pharma Inc. | Activin-actriia antagonists for inhibiting germ cell maturation |
| US8486403B2 (en) | 2005-11-23 | 2013-07-16 | Acceleron Pharma, Inc. | Method of promoting bone growth by an anti-activin A antibody |
| CN103298832A (zh) * | 2010-11-08 | 2013-09-11 | 阿塞勒隆制药公司 | Actriia结合剂及其用途 |
| US8629109B2 (en) | 2005-11-23 | 2014-01-14 | Acceleron Pharma Inc. | Method for promoting bone growth using activin-actriia antagonists |
| US8703927B2 (en) | 2008-08-14 | 2014-04-22 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| US8703694B2 (en) | 2009-06-08 | 2014-04-22 | Acceleron Pharma, Inc. | Methods for increasing thermogenic adipocytes |
| US8710016B2 (en) | 2009-11-17 | 2014-04-29 | Acceleron Pharma, Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
| US8765663B2 (en) | 2009-01-13 | 2014-07-01 | Acceleron Pharma Inc. | Methods for increasing adiponectin |
| US8895016B2 (en) | 2006-12-18 | 2014-11-25 | Acceleron Pharma, Inc. | Antagonists of activin-actriia and uses for increasing red blood cell levels |
| US9138459B2 (en) | 2004-07-23 | 2015-09-22 | Acceleron Pharma Inc. | ACTRIIB-FC polynucleotides, polypeptides, and compositions |
| US9399669B2 (en) | 2007-02-02 | 2016-07-26 | Acceleron Pharma Inc. | Variants derived from ActRIIB |
| US9526759B2 (en) | 2007-02-01 | 2016-12-27 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating or preventing breast cancer |
| US9572865B2 (en) | 2005-11-23 | 2017-02-21 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating multiple myeloma |
| WO2017147182A1 (en) * | 2016-02-22 | 2017-08-31 | Acceleron Pharma Inc. | Actrii antagonists for use in increasing immune activity |
| US9850298B2 (en) | 2014-06-13 | 2017-12-26 | Acceleron Pharma Inc. | Methods for treating ulcers in thalassemia syndrome with an ActRIIB polypeptide |
| US10195249B2 (en) | 2012-11-02 | 2019-02-05 | Celgene Corporation | Activin-ActRII antagonists and uses for treating bone and other disorders |
| WO2019094751A1 (en) | 2017-11-09 | 2019-05-16 | Keros Therapeutics, Inc. | Activin receptor type iia variants and methods of use thereof |
| US11345760B2 (en) | 2014-06-25 | 2022-05-31 | UCB Biopharma SRL | Multispecific antibody constructs |
| US11471510B2 (en) | 2014-12-03 | 2022-10-18 | Celgene Corporation | Activin-ActRII antagonists and uses for treating anemia |
| US11717558B2 (en) | 2016-11-10 | 2023-08-08 | Keros Therapeutics, Inc. | Nucleic acid molecules encoding activin receptor type IIA variants |
| US11813308B2 (en) | 2014-10-09 | 2023-11-14 | Celgene Corporation | Treatment of cardiovascular disease using ActRII ligand traps |
| US11884715B2 (en) | 2018-01-12 | 2024-01-30 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12194076B2 (en) | 2016-07-27 | 2025-01-14 | Acceleron Pharma Inc. | Methods and compositions for treating myelofibrosis |
| US12343378B2 (en) | 2016-07-15 | 2025-07-01 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| US12364737B2 (en) | 2018-05-09 | 2025-07-22 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US12440539B2 (en) | 2020-03-20 | 2025-10-14 | Keros Therapeutics, Inc. | Methods of using activin receptor type IIB variants |
Families Citing this family (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20100028332A1 (en) * | 2006-12-18 | 2010-02-04 | Acceleron Pharma Inc. | Antagonists of actriib and uses for increasing red blood cell levels |
| EP2468291B1 (en) * | 2006-12-18 | 2017-11-22 | Acceleron Pharma, Inc. | Activin-actrii antagonists and uses for increasing red blood cell levels |
| CA2773494A1 (en) * | 2009-09-09 | 2011-03-17 | Acceleron Pharma Inc. | Actriib antagonists and dosing and uses thereof |
| CA2779472C (en) * | 2009-11-03 | 2021-03-16 | Acceleron Pharma Inc. | The use of a composition comprising an activin type iib receptor polypeptide in the treatment of fatty liver disease |
| US9809636B2 (en) | 2012-04-06 | 2017-11-07 | Acceleron Pharma Inc. | Methods for increasing red blood cell levels comprising administering BMP9 |
| JP6649895B2 (ja) | 2014-04-18 | 2020-02-19 | アクセルロン ファーマ, インコーポレイテッド | 赤血球レベルを増加させ、そして鎌状赤血球症を処置するための方法 |
| MA41119A (fr) * | 2014-12-03 | 2017-10-10 | Acceleron Pharma Inc | Méthodes de traitement de syndromes myélodysplasiques et d'anémie sidéroblastique |
| JP6810702B2 (ja) * | 2015-04-06 | 2021-01-06 | アクセルロン ファーマ インコーポレイテッド | シングルアームi型およびii型受容体融合タンパク質およびその使用 |
| EP4190805A3 (en) | 2015-05-20 | 2023-08-16 | Celgene Corporation | In vitro cell culture methods for beta-thalassemia using activin type ii receptor ligand traps |
| KR102457751B1 (ko) | 2016-03-10 | 2022-10-21 | 악셀레론 파마 인코포레이티드 | 액티빈 타입 2 수용체 결합 단백질 및 이의 용도 |
| AU2018214979A1 (en) * | 2017-02-01 | 2019-08-15 | Acceleron Pharma Inc. | TGFβ and actrii antagonists for use in increasing immune activity |
| WO2018183376A1 (en) | 2017-03-28 | 2018-10-04 | Rigel Pharmaceuticals, Inc. | Acvr2a-specific antibody and method of use thereof |
| KR20220088699A (ko) | 2019-09-27 | 2022-06-28 | 디스크 메디슨, 인크. | 골수섬유증 및 관련 상태의 치료 방법 |
| KR20230012539A (ko) | 2020-05-13 | 2023-01-26 | 디스크 메디슨, 인크. | 골수섬유증을 치료하기 위한 항-헤모주벨린 (hjv) 항체 |
| US12186370B1 (en) | 2020-11-05 | 2025-01-07 | Celgene Corporation | ACTRIIB ligand trap compositions and uses thereof |
Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2002032925A2 (en) | 2000-10-16 | 2002-04-25 | Phylos, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| WO2002088171A2 (en) | 2001-04-26 | 2002-11-07 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| WO2006012627A2 (en) | 2004-07-23 | 2006-02-02 | Acceleron Pharma Inc. | Actrii receptor polypeptides, methods and compositions |
| WO2006055689A2 (en) | 2004-11-16 | 2006-05-26 | Avidia Research Institute | Protein scaffolds and uses thereof |
Family Cites Families (217)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| JPH0637520B2 (ja) * | 1985-07-03 | 1994-05-18 | 味の素株式会社 | ポリペプチド |
| US4973577A (en) * | 1986-04-04 | 1990-11-27 | The Salk Institute For Biological Studies | FSH-releasing peptides |
| US5092885A (en) | 1987-02-12 | 1992-03-03 | The Government Of The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services | Peptides with laminin activity |
| US5080891A (en) | 1987-08-03 | 1992-01-14 | Ddi Pharmaceuticals, Inc. | Conjugates of superoxide dismutase coupled to high molecular weight polyalkylene glycols |
| US5223409A (en) | 1988-09-02 | 1993-06-29 | Protein Engineering Corp. | Directed evolution of novel binding proteins |
| US5198346A (en) | 1989-01-06 | 1993-03-30 | Protein Engineering Corp. | Generation and selection of novel DNA-binding proteins and polypeptides |
| US5096815A (en) | 1989-01-06 | 1992-03-17 | Protein Engineering Corporation | Generation and selection of novel dna-binding proteins and polypeptides |
| US5112946A (en) | 1989-07-06 | 1992-05-12 | Repligen Corporation | Modified pf4 compositions and methods of use |
| US5192744A (en) | 1990-01-12 | 1993-03-09 | Northwestern University | Method of inhibiting angiogenesis of tumors |
| US5202352A (en) | 1990-08-08 | 1993-04-13 | Takeda Chemical Industries, Ltd. | Intravascular embolizing agent containing angiogenesis-inhibiting substance |
| WO1992004913A1 (en) | 1990-09-13 | 1992-04-02 | Children's Hospital Medical Center Of Northern California | Method for increasing red blood cell production by treatment with activin or activin-related peptides |
| WO1992012717A2 (en) | 1991-01-15 | 1992-08-06 | A composition containing a tetracycline and use for inhibiting angiogenesis | |
| US5118667A (en) * | 1991-05-03 | 1992-06-02 | Celtrix Pharmaceuticals, Inc. | Bone growth factors and inhibitors of bone resorption for promoting bone formation |
| WO1992020793A1 (en) | 1991-05-10 | 1992-11-26 | The Salk Institute For Biological Studies | CLONING AND RECOMBINANT PRODUCTION OF RECEPTOR(S) OF THE ACTIVIN/TGF-β SUPERFAMILY |
| US6162896A (en) * | 1991-05-10 | 2000-12-19 | The Salk Institute For Biological Studies | Recombinant vertebrate activin receptors |
| US5885794A (en) * | 1991-05-10 | 1999-03-23 | The Salk Institute For Biological Studies | Recombinant production of vertebrate activin receptor polypeptides and identification of receptor DNAs in the activin/TGF-β superfamily |
| US20050186593A1 (en) | 1991-05-10 | 2005-08-25 | The Salk Institute For Biological Studies | Cloning and recombinant production of CRF receptor(s) |
| US5661007A (en) | 1991-06-25 | 1997-08-26 | Genetics Institute, Inc. | Bone morphogenetic protein-9 compositions |
| US6287816B1 (en) | 1991-06-25 | 2001-09-11 | Genetics Institute, Inc. | BMP-9 compositions |
| US6692925B1 (en) * | 1992-11-17 | 2004-02-17 | Ludwig Institute For Cancer Research | Proteins having serine/threonine kinase domains, corresponding nucleic acid molecules, and their use |
| EP1475440A3 (en) | 1993-01-12 | 2004-11-17 | The Johns Hopkins University School Of Medicine | Growth differentiation factor-3 |
| US6228879B1 (en) | 1997-10-16 | 2001-05-08 | The Children's Medical Center | Methods and compositions for inhibition of angiogenesis |
| US5637480A (en) | 1993-05-12 | 1997-06-10 | Genetics Institute, Inc. | DNA molecules encoding bone morphogenetic protein-10 |
| DE69433742T2 (de) | 1993-05-12 | 2005-07-07 | Genetics Institute, LLC, Cambridge | Bmp-10 zusammensetzungen |
| US5677196A (en) | 1993-05-18 | 1997-10-14 | University Of Utah Research Foundation | Apparatus and methods for multi-analyte homogeneous fluoro-immunoassays |
| US5831050A (en) * | 1993-06-07 | 1998-11-03 | Creative Biomolecules, Inc. | Morphogen cell surface receptor |
| EP0726948B1 (en) | 1993-10-14 | 2007-02-28 | President And Fellows Of Harvard College | Method of inducing and maintaining neuronal cells |
| US5525490A (en) | 1994-03-29 | 1996-06-11 | Onyx Pharmaceuticals, Inc. | Reverse two-hybrid method |
| US5837682A (en) | 1996-03-08 | 1998-11-17 | The Children's Medical Center Corporation | Angiostatin fragments and method of use |
| US5658876A (en) * | 1994-04-28 | 1997-08-19 | The General Hospital Corporation | Activin antagonists as novel contraceptives |
| US5760010A (en) * | 1995-01-01 | 1998-06-02 | Klein; Ira | Method of treating liver disorders with a macrolide antibiotic |
| US5814565A (en) | 1995-02-23 | 1998-09-29 | University Of Utah Research Foundation | Integrated optic waveguide immunosensor |
| CA2217545A1 (en) | 1995-04-11 | 1996-10-17 | Marc Vidal | Reverse two-hybrid systems |
| EP0857210B1 (en) | 1995-10-23 | 2003-09-03 | The Children's Medical Center Corporation | Therapeutic antiangiogenic compositions and methods |
| US6132988A (en) * | 1995-10-27 | 2000-10-17 | Takeda Chemical Industries, Ltd. | DNA encoding a neuronal cell-specific receptor protein |
| GB9526131D0 (en) | 1995-12-21 | 1996-02-21 | Celltech Therapeutics Ltd | Recombinant chimeric receptors |
| US6465431B1 (en) | 1999-11-17 | 2002-10-15 | Boston Life Sciences, Inc. | Pharmaceutical compositions comprising troponin subunits, fragments and homologs thereof and methods of their use to inhibit angiogenesis |
| US6004780A (en) * | 1996-03-26 | 1999-12-21 | Human Genome Sciences, Inc. | Growth factor HTTER36 |
| US20050244867A1 (en) * | 1996-03-26 | 2005-11-03 | Human Genome Sciences, Inc. | Growth factor HTTER36 |
| SK163598A3 (en) | 1996-05-31 | 1999-06-11 | Scripps Research Inst | Methods and compositions useful for inhibition of angiogenesis |
| EP0939816A1 (en) | 1996-10-25 | 1999-09-08 | G.D. SEARLE & CO. | Circularly permuted erythropoietin receptor agonists |
| US6573256B2 (en) | 1996-12-30 | 2003-06-03 | Bone Care International, Inc. | Method of inhibiting angiogenesis using active vitamin D analogues |
| US6605699B1 (en) * | 1997-01-21 | 2003-08-12 | Human Genome Sciences, Inc. | Galectin-11 polypeptides |
| US6034062A (en) | 1997-03-13 | 2000-03-07 | Genetics Institute, Inc. | Bone morphogenetic protein (BMP)-9 compositions and their uses |
| US6231880B1 (en) * | 1997-05-30 | 2001-05-15 | Susan P. Perrine | Compositions and administration of compositions for the treatment of blood disorders |
| US6696260B1 (en) * | 1997-08-01 | 2004-02-24 | The Johns Hopkins University School Of Medicine | Methods to identify growth differentiation factor (GDF) binding proteins |
| AU8666398A (en) | 1997-08-01 | 1999-02-22 | Johns Hopkins University School Of Medicine, The | Methods to identify growth differentiation factor (gdf) receptors |
| US6656475B1 (en) * | 1997-08-01 | 2003-12-02 | The Johns Hopkins University School Of Medicine | Growth differentiation factor receptors, agonists and antagonists thereof, and methods of using same |
| US6891082B2 (en) | 1997-08-01 | 2005-05-10 | The Johns Hopkins University School Of Medicine | Transgenic non-human animals expressing a truncated activintype II receptor |
| EP1015468A4 (en) * | 1997-08-29 | 2000-09-06 | Human Genome Sciences Inc | FOLLISTATINE-3 |
| US6953662B2 (en) * | 1997-08-29 | 2005-10-11 | Human Genome Sciences, Inc. | Follistatin-3 |
| JP3992298B2 (ja) | 1997-10-03 | 2007-10-17 | 中外製薬株式会社 | 天然ヒト型化抗体 |
| US6475784B1 (en) | 1997-11-14 | 2002-11-05 | Valentis, Inc. | Inhibition of angiogenesis by delivery of nucleic acids encoding anti-angiogenic polypeptides |
| EP1048673A4 (en) | 1997-12-26 | 2002-10-25 | Mochida Pharm Co Ltd | INHIBITOR OF NEO VASCULARIZATION, WHICH CONTAINS DIENOGEST AS AN ACTIVE ACTIVE SUBSTANCE |
| US6696411B1 (en) * | 1998-04-22 | 2004-02-24 | Cornell Research Foundation, Inc. | Canine erythropoietin gene and recombinant protein |
| CA2331620A1 (en) | 1998-05-11 | 1999-11-18 | The Endowment For Research In Human Biology, Inc. | Use of neomycin for treating angiogenesis-related diseases |
| US6413513B1 (en) | 1998-05-22 | 2002-07-02 | Entremed, Inc. | Compositions and methods for inhibiting endothelial cell proliferation and regulating angiogenesis using cancer markers |
| US6395718B1 (en) | 1998-07-06 | 2002-05-28 | Guilford Pharmaceuticals Inc. | Pharmaceutical compositions and methods of inhibiting angiogenesis using naaladase inhibitors |
| US6500431B1 (en) | 1998-07-13 | 2002-12-31 | University Of Southern California | Inhibitors of angiogenesis and tumor growth |
| IL140729A0 (en) | 1998-07-14 | 2002-02-10 | Bristol Myers Squibb Co | Lysine binding fragments of angiostatin, pharmaceutical compositions containing the same and processes for the preparation thereof |
| AU775289B2 (en) | 1998-08-21 | 2004-07-29 | Children's Medical Center Corporation | Use of melanin for inhibition of angiogenesis and macular degeneration |
| EP1113799A4 (en) * | 1998-09-17 | 2004-06-09 | Lilly Co Eli | PROTEIN-BASED PREPARATION |
| CA2343715C (en) * | 1998-09-22 | 2004-05-18 | Long Yu | New human growth differentiation factor encoding sequence and polypeptide encoded by such dna sequence and producing method thereof |
| US6472179B2 (en) | 1998-09-25 | 2002-10-29 | Regeneron Pharmaceuticals, Inc. | Receptor based antagonists and methods of making and using |
| US6548634B1 (en) * | 1998-09-30 | 2003-04-15 | Chiron Corporation | Synthetic peptides having FGF receptor affinity |
| US6238860B1 (en) | 1998-11-05 | 2001-05-29 | Dyax Corp. | Binding moieties for human parvovirus B19 |
| US6777205B1 (en) * | 1998-11-06 | 2004-08-17 | Sterrenbeld Biotechnologie North America, Inc. | Host cells expressing recombinant human erythropoietin |
| US20040009535A1 (en) | 1998-11-27 | 2004-01-15 | Celltech R&D, Inc. | Compositions and methods for increasing bone mineralization |
| BR0008188A (pt) | 1999-01-21 | 2002-02-13 | Metamorphix Inc | Inibidores de fator de diferenciação de crescimento e usos para os mesmos |
| US6914128B1 (en) | 1999-03-25 | 2005-07-05 | Abbott Gmbh & Co. Kg | Human antibodies that bind human IL-12 and methods for producing |
| AU777783B2 (en) | 1999-04-19 | 2004-10-28 | Kyowa Hakko Kogyo Co. Ltd. | Proliferation inhibitor for androgen-independent tumor |
| US6468543B1 (en) * | 1999-05-03 | 2002-10-22 | Zymogenetics, Inc. | Methods for promoting growth of bone using ZVEGF4 |
| HRP20020387A2 (en) | 1999-11-12 | 2005-10-31 | Maxygen Holdings Ltd. | Interferon gamma conjugates |
| WO2001043763A1 (en) | 1999-12-15 | 2001-06-21 | Research Development Foundation | Betaglycan as an inhibin receptor and uses thereof |
| CA2395191A1 (en) | 1999-12-23 | 2001-06-28 | Tedman Ehlers | Chalcone and its analogs as agents for the inhibition of angiogenesis and related disease states |
| US20030224501A1 (en) | 2000-03-17 | 2003-12-04 | Young Paul E. | Bone morphogenic protein polynucleotides, polypeptides, and antibodies |
| JP2003528632A (ja) | 2000-03-31 | 2003-09-30 | インスティティ・パスツール | 血管内皮成長因子(vegf)−媒介性脈管形成を阻害するペプチド、該ペプチドをエンコードするポリヌクレオチド及びその使用方法 |
| JP4487376B2 (ja) * | 2000-03-31 | 2010-06-23 | 味の素株式会社 | 腎疾患治療剤 |
| US6627424B1 (en) | 2000-05-26 | 2003-09-30 | Mj Bioworks, Inc. | Nucleic acid modifying enzymes |
| AU2001269709A1 (en) | 2000-07-19 | 2002-02-05 | Eli Lilly And Company | Nucleic acids, vectors, host cells, polypeptides, and uses thereof |
| US6632180B1 (en) | 2000-09-07 | 2003-10-14 | John H. Laragh | Method for evaluating and treating hypertension |
| DE10045591A1 (de) | 2000-09-15 | 2002-04-04 | Klaus Pfizenmaier | Ortsspezifische, antikörpervermittelte Aktivierung proapoptotischer Zytokine - AMAIZe (Antibody-Mediated Apoptosis Inducing Zytokine) |
| US7087224B2 (en) * | 2000-10-31 | 2006-08-08 | Amgen Inc. | Method of treating anemia by administering IL-1ra |
| US6548477B1 (en) | 2000-11-01 | 2003-04-15 | Praecis Pharmaceuticals Inc. | Therapeutic agents and methods of use thereof for the modulation of angiogenesis |
| AU2002225670B2 (en) | 2000-11-20 | 2006-05-11 | The Board Of Trustees Of The University Of Illinois | Membrane scaffold proteins |
| EP1370287A2 (en) | 2000-12-01 | 2003-12-17 | Wyeth | Method and composition for modulating bone growth |
| US20030082233A1 (en) | 2000-12-01 | 2003-05-01 | Lyons Karen M. | Method and composition for modulating bone growth |
| TW200526779A (en) * | 2001-02-08 | 2005-08-16 | Wyeth Corp | Modified and stabilized GDF propeptides and uses thereof |
| US20040132675A1 (en) * | 2002-02-08 | 2004-07-08 | Calvin Kuo | Method for treating cancer and increasing hematocrit levels |
| US7294472B2 (en) | 2001-03-14 | 2007-11-13 | Caden Biosciences | Method for identifying modulators of G protein coupled receptor signaling |
| US20040121008A1 (en) | 2001-03-16 | 2004-06-24 | Keiko Shiraishi | Process for producing sustained release preparation |
| DK1436003T3 (da) | 2001-05-24 | 2010-03-15 | Zymogenetics Inc | TACI-immunoglobulin-fusionsproteiner |
| AU2001286171B2 (en) * | 2001-05-25 | 2008-01-10 | Serono Genetics Institute S.A. | Human CDNAs and proteins and uses thereof |
| AUPR638101A0 (en) * | 2001-07-13 | 2001-08-09 | Bioa Pty Limited | Composition and method for treatment of disease |
| KR101021817B1 (ko) | 2001-07-17 | 2011-03-17 | 데이진 가부시키가이샤 | PPAR δ활성화 작용을 측정하는 것을 특징으로 하는 물질의 선택방법 및 약제 |
| US6855344B2 (en) * | 2001-07-17 | 2005-02-15 | Integrated Chinese Medicine Holdings, Ltd. | Compositions and methods for prostate and kidney health and disorders, an herbal preparation |
| KR100453877B1 (ko) | 2001-07-26 | 2004-10-20 | 메덱스젠 주식회사 | 연쇄체화에 의한 면역 글로블린 융합 단백질의 제조 방법 및 이 방법에 의해 제조된 TNFR/Fc 융합 단백질, 상기 단백질을 코딩하는 DNA, 상기 DNA를 포함하는벡터, 및 상기 벡터에 의한 형질전환체 |
| US7320789B2 (en) * | 2001-09-26 | 2008-01-22 | Wyeth | Antibody inhibitors of GDF-8 and uses thereof |
| US6784154B2 (en) * | 2001-11-01 | 2004-08-31 | University Of Utah Research Foundation | Method of use of erythropoietin to treat ischemic acute renal failure |
| US20030144203A1 (en) | 2001-12-19 | 2003-07-31 | Voyager Pharmaceutical Corporation | Methods for slowing senescence and treating and preventing diseases associated with senescence |
| US20060234918A1 (en) | 2001-12-19 | 2006-10-19 | Voyager Pharmaceutical Corporation | Methods for treating and preventing cancers that express the hypothalamic-pituitary-gonadal axis of hormones and receptors |
| US6998118B2 (en) * | 2001-12-21 | 2006-02-14 | The Salk Institute For Biological Studies | Targeted retrograde gene delivery for neuronal protection |
| WO2003068801A2 (en) | 2002-02-11 | 2003-08-21 | Genentech, Inc. | Antibody variants with faster antigen association rates |
| MXPA04008150A (es) * | 2002-02-21 | 2005-06-17 | Wyeth Corp | Gasp1: una proteina que contiene dominio de folistatina. |
| US20030219846A1 (en) | 2002-02-28 | 2003-11-27 | Pfizer Inc. | Assay for activity of the ActRIIB kinase |
| US8053552B2 (en) | 2002-04-18 | 2011-11-08 | Mtm Laboratories, Ag | Neopeptides and methods useful for detection and treatment of cancer |
| CA2497304A1 (en) | 2002-08-16 | 2004-02-26 | Wyeth | Bmp-2 estrogen responsive element and methods of using the same |
| US7261893B2 (en) * | 2002-10-22 | 2007-08-28 | Wyeth | Neutralizing antibodies against GDF-8 and uses therefor |
| US20040223966A1 (en) * | 2002-10-25 | 2004-11-11 | Wolfman Neil M. | ActRIIB fusion polypeptides and uses therefor |
| AU2002953327A0 (en) * | 2002-12-12 | 2003-01-09 | Monash University | Methods of diagnosing prognosing and treating activin associated diseases and conditions |
| DE04708802T1 (de) | 2003-02-07 | 2006-06-22 | Prometic Biosciences Inc., Montreal | Fettsäuren mittlerer kettenlänge, glyceride und analoga als stimulatoren der erythropoiese |
| WO2004086953A2 (en) | 2003-03-26 | 2004-10-14 | The Board Of Trustees Of The University Of Arkansas | Method for diagnosis and treatment of bone turnover |
| US20070184052A1 (en) * | 2003-05-09 | 2007-08-09 | Lin Herbert Y | Soluble tgf-b type III receptor fusion proteins |
| US7785587B2 (en) | 2003-06-02 | 2010-08-31 | Wyeth | Therapeutic methods for muscular or neuromuscular disorders |
| NZ544618A (en) | 2003-06-16 | 2009-02-28 | Celltech R & D Inc | Antibodies specific for sclerostin and methods for increasing bone mineralization |
| WO2005009460A2 (en) | 2003-07-25 | 2005-02-03 | Medexis, S.A. | Pharmaceutical composition comprising activin a, alk-4 or derivatives thereof for the treatment of ophthalmic disorders or cancer |
| US8895540B2 (en) | 2003-11-26 | 2014-11-25 | DePuy Synthes Products, LLC | Local intraosseous administration of bone forming agents and anti-resorptive agents, and devices therefor |
| EP1706428B1 (en) | 2004-01-22 | 2009-09-23 | MERCK PATENT GmbH | Anti-cancer antibodies with reduced complement fixation |
| US20050197292A1 (en) * | 2004-01-30 | 2005-09-08 | Glennda Smithson | Compositions and methods for treating T-cell mediated pathological conditions |
| WO2005094871A2 (en) | 2004-03-26 | 2005-10-13 | Acceleron Pharma Inc. | Bmp-3 propeptides and related methods |
| JP2008500816A (ja) | 2004-03-31 | 2008-01-17 | ゼンコー・インコーポレイテッド | 改善された性質を有するbmp−7変異体 |
| WO2005113590A2 (en) | 2004-05-12 | 2005-12-01 | Acceleron Pharma Inc. | Bmp10 propeptides and related methods |
| EP1771557B1 (en) | 2004-06-24 | 2014-12-31 | Acceleron Pharma Inc. | GDF3 Propeptides and Related Methods |
| EP1794191B1 (en) | 2004-08-05 | 2016-05-18 | The Regents of The University of California | Molecules with effects on cellular development and function |
| US20060034831A1 (en) | 2004-08-12 | 2006-02-16 | Wyeth | Combination therapy for diabetes, obesity and cardiovascular diseases using GDF-8 inhibitors |
| EP1804824B1 (en) | 2004-09-29 | 2017-01-04 | Icahn School of Medicine at Mount Sinai | Fsh and fsh receptor modulator compositions and methods for inhibiting osteoclastic bone resorption and bone loss in osteoporosis |
| NL1027887C2 (nl) | 2004-12-24 | 2006-06-27 | Bosch Gmbh Robert | Transmissie met gebombeerde poelieschijven en een drijfriem. |
| NZ538097A (en) | 2005-02-07 | 2006-07-28 | Ovita Ltd | Method and compositions for improving wound healing |
| US7968091B2 (en) | 2005-02-16 | 2011-06-28 | The General Hospital Corporation | Methods and compositions to regulate iron metabolism |
| JPWO2006115274A1 (ja) | 2005-04-26 | 2008-12-18 | 味の素株式会社 | 骨髄赤血球前駆細胞分化促進剤 |
| TWI323734B (en) | 2005-08-19 | 2010-04-21 | Abbott Lab | Dual variable domain immunoglobulin and uses thereof |
| JP2007099764A (ja) | 2005-09-09 | 2007-04-19 | Ajinomoto Co Inc | 血糖低下剤 |
| JP2009510093A (ja) | 2005-09-28 | 2009-03-12 | ザイモジェネティクス, インコーポレイテッド | Il−17aおよびil−17fアンタゴニストならびにその使用方法 |
| US8067562B2 (en) | 2005-11-01 | 2011-11-29 | Amgen Inc. | Isolated nucleic acid molecule comprising the amino acid sequence of SEQ ID NO:1 |
| EA201692543A1 (ru) | 2005-11-23 | 2017-08-31 | Акселерон Фарма Инк. | Антагонисты активина-actriia и их применение для стимулирования роста кости |
| US8128933B2 (en) | 2005-11-23 | 2012-03-06 | Acceleron Pharma, Inc. | Method of promoting bone growth by an anti-activin B antibody |
| SI1973559T1 (sl) * | 2005-11-23 | 2013-05-31 | Acceleron Pharma, Inc. | Aktivin-aktriia antagonisti in uporaba za pospeĺ evanje kostne rasti |
| US20070149458A1 (en) | 2005-12-06 | 2007-06-28 | Amgen Inc. | Uses of myostatin antagonists |
| WO2007071023A1 (en) | 2005-12-20 | 2007-06-28 | Merck Frosst Canada Ltd. | Heteroaromatic compounds as inhibitors of stearoyl-coenzyme a delta-9 desaturase |
| WO2007075702A2 (en) | 2005-12-21 | 2007-07-05 | Schering Corporation | Treatment of nonalcoholic fatty liver disease using cholesterol lowering agents and h3 receptor antagonist/inverse agonist |
| WO2007076127A2 (en) | 2005-12-22 | 2007-07-05 | Biogen Idec Ma Inc | Condensed imidazoles or pyrazoles and their use as transforming growth factor modulators |
| US7361510B2 (en) * | 2006-01-20 | 2008-04-22 | Beckman Coulter, Inc. | Methods of detection of iron deficiency |
| CA2637375A1 (en) | 2006-01-25 | 2007-08-02 | Wellstat Therapeutics Corporation | Compounds for the treatment of metabolic disorders |
| CA2642662A1 (en) | 2006-02-28 | 2007-09-07 | Wellstat Therapeutics Corporation | Compounds for the treatment of metabolic disorders |
| WO2007120767A2 (en) * | 2006-04-14 | 2007-10-25 | Amgen Inc. | Agonist erythropoietin receptor antibodies |
| WO2007123391A1 (en) | 2006-04-20 | 2007-11-01 | Academisch Ziekenhuis Leiden | Therapeutic intervention in a genetic disease in an individual by modifying expression of an aberrantly expressed gene. |
| BRPI0713096A2 (pt) * | 2006-05-09 | 2012-10-16 | Hemaquest Pharmaceuticals Inc | métodos para tratar distúrbios sangüìneos |
| BRPI0714882A2 (pt) * | 2006-07-21 | 2013-05-21 | Lyne Lab | composiÇço lÍquida de acetato de cÁlcio e uso de uma soluÇço aquosa que compreende entre cerca de 7% (p/v) e cerca de 21% (p/v) de acetato de cÁlcio |
| GB0615129D0 (en) | 2006-07-29 | 2006-09-06 | Univ Cardiff | Anti-cancer activity of BMP-9 and BMP-10 and their use in cancer therapies |
| CL2007002567A1 (es) | 2006-09-08 | 2008-02-01 | Amgen Inc | Proteinas aisladas de enlace a activina a humana. |
| US7547781B2 (en) * | 2006-09-11 | 2009-06-16 | Curis, Inc. | Quinazoline based EGFR inhibitors containing a zinc binding moiety |
| WO2008060139A1 (en) | 2006-11-17 | 2008-05-22 | Erasmus University Medical Center Rotterdam | Methods for controlling mineralization of extracellular matrix, therapeutic methods based thereon and medicaments for use therein |
| WO2008073292A2 (en) | 2006-12-08 | 2008-06-19 | Caritas St. Elizabeth's Medical Center Of Boston, Inc. | Method for protecting renal tubular epithelial cells from radiocontrast nephro parhy (rcn) |
| AU2007332473B2 (en) | 2006-12-14 | 2012-09-27 | Forerunner Pharma Research Co., Ltd. | Anti-Claudin-3 monoclonal antibody, and treatment and diagnosis of cancer using the same |
| US20100028332A1 (en) | 2006-12-18 | 2010-02-04 | Acceleron Pharma Inc. | Antagonists of actriib and uses for increasing red blood cell levels |
| EP2468291B1 (en) * | 2006-12-18 | 2017-11-22 | Acceleron Pharma, Inc. | Activin-actrii antagonists and uses for increasing red blood cell levels |
| US8895016B2 (en) | 2006-12-18 | 2014-11-25 | Acceleron Pharma, Inc. | Antagonists of activin-actriia and uses for increasing red blood cell levels |
| CA2677007A1 (en) | 2007-02-01 | 2008-08-07 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating or preventing breast cancer |
| TWI782836B (zh) | 2007-02-02 | 2022-11-01 | 美商艾瑟勒朗法瑪公司 | 衍生自ActRIIB的變體與其用途 |
| CA3039330C (en) * | 2007-02-09 | 2021-11-09 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for promoting bone growth in cancer patients |
| US8501678B2 (en) | 2007-03-06 | 2013-08-06 | Atara Biotherapeutics, Inc. | Variant activin receptor polypeptides and uses thereof |
| TWI573802B (zh) | 2007-03-06 | 2017-03-11 | 安美基公司 | 變異之活動素受體多肽及其用途 |
| US20090017019A1 (en) * | 2007-06-01 | 2009-01-15 | Wyeth | Methods and compositions for modulating bmp-10 activity |
| WO2009009059A1 (en) | 2007-07-09 | 2009-01-15 | Biogen Idec Ma Inc. | Spiro compounds as antagonists of tgf-beta |
| GB0715087D0 (en) | 2007-08-03 | 2007-09-12 | Summit Corp Plc | Drug combinations for the treatment of duchenne muscular dystrophy |
| LT2170396T (lt) | 2007-08-03 | 2017-03-10 | Summit (Oxford) Limited | Vaistų deriniai, skirti diušeno raumenų distrofijos gydymui |
| GB0715938D0 (en) | 2007-08-15 | 2007-09-26 | Vastox Plc | Method of treatment of duchenne muscular dystrophy |
| WO2009025651A1 (en) | 2007-08-17 | 2009-02-26 | University Of Maine System Board Of Trustees | Biologically active peptide and method of using the same |
| WO2009035629A1 (en) | 2007-09-13 | 2009-03-19 | Ludwig Institute Of Cancer Research | Method for modifying cellular immune response by modulating activin activity |
| CN103877564A (zh) | 2007-09-18 | 2014-06-25 | 阿塞勒隆制药公司 | 活化素-actriia拮抗剂和减少或抑制fsh分泌的用途 |
| PE20091163A1 (es) * | 2007-11-01 | 2009-08-09 | Wyeth Corp | Anticuerpos para gdf8 |
| US8043620B2 (en) | 2007-11-21 | 2011-10-25 | Amgen Inc. | Wise binding agents and epitopes |
| EP2265603B1 (en) | 2008-03-13 | 2014-05-07 | The General Hospital Corporation | Inhibitors of the bmp signaling pathway |
| WO2009137075A1 (en) | 2008-05-06 | 2009-11-12 | Acceleron Pharma Inc. | Anti-activin antibodies and uses for promoting bone growth |
| JP2011523357A (ja) | 2008-05-06 | 2011-08-11 | ジョスリン ダイアビーティス センター インコーポレイテッド | 褐色脂肪細胞分化を誘導するための方法および組成物 |
| NZ590326A (en) | 2008-06-26 | 2013-05-31 | Acceleron Pharma Inc | Antagonists of activin-actriia and uses for increasing red blood cell levels |
| US20100008918A1 (en) * | 2008-06-26 | 2010-01-14 | Acceleron Pharma Inc. | Methods for dosing an actriib antagonist and monitoring of treated patients |
| JP5922928B2 (ja) * | 2008-08-14 | 2016-05-24 | アクセルロン ファーマ, インコーポレイテッド | 赤血球レベルを高めるためのgdfトラップの使用 |
| US8216997B2 (en) | 2008-08-14 | 2012-07-10 | Acceleron Pharma, Inc. | Methods for increasing red blood cell levels and treating anemia using a combination of GDF traps and erythropoietin receptor activators |
| US20110293526A1 (en) | 2008-11-20 | 2011-12-01 | University Of Southern California | Compositions and methods to modulate hair growth |
| ME02652B (me) | 2008-11-26 | 2017-06-20 | Amgen Inc | Stabilizovana varijanta aktivin iib receptora |
| EP2387412A4 (en) * | 2009-01-13 | 2013-04-03 | Acceleron Pharma Inc | PROCESS FOR INCREASING THE ADIPONECTIN MIRROR |
| US8110355B2 (en) | 2009-02-20 | 2012-02-07 | GenRemedy, LLC | Methods for identifying agents that inhibit cell migration, promote cell adhesion and prevent metastasis |
| NO2424895T3 (enExample) | 2009-04-27 | 2018-02-03 | ||
| CN102482339B (zh) | 2009-06-08 | 2015-06-17 | 阿塞勒隆制药公司 | 用于增加产热脂肪细胞的方法 |
| EP2440577A4 (en) | 2009-06-12 | 2013-01-23 | Acceleron Pharma Inc | SHORTEN ACTRIIB FC FUSION PROTEINS |
| ES2796121T3 (es) | 2009-08-13 | 2020-11-25 | Acceleron Pharma Inc | Uso combinado de trampas de GDF y activadores del receptor de la eritropoyetina para aumentar los niveles de glóbulos rojos |
| CA2773494A1 (en) * | 2009-09-09 | 2011-03-17 | Acceleron Pharma Inc. | Actriib antagonists and dosing and uses thereof |
| CA2779472C (en) * | 2009-11-03 | 2021-03-16 | Acceleron Pharma Inc. | The use of a composition comprising an activin type iib receptor polypeptide in the treatment of fatty liver disease |
| ES2658292T3 (es) * | 2009-11-17 | 2018-03-09 | Acceleron Pharma, Inc. | Proteínas ActRIIB y variantes y usos de las mismas con respecto a la inducción de la utrofina para el tratamiento de la distrofia muscular |
| WO2012027065A2 (en) | 2010-08-27 | 2012-03-01 | Celgene Corporation | Combination therapy for treatment of disease |
| US8580922B2 (en) | 2011-03-04 | 2013-11-12 | Shire Human Genetic Therapies, Inc. | Peptide linkers for polypeptide compositions and methods for using same |
| PL2726099T3 (pl) | 2011-07-01 | 2018-12-31 | Novartis Ag | Sposób leczenia zaburzeń metabolicznych |
| CA2852683A1 (en) | 2011-10-17 | 2013-04-25 | Acceleron Pharma, Inc. | Methods and compositions for treating ineffective erythropoiesis |
| US8765385B2 (en) | 2011-10-27 | 2014-07-01 | Ravindra Kumar | Method of detection of neutralizing anti-actriib antibodies |
| WO2013063536A1 (en) | 2011-10-27 | 2013-05-02 | Acceleron Pharma, Inc. | Actriib binding agents and uses thereof |
| JP6145112B2 (ja) | 2011-12-19 | 2017-06-07 | アムジエン・インコーポレーテツド | 単独でのまたは化学療法と組み合わされた変異アクチビン受容体ポリペプチド、およびその使用 |
| US9878056B2 (en) | 2012-04-02 | 2018-01-30 | Modernatx, Inc. | Modified polynucleotides for the production of cosmetic proteins and peptides |
| US9102212B2 (en) | 2012-05-14 | 2015-08-11 | Paccar Inc | Fresh air system for heavy duty vehicle cab/sleeper combination |
| EP3521310A1 (en) | 2012-06-14 | 2019-08-07 | The Medical Research, Infrastructure, And Health Services Fund Of The Tel Aviv Medical Center | Use of blocking agents of bone morphogenic protein (bmp) signaling for the treatment of neuroinflammatory and neurodegenerative diseases |
| CN104411720B (zh) | 2012-07-02 | 2018-05-11 | 协和发酵麒麟株式会社 | 以抗bmp9抗体作为有效成分的、对肾性贫血、癌性贫血等贫血的治疗剂 |
| CN104968801B (zh) | 2012-10-24 | 2021-06-15 | 细胞基因公司 | 用于治疗贫血症的生物标志物 |
| CN104981250A (zh) | 2012-10-24 | 2015-10-14 | 细胞基因公司 | 用于治疗贫血的方法 |
| WO2014064292A1 (en) | 2012-10-26 | 2014-05-01 | Universite Pierre Et Marie Curie (Paris 6) | A method for preventing or treating atrial fibrillation |
| MX366336B (es) | 2012-11-02 | 2019-07-05 | Celgene Corp | Antagonistas de activina - actrii y usos para el tratar trastornos oseos y otros. |
| CA3240136A1 (en) | 2012-11-08 | 2014-05-15 | Clearside Biomedical, Inc. | Methods and devices for the treatment of ocular diseases in human subjects |
| WO2014093531A1 (en) | 2012-12-11 | 2014-06-19 | Los Angeles Biomedical Research Institute At Harbor-Ucla Medical Center | Modulation of myofiber repair by anti-myostatin in strategies with stem cells |
| US20140220033A1 (en) | 2013-02-01 | 2014-08-07 | Santa Maria Biotherapeutics, Inc. | Administration of an Anti-Activin-A Compound to a Subject |
| EP3431592A1 (en) | 2013-03-14 | 2019-01-23 | Translate Bio, Inc. | Mrna therapeutic compositions and use to treat diseases and disorders |
| TWI655207B (zh) | 2013-07-30 | 2019-04-01 | 再生元醫藥公司 | 抗活化素a之抗體及其用途 |
| TW201536318A (zh) | 2013-08-14 | 2015-10-01 | Novartis Ag | 治療偶發性包涵體肌炎之方法 |
| JP2017505428A (ja) | 2013-12-16 | 2017-02-16 | パランタ バイオサイエンス リミテッド | 診断及び治療の方法 |
| WO2015108972A1 (en) | 2014-01-14 | 2015-07-23 | Santa Maria Biotherapeutics, Inc. | Activin inhibitor response prediction and uses for treatment |
| US20170248609A1 (en) | 2014-01-27 | 2017-08-31 | Novartis Ag | Biomarkers predictive of muscle atrophy, method and use |
| JP6601687B2 (ja) | 2014-03-31 | 2019-11-06 | 大日本住友製薬株式会社 | 進行性骨化性線維異形成症の予防剤及び治療剤 |
| TW201622746A (zh) | 2014-04-24 | 2016-07-01 | 諾華公司 | 改善或加速髖部骨折術後身體復原之方法 |
| AU2015274293A1 (en) | 2014-06-13 | 2017-02-02 | Amgen Inc. | Formulated receptor polypeptides and related methods |
-
2008
- 2008-02-01 CA CA002677007A patent/CA2677007A1/en not_active Abandoned
- 2008-02-01 RU RU2009132663/15A patent/RU2473362C2/ru active
- 2008-02-01 CN CN201410160117.6A patent/CN103920139B/zh active Active
- 2008-02-01 US US12/012,510 patent/US9526759B2/en active Active
- 2008-02-01 MX MX2009008222A patent/MX2009008222A/es active IP Right Grant
- 2008-02-01 TW TW097103890A patent/TWI480048B/zh active
- 2008-02-01 EP EP12178903.6A patent/EP2599495A1/en not_active Withdrawn
- 2008-02-01 KR KR1020097017346A patent/KR101526613B1/ko active Active
- 2008-02-01 TW TW106100841A patent/TW201716081A/zh unknown
- 2008-02-01 CN CN200880011264.XA patent/CN101835485B/zh active Active
- 2008-02-01 WO PCT/US2008/001429 patent/WO2008094708A2/en not_active Ceased
- 2008-02-01 ES ES08725118T patent/ES2415666T3/es active Active
- 2008-02-01 TR TR2009/06131T patent/TR200906131T1/xx unknown
- 2008-02-01 KR KR1020147031360A patent/KR20140137463A/ko not_active Ceased
- 2008-02-01 BR BRPI0806861-5A patent/BRPI0806861A2/pt not_active Application Discontinuation
- 2008-02-01 EP EP08725118.7A patent/EP2111229B1/en active Active
- 2008-02-01 AU AU2008211007A patent/AU2008211007B2/en active Active
- 2008-02-01 TW TW103130372A patent/TWI584815B/zh active
- 2008-02-01 MX MX2014007015A patent/MX354099B/es unknown
- 2008-02-01 CN CN201610862318.XA patent/CN107050424A/zh active Pending
- 2008-02-01 JP JP2009548327A patent/JP5237970B2/ja active Active
-
2009
- 2009-07-30 IL IL200186A patent/IL200186A/en active IP Right Grant
-
2012
- 2012-07-11 RU RU2012129353/15A patent/RU2012129353A/ru not_active Application Discontinuation
-
2013
- 2013-03-29 JP JP2013073352A patent/JP6243133B2/ja active Active
-
2014
- 2014-10-14 JP JP2014209681A patent/JP2015025005A/ja not_active Withdrawn
-
2015
- 2015-01-13 HK HK15100330.2A patent/HK1199833A1/xx unknown
- 2015-10-20 IL IL242169A patent/IL242169A0/en unknown
- 2015-10-20 IL IL242168A patent/IL242168A0/en unknown
-
2016
- 2016-11-04 JP JP2016215914A patent/JP2017031217A/ja active Pending
- 2016-11-30 US US15/364,380 patent/US20170145074A1/en not_active Abandoned
Patent Citations (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2002032925A2 (en) | 2000-10-16 | 2002-04-25 | Phylos, Inc. | Protein scaffolds for antibody mimics and other binding proteins |
| WO2002088171A2 (en) | 2001-04-26 | 2002-11-07 | Avidia Research Institute | Combinatorial libraries of monomer domains |
| WO2006012627A2 (en) | 2004-07-23 | 2006-02-02 | Acceleron Pharma Inc. | Actrii receptor polypeptides, methods and compositions |
| WO2006055689A2 (en) | 2004-11-16 | 2006-05-26 | Avidia Research Institute | Protein scaffolds and uses thereof |
Non-Patent Citations (21)
| Title |
|---|
| "Current Protocols in Molecular Biology", 1992, JOHN WILEY & SONS |
| "Laboratory Manual", 2001, COLD SPRING HARBOR LABORATORY PRESS |
| BIOCHEMISTRY, vol. 30, pages 10832 - 10838 |
| BROWN ET AL., MOL. CELL BIOL., vol. 12, 1992, pages 2644 - 2652 |
| CUNNINGHAM, SCIENCE, vol. 244, 1989, pages 1081 - 1085 |
| FRALEY, TRENDS BIOCHEM. SCI., vol. 6, 1981, pages 77 |
| GOEDDEL: "Gene Expression Technology: Methods in Enzymology", 1990, ACADEMIC PRESS |
| GREENER ET AL., STRATEGIES IN MOL BIOL, vol. 7, 1994, pages 32 - 34 |
| GUSTIN ET AL., VIROLOGY, vol. 193, 1993, pages 653 - 660 |
| HOCHULI ET AL., J. CHROMATOGRAPHY, vol. 411, 1987, pages 177 |
| JANKNECHT ET AL., PNAS USA, vol. 88, pages 8972 |
| LEUNG, METHOD CELL MOL BIOL, vol. 1, 1989, pages 11 - 19 |
| MANNINO ET AL., BIOTECHNIQUES, vol. 6, 1988, pages 682 |
| MCKNIGHT ET AL., SCIENCE, vol. 232, 1982, pages 316 |
| MEYERS ET AL., SCIENCE, vol. 232, 1986, pages 613 |
| MILLER ET AL.: "A Short Course in Bacterial Genetics", 1992, CSHL PRESS |
| THOTAKURA ET AL., METH. ENZYMOL., vol. 138, 1987, pages 350 |
| VAN DE VIJVER ET AL., N. ENGL. J. MED., vol. 347, 2002, pages 1999 - 2009 |
| VAN 'T VEER ET AL., NATURE, vol. 415, 2002, pages 530 - 536 |
| WEIGELT ET AL., NAT. REV. CANCER, vol. 5, 2005, pages 591 - 602 |
| WEIGELT, NAT. REV. CANCER, vol. 5, 2005, pages 591 - 602 |
Cited By (70)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US9138459B2 (en) | 2004-07-23 | 2015-09-22 | Acceleron Pharma Inc. | ACTRIIB-FC polynucleotides, polypeptides, and compositions |
| US10071135B2 (en) | 2005-11-23 | 2018-09-11 | Acceleron Pharma Inc. | Method of identifying an agent that promotes bone growth or increases bone density |
| US9572865B2 (en) | 2005-11-23 | 2017-02-21 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating multiple myeloma |
| US9480742B2 (en) | 2005-11-23 | 2016-11-01 | Acceleron Pharma Inc. | Method of promoting bone growth by an anti-actriia antibody |
| US8486403B2 (en) | 2005-11-23 | 2013-07-16 | Acceleron Pharma, Inc. | Method of promoting bone growth by an anti-activin A antibody |
| US10239940B2 (en) | 2005-11-23 | 2019-03-26 | Acceleron Pharma Inc. | Method of promoting bone growth by an anti-actriia antibody |
| US8629109B2 (en) | 2005-11-23 | 2014-01-14 | Acceleron Pharma Inc. | Method for promoting bone growth using activin-actriia antagonists |
| US9163075B2 (en) | 2005-11-23 | 2015-10-20 | Acceleron Pharma Inc. | Isolated polynucleotide that encodes an ActRIIa-Fc fusion polypeptide |
| US11129873B2 (en) | 2005-11-23 | 2021-09-28 | Acceleron Pharma Inc. | Method for promoting bone growth using activin-actriia antagonists |
| US8895016B2 (en) | 2006-12-18 | 2014-11-25 | Acceleron Pharma, Inc. | Antagonists of activin-actriia and uses for increasing red blood cell levels |
| US10093707B2 (en) | 2006-12-18 | 2018-10-09 | Acceleron Pharma Inc. | Antagonists of activin-ActRIIa and uses for increasing red blood cell levels |
| US9526759B2 (en) | 2007-02-01 | 2016-12-27 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for treating or preventing breast cancer |
| US9399669B2 (en) | 2007-02-02 | 2016-07-26 | Acceleron Pharma Inc. | Variants derived from ActRIIB |
| US10259861B2 (en) | 2007-02-02 | 2019-04-16 | Acceleron Pharma Inc. | Variants derived from ActRIIB and uses therefor |
| EP3243524A1 (en) * | 2007-09-18 | 2017-11-15 | Acceleron Pharma Inc. | Activin-actriia antagonists and uses for decreasing or inhibiting fsh secretion |
| US8367611B2 (en) | 2007-09-18 | 2013-02-05 | Acceleron Pharma Inc. | Activin-actriia antagonists for inhibiting germ cell maturation |
| US9353356B2 (en) | 2007-09-18 | 2016-05-31 | Acceleron Pharma Inc. | Activin-actriia antagonists for treating a follicle-stimulating horomone-secreting pituitary tumor |
| EP3415161A1 (en) | 2008-06-26 | 2018-12-19 | Acceleron Pharma Inc. | The use of an actriib antagonist for the treatment of anemia |
| EP3363453A1 (en) | 2008-06-26 | 2018-08-22 | Acceleron Pharma Inc. | Soluble actriia as activin-actriia antagonist for use in treating anemia or bone-related disorders |
| WO2009158035A2 (en) | 2008-06-26 | 2009-12-30 | Acceleron Pharma Inc. | Methods for dosing an activin-actriia antagonist and monitoring of treated patients |
| US10829532B2 (en) | 2008-08-14 | 2020-11-10 | Acceleron Pharma Inc. | Combined use of gdf traps and erythropoietin receptor activators to increase red blood cell levels |
| US9439945B2 (en) | 2008-08-14 | 2016-09-13 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| US11168311B2 (en) | 2008-08-14 | 2021-11-09 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
| US11162085B2 (en) | 2008-08-14 | 2021-11-02 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
| US11155791B2 (en) | 2008-08-14 | 2021-10-26 | Acceleron Pharma Inc. | Methods for treating anemia in a subject in need thereof |
| US10889626B2 (en) | 2008-08-14 | 2021-01-12 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| US9505813B2 (en) | 2008-08-14 | 2016-11-29 | Acceleron Pharma Inc. | Use of GDF traps to treat anemia |
| US10689427B2 (en) | 2008-08-14 | 2020-06-23 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| US10377996B2 (en) | 2008-08-14 | 2019-08-13 | Acceleron Pharma Inc. | Methods of identifying ActRIIB variants |
| US10829533B2 (en) | 2008-08-14 | 2020-11-10 | Acceleron Pharma Inc. | Combined use of GDF traps and erythropoietin receptor activators to increase red blood cell levels |
| US9932379B2 (en) | 2008-08-14 | 2018-04-03 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| US8361957B2 (en) | 2008-08-14 | 2013-01-29 | Acceleron Pharma, Inc. | Isolated GDF trap polypeptide |
| US8703927B2 (en) | 2008-08-14 | 2014-04-22 | Acceleron Pharma Inc. | Isolated nucleotide sequences encoding GDF traps |
| US8765663B2 (en) | 2009-01-13 | 2014-07-01 | Acceleron Pharma Inc. | Methods for increasing adiponectin |
| US9790284B2 (en) | 2009-06-08 | 2017-10-17 | Acceleron Pharma Inc. | Methods for increasing thermogenic adipocytes |
| US10968282B2 (en) | 2009-06-08 | 2021-04-06 | Acceleron Pharma Inc. | Methods for screening compounds for increasing thermogenic adipocytes |
| US8703694B2 (en) | 2009-06-08 | 2014-04-22 | Acceleron Pharma, Inc. | Methods for increasing thermogenic adipocytes |
| US9181533B2 (en) | 2009-06-12 | 2015-11-10 | Acceleron Pharma, Inc. | Truncated ACTRIIB-FC fusion protein |
| US8293881B2 (en) | 2009-06-12 | 2012-10-23 | Acceleron Pharma Inc. | Isolated nucleic acid encoding a truncated ActRIIB fusion protein |
| US11066654B2 (en) | 2009-06-12 | 2021-07-20 | Acceleron Pharma Inc. | Methods and compositions for reducing serum lipids |
| US10358633B2 (en) | 2009-06-12 | 2019-07-23 | Acceleron Pharma Inc. | Method for producing an ActRIIB-Fc fusion polypeptide |
| US9745559B2 (en) | 2009-06-12 | 2017-08-29 | Acceleron Pharma Inc. | Method for decreasing the body fat content in a subject by administering an ActRIIB protein |
| US10968262B2 (en) | 2009-11-17 | 2021-04-06 | Acceleron Pharma Inc. | Methods of increasing sarcolemmal utrophin |
| US9617319B2 (en) | 2009-11-17 | 2017-04-11 | Acceleron Pharma Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
| US8710016B2 (en) | 2009-11-17 | 2014-04-29 | Acceleron Pharma, Inc. | ActRIIB proteins and variants and uses therefore relating to utrophin induction for muscular dystrophy therapy |
| EP2638065A4 (en) * | 2010-11-08 | 2014-04-09 | Acceleron Pharma Inc | ACTRIIA-BINDING SUBSTANCES AND ITS USES |
| US9493556B2 (en) | 2010-11-08 | 2016-11-15 | Acceleron Pharma Inc. | Actriia binding agents and uses thereof |
| CN103298832A (zh) * | 2010-11-08 | 2013-09-11 | 阿塞勒隆制药公司 | Actriia结合剂及其用途 |
| US10195249B2 (en) | 2012-11-02 | 2019-02-05 | Celgene Corporation | Activin-ActRII antagonists and uses for treating bone and other disorders |
| US11260107B2 (en) | 2014-06-13 | 2022-03-01 | Acceleron Pharma Inc. | Methods and compositions for treating ulcers |
| US10487144B2 (en) | 2014-06-13 | 2019-11-26 | Acceleron Pharma Inc. | Methods for treating ulcers in a hemoglobinopathy anemia with a soluble actRIIB polypeptide |
| US9850298B2 (en) | 2014-06-13 | 2017-12-26 | Acceleron Pharma Inc. | Methods for treating ulcers in thalassemia syndrome with an ActRIIB polypeptide |
| US12428497B2 (en) | 2014-06-25 | 2025-09-30 | UCB Biopharma SRL | Multispecific antibody constructs |
| US11345760B2 (en) | 2014-06-25 | 2022-05-31 | UCB Biopharma SRL | Multispecific antibody constructs |
| US11813308B2 (en) | 2014-10-09 | 2023-11-14 | Celgene Corporation | Treatment of cardiovascular disease using ActRII ligand traps |
| US11471510B2 (en) | 2014-12-03 | 2022-10-18 | Celgene Corporation | Activin-ActRII antagonists and uses for treating anemia |
| EP3420002A4 (en) * | 2016-02-22 | 2020-01-15 | Acceleron Pharma Inc. | ACTRII ANTAGONISTS FOR USE TO INCREASE IMMUNITY |
| WO2017147182A1 (en) * | 2016-02-22 | 2017-08-31 | Acceleron Pharma Inc. | Actrii antagonists for use in increasing immune activity |
| US12343378B2 (en) | 2016-07-15 | 2025-07-01 | Acceleron Pharma Inc. | Compositions and methods for treating pulmonary hypertension |
| US12194076B2 (en) | 2016-07-27 | 2025-01-14 | Acceleron Pharma Inc. | Methods and compositions for treating myelofibrosis |
| US11717558B2 (en) | 2016-11-10 | 2023-08-08 | Keros Therapeutics, Inc. | Nucleic acid molecules encoding activin receptor type IIA variants |
| US12350313B2 (en) | 2016-11-10 | 2025-07-08 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| WO2019094751A1 (en) | 2017-11-09 | 2019-05-16 | Keros Therapeutics, Inc. | Activin receptor type iia variants and methods of use thereof |
| EP3706777A4 (en) * | 2017-11-09 | 2021-06-23 | Keros Therapeutics, Inc. | ACTIVIN RECEPTOR TYPE IIA VARIANTS AND METHOD OF USE THEREOF |
| US11484573B2 (en) | 2017-11-09 | 2022-11-01 | Keros Therapeutics, Inc. | Activin receptor type IIa variants and methods of use thereof |
| EP4428147A3 (en) * | 2017-11-09 | 2024-10-30 | Keros Therapeutics, Inc. | Activin receptor type iia variants and methods of use thereof |
| US11884715B2 (en) | 2018-01-12 | 2024-01-30 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12269858B2 (en) | 2018-01-12 | 2025-04-08 | Keros Therapeutics, Inc. | Activin receptor type IIB variants and methods of use thereof |
| US12364737B2 (en) | 2018-05-09 | 2025-07-22 | Keros Therapeutics, Inc. | Activin receptor type IIA variants and methods of use thereof |
| US12440539B2 (en) | 2020-03-20 | 2025-10-14 | Keros Therapeutics, Inc. | Methods of using activin receptor type IIB variants |
Also Published As
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US9526759B2 (en) | Activin-actriia antagonists and uses for treating or preventing breast cancer | |
| EP2207562B1 (en) | Activin-actriia antagonists and uses for decreasing or inhibiting fsh secretion | |
| HK1185569A (en) | Activin-actriia antagonists and uses for treating or preventing breast cancer | |
| AU2013204964A1 (en) | Activin-actriia antagonists and uses for treating or preventing breast cancer | |
| HK1137146B (en) | Pharmaceutical compositions comprising activin-actriia antagonists for use in preventing or treating breast cancer metastasis or breast cancer related bone loss | |
| HK1146243A (en) | Activin-actriia antagonists and uses for decreasing or inhibiting fsh secretion | |
| HK1146243B (en) | Activin-actriia antagonists and uses for decreasing or inhibiting fsh secretion |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200880011264.X Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 08725118 Country of ref document: EP Kind code of ref document: A2 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2008211007 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2677007 Country of ref document: CA |
|
| ENP | Entry into the national phase |
Ref document number: 2009548327 Country of ref document: JP Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 200186 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009/06131 Country of ref document: TR Ref document number: MX/A/2009/008222 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| ENP | Entry into the national phase |
Ref document number: 2008211007 Country of ref document: AU Date of ref document: 20080201 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020097017346 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2008725118 Country of ref document: EP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 3080/KOLNP/2009 Country of ref document: IN |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2009132663 Country of ref document: RU |
|
| REG | Reference to national code |
Ref country code: BR Ref legal event code: B01E Ref document number: PI0806861 Country of ref document: BR Free format text: ESCLARECA A DIVERGENCIA ENTRE A DATA QUE CONSTA NA PETICAO 200974499 DE 04/08/2009 E A DATA QUE O DEPOSITANTE AFIRMA TER PROTOCOLADO O PEDIDO (03/08/2009), SENDO ESTA A DATA LIMITE PARA COMPLETAR OS 30 MESES DE PRAZO. |
|
| ENP | Entry into the national phase |
Ref document number: PI0806861 Country of ref document: BR Kind code of ref document: A2 Effective date: 20090804 |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020147031360 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 242168 Country of ref document: IL Ref document number: 242169 Country of ref document: IL |