WO2008003115A1 - Method for engineering t-cell receptors - Google Patents

Method for engineering t-cell receptors Download PDF

Info

Publication number
WO2008003115A1
WO2008003115A1 PCT/AT2007/000342 AT2007000342W WO2008003115A1 WO 2008003115 A1 WO2008003115 A1 WO 2008003115A1 AT 2007000342 W AT2007000342 W AT 2007000342W WO 2008003115 A1 WO2008003115 A1 WO 2008003115A1
Authority
WO
WIPO (PCT)
Prior art keywords
cell receptor
modified
receptor domain
domain polypeptide
amino acids
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/AT2007/000342
Other languages
German (de)
English (en)
French (fr)
Inventor
Gottfried Himmler
Florian RÜKER
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
F Star Biotechnologische Forschungs und Entwicklungsges mbH
Original Assignee
F Star Biotechnologische Forschungs und Entwicklungsges mbH
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority to DK07763740.3T priority Critical patent/DK2051996T3/en
Priority to JP2009516818A priority patent/JP5426372B2/ja
Priority to SI200731617T priority patent/SI2051996T1/sl
Priority to US12/307,582 priority patent/US20100009863A1/en
Priority to EP07763740.3A priority patent/EP2051996B1/en
Priority to ES07763740.3T priority patent/ES2531515T3/es
Application filed by F Star Biotechnologische Forschungs und Entwicklungsges mbH filed Critical F Star Biotechnologische Forschungs und Entwicklungsges mbH
Priority to PL07763740T priority patent/PL2051996T3/pl
Publication of WO2008003115A1 publication Critical patent/WO2008003115A1/en
Anticipated expiration legal-status Critical
Priority to US13/482,926 priority patent/US20130040836A1/en
Priority to US15/284,471 priority patent/US20170015727A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex

Definitions

  • the present invention relates to a novel method for engineering and manufacturing of modified T-cell receptors and T-cell receptor domain polypeptides with the aim to impart them with specific binding properties. Further, modified T- cell receptor domain polypeptides obtained by said method and their use for establishing libraries and developing detection and screening methods for possible binding structures are discclosed .
  • T-cell receptors are important molecules of the immune system. Its extracellular domains are homologous with and structurally similar to an antibody Fab fragment.
  • T-cell receptors are expressed in nature on the surface of T- cells usually as alpha/beta and gamma/delta heterodimeric integral membrane proteins, each subunit comprising a short intracellular segment, a single transmembrane alpha-helix and two globular extracellular Ig-superfamily domains.
  • the TCR- heterodimer is stabilized by an extracellular, membrane proximal, inter-chain disulphide bond (Immunobiology . 5th ed. Janeway, Charles A.; Travers, Paul; Walport, Mark; Shlomchik, Mark. New York and London: Garland Publishing; 2001) .
  • TCRs therefore have four extracellular domains, the two membrane proximal (C-terminal) domains, which are constant, and the two N-terminal domains, which are variable.
  • the variable domains are encoded by variable gene segments which are rearranged with junctional and constant gene segments (and diversity gene segments in the case of ⁇ -chains) to produce the TCR diversity observed in the mature immune system.
  • variable domains as well as constant domains of T-cell receptors are structurally similar to antibody domains and exhibit the typical "immunoglobulin fold":
  • Each domain has a similar structure of two beta sheets packed tightly against each other in a compressed antiparallel beta barrel .
  • the immunoglobulin fold of TCR-constant domains contains a 3-stranded sheet packed against a 4-stranded sheet.
  • the fold is stabilized by hydrogen bonding between the beta- strands of each sheet, by hydrophobic bonding between residues of opposite sheets in the interior, and by a disulfide bond between the sheets .
  • the 3-stranded sheet strands are denoted C, F, and G, and the 4-stranded sheet comprises the strands A B, D, and E.
  • the letters A through G denote the sequential positions of the beta strands along the amino acid sequence of the immunoglobulin fold.
  • V-domains The fold of variable domains (V-domains) has 9 beta strands arranged in two sheets of 4 and 5 strands.
  • the 5- stranded sheet is structurally homologous to the 3-stranded sheet of constant domains, but contains the extra strands C 1 and C''.
  • the remainder of the strands (A, B, C, D, E, F, G) have the same topology and similar structure as their counterparts in constant domain immunoglobulin folds.
  • a disulfide bond links strands B and F in opposite sheets, as in constant domains .
  • IMGT the international ImMunoGeneTics information system@imgt.cines.fr; http://imgt.cines.fr; Lefranc et al . , (2003) Dev Comp Immunol 27:55 77.; Lefranc et al. (2005) Dev Comp Immunol 29:185-203).
  • variable domains of both TCR chains contain three hypervariable loops, or complementarity-determining regions (CDRs) .
  • the CDRs are loops that connect beta strands B-C, C-C 1 ', and F-G of the immunoglobulin fold.
  • the residues in the CDRs vary from one TCR molecule to the next, imparting antigen specificity to each TCR.
  • the V-domains at the tips of TCR-molecules are closely packed such that the 6 CDRs (3 on each variable domain) cooperate in constructing a surface (or cavity) for antigen- specific binding.
  • the natural antigen binding site of a TCR thus is composed of the loops which connect strands B-C, C- C', and F-G of the light chain variable domain and strands B- C, C-C', and F-G of the heavy chain variable domain.
  • the extent of the specific contribution to antigen binding by the six CDR loops can vary between different TCRs .
  • T-cell receptors have therapeutic and diagnostic potential and can be manipulated similarly to antibody molecules (e.g. Molloy et al . Curr Opin Pharmacol. (2005) 5:438-443; Boulter & Jakobsen (2005) Clin Exp Immunol. 142:454-460).
  • WO02059263C2 describes transgenic animals comprising a humanized immune system to develop human TCR molecules.
  • WO04044004A2 WO05116646A1 and WO9839482A1 describe ribosome and phage display of TCR chains and methods to select for TCR molecules against specific antigens.
  • WO0148145A2 describes high affinity TCRs. Manipulation of the extracellular variable domains of T-cell receptors has been performed for the purpose of specificity engineering via modification of the CDR-regions (WO05114215A2 ; WO0155366C2) .
  • the CDR-loops of a TCR variable domain define the antigen specificity.
  • the rest of the domain is termed framework (FR) .
  • FR framework
  • These framework regions are composed of beta-strand and loop structures .
  • loops which are not CDR-loops in a native TCR domain do not have antigen-binding or epitope-binding specificity but contribute to the correct overall folding of the TCR-domain and consequently also to the correct positioning of the CDRs and to interaction between domains.
  • These loops are named structural loops for the purpose of this invention.
  • TCR domains have been modified e.g for stabilization of the dimers .
  • WO06037960A2 and WO06056733A1 describe the introduction of a non-native disulfide interchain bond.
  • WO0157211A1 describes heterodimerization of TCR chains by fusion to leucine-zipper peptides.
  • EP0640130B1 describes chimeric immunoglobulin superfamily protein analogues (chi-proteins) having more than one biological binding site (single V domains or Fvs).
  • the binding sites on these proteins are comprised of hypervariable regions derived from molecules related to the immunoglobulin superfamily of molecules, including immunoglobulins, cell surface antigens (such as T-cell antigens) and .cell receptors (such as Fc- receptor) .
  • the hypervariable regions are called "CDR-like regions" and define ligand binding sites .
  • the chi-protein has at least one more ligand binding site segment, also a CDR-like region, spliced into the FR-like regions of the beta-barrel domain.
  • Each ligand binding site of the chi-protein therefore is comprised of a CDR-like region derived from molecules of the immunoglobulin superfamily.
  • a ligand binding site is comprised of the CDRs derived from an immunoglobulin molecule whose ligand is an antigen.
  • EP0640130B1 thus teaches how to splice CDR-like regions with a given specificity from a molecule of the immunoglobulin superfamily into the structural loops of a variable domain. It is postulated by the inventors of the chi-proteins that functional bispecific antibodies can be prepared by this technique. However, there is a requirement for this technique that the relative orientations of the CDR-like loops (CDR loop symmetry) for a variable domain be reproduced to a reasonable approximation in the relative orientation of the structural loops. EP0640130B1 claims that such an approximation of the CDR-like loop symmetry does exist for the structural loops. However, it is doubtful that the relative orientation of the CDR-loops and the structural loops is similar in sufficient detail and resolution; consequently it has not been described to date that it is actually possible to develop bispecific molecules by this technique.
  • EP0640130B1 exemplifies that R19.9 (a monoclonal murine antibody specific for the p-azobenzenearsonate) and 26-10 (monoclonal murine antibody specific for ouabain) were used as the framework providing the primary CDR loops respectively, and the CDR-loops of murine anti-lysozyme antibody Dl .3 were grafted into the structural loop regions. However, functional specificity after grafting is not described.
  • the single chain antibody 26-10 specific for ouabain could retain its ouabain-specificity after grafting two CDRs from the lysozyme-specific antibody into the structural loops of the ouabain-specific single-chain Fv anti-body fragment.
  • the antibody fragment which was made according to this method had also ly-sozyme-binding specificity.
  • the present invention provides a solution for the introduction of new functions into TCR molecules.
  • the present invention advantageously provides a method for engineering a T-cell receptor domain polypeptide comprising at least one modification in a structural loop region of said T- cell receptor domain polypeptide and determining the binding of said T-cell receptor domain polypeptide to an epitope of an antigen, wherein the unmodified T-cell receptor domain polypeptide does not significantly bind to said epitope, comprising the steps of:
  • the so obtained T-cell receptor domain polypeptides can bind specifically to one single epitope but also to two or more epitopes.
  • the T-cell receptor domain polypeptides according to the invention can be of human or animal origin, preferably of human or murine origin.
  • the inventive T-cell receptor domains can be selected from the variable or constant domains, preferably from V-alpha, V-beta, V-gamma, V-delta, C-alpha, C- beta, C-gamma, C-delta domains.
  • the modified loop regions of the variable domains can comprise at least one modification within amino acids 11 to 19, amino acids 43 to 51, amino acids 67 to 80 or amino acids 90 to 99.
  • the modified loop regions of the constant domains can comprise at least one modification within amino acids 9 to 20, amino acids 27 to 36, amino acids 41 to 78, amino acids 82 to 85, amino acids 90 to 102 or amino acids 107 to 116.
  • the numbering of the amino acid positions of the domains is that of the IMGT.
  • the method according to the invention provides for example a modification of at least one nucleotide of a nucleic acid resulting in a substitution, deletion and/or insertion of one or more amino acids of the T-cell receptor domain polypeptide encoded by said nucleic acid.
  • At least one amino acid of at least one structural loop region is modified by site-directed random mutation, wherein the randomly modified nucleic acid molecule can comprise at least one nucleotide repeating unit having the coding sequence NNS, NNN, NNK, TMT, WMT, RMC, RMG, MRT, SRC, KMT, RST, YMT, MKC, RSA, RRC, where the coding is according to IUPAC.
  • the invention further provides T-cell receptor domain polypeptides obtainable by this method and their use for the preparation of a protein libraries of variant T-cell receptor domain polypeptides .
  • the method of the present invention specifically provides libraries comprising at least 10 T-cell receptor domain polypeptides or T-cell receptors with a modification in at least one structural loop region, alternatively with mutations of at least 3 amino acid positions in at least one structural loop region.
  • the T-cell receptor domain polypeptides can be V- alpha, V-beta, V-gamma, V-delta, C-alpha, C-beta, C-gamma or C-delta.
  • a method for specifically binding and/or detecting a molecule comprising the steps of (a) contacting a library of modified T-cell receptors or modified T-cell receptor domain polypeptides obtainable by the inventive method with a test sample containing said molecule, and optionally (b) detecting the potential formation of a specific T-cell receptor/molecule complex .
  • the invention also enables a method for specifically isolating a modified T-cell receptor binding to a molecule comprising the steps of (a) contacting a library of modified T-cell receptors or a modified T-cell receptor obtainable by a method according to the invention with a sample containing said molecule, (b) separating the specific modified T-cell receptor/molecule complex formed, and (c) optionally isolating the modified T-cell receptor from said complex.
  • a kit of binding partners is also provided, containing (a) a library of modified T-cell receptors or modified T-cell receptor domain polypeptides obtained by the inventive method and (b) a binding molecule containing an epitope of an antigen.
  • the binding molecule of the kit can be used for selecting a modified T-cell receptor domain polypeptide from a library- according to the invention.
  • the invention also provides a T-cell receptor domain polypeptide comprising at least one structural loop region said at least one loop region comprising at least one modification enabling a binding of said at least one modified loop region to an epitope of an antigen wherein the unmodified T-cell receptor domain polypeptide does not bind to said epitope .
  • Said T-cell receptor domain polypeptide can preferably bind to an epitope of an antigen, for example serum proteins, Fc- receptors, complement molecules and serum albumins. Binding to these antigens can be advantageous as native TCRs do not have any effector functions .
  • an antigen for example serum proteins, Fc- receptors, complement molecules and serum albumins. Binding to these antigens can be advantageous as native TCRs do not have any effector functions .
  • TCRs By developing modified T-cell receptor domain polypeptides binding Fc receptors like Fc gamma I, II or III or neonatal Fc receptors or complement proteins, TCRs can be obtained having effector function capabilities. Alternatively, also serum half lifesof the so modified TCRs due to binding to neonatal Fc receptors can be increased if appropriate. This can be especially highly advantageous for therapeutic purposes.
  • the modified T-cell receptor domain polypeptides according to the invention can also contain at least two modified structural loop regions .
  • the T-cell receptor comprising at least one modified T-cell receptor domain as described above can be V- alpha, V-beta, V-gamma, V-delta, C-alpha, C-beta, C-gamma, C- delta or a part thereof and said at least one modified structural loop region can comprise at least 3 amino acid modifications .
  • the invention also provides a molecule or composition comprising at least one modified T-cell receptor domain according to the invention and at least one other binding molecule, wherein said other binding molecule is selected from the group of modified T-cell receptor domains according to, immunoglobulins, soluble receptors, ligands, nucleic acids, and carbohydrates .
  • Said molecule or composition can be further characterized in that the modified loop regions of a V-alpha, V-beta, V-gamma, V-delta comprise at least one modification within amino acids 11 to 19, amino acids 43 to 51, amino acids 67 to 80 or amino acids 90 to 99, where the numbering of the amino acid position of the domains is that of the IMGT.
  • said molecule or composition can be characterised in that the loop regions of a C-alpha, C-beta, C-gamma, C-delta comprise at least one modification within amino acids 9 to 20, amino acids 27 to 36, amino acids 41 to 78, amino acids 82 to 85, amino acids 90 to 102 or amino acids 107 to 116, where the numbering of the amino acid position of the domains is that of the IMGT.
  • the present invention further provides a nucleic acid encoding said T-cell receptor domain or part thereof.
  • a "structural loop" or NN non-CDR-loop” according to the present invention is to be understood in the following manner: T-cell receptors are made of domains with a so called immunoglobulin fold. In essence, anti-parallel beta sheets are connected by loops to form a compressed antiparallel beta barrel. In the variable region, some of the loops of the domains contribute essentially to the specificity of the TCR, i.e. the binding to an antigen. These loops are called CDR-loops . All other loops of antibody variable domains are rather contributing to the structure of the molecule and/or interaction with other domains . These loops are defined herein as structural loops or non-CDR-loops .
  • T-cell receptors are molecules on T-cells, for the purpose of this invention it also includes molecules derived from T-cell receptors including but not limited to fusion proteins, chimera of T-cell receptor sequences with other immunoglobulin domain sequences, chimera of T-cell receptor sequences of one species with sequences of different species; soluble T-cell receptors, single-chain T-cell receptors, zipper-dimerized T- cell receptors.
  • a TCR-domain polypeptide is a stretch of amino acids derived from a TCR variable or constant domain comprising at least one structural loop.
  • immunoglobulin herein is used for antibodies, fragments thereof, variable regions, constant regions and fusion molecules thereof
  • the present invention relates to a method for engineering a T-cell receptor domain polypeptide binding specifically with its modified structural loops to an epitope of an antigen selected from the group consisting of allergens, tumor associated antigens, self antigens, enzymes, Fc- receptors, proteins of the complement system, serum molecules, bacterial antigens, fungal antigens, protozoan antigen and viral antigens .
  • an antigen selected from the group consisting of allergens, tumor associated antigens, self antigens, enzymes, Fc- receptors, proteins of the complement system, serum molecules, bacterial antigens, fungal antigens, protozoan antigen and viral antigens .
  • the T-cell receptor domain polypeptide is binding with its modified structural loops specifically to at least two such epitopes that differ from each other, either of the same antigen or of different antigens .
  • T-cell receptor domain polypeptide modified T-cell receptor domain or “T-cell receptor domain according to the invention” includes a derivative of a T-cell receptor as well.
  • a derivative is any combination of one or more T-cell receptor domains of the invention and/or a fusion protein in which any.
  • T-cell receptor domain of the invention may be 'fused at any position of one or more other proteins, including, but not limited to other T- cell receptor domains, immunoglobulin domains, Fc parts, ligands, scaffold proteins, enzymes, toxins, serum proteins and the like.
  • a derivative of the T-cell receptor of the invention may also be obtained by connecting the T-cell receptor domain polypeptide of the invention to other substances by various chemical techniques such as covalent coupling, electrostatic interaction, disulphide bonding etc.
  • the other substances bound to the T-cell receptor domain polypeptide may be lipids, carbohydrates, nucleic acids, organic and inorganic molecules or any combination thereof (e.g. PEG, pro-drugs or drugs) .
  • a derivative is also a T-cell receptor domain polypeptide with the same amino acid sequence but made completely or partly from non-natural or chemically modified amino acids.
  • the engineered molecules according to the present invention will be useful as stand-alone proteins as well as fusion proteins or derivatives, most typically fused in such a way as to be part of larger T-cell receptor structures or complete T-cell receptor molecules, or parts thereof such as bispecific and multispecific single-chain T-cell receptors or combined formulations wherein the engineered polypeptides are combined as needed. It will be possible to use the engineered proteins to produce molecules which are monospecific, bispecific, trispecific, and may even carry more specificities at the same time, and it will be possible to control and preselect the valency of binding at the same time according to the requirements of the planned use of such molecules.
  • binding regions to antigens or antigen binding sites to all kinds of allergens, tumor associated antigens, self antigens, enzymes, Fc- receptors, proteins of the complement system, serum molecules, bacterial antigens, fungal antigens, protozoan antigens and viral antigens may be introduced into a structural loop region of a given T-cell receptor domain structure.
  • the antigens may be naturally occurring molecules or chemically synthesized molecules or recombinant molecules, all either in solution or on or in particles such as solid phases, on or in cells or on viral surfaces .
  • Preferred antigens are serum proteins, Fc-receptors, like Fc gamma I, II or II, neonatal Fc receptors, complement molecules and serum albumins .
  • allergens for example, all allergens and antigens and targets capable of being recognised by a T-cell receptor or antibody, and fragments of such molecules as well as small molecules such as haptens .
  • epitope shall mean a molecular structure which may completely make up a specific binding partner or be part of a specific binding partner to the binding domain or the T-cell receptor domain polypeptide of the present invention.
  • an epitope may either be composed of a carbohydrate, a peptide, a fatty acid, an organic, biochemical or inorganic substance or derivatives thereof and any " combinations thereof. If an epitope is a polypeptide, it will usually include at least 3 amino acids, preferably 8 to 50 amino acids, and more preferably between about 10-20 amino acids in the peptide. There is no critical upper limit to the length of the peptide, which could comprise nearly the full length of a polypeptide sequence.
  • Epitopes can be either linear or conformational epitopes .
  • a linear epitope is comprised of a single segment of a primary sequence of a polypeptide chain.
  • Linear epitopes can be contiguous or overlapping.
  • Conformational epitopes are comprised of amino acids brought together by folding of the polypeptide to form a tertiary structure and the amino acids are not necessarily adjacent to one another in the linear sequence.
  • epitopes are at least part of diagnostically relevant molecules, i.e. the absence or presence of an epitope in a sample is qualitatively or quantitatively correlated to either a disease or to the health status of a patient or to a process status in manufacturing or to environmental and food status.
  • Epitopes may also be at least part of therapeutically relevant molecules, i.e. molecules which can be targeted by the specific binding domain which changes the course of the disease .
  • allergens are those allergens or antigens, which have already been proven to be or are capable of being immunologically or therapeutically relevant, especially those, for which a clinical efficacy has been tested.
  • binding capacities may be introduced in the structural loop regions of T-cell receptor domain polypeptides, e.g. binding capacities for small molecules, for drugs or enzymes, catalytic sites of enzymes or enzyme substrates or the binding to a transition state analogue of an enzyme substrate.
  • the new antigen binding site in the structural loops is foreign to the unmodified T-cell receptor domain polypeptide.
  • targets like effector molecules serum proteins or Fc-receptors and cell surface molecules are preferred as binding partners of the T-cell receptor domain polypeptide according to the invention.
  • the term “specifically binds” or “specific binding” refers to a binding reaction which is determinative of the cognate ligand of interest in a heterogeneous population of molecules.
  • the specified T-cell receptor domain polypeptide binds to its particular "target” and does not bind in a significant amount to other molecules present in a sample.
  • expression system refers to nucleic acid molecules containing a desired coding sequence and control sequences in operable linkage, so that hosts transformed or transfected with these sequences are capable of producing the encoded proteins.
  • the expression system may be included on a vector; however, the relevant DNA may then also be integrated into the host chromosome.
  • an expression system can be used for in vitro transcription/translation.
  • the TCR domain polypeptide is of human or animal origin, preferably of camelid, rabbit, chicken, rat, dog, horse, sheep or murine origin.
  • the T-cell receptor domain polypeptide is preferably of human or murine origin.
  • the modified T-cell receptor polypeptide may also be a humanized or a chimeric T-cell receptor domain polypeptide.
  • the modified T-cell receptor domain polypeptide is of human origin or a humanized version of a T-cell receptor domain polypeptide of any species .
  • the structural loop regions of a T-cell receptor variable domain polypeptide are selected preferably from the structural loops that comprise amino acids 11 to 19, amino acids 43 to 51, amino acids 67 to 80 or amino acids 90 to 99, where the numbering of the amino acid position of the domains is that of the IMGT.
  • the structural loop regions of a T-cell receptor constant domain polypeptide are selected preferably from the structural loops that comprise amino acids 9 to 20, amino acids 27 to 36, amino acids 41 to 78, amino acids 82 to 85, amino acids 90 to 102 or amino acids 107 to 116, where the numbering of the amino acid position of the domains is that of the IMGT.
  • the new antigen binding sites in the structural loops are introduced in the T-cell receptor domain polypeptides encoded by the selected nucleic acid by substitution, deletion and/or insertion of at least one nucleotide .
  • the modification of at least one nucleotide in at least one structural loop region results in a substitution, deletion and/or insertion in the T-cell receptor domain polypeptide encoded by said nucleic acid.
  • the modification of the at least one loop region of a T- cell receptor domain polypeptide may result in a substitution, deletion and/or insertion of one or more amino acids, preferably point mutations, change of amino acids of whole loops, more preferred the change of at least 2, 3, 4, 5, 6, 7, 8, 9, 10, up to 30 amino acids.
  • a preferred method to introduce modifications is site directed random mutation. With this method two or more specific amino acid residues of the loops are exchanged or introduced using randomly generated inserts into such structural loops. Alternatively preferred is the use of combinatorial approaches .
  • the at least one region is preferably mutated or modified by random, semi-random or, in particular, by site-directed random mutagenesis methods.
  • At least two, in another preferred embodiment at least three structural loop regions of a T-cell receptor domain polypeptide are mutated or modified by random, semi-random or, in particular, by site-directed random mutagenesis methods .
  • positions are chosen randomly, or amino acid changes are made using certain rules. For example certain residues may be mutated to any amino acid, whereas other residues may be mutated to a restricted set of amino acids. This can be achieved in a stepwise fashion by alternating of cycles of mutation and selection or simultaneously .
  • a preferred method according to the invention refers to a randomly modified nucleic acid molecule coding for a T-cell receptor domain polypeptide which comprises at least one nucleotide repeating unit within a structural loop coding region having the sequence 5'-NNS-3', 5 -NNN-3 or 5 - NNK-3 .
  • the modified nucleic acid comprises nucleotide codons selected from the group of TMT, WMT, RMC, RMG, MRT, SRC, KMT, RST, YMT, MKC, RSA, RRC, NNK, NNN, NNS or any combination thereof (the coding is according to IUPAC) .
  • the randomly modified nucleic acid molecule may comprise the above identified repeating units, which code for all known naturally occurring amino acids or a subset thereof.
  • the modification of the nucleic acid molecule may be performed by introducing synthetic oligonucleotides into a larger segment of nucleic acids or by de novo synthesis of a complete nucleic acid molecule. Synthesis of nucleic acid may also be performed with tri-nucleotide building blocks which would reduce the number of nonsense sequence combinations if a subset of amino acids is to be encoded (e.g. Yanez et al . Nucleic Acids Res. (2004) 32:el58; Virnekas et al . Nucleic Acids Res. (1994) 22:5600-5607).
  • positions to be modified are surface exposed amino acids.
  • Surface exposition of amino acids of structural loops can be. judged from known protein structures of T-cell receptor domain polypeptides and by analogy (homology) for such amino acid sequences for which no experimentally determined structure is available.
  • the modifications introduced into the at least one structural loop comprise at least 1, 2, 3, 4, 5, or 6 amino acids not naturally occurring at the respective site of the structural loop of the non-modified T-cell receptor domain polypeptide.
  • the modification of amino acids may preferentially be biased in order to introduce into structural loop regions amino acids which are known to be frequently involved in protein-protein interactions (e.g. Lea & Stewart (1995) FASEB J. 9:87-93; Fellhouse et al . (2006) J. MoI. Biol. 357:100-114; Adib-Conquuy et al . (1998) International Immunology 10:341- 346; Lo Conte et al . (1999) J. MoI. Biol. 285:2177-2198; Zemlin et al . (2003) J. MoI. Biol. 334:733-749).
  • a library of polypeptide variants comprising T-cell receptor domain polypeptides of the invention is used as a pool for selection wherein the modifications contain or introduce at least one, more preferably at least two amino acids per modified structural loop, preferably out of the group of amino acids tryptophane, tyrosine, phenylalanine, histidine, isoleucine, serine, methionine, alanine and asparagine .
  • the modification of the T-cell receptor domain polypeptide structural loop according to the present invention is preferably a deletion, substitution or an insertion of one or more amino acids .
  • At least 1, preferably at least 2, 3, 4, 5, 6, 7, 8, 9, 10 and up to 30 amino acids are deleted, substituted with other amino acids (also with modified amino acids) or inserted into the structural loop region of the T-cell receptor domain polypeptide.
  • the maximum number of amino acids inserted into a structural loop region of a T-cell receptor domain polypeptide may not exceed the number of 30, preferably 25, more preferably 20 amino acids .
  • TCR variants As is well known in the art, there are a variety of selection technologies that may be used for the identification and isolation of proteins with certain binding characteristics and affinities, including, for example, display technologies such as phage display, ribosome display, cell surface display, and the like, as described below. Methods for production and screening of TCR variants are well known in the art.
  • T-cell receptors and T-cell receptor fragments comprising a modified T-cell receptor domain polypeptide may be ⁇ cloned into host cells, expressed and assayed for their binding specificities. These practices are carried out using well-known procedures, and a variety of methods that may find use in the present invention are described in Molecular Cloning--A Laboratory Manual, 3.sup.rd Ed. (Maniatis, Cold Spring Harbor Laboratory Press, New York, 2001) , and Current Protocols in Molecular Biology (John Wiley & Sons) .
  • the nucleic acids that encode the modified T-cell receptor domain polypeptides of the present invention may be .
  • T-cell receptor domain polypeptides typically comprise a T-cell receptor domain polypeptide operably linked - that is placed in a functional relationship - with control or regulatory sequences, selectable markers, any fusion partners, and/or additional elements.
  • the modified T-cell receptor domain polypeptide of the present invention may be produced by culturing a host cell transformed with nucleic acid, preferably an expression vector, containing nucleic acid encoding the modified T-cell receptor domain polypeptide, under the appropriate conditions to induce or cause expression of the modified T-cell receptor domain polypeptide .
  • the methods of introducing exogenous nucleic acid molecules into a host are well known in the art, and will vary with the host used. Of course, also non-cellular or cell-free expression systems for the expression of modified T-cell receptor domain polypeptides may be employed.
  • the modified T-cell receptor domain polypeptides are purified or isolated after expression.
  • Modified T-cell receptor domain polypeptides may be isolated or purified in a variety of ways known to those skilled in the art. Standard purification methods include chromatographic techniques, electrophoretic, immunological, precipitation, dialysis, filtration, concentration, and chromatofocusing techniques. Purification can often be enabled by a particular fusion partner. For example, TCRs may be purified using glutathione resin if a GST fusion is employed, Ni 2+ -affinity chromatography if a His-tag is employed or immobilized anti-flag antibody if a flag-tag is used. For general guidance in suitable purification techniques, see e.g.
  • Modified T-cell receptor domain polypeptides of the invention may be screened using a variety of methods, including but not limited to those that use in vitro assays, in vivo and cell-based assays, and selection technologies. Automation and high-throughput screening technologies may be utilized in the screening procedures. Screening may employ the use of a fusion partner or label, for example an enzyme, an immune label, isotopic label, or small molecule label such as a fluorescent or colorimetric dye or a luminogenic molecule.
  • a fusion partner or label for example an enzyme, an immune label, isotopic label, or small molecule label such as a fluorescent or colorimetric dye or a luminogenic molecule.
  • the functional and/or biophysical properties of the T-cell receptor domain • polypeptides are screened in an in vitro assay.
  • the TCR is screened for functionality, for example its ability to catalyze a reaction or its binding specificity, cross reactivity and/or affinity to its target.
  • the favourable modified T-cell receptor domain polypeptides may be selected in vivo, e.g. by introducing it into a cell or an organism.
  • the specifically binding variants may be isolated either from body fluid such as blood or lymphatic liquid or from specific organs, depending on the required properties of the modified domains .
  • Assays may employ a variety of detection methods including but not limited to chromogenic, fluorescent, luminescent, or isotopic labels.
  • selection methods find use in the present invention for screening modified T-cell receptor domain polypeptides.
  • selection methods When variant T-cell receptor domain polypeptide libraries are screened using a selection method, only those members of a library that are favourable, that is which meet some selection criteria, are propagated, isolated, and/or observed.
  • selection methods enable the screening of libraries that are larger than those screenable by methods that assay the fitness of library members individually.
  • Selection is enabled by any method, technique, or fusion partner that links, covalently or non- covalently, the phenotype of T-cell receptor domain polypeptide with its genotype, that is the function of a T- cell receptor domain polypeptide with the nucleic acid that encodes it.
  • phage display as a selection method is enabled by the fusion of library members to a phage coat protein. Most frequently used is the filamentous phage gene III protein, however also other coat proteins such as protein VIII, protein VII, protein VI and protein IX can be used.
  • modified T-cell receptor domain polypeptides that meet some criteria, for example binding affinity to the T-cell receptor domain polypeptide's target, also selects for or isolates the nucleic acid that encodes it.
  • the gene or genes encoding modified T-cell receptor domain polypeptides may then be amplified. This process of isolation and amplification, referred to as panning, may be repeated, allowing favourable T-cell receptor domain polypeptide variants in the library to be enriched. Nucleic acid sequencing of the attached nucleic acid ultimately allows for gene identification.
  • T-cell receptor domain polypeptide libraries WO04044004A2, WO05116646A1 and WO9839482A1 ; Dunn et al . (2006) Protein Sci. 15:710-721; Richmann et al . (2006) Protein Eng Des SeI. 19:255-264) .
  • These include but are not limited to all the techniques that have been used for selection of specific antibodies and peptides such as phage display (Phage display of peptides and antibodies: a laboratory manual, Kay et al . , 1996, Academic Press, San Diego, Calif., 1996; Lowman et al .
  • selection methods include methods that do not rely on display, such as in vivo methods including but not limited to periplasmic expression and cytometric screening (Chen et al . , 2001, Nat Biotechnol 19:537-542), the fragment complementation assay (Johnsson & Varshavskiy, 1994, Proc Natl Acad Sci USA 91:10340- 10344; Pelletier et al . , 1998, Proc Natl Acad Sci USA- 95:12141-12146), and the yeast two hybrid screen (Fields & Song, 1989, Nature 340:245-246) used in selection mode (Visintin et al .
  • selection is enabled by a fusion partner that binds to a specific sequence on the expression vector, thus linking covalently or noncovalently the fusion partner and associated T-cell receptor domain polypeptide library member with the nucleic acid that encodes them.
  • a fusion partner that binds to a specific sequence on the expression vector, thus linking covalently or noncovalently the fusion partner and associated T-cell receptor domain polypeptide library member with the nucleic acid that encodes them.
  • WO9308278 describe such a fusion partner and technique that may find use in the present invention.
  • in vivo selection can occur if expression of the T-cell receptor domain polypeptide imparts some growth, reproduction, or survival advantage to the cell.
  • directed evolution methods Some selection methods are referred to as "directed evolution" methods . Those methods include the mating or breeding of favourable sequences during selection, sometimes with the incorporation of new mutations. As will be appreciated by those skilled in the art, directed evolution methods can facilitate identification of the most favourable sequences in a plurality of polypeptides, and can increase the diversity of sequences that are screened. A variety of directed evolution methods are known in the art that may find use in the present invention for generating and screening T- cell receptor domain polypeptides.
  • T-cell receptor domain polypeptide variants are screened using one or more cell-based or in vivo assays.
  • purified or non-purified modified T- cell receptor domain polypeptides are typically added exogenously such that cells are exposed to individual modified T-cell receptor domain polypeptides or pools of modified T- cell receptor domain polypeptides belonging to a library.
  • These assays are typically, but not always, based on the desired function of the T-cell receptor domain polypeptide; that is, the ability of the T-cell receptor domain polypeptide modified according to the invention to bind to its target and to mediate some biochemical event, for example effector function, serum half life, ligand/receptor binding inhibition, apoptosis, and the like.
  • Such assays often involve monitoring the response of cells to the T-cell receptor domain polypeptide, for example cell survival, cell death, change in cellular morphology, or transcriptional activation such as cellular expression of a natural gene or reporter gene.
  • such assays may measure the ability of T-cell receptor domain polypeptide variants to elicit ADCC, ADCP or CDC.
  • additional cells or components that is in addition to the target cells, may need to be added, for example serum complement, or effector cells such as peripheral blood monocytes (PBMCs), NK cells, macrophages, and the like.
  • PBMCs peripheral blood monocytes
  • NK cells macrophages, and the like.
  • additional cells may be from any organism, preferably humans, mice, rat, rabbit, and monkey.
  • T-cell receptor domain polypeptides may cause apoptosis of certain cell lines expressing the target, or they may mediate attack on target cells by immune cells which have been added to the assay.
  • Methods for monitoring cell death or viability include the use of dyes, immunochemical, cytochemical, and radioactive reagents.
  • caspase staining assays may enable to measure apoptosis, and uptake or release of radioactive substrates or fluorescent dyes may enable cell growth or activation to be monitored.
  • dead or damaged target cells may be monitored by measuring the release of one or more natural intracellular components, e.g. lactate dehydrogenase.
  • Transcriptional activation may also serve as a method for assaying function in cell-based assays.
  • response may be monitored by assaying for natural genes which may be upregulated, for example the release of certain interleukins may be measured, or alternatively readout may be via a reporter system.
  • Cell- based assays may also involve the measure of morphological changes of cells as a response to the presence of modified T- cell receptor domain polypeptides.
  • Cell types for such assays may be prokaryotic or eukaryotic, and a variety of cell lines that are known in the art may be employed.
  • cell-based screens may be performed using cells that have been transformed or transfected with nucleic acids encoding the variant T-cell receptor domain polypeptides.
  • T-cell receptor domain polypeptide variants of the invention are not added exogenously to the cells (e.g. analogue to Auf der Maur, 2004, Methods, 34:215-224).
  • the cell-based screen utilizes cell surface display.
  • a fusion partner can be employed that enables display of modified T-cell receptor domain polypeptides on the surface of cells (as has been shown for antibody fragments: Witrrup, 2001, Curr Opin Biotechnol, 12:395-399) .
  • the immunogenicity of the modified T-cell receptor domain polypeptide may be determined experimentally using one or more immunological or cell based assays (e.g. Koren et al . , 2002, Current Pharmaceutical Biotechnology 3:349-360; Chirino et al., 2004, Drug Discovery Today 9:82-90; Tangri et al . , 2005, J. Immunol. 174:3187-3196; Hermeling et al . , 2004, Pharm. Res. 21:897-903).
  • ex vivo T-cell activation assays are used to experimentally quantitate immunogenicity.
  • T- cell activation can be detected using a number of methods, e.g. by monitoring of cytokine release or measuring uptake of tritiated thymidine.
  • LUMINEX technology is used to measure cytokine release (e.g. de Jager et al., Clin. Diagn. Lab. Immunol., 2003, 10:133-139) or interferon gamma production is monitored using Elispot assays (Schstoff et . al . , 2000, J. Immunol. Meth., 24: 17-24).
  • the biological properties of the modified T-cell receptor domain polypeptides of the present invention may be characterized in cell, tissue, and whole organism experiments.
  • drugs are often tested in animals, including but not limited to mice, rats, rabbits, dogs, cats, pigs, and monkeys, in order to measure a drug's efficacy for treatment against a disease or disease model, or to measure a drug's pharmacokinetics, toxicity, and other properties.
  • the animals may be referred to as disease models.
  • Therapeutics are often tested in mice, including but not limited to nude mice, SCID mice, xenograft mice, and transgenic mice (including genetic knock-in and knock-out mutants) .
  • Such experimentation may provide meaningful data for determination of the potential of the polypeptide variant to be used as a therapeutic.
  • Any organism preferably mammals, may be used for testing.
  • monkeys can be suitable therapeutic models, and thus may be used to test the efficacy, toxicity, pharmacokinetics, or other property of the modified T-cell receptor domain polypeptides of the present invention. Tests in humans are most frequently required for approval as therapeutics, and thus of course these experiments are contemplated.
  • the modified T-cell receptor domain polypeptide of the present invention may be tested in humans to determine their therapeutic efficacy, toxicity, immunogenicity, pharmacokinetics, and/or other clinical properties .
  • the modified T-cell receptor domain polypeptide of the present invention may find use in a wide range of products .
  • the T-cell receptor domain polypeptide variant of the present invention is used for therapy or prophylaxis, for preparative or analytic use, as a diagnostic, as an industrial compound or a research reagent, preferably as a therapeutic.
  • the T-cell receptor domain polypeptide variant may find use in a T-cell receptor domain polypeptide composition that is monoclonal, oligoclonal or polyclonal.
  • the modified T-c ' ell receptor domain polypeptides of the present invention are used to kill target cells that bear the target antigen, for example cancer cells.
  • the modified T-cell receptor domain polypeptides of the present invention are used to block, antagonize, or agonize the target antigen, for example by antagonizing a cytokine or cytokine receptor.
  • the modified T-cell receptor domain polypeptides of the present invention are used to block, antagonize, or agonize the target antigen and kill the target cells that bear the target antigen.
  • the modified T-cell receptor domain polypeptides of the present invention are used to block, antagonize, or agonize growth factors or growth factor receptors and kill the target cells that bear or need the target antigen.
  • the modified T-cell receptor domain polypeptides of the present invention are used to block, antagonize, or agonize enzymes and substrate of enzymes .
  • the modified T- cell receptor domain polypeptides of the present invention are used to neutralize infectious agents such as viruses, bacteria or fungi .
  • modified T- cell receptor domain polypeptides of the present invention shows increased serum half life.
  • modified T- cell receptor domain polypeptides of the present invention shows effector function capabilities.
  • the modified T-cell receptor domain polypeptides of the present invention may be used for various therapeutic purposes.
  • a T-cell receptor comprising the modified T-cell receptor domain polypeptide is administered to a patient to treat a specific disorder.
  • a "patient” for the purposes of the present invention includes both, humans and other animals, preferably mammals and most preferably humans.
  • specific disorder herein is meant a disorder that may be ameliorated by the administration of a pharmaceutical composition comprising a modified T-cell receptor domain polypeptide of the present invention.
  • a modified T-cell receptor domain polypeptide according to the present invention is the only therapeutically active agent administered to a patient.
  • the modified T-cell receptor domain polypeptide according the present invention is administered in combination with one or more other therapeutic agents, including but not limited to cytotoxic agents, chemotherapeutic agents, cytokines, growth inhibitory agents, anti-hormonal agents, kinase inhibitors, anti-angiogenic agents, cardioprotectants, or other therapeutic agents .
  • the modified T-cell receptor domain polypeptide may be administered concomitantly with one or more other therapeutic regimens.
  • a T-cell receptor variant of the present invention may be administered to the patient along with chemotherapy, radiation therapy, or both chemotherapy and radiation therapy.
  • the modified T-cell receptor domain polypeptide of the present invention may be administered in conjunction with one or more antibodies .
  • the modified T-cell receptor domain polypeptide of the present invention and one or more other anti-cancer therapies are employed to treat cancer cells ex vivo. It is contemplated that such ex vivo treatment may be useful in bone marrow transplantation and particularly, autologous bone marrow transplantation. It is of course contemplated that the T-cell receptor domain polypeptide of the invention can be employed in combination with still other therapeutic techniques such as surgery.
  • the modified T-cell receptor domain polypeptide of the present invention is administered with an anti-angiogenic agent, which is a compound that blocks, or interferes to some degree with the development of blood vessels.
  • the anti-angiogenic factor may, for instance, be a small molecule or a protein, for example an antibody, Fc fusion, or cytokine, that binds to a growth factor or growth factor receptor involved in promoting angiogenesis .
  • the preferred anti-angiogenic factor herein is an antibody that binds to Vascular Endothelial Growth Factor (VEGF) .
  • VEGF Vascular Endothelial Growth Factor
  • the modified T-cell receptor domain polypeptide is administered with a therapeutic agent that induces or enhances adaptive immune response, for example an antibody that targets CTLA-4.
  • the modified T-cell receptor domain polypeptide is administered with a tyrosine kinase inhibitor, which is a molecule that inhibits to some extent tyrosine kinase activity of a tyrosine kinase.
  • the modified T-cell receptor domain polypeptides of the present invention are administered with a cytokine.
  • cytokine as usqd herein is meant a generic term for proteins released by one cell population that act on another cell as intercellular mediators including chemokines .
  • compositions are contemplated wherein modified T-cell receptor domain polypeptides of the present invention of the same or different specificities and one or more therapeutically active agents are formulated.
  • Formulations of the polypeptide variants of the present invention are prepared for storage by mixing said modified T- cell receptor domain polypeptides having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences, 1980, 16 th edition, Osol, A. Ed.,), in the form of lyophilized formulations or aqueous solutions.
  • the formulations to be used for in vivo administration are preferably sterile. This is readily accomplished by filtration through sterile filtration membranes or other methods.
  • the modified T-cell receptor domain polypeptide and other therapeutically active agents disclosed herein may also be formulated as immunoliposomes, and/or entrapped in microcapsules .
  • Administration of the pharmaceutical composition comprising a modified T-cell receptor domain polypeptide of the present invention or a mixture of different modified T- cell receptor domain polypeptides, preferably in the form of a sterile aqueous solution may be performed in a variety of ways, including, but not limited to, orally, subcutaneously, intravenously, intranasally, intraotically, transdermally, topically (e.g., gels, salves, lotions, creams, etc.), intraperitoneally, intramuscularly, intrapulmonary, vaginally, parenterally, rectally, or intraocularly .
  • the expression system comprises a vector. Any expression vector known in the art may be used for this purpose as appropriate.
  • the modified T-cell receptor domain polypeptide is preferably expressed in a host, preferably in a bacterium, in yeast, in a plant cell, in an insect cell, in an animal cell or mammalian cell or in an organ of a plant or animal or in a complete plant or animal .
  • a wide variety of appropriate host cells may be used to express the modified polypeptide of the invention, including but not limited to mammalian cells (animal cells) plant cells, bacteria (e.g. Bacillus subtilis, Escherichia coli) , insect cells, and yeast (e.g. Pichia pastoris, Saccharomyces cerevisiae) .
  • mammalian cells animal cells
  • bacteria e.g. Bacillus subtilis, Escherichia coli
  • insect cells e.g. Pichia pastoris, Saccharomyces cerevisiae
  • yeast e.g. Pichia pastoris, Saccharomyces cerevisiae
  • a variety of cell lines that may find use in the present invention are described in the ATCC cell line catalog, available from the American Type Culture Collection.
  • plants and animals may be used as hosts for the expression of the T-cell receptor domain polypeptide according to the present invention.
  • the expression as well as the transfection vectors or cassettes may be selected according to the host
  • non-cellular or cell-free protein expression systems may be used.
  • In vitro transcription/translation protein expression platforms that produce sufficient amounts of protein offer many advantages of a cell-free protein expression, eliminating the need for laborious up- and down-stream steps (e.g. host cell transformation, culturing, or lysis) typically associated with cell-based expression systems.
  • Another aspect of the present invention relates to a method for manufacturing a molecule comprised of a T-cell receptor domain polypeptide' or a pharmaceutical preparation thereof comprising at least one modification in a structural loop of said T-cell receptor domain polypeptide and determining the binding of said molecule to an epitope of an antigen, wherein the unmodified molecule does not significantly bind to said epitope, comprising the steps of:
  • the present invention relates to a method for manufacturing a multi-specific molecule binding specifically to at least one first molecule or a pharmaceutical preparation thereof comprising at least one modification in each of at least one structural loop region of said T-cell receptor domain polypeptide and determining the specific binding of said at least one loop region to at least one second molecule selected from the group consisting of allergens, tumor associated antigens, self antigens, enzymes, Fc-receptors, proteins of the complement system, serum molecules, bacterial antigens, fungal antigens, protozoal antigens and viral antigens, wherein the T-cell receptor domain polypeptide containing an unmodified structural loop region does not specifically bind to said at least one second molecule, comprising the steps of:
  • a TCR of the present invention may consist of an alpha (or a gamma) chain and a beta (or a delta) chain, which form together a variable region binding to a specific binding partner, and the second specificity may be formed by modified structural loops of either the alpha (or gamma) chain or the beta (or delta) chain variable or constant domain.
  • the binding site may also be formed by at least one or more than one non- CDR loops on two variable or constant domains (e.g. a heavy chain variable domain and a light chain variable domain which may be structurally neighboured) .
  • the modified T-cell receptor or derivative may be a complete T-cell receptor or a T-cell receptor fragment (e.g. soluble TCR, single-chain-TCR) comprising at least one modified T-cell receptor domain polypeptide .
  • T-cell receptor fragment or, equivalently an scTCR may be engineered in such a way that the structural loops of both variable domains are separately engineered to bind to the same epitope as the binding site formed by the CDRs, resulting in a trivalent T-cell receptor or scTCR respectively.
  • the natural binding site formed by the CDRs recognizes a different target epitope than the engineered variable domains then the resulting TCR fragment or scTCR will bind monovalently to the first target, and bivalently to the second target which is bound independantly by the modified structural loops of the variable domains respectively.
  • This modular design principle can be applied in numerous different ways as will be obvious to those skilled in the art.
  • T-cell receptor derivatives As there are a number of various structural loops available for selection and design of a specific binding site in the non-CDR regions of alpha (gamma) and beta (delta) domains it is possible to design T-cell receptor derivatives with even more than two specificities.
  • Valpha and Vbeta domains recognizing a first target by their CDRs can be engineered separately to bind specifically to different (second and third) targets through interactions mediated by the modified structural loops in the respective variable domain.
  • a trispecific T-cell receptor or a fragment therof such as a single chain T-cell receptor, which binds monovalenty to each of its various targets can be generated.
  • the specific binding domains within one polypeptide chain may be connected with or without a peptide linker and may not necessarily be in the natural order. Neither constant nor variable domains of T-cell receptors mediate effector functions which is the reason why T-cell receptor fragments do not show ADCC, ADCP or CDC. With the current invention it is possible to design a T-cell receptor binding to effector molecules such as Fc receptors and complement proteins . Modified loops in T-cell receptor domains can be selected from a library of modified loop structures or designed to bind to one or more effector molecules . A T-cell receptor or a fragment thereof with such effector molecule binding sites would enable effector functions similar to antibodies and could be designed depending on the requirements to show strong or weak ADCC and ADCP and/or complement activation .
  • libraries comprising mutant T-cell receptor domain polypeptides may be selected for binding to Fc- receptors and/or complement factors such as CIq.
  • Fcgamma receptors for selection may be provided either on the surface of cells expressing naturally the respective receptors or by- expression and purification of the extracellular part of the respective receptor.
  • IFN-g stimulated U937 cells CRM-1503, American Type Culture Collection
  • FcgammaRI similar to Berntzen et al . , 2-006, Protein Eng Des SeI.
  • Binding to the Fc receptor can be tested for by FACS using U937 cells as target which are stained specifically with selected modified T-cell receptor domain polypeptides.
  • the extracellular domains of human Fcgamma receptors can be cloned and expressed as soluble proteins or fusion proteins and used for analysis of the specific binding of potential binding partners (e.g. as in Berntzen et al . , 2005, J Immunol Methods. 298 (1-2) : 93-104) .
  • the identification and characterisation of modified T-cell receptor domain polypeptides specifically binding to complement factor CIq can be performed essentially similarily (e.g. as in Lauvrak et al . 1997 Biol Chem. 378 (12 ): 1509-19) .
  • T-cell receptor domain polypeptide binding to FcRn may be selected for with libraries of mutant T-cell receptor domain polypeptides according to the present invention .
  • FcRn-receptors for selection may be provided either on the surface of cells expressing naturally the respective receptors or by expression and purification of the extracellular part of the respective receptor.
  • a first screening on FcRn may select for mutant T-cell receptor domain polypeptides (or molecules comprising such mutant T- cell receptor domain polypeptides) which can further be tested in vitro and even further characterized in FACS experiments by binding to cells expressing FcRn receptor.
  • Screening and selection may also consider pH dependencies in binding to FcRn (as described in PCT WO02/060919; PCT WO97/34631 ).It can be further characterized by affinity ranking of binding to various recombinant FcRn, isoforms and allotypes e.g with surface plasmon resonance techniques (e.g. as in DaIl' Acqua et al. Journal of Immunology, 2002, 169: 5171 5180).
  • the T-cell receptors comprise preferably either an alpha and beta chain or a gamma and delta chain of the T-cell receptor or a part thereof.
  • the modified T-cell receptor may comprise an alpha or beta chain or a gamma and delta chain, at least one variable domain.
  • the T-cell receptor according to the present invention comprises preferably at least one constant and/or at least one variable domain of a T-cell receptor or a part thereof.
  • Another preferred T-cell receptor according to the invention consists of a domain of an alpha, beta, gamma or delta chain, or a part thereof, with at least two structural loop regions, and is characterised in that said at least two structural loop regions comprise at least two amino acid modifications forming at least two modified structural loop regions, wherein said at least two modified structural loop regions bind specifically to at least one epitope of an antigen.
  • the specific binding of the modified T-cell receptor domain polypeptide to a molecule is determined by a binding assay selected from the group consisting of immunological assays, preferably enzyme linked immunosorbent assays (ELISA), surface plasmon resonance assays, saturation transfer difference nuclear magnetic resonance spectroscopy, transfer NOE (trNOE) nuclear magnetic resonance spectroscopy, competitive assays, tissue binding assays, live cell binding assays and cellular extract assays.
  • immunological assays preferably enzyme linked immunosorbent assays (ELISA), surface plasmon resonance assays, saturation transfer difference nuclear magnetic resonance spectroscopy, transfer NOE (trNOE) nuclear magnetic resonance spectroscopy, competitive assays, tissue binding assays, live cell binding assays and cellular extract assays.
  • Binding assays can be carried out using a variety of methods known in the art, including but not limited to FRET (Fluorescence Resonance Energy Transfer) and BRET (Bioluminescence Resonance Energy Transfer) -based assays, Amplified Luminescent Proximity Homogeneous Assay, Scintillation Proximity Assay, ELISA (Enzyme-Linked Immunosorbent Assay) , SPR (Surface Plasmon Resonance)', isothermal titration calorimetry, differential scanning calorimetry, gel electrophoresis, and chromatography including gel filtration.
  • FRET Fluorescence Resonance Energy Transfer
  • BRET Bioluminescence Resonance Energy Transfer
  • Amplified Luminescent Proximity Homogeneous Assay Scintillation Proximity Assay
  • ELISA Enzyme-Linked Immunosorbent Assay
  • SPR Surface Plasmon Resonance
  • the modified polypeptide of the invention is preferably conjugated to a label selected from the group consisting of organic molecules, enzyme labels, radioactive labels, colored labels, fluorescent labels, chromogenic labels, luminescent labels, haptens, digoxigenin, biotin, metal complexes, metals, colloidal gold and mixtures thereof.
  • the modified T-cell receptor domain polypeptide may be conjugated to other molecules which allow the simple detection of said conjugate in, for instance, binding assays (e.g. ELISA) and binding studies.
  • Another aspect of the present invention relates to a polypeptide comprising a domain of a T-cell receptor or combinations thereof, with at least two structural loop regions, characterised in" that said at least two structural loop regions each comprise at least one amino acid modification forming at least two modified structural loop regions, wherein said at least two modified structural loop regions bind specifically to at least one epitope of an antigen.
  • T-cell receptor domain polypeptide binding to the specific partner via the non-variable sequences or structural loops
  • at least one other binding molecule which can be an antibody, antibody fragment, a soluble receptor, a ligand or another modified T-cell receptor domain polypeptide.
  • the other binding molecule combined with the at least one modified T-cell receptor domain polypeptide of the invention is selected from the group consisting of proteinaceous molecules, nucleic acids, and carbohydrates.
  • the structural loop regions of the modified T-cell receptor domain polypeptides may specifically bind to any kindof binding molecules, in particular to proteinaceous molecules, proteins, peptides, polypeptides, nucleic acids, glycans, carbohydrates, lipids, small and large organic molecules, inorganic molecules.
  • the modified T-cell receptor domain polypeptide may comprise at least two loop regions whereby each of the loop regions may specifically bind to different molecules or epitopes.
  • the molecule binding to the modified structural loop region is selected from the group consisting of tumor associated antigens, in particular EpC ⁇ M, tumor-associated glycoprotein-72 (TAG-72), tumor-associated antigen CA 125, Prostate specific membrane antigen (PSMA) , High molecular weight melanoma-associated antigen (HMW-MAA) , tumor-associated antigen expressing Lewis Y related carbohydrate, Carcinoembryonic antigen (CEA), CEACAM5, HMFG PEM, mucin MUCl, MUC18 and cytokeratin tumor-associated antigen, bacterial antigens, viral antigens, allergens, allergy related molecules IgE, cKIT and Fc-epsilon-receptorl, IRp ⁇ O, IL-5 receptor, CCR3, red blood cell receptor (CRl) , human serum albumin, mouse serum albumin, rat serum albumin, neonatal Fc-gamma- receptor FcRn, F
  • the antigen is selected from the group consisting of pathogen antigen, tumor associated antigen, enzyme, substrate, self antigen, organic molecule or allergen. More preferred antigens are selected from the group consisting of viral antigens, bacterial antigens or antigens from pathogens of eukaryots or phages .
  • Preferred viral antigens include HAV-, HBV-, HCV-, HIV I-, HIV II-, Parvovirus-, Influenza-, HSV-, Hepatitis Viruses, Flaviviruses, Westnile Virus, Ebola Virus, Pox-Virus, Smallpox Virus, Measles Virus, Herpes Virus, Adenovirus, Papilloma Virus, Polyoma Virus, Parvovirus, Rhinovirus, Coxsackie virus, Polio Virus, Echovirus, Japanese Encephalitis virus, Dengue Virus, Tick Borne Encephalitis Virus, Yellow Fever Virus, Coronavirus, respiratory syncytial virus, parainfluenza virus, La Crosse Virus, Lassa Virus, Rabies Viruse, Rotavirus antigens; preferred bacterial antigens include Pseudomonas-, Mycobacterium-, Staphylococcus-, Salmonella-, Meningococcal-, Borelli
  • Preferred eukaryotic antigens of pathogenic eukaryotes include antigens from Giardia, Toxoplasma, Cyclospora, Cryptosporidium, Trichinella, Yeasts, Candida, Aspergillus, Cryptococcus, Blastomyces, Histoplasma, Coccidioides .
  • the modified T-cell receptor domain polypeptide according to the present invention may preferably bind to one of the molecules disclosed above. These molecules comprise also allergens .
  • the modified polypeptide according to the invention is preferably conjugated to a label or reporter molecule selected from the group consisting of organic molecules, enzyme labels, radioactive labels, colored labels, fluorescent labels, chromogenic labels, luminescent labels, haptens, digoxigenin, biotin, metal complexes, metals, colloidal gold and mixtures thereof.
  • a label or reporter molecule selected from the group consisting of organic molecules, enzyme labels, radioactive labels, colored labels, fluorescent labels, chromogenic labels, luminescent labels, haptens, digoxigenin, biotin, metal complexes, metals, colloidal gold and mixtures thereof.
  • Modified polypeptides of the invention conjugated to labels as specified above may be used, for instance, in diagnostic methods .
  • T-cell receptor domain polypeptide according to the present invention or obtainable by a method according to the present invention for the preparation of a vaccine for active immunization.
  • the T-cell receptor domain polypeptide is either used as antigenic drug substance to formulate a vaccine or used for fishing or capturing antigenic structures for use in a vaccine formulation.
  • Another aspect of the present invention relates to the use of a T-cell receptor domain polypeptide according to the present invention or obtainable by a method according to the present invention for the preparation of a protein library of molecules comprising modified T-cell receptor domain polypeptides .
  • Yet another aspect of the present invention relates to a method for specifically binding and/or detecting a target molecule comprising the steps of:
  • Another aspect of the present invention relates to a method for specifically isolating a target molecule comprising the steps of:
  • the T-cell receptor domain polypeptides according to the present invention may be used to isolate specifically target molecules from a sample. If multi-specific T-cell receptor domain polypeptides are used more than one target molecule may be isolated from a sample. It is especially advantageous using modified T-cell receptor domain polypeptides in such methods because it allows, e.g., to generate a matrix having a homogeneous surface with defined amounts of binding partners (i.e. modified T-cell receptor domain polypeptides) immobilised thereon which are able to bind to the target molecules to be isolated. In contrast thereto, if monospecific binding partners are used no homogeneous matrix can be generated because the single binding partners do not bind with the same efficiency to the matrix.
  • binding partners i.e. modified T-cell receptor domain polypeptides
  • Another aspect of the present invention relates to a method for targeting a compound to a target comprising the steps of: (a) contacting a molecule comprising a modified T-cell receptor domain polypeptide according to the present invention or a molecule comprising a modified T-cell receptor domain polypeptide obtainable by a method according to the present invention capable to specifically bind to said compound,
  • Modified T-cell receptor domain polypeptides according to the present invention may be used to deliver at least one compound bound to the CDRs and/or modified structural loop regions- to a target. Such modified T-cell receptors may be used to target therapeutic substances to a preferred site of action in the course of the treatment of a disease.
  • Another aspect of the present invention relates to a molecule library comprising a T-cell receptor domain polypeptide according to the present invention or obtainable by the method according to the present invention.
  • the library according to the present invention may be used to identify T-cell receptor domain polypeptides binding to a distinct molecule.
  • the present invention relates to the use of a protein library of polypeptides comprising a T ⁇ -cell receptor domain polypeptide according to the present invention or obtainable by the method according to the present invention for the design of T-cell receptor derivatives .
  • An existing T-cell receptor can be changed to introduce antigen binding sites into a domain by using a protein library of the respective modified wild-type domain of at least 10, preferably 100, more preferably 1000, more preferably 10000, more preferably 100000, most preferably more than 1000000 variant domains each with at least one modified structural loop.
  • the variant domains comprise of at least two modified structural loops.
  • the library is then screened for binding to the specific antigen.
  • the selected domain is cloned into the original T-cell receptor by genetic engineering techniques so that it replaces the wild type region.
  • the DNA coding for the modified structural loops or coding for the mutated amino acids may be exchanged to obtain a T-cell receptor with the additional binding site for the specific antigen.
  • the modification in the structural loops of the domains may be performed with the domain in its natural context, e.g. in the form of a cell bound T-cell receptor, a soluble T-cell receptor, a ingle-chain TCR a zipper dimerized TCR or a combination thereof with any other molecule.
  • the advantage of this setup is that the screening is performed with modifications in their intended context and therefore any influence of the various modifications on the structure or function of the remainder of the molecule is easily observed.
  • the choice of the site for the mutated, antigen-specific structural loop is dependent on the structure of the original T-cell receptor and on the purpose of the additional binding site. If, for example, the original T-cell receptor is a single chain TCR modification of structural loops in the two variable domains is possible. If the original T-cell receptor is a soluble TCR with constant and variable domains, structural loops on one side of each variable domain may be modified as well as structural loops on two sides of each constant domain.
  • the selection with complete mutated original molecules may have some advantages as the selection for antigen binding with a modified structural loop will deliver the sterically advantageous modifications.
  • the complete molecule is a single chain TCR
  • the original - the first - antigen may be bound to the CDR-loops during the screening for binding to an antigen with the modified structural loops .
  • This simultaneous screening may allow for preferential selection of clones that contain mutations in the structural loops which do not negatively affect the binding of the modified T-cell receptor domain to its original target which it recognizes through its CDR loops.
  • a preferred embodiment of the invention is a library of variant T-cell receptor domain polypeptides with at least one variant amino acid position in at least one of the structural loops.
  • the library may comprise TCR domains of the alpha, beta, gamma and delta chain or mixtures and molecular combinations thereof. More preferably the variant T-cell receptor domain polypeptides of the library have at least 2, at least 3, at least 4 variant amino acid position in at least one structural loop.
  • Another preferred embodiment of the invention is a single- chain TCR library with at least one variant amino acid position in at least one of the structural loops of any of the domains of the scTCR.
  • Another preferred embodiment of the invention is a zipper- dimerized TCR library with at least one variant amino acid position in at least one of the structural loops of any of the domains of the leucine-zipper-dimerized TCR.
  • Another preferred embodiment of the invention is a TCR library with at least one variant amino acid position in at least one of the structural loops of any of the domains of the TCR.
  • Yet another preferred embodiment of the invention is a soluble TCR library with at least one variant amino acid position in at least one of the structural loops of any of the domains of the soluble TCR.
  • the size requirement (i.e. the number of variant proteins) of a protein library comprising mutated T-cell receptor domain polypeptides or fusion molecules of a mutated T-cell receptor domain polypeptide is dependent on the task.
  • a library to generate an antigen binding site de novo needs to be larger than a library used to further modify an already existing engineered antigen binding site formed by a modified structural loop (e.g. for enhancing affinity or changing fine specificity to the antigen) .
  • the present invention also relates to a polypeptide library or a nucleic acid library comprising a plurality of polypeptides comprising T-cell receptor domains or at least one structural loop region contained in a minidomain, or nucleic acid molecules encoding the same.
  • the library contains members with different modifications, wherein the plurality is defined by the modifications in the at least one structural loop region.
  • the nucleic acid library preferably includes at least 10 different members (with at least one, more preferably at least two, even more preferably at least three, most preferably at least four potential amino acid modifications) and more preferably includes at least 100, more preferably 1000 or 10000 different members (e.g. designed by randomisation strategies or combinatory techniques) . Even more diversified individual member numbers, such as at least 1000000 or at least 10000000 are also preferred.
  • a further aspect of the invention is the combination of two different T-cell receptor domain polypeptides selected from at least two libraries according to the invention in order to generate multispecific T-cell receptors.
  • selected specific T-cell receptor domain polypeptides may be combined with each other and with other molecules, similar to building blocks, to design the optimal arrangement of the domains to get the desired properties such as combinations of specificities and/or valencies.
  • one or more modified T-cell receptor domain polypeptides according to the invention may be introduced at various or all the different sites of a protein without destruction of the structure of the protein. By such a "domain shuffling" technique new libraries are created which can again be selected for the desired properties.
  • the preferred library contains T-cell receptor domain polypeptides according to the invention or derivatives thereof .
  • a preferred embodiment of the present invention is a binding molecule for an antigen (antigen binding molecule) comprising at least one T-cell receptor domain polypeptide and at least one structural loop region thereof being modified according to the present invention to bind to the antigen, wherein said binding molecule has no relevant and/or specific binding activity with its CDR-loops; however with a newly introduced specific binding activity in the structural loop region.
  • the new antigen binding sites in the structural loops are introduced by randomising technologies, i.e. by modifying one or more amino acid residues of at least two structural loops by randomisation techniques or by introducing randomly generated inserts into such structural loops .
  • randomising technologies i.e. by modifying one or more amino acid residues of at least two structural loops by randomisation techniques or by introducing randomly generated inserts into such structural loops .
  • combinatorial approaches are used for the use of combinatorial approaches.
  • the present invention relates to a modified T-cell receptor having an antigen binding site foreign to the unmodified T-cell receptor and incorporated in one, two, three or more structural loops of at least one domain.
  • the term "foreign" means that the antigen binding site is not naturally formed by the specific structural loop regions of the T-cell receptor domain.
  • the present invention relates to a modified T-cell receptor having an antigen binding site foreign to the unmodified T-cell receptor and incorporated in one, two, three or more structural loops of al least one domain, wherein said modified T-cell receptor binds to said antigen with an affinity of at least 10 3 mol "1 , at least 10 4 mol “1 , at least 10 5 mol "1 , at least 10 6 mol “1 , at least 10 7 mol "1 , at least 10 8 mol "1 , or at least 10 9 mol "1 .
  • Preferred T-cell receptor domain polypeptides according to the present invention comprise at least two antigen binding sites, the first site binding to a first epitope, and the second site binding to a second epitope.
  • the present T-cell receptor domain polypeptide comprises at least three loop regions, the first loop region binding to a first epitope, and the second and third loop region binding to a second epitope. Either the at least first or at least second and third. loop region or both may contain a structural loop.
  • the T-cell receptor domains according to the present inventions include the fragments thereof known in the art to be functional which contain the essential elements according to the present invention: the structural loop regions modified according to the present invention.
  • the T-cell receptor according to the present invention is composed of at least two T-cell receptor domains, or a part thereof including a minidomain, and each domain contains at least one antigen binding site.
  • T-cell receptor domain polypeptide which comprises at least one domain of the variable region of a T-cell receptor and at least one domain of the constant region of a T-cell receptor; for example, a variable domain, which is modified in at least two structural loops linked to a constant domain.
  • the preferred T-cell receptor domain polypeptide according to the invention comprises a domain that has at least 50% homology with the unmodified domain.
  • the term "homology” indicates that polypeptides have the same or conserved residues at a corresponding position in their primary, secondary or tertiary structure. The term also extends to two or more nucleotide sequences encoding the homologous polypeptides .
  • “Homologous TCR domain” means a TCR domain according to the invention having at least about 50% amino acid sequence identity with regard to a full-length native sequence TCR framework domain sequence or any other fragment of a full- length TCR domain sequence as disclosed herein.
  • a homologous TCR domain will have at least about 50% amino acid sequence identity, preferably at least about 55% amino acid sequence identity, more preferably at least about 60% amino acid sequence identity, more preferably at least about 65% amino acid sequence identity, more preferably at least about 70% amino acid sequence identity, more preferably at least about 75% amino acid sequence identity, more preferably at least about 80% amino acid sequence identity, more preferably at least about 85% amino acid sequence identity, more preferably at least about 90% amino acid sequence identity, more preferably at least about 95% amino acid sequence identity to a native TCR domain sequence, or any other specifically defined fragment of a full-length TCR domain sequence as disclosed herein.
  • Percent (%) amino acid sequence identity with respect to the TCR domain sequences identified herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the specific TCR domain sequence, after aligning the sequence and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
  • a % amino acid sequence identity value is determined by dividing (a) the number of matching identical amino acid residues between the amino acid sequence of the TCR domain of interest having a sequence derived from the native TCR domain and the comparison amino acid sequence of interest (i.e., the sequence against which the TCR domain of interest is being compared which may be the unmodified TCR domain) as determined by WU- BLAST-2 by (b) the total number of amino acid residues of the non-randomized parts of the TCR domain of interest.
  • amino acid sequence A is the comparison amino acid sequence of interest and the amino acid sequence B is the amino acid sequence of the TCR domain of interest.
  • the polypeptide according to the invention is a T-cell receptor or a bispecific single chain T- cell receptor or a bispecific zipper-dimerized T-cell receptor or a bispecific soluble T-cell receptor. Further preferred is that the polypeptide comprises a bispecific domain or a part thereof .
  • the polypeptide according to the present invention may be used for any purpose known in the art for T-cell receptors and immunoglobulins but also enables applications which are depending on the combination of specificities introduced by the present invention. Accordingly, the polypeptides according to the present inventions are preferably used for therapeutic and prophylactic use (e.g. as an active or passive immunotherapy, for immunomodulation) ; for preparative and analytic use and for diagnostic use.
  • Another aspect of the present invention relates to a kit of binding partners containing
  • a binding molecule containing an epitope of said antigen may be used for identifying the binding specificity of the polypeptide comprising a modified T-cell receptor domain polypeptide according to the present invention.
  • the potency of the modified polypeptide according to the present invention may be determined .
  • Potency as defined here is the binding property of the modified molecule of the invention to its antigen.
  • the binding can be determined quantitatively and/or qualitatively in terms of specificity and/or affinity and/or avidity as used for quality control purposes.
  • the binding molecule of a kit according to the present invention may be used for selecting the polypeptide comprising a modified T-cell receptor domain polypeptide according to the present invention from a library consisting of at least 10, preferably at least 100, more preferably at least 1000, more preferred at least 10000, especially at least 100000 polypeptides with different modifications in the structural loops.
  • one of the key features of the present invention is that the engineering of the T-cell receptor domain polypeptides takes place in regions which are not normally involved in antigen binding, in other words, in regions other than the CDRs of a TCR variable domain. It was observed that the specific fold of T-cell receptor domains allows the introduction of random mutations in regions which are structurally analogous to the CDRs but different in position in sequence and structure.
  • the regions identified by the present invention are, like CDRs, loop regions connecting the beta strands of the immunoglobulin fold of the T-cell receptor domain polypeptide. These structural loop regions can be mutated as described in the present invention without affecting the binding of the domains of the T-cell receptor that is mediated through the CDR loops.
  • a new molecular binding surface or binding pocket can be generated that is similar in size and shape to the binding surface or binding pocket formed by the CDR loops of the natural antigen binding site of a T- cell receptor. Since the structural loops can also be extended by the insertion of additional amino acids, the architecture of the newly generated binding site can be adjusted to the target to which it should bind. For example, deep binding pockets which are especially suitable for the binding of small molecules can be preferentially formed by long loops, i.e.
  • mutated domains can be selected that bind specifically to either human serum albumin or to Fc- receptors, which are not normally recognized and bound by human TCR domains .
  • the mutations introduced include mutations in which selected amino acid residues in the wild-type sequence were replaced by randomly chosen residues, and they also include insertions of extra amino acid residues in the loops mentioned above.
  • Engineered T-cell receptor domains from any organism and from any class can be used according to the present invention either as such (as single domains), or as part of a larger molecule.
  • they can be part of an intact T-cell receptor, which accordingly would have its "normal" antigen binding region formed by the 6 CDRs and the new, engineered antigen binding region.
  • a multi-specific, e.g. bispecific, T-cell receptor could be generated.
  • the engineered T-cell receptor domains can also be part of any fusion protein. The use of these engineered T-cell receptor domains is in the general field of the use of T-cell receptors and immunoglobulins .
  • a number of different libraries are constructed based on a soluble version of the 1G4 TCR, which is specific for the NY- ESO epitope (WO2005113595) .
  • the library genes are assembled from specific synthetic oligonucleotides and cloned as full length TCR alpha and beta chains displayed on filamentous phage. The alpha chain is expressed in soluble format, and the beta chain is expressed as in-frame fusion to the geneIII coat protein of M13 bacteriophage .
  • the alpha chain has a non-native Cystein residue (encoded by the mutation Thr84Cys (IMGT numbering)) and the beta chain has a non-native Cystein residue (encoded by the mutation Ser79Cys (IMGT numbering)) to allow heterodimer formation.
  • Cloning, selection and characterization can be done as described in Li et al . (2005) Nat Biotechnol. 23:349-354.
  • the following 1G4 TCR gene and library gene pairs are cloned into the three-cistron phage display vector, pEX746 essentially as described in Li et al . (2005) Nat Biotechnol. 23:349-354.
  • Gene of 1G4 alpha-chain wild type Genbank accession no. CS230225 (including start codon and stop codon) : 1 ATGCAGGAGG TGACACAGAT TCCTGCAGCT CTGAGTGTCC CAGAAGGAGA AAACTTGGTT TCAACTGCA GTTTCACTGA TAGCGCTATT TACAACCTCC ioi AGTGGTTTAG GC ⁇ GGACCCT GGGAAAGGTC TCACATCTCT GTTGCTTATT
  • CS230225 (including start codon and stop codon) :
  • V-alpha-library 1G4-2 (including start codon and stop codon) : i ATGCAGGAGG TGACAC ⁇ GAT TCCTGCAGCT CTGAGTGTCC CANNSNNSNN
  • Protein of C-alpha-library 1G4-1 (including start codon and stop codon MQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNA SLDKSSGRSTLYIAASQPGDSATYLCAVRPTSGGSYIPTFGRGTSLIVHPYIQNPDPAVYQLRD SKSSDKSVCLFTDFDSQTNVSQSXXXXVYITDKCVLDMRSMDFKSNSAVAWSXXXXFACANAFN NSIIPEDTFFPSPESS#
  • Protein of C-alpha-library 1G4-2 (including start codon and stop codon) :
  • V-beta-library 1G4-2 (including start codon and stop codon) : 1 ATGGGTGTCA CTCAGACCCC AAAATTCCAG GTCCTGNM5N NSNNSNNSNN
  • the steps of phage preparation are performed following standard protocols. Briefly, the ligation mixtures are transformed into E. coli TG] cells by electroporation. Subsequently, phage particles are rescued from E. coli TGl cells with helper phage M13-KO7. Phage particles are then precipitated from culture supernatant witl PEG/NaCl in 2 steps, dissolved in water and used for selectioi by panning or, alternatively, they were stored at minus 80 0 C.
  • the libraries as described in example 1 are used in panning rounds for the isolation of specifically binding clones following standard protocols. Briefly, the phage libraries are suspended in binding buffer (PBS, 1% ovalbumin, 0.005% Tween 20) and panned against human serum albumin immobilized directly on maxisorp plates ( 10 micrograms/ml in PBS, overnight at 4°C; plates are blocked with Blocker Casein (Pierce) . After 2 hours, unbound phage are removed by repetitive washing (PBS, 0.05% Tween 20) and bound phage are eluted with 500 mM KCl, 1OmM HCl, pH2. 2, 3, 4 or 5 such panning rounds are performed. After each panning round on human serum albumin, the resulting clones are selected or tested for binding to human serum albumin.
  • binding buffer PBS, 1% ovalbumin, 0.005% Tween 20
  • PBS 1% ovalbumin, 0.005% Tween 20
  • bound phage are eluted
  • phage libraries are resuspended in 5 ml 20 mM MES, pH 6.0/5% skimmed milk/0.05% Tween 20 and added (100 micro- litre of 5 x 10 12 PFU/ml/well) to 20 wells of a Maxisorp immunoplate (Nunc) previously coated with 1 microgram of murine FcRn and blocked with 5% skimmed milk.
  • Fc-gammaRI, Fc-gammaRIIA, Fc-gammaRIIB and Fc- gammaRIIIB Panning against Fc-gammaRI, Fc-gammaRIIA, Fc-gammaRIIB and Fc- gammaRIIIB are performed as described in Berntzen et al (2006) Protein Eng Des SeI 19:121-128. Briefly, cultured cells which are transfected with the genes coding for Fc-gammaRI, Fc- gammaRIIA, Fc-gammaRIIB or Fc-gammaRIIIB are used as targets for the selection of phage libraries. Cells which naturally express Fc-gammaRI, Fc-gammaRIIA, Fc-gammaRIIB or Fc-gammaRIIIB can also be used for this purpose. E.g.
  • the cell line U937 (American Type Culture Collection CRL-1503) which constitutively expresses FcgRI, FcgRIIA and FcgRIIB can be used as a target.
  • the level of FcgRI can be upregulated in this cell line by IFN-g stimulation, making this receptor the most abundant of the FcgRs .
  • Soluble versions of the receptors which can be produced recombinantly in bacteria, yeast or animal cells can also be used for this purpose.
  • Fc-gammaRI After each panning round on Fc-gammaRI, Fc-gammaRIIA, Fc- gammaRIIB or Fc-gammaRIIIB the resulting clones are selected or tested for binding to the respective receptor e.g. by ELISA or flow cytometry-

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Biochemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Zoology (AREA)
  • Toxicology (AREA)
  • Biophysics (AREA)
  • General Health & Medical Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Cell Biology (AREA)
  • Peptides Or Proteins (AREA)
  • Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
PCT/AT2007/000342 2006-07-05 2007-07-05 Method for engineering t-cell receptors Ceased WO2008003115A1 (en)

Priority Applications (9)

Application Number Priority Date Filing Date Title
JP2009516818A JP5426372B2 (ja) 2006-07-05 2007-07-05 T細胞受容体の製造方法
SI200731617T SI2051996T1 (sl) 2006-07-05 2007-07-05 Postopek za inženiring T-celičnih receptorjev
US12/307,582 US20100009863A1 (en) 2006-07-05 2007-07-05 Method for engineering t-cell receptors
EP07763740.3A EP2051996B1 (en) 2006-07-05 2007-07-05 Method for engineering t-cell receptors
ES07763740.3T ES2531515T3 (es) 2006-07-05 2007-07-05 Método para modificar receptores de células T
DK07763740.3T DK2051996T3 (en) 2006-07-05 2007-07-05 Process for Preparing T-Cell Receptors
PL07763740T PL2051996T3 (pl) 2006-07-05 2007-07-05 Sposób konstruowania receptorów komórek T
US13/482,926 US20130040836A1 (en) 2006-07-05 2012-05-29 Methods for engineering t-cell receptors
US15/284,471 US20170015727A1 (en) 2006-07-05 2016-10-03 Methods for engineering t-cell receptors

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
ATA1146/2006 2006-07-05
AT0114606A AT503861B1 (de) 2006-07-05 2006-07-05 Verfahren zur manipulation von t-zell-rezeptoren

Related Child Applications (2)

Application Number Title Priority Date Filing Date
US12/307,582 A-371-Of-International US20100009863A1 (en) 2006-07-05 2007-07-05 Method for engineering t-cell receptors
US13/482,926 Continuation US20130040836A1 (en) 2006-07-05 2012-05-29 Methods for engineering t-cell receptors

Publications (1)

Publication Number Publication Date
WO2008003115A1 true WO2008003115A1 (en) 2008-01-10

Family

ID=38434794

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/AT2007/000342 Ceased WO2008003115A1 (en) 2006-07-05 2007-07-05 Method for engineering t-cell receptors

Country Status (10)

Country Link
US (3) US20100009863A1 (enExample)
EP (2) EP2894164A1 (enExample)
JP (2) JP5426372B2 (enExample)
AT (1) AT503861B1 (enExample)
DK (1) DK2051996T3 (enExample)
ES (1) ES2531515T3 (enExample)
HU (1) HUE024559T2 (enExample)
PL (1) PL2051996T3 (enExample)
SI (1) SI2051996T1 (enExample)
WO (1) WO2008003115A1 (enExample)

Cited By (45)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2009042570A3 (en) * 2007-09-25 2009-06-04 Us Health Modified t cell receptors and related materials and methods
CN105658671A (zh) * 2013-10-10 2016-06-08 Ucl商务股份有限公司 嵌合抗原受体
US9493578B2 (en) 2009-09-02 2016-11-15 Xencor, Inc. Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens
US9605061B2 (en) 2010-07-29 2017-03-28 Xencor, Inc. Antibodies with modified isoelectric points
US9605084B2 (en) 2013-03-15 2017-03-28 Xencor, Inc. Heterodimeric proteins
US9650446B2 (en) 2013-01-14 2017-05-16 Xencor, Inc. Heterodimeric proteins
US9701759B2 (en) 2013-01-14 2017-07-11 Xencor, Inc. Heterodimeric proteins
US9738722B2 (en) 2013-01-15 2017-08-22 Xencor, Inc. Rapid clearance of antigen complexes using novel antibodies
US9822186B2 (en) 2014-03-28 2017-11-21 Xencor, Inc. Bispecific antibodies that bind to CD38 and CD3
US9850320B2 (en) 2014-11-26 2017-12-26 Xencor, Inc. Heterodimeric antibodies to CD3 X CD20
US9856327B2 (en) 2014-11-26 2018-01-02 Xencor, Inc. Heterodimeric antibodies to CD3 X CD123
US10106624B2 (en) 2013-03-15 2018-10-23 Xencor, Inc. Heterodimeric proteins
US10131710B2 (en) 2013-01-14 2018-11-20 Xencor, Inc. Optimized antibody variable regions
US10227411B2 (en) 2015-03-05 2019-03-12 Xencor, Inc. Modulation of T cells with bispecific antibodies and FC fusions
US10227410B2 (en) 2015-12-07 2019-03-12 Xencor, Inc. Heterodimeric antibodies that bind CD3 and PSMA
US10316088B2 (en) 2016-06-28 2019-06-11 Xencor, Inc. Heterodimeric antibodies that bind somatostatin receptor 2
US10428155B2 (en) 2014-12-22 2019-10-01 Xencor, Inc. Trispecific antibodies
US10487155B2 (en) 2013-01-14 2019-11-26 Xencor, Inc. Heterodimeric proteins
US10501543B2 (en) 2016-10-14 2019-12-10 Xencor, Inc. IL15/IL15Rα heterodimeric Fc-fusion proteins
US10519242B2 (en) 2013-03-15 2019-12-31 Xencor, Inc. Targeting regulatory T cells with heterodimeric proteins
US10526417B2 (en) 2014-11-26 2020-01-07 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CD38
US10544187B2 (en) 2013-03-15 2020-01-28 Xencor, Inc. Targeting regulatory T cells with heterodimeric proteins
US10611811B2 (en) 2014-02-27 2020-04-07 Ucl Business Ltd Ligand
EP2423222B2 (en) 2007-01-30 2020-07-29 Epivax, Inc. Regulatory t cell epitopes, compositions and uses thereof
US10787518B2 (en) 2016-06-14 2020-09-29 Xencor, Inc. Bispecific checkpoint inhibitor antibodies
US10793632B2 (en) 2016-08-30 2020-10-06 Xencor, Inc. Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors
US10851178B2 (en) 2011-10-10 2020-12-01 Xencor, Inc. Heterodimeric human IgG1 polypeptides with isoelectric point modifications
US10858417B2 (en) 2013-03-15 2020-12-08 Xencor, Inc. Heterodimeric proteins
US10968276B2 (en) 2013-03-12 2021-04-06 Xencor, Inc. Optimized anti-CD3 variable regions
US10982006B2 (en) 2018-04-04 2021-04-20 Xencor, Inc. Heterodimeric antibodies that bind fibroblast activation protein
US10981992B2 (en) 2017-11-08 2021-04-20 Xencor, Inc. Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors
US11053316B2 (en) 2013-01-14 2021-07-06 Xencor, Inc. Optimized antibody variable regions
US11084863B2 (en) 2017-06-30 2021-08-10 Xencor, Inc. Targeted heterodimeric Fc fusion proteins containing IL-15 IL-15alpha and antigen binding domains
US11312770B2 (en) 2017-11-08 2022-04-26 Xencor, Inc. Bispecific and monospecific antibodies using novel anti-PD-1 sequences
US11319355B2 (en) 2017-12-19 2022-05-03 Xencor, Inc. Engineered IL-2 Fc fusion proteins
US11358999B2 (en) 2018-10-03 2022-06-14 Xencor, Inc. IL-12 heterodimeric Fc-fusion proteins
US11472890B2 (en) 2019-03-01 2022-10-18 Xencor, Inc. Heterodimeric antibodies that bind ENPP3 and CD3
US11505595B2 (en) 2018-04-18 2022-11-22 Xencor, Inc. TIM-3 targeted heterodimeric fusion proteins containing IL-15/IL-15RA Fc-fusion proteins and TIM-3 antigen binding domains
US11524991B2 (en) 2018-04-18 2022-12-13 Xencor, Inc. PD-1 targeted heterodimeric fusion proteins containing IL-15/IL-15Ra Fc-fusion proteins and PD-1 antigen binding domains and uses thereof
US11591401B2 (en) 2020-08-19 2023-02-28 Xencor, Inc. Anti-CD28 compositions
WO2023047124A3 (en) * 2021-09-24 2023-06-08 Reflection Therapeutics Limited Targeted cell therapies
US11739144B2 (en) 2021-03-09 2023-08-29 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CLDN6
US11859012B2 (en) 2021-03-10 2024-01-02 Xencor, Inc. Heterodimeric antibodies that bind CD3 and GPC3
US11919956B2 (en) 2020-05-14 2024-03-05 Xencor, Inc. Heterodimeric antibodies that bind prostate specific membrane antigen (PSMA) and CD3
US12466897B2 (en) 2011-10-10 2025-11-11 Xencor, Inc. Heterodimeric human IgG1 polypeptides with isoelectric point modifications

Families Citing this family (61)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7994298B2 (en) 2004-09-24 2011-08-09 Trustees Of Dartmouth College Chimeric NK receptor and methods for treating cancer
AU2006204459B2 (en) 2005-01-05 2012-11-01 F-Star Therapeutics Limited Synthetic immunoglobulin domains with binding properties engineered in regions of the molecule different from the complementarity determining regions
US12492376B2 (en) 2009-10-29 2025-12-09 The Trustees Of Dartmouth College T-cell receptor-deficient T cell compositions
WO2011059836A2 (en) 2009-10-29 2011-05-19 Trustees Of Dartmouth College T cell receptor-deficient t cell compositions
US9273283B2 (en) 2009-10-29 2016-03-01 The Trustees Of Dartmouth College Method of producing T cell receptor-deficient T cells expressing a chimeric receptor
US9833476B2 (en) 2011-08-31 2017-12-05 The Trustees Of Dartmouth College NKP30 receptor targeted therapeutics
WO2013169691A1 (en) 2012-05-07 2013-11-14 Trustees Of Dartmouth College Anti-b7-h6 antibody, fusion proteins, and methods of using the same
WO2014018863A1 (en) 2012-07-27 2014-01-30 The Board Of Trustees Of The University Of Illinois Engineering t-cell receptors
US10713726B1 (en) 2013-01-13 2020-07-14 United Services Automobile Association (Usaa) Determining insurance policy modifications using informatic sensor data
LT2956175T (lt) 2013-02-15 2017-12-11 The Regents Of The University Of California Chimerinis antigeno receptorius ir jo panaudojimo būdai
US9499855B2 (en) 2013-03-14 2016-11-22 Elwha Llc Compositions, methods, and computer systems related to making and administering modified T cells
US9587237B2 (en) 2013-03-14 2017-03-07 Elwha Llc Compositions, methods, and computer systems related to making and administering modified T cells
EP2971288A4 (en) * 2013-03-14 2016-12-07 Elwha Llc COMPOSITIONS, METHODS AND COMPUTER SYSTEMS FOR THE MANUFACTURE AND ADMINISTRATION OF MODIFIED T CELLS
JP2016526536A (ja) * 2013-06-14 2016-09-05 ザ ユニバーシティ オブ ヒューストン システム 修飾されたキメラ抗原受容体による腫瘍新生血管構造の標的化
US9409139B2 (en) 2013-08-05 2016-08-09 Twist Bioscience Corporation De novo synthesized gene libraries
US9947051B1 (en) 2013-08-16 2018-04-17 United Services Automobile Association Identifying and recommending insurance policy products/services using informatic sensor data
EP3071594A4 (en) * 2013-11-22 2017-05-03 The Board of Trustees of the University of Illionis Engineered high-affinity human t cell receptors
US11087404B1 (en) 2014-01-10 2021-08-10 United Services Automobile Association (Usaa) Electronic sensor management
US11416941B1 (en) 2014-01-10 2022-08-16 United Services Automobile Association (Usaa) Electronic sensor management
US10552911B1 (en) 2014-01-10 2020-02-04 United Services Automobile Association (Usaa) Determining status of building modifications using informatics sensor data
US12100050B1 (en) 2014-01-10 2024-09-24 United Services Automobile Association (Usaa) Electronic sensor management
US11847666B1 (en) 2014-02-24 2023-12-19 United Services Automobile Association (Usaa) Determining status of building modifications using informatics sensor data
US10614525B1 (en) 2014-03-05 2020-04-07 United Services Automobile Association (Usaa) Utilizing credit and informatic data for insurance underwriting purposes
WO2016014725A1 (en) 2014-07-22 2016-01-28 The University Of Notre Dame Du Lac Molecular constructs and uses thereof
CA2975852A1 (en) 2015-02-04 2016-08-11 Twist Bioscience Corporation Methods and devices for de novo oligonucleic acid assembly
WO2016172377A1 (en) 2015-04-21 2016-10-27 Twist Bioscience Corporation Devices and methods for oligonucleic acid library synthesis
KR20180029201A (ko) 2015-05-18 2018-03-20 티씨알2 테라퓨틱스 인크. 융합 단백질을 이용하는 tcr 리프로그래밍을 위한 조성물 및 방법
AU2016324296A1 (en) 2015-09-18 2018-04-12 Twist Bioscience Corporation Oligonucleic acid variant libraries and synthesis thereof
CN108698012A (zh) 2015-09-22 2018-10-23 特韦斯特生物科学公司 用于核酸合成的柔性基底
WO2017087723A1 (en) * 2015-11-19 2017-05-26 The Regents Of The University Of California Conditionally repressible immune cell receptors and methods of use thereof
CN108603307A (zh) 2015-12-01 2018-09-28 特韦斯特生物科学公司 功能化表面及其制备
EA201891589A1 (ru) 2016-01-08 2019-01-31 Те Риджентс Оф Те Юниверсити Оф Калифорния Условно активные гетеродимерные полипептиды и способы их применения
AU2017233035B2 (en) * 2016-03-16 2021-08-05 Neximmune, Inc. Production of antigen-specific T-cells
WO2018026953A1 (en) 2016-08-02 2018-02-08 TCR2 Therapeutics Inc. Compositions and methods for tcr reprogramming using fusion proteins
CA3034769A1 (en) 2016-08-22 2018-03-01 Twist Bioscience Corporation De novo synthesized nucleic acid libraries
CN110248724B (zh) 2016-09-21 2022-11-18 特韦斯特生物科学公司 基于核酸的数据存储
IL302917A (en) 2016-10-07 2023-07-01 Tcr2 Therapeutics Inc Compositions and methods for t-cell receptors reprogramming using fusion proteins
JP7291396B2 (ja) 2016-11-22 2023-06-15 ティーシーアール2 セラピューティクス インク. 融合タンパク質を用いたtcrの再プログラミングのための組成物及び方法
CN110366613A (zh) * 2016-12-16 2019-10-22 特韦斯特生物科学公司 免疫突触的变体文库及其合成
PT3583120T (pt) 2017-02-17 2022-12-15 Denali Therapeutics Inc Polipeptídeos de ligação ao recetor de transferrina manipulados
WO2018156792A1 (en) 2017-02-22 2018-08-30 Twist Bioscience Corporation Nucleic acid based data storage
CN110913865A (zh) 2017-03-15 2020-03-24 特韦斯特生物科学公司 免疫突触的变体文库及其合成
WO2018231864A1 (en) 2017-06-12 2018-12-20 Twist Bioscience Corporation Methods for seamless nucleic acid assembly
IL271205B2 (en) 2017-06-12 2025-02-01 Twist Bioscience Corp Methods for assembling continuous nucleic acids
ES2871146T3 (es) 2017-07-14 2021-10-28 Immatics Biotechnologies Gmbh Molécula de polipéptido con especificidad dual mejorada
US11407837B2 (en) 2017-09-11 2022-08-09 Twist Bioscience Corporation GPCR binding proteins and synthesis thereof
KR102637566B1 (ko) 2017-10-20 2024-02-16 트위스트 바이오사이언스 코포레이션 폴리뉴클레오타이드 합성을 위한 가열된 나노웰
CN112041438B (zh) 2018-01-04 2025-05-23 特韦斯特生物科学公司 基于dna的数字信息存储
CA3100739A1 (en) 2018-05-18 2019-11-21 Twist Bioscience Corporation Polynucleotides, reagents, and methods for nucleic acid hybridization
IL321690A (en) 2018-07-26 2025-08-01 Curevac Netherlands B V Cancer vaccines for uterine cancer
CA3106574A1 (en) 2018-07-26 2020-01-30 Frame Pharmaceuticals B.V. Arid1a, cdkn2a, kmt2b, kmt2d, tp53 and pten vaccines for cancer
EP3827265A1 (en) 2018-07-26 2021-06-02 Frame Pharmaceuticals B.V. Cancer vaccines for kidney cancer
EP3827263A1 (en) 2018-07-26 2021-06-02 Frame Pharmaceuticals B.V. Cancer vaccines for colorectal cancer
CA3106564A1 (en) 2018-07-26 2020-01-30 Frame Pharmaceuticals B.V. Cancer vaccines for breast cancer
CA3124980A1 (en) 2018-12-26 2020-07-02 Twist Bioscience Corporation Highly accurate de novo polynucleotide synthesis
KR20210143766A (ko) 2019-02-26 2021-11-29 트위스트 바이오사이언스 코포레이션 Glp1 수용체에 대한 변이체 핵산 라이브러리
CN113785057A (zh) 2019-02-26 2021-12-10 特韦斯特生物科学公司 用于抗体优化的变异核酸文库
JP2022550497A (ja) 2019-06-21 2022-12-02 ツイスト バイオサイエンス コーポレーション バーコードに基づいた核酸配列アセンブリ
AU2020355027A1 (en) 2019-09-23 2022-04-21 Twist Bioscience Corporation Antibodies that bind CD3 Epsilon
CA3155629A1 (en) 2019-09-23 2021-04-01 Twist Bioscience Corporation Variant nucleic acid libraries for crth2
BR112023022765A2 (pt) 2021-05-05 2024-01-02 Immatics Biotechnologies Gmbh Proteínas de ligação ao antígeno que ligam especificamente o prame

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004074322A1 (en) * 2003-02-22 2004-09-02 Avidex Ltd Modified soluble t cell receptor
WO2006054096A2 (en) 2004-11-18 2006-05-26 Avidex Ltd Soluble bifunctional proteins
WO2006072620A1 (en) * 2005-01-05 2006-07-13 F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. Synthetic immunoglobulin domains with binding properties engineered in regions of the molecule different from the complementarity determining regions

Family Cites Families (34)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE3588219T2 (de) * 1984-03-01 2000-05-18 The Board Of Trustees Of The Leland S. Stanford Junior University, Stanford T-Zellenrezeptor, spezifisch für Antigenpolypeptide und verwandte Polynukleotide
WO1986005803A1 (fr) * 1985-03-30 1986-10-09 Marc Ballivet Procede d'obtention d'adn, arn, peptides, polypeptides ou proteines, par une technique de recombinaison d'adn
US6492107B1 (en) * 1986-11-20 2002-12-10 Stuart Kauffman Process for obtaining DNA, RNA, peptides, polypeptides, or protein, by recombinant DNA technique
US5270170A (en) 1991-10-16 1993-12-14 Affymax Technologies N.V. Peptide library and screening method
AU675223B2 (en) * 1992-05-08 1997-01-30 Creative Biomolecules, Inc. Chimeric multivalent protein analogues and methods of use thereof
WO1996018105A1 (en) 1994-12-06 1996-06-13 The President And Fellows Of Harvard College Single chain t-cell receptor
US6358709B1 (en) * 1995-12-07 2002-03-19 Diversa Corporation End selection in directed evolution
US6361974B1 (en) * 1995-12-07 2002-03-26 Diversa Corporation Exonuclease-mediated nucleic acid reassembly in directed evolution
US6352842B1 (en) * 1995-12-07 2002-03-05 Diversa Corporation Exonucease-mediated gene assembly in directed evolution
WO1997034631A1 (en) 1996-03-18 1997-09-25 Board Of Regents, The University Of Texas System Immunoglobin-like domains with increased half lives
AU6685698A (en) 1997-03-07 1998-09-22 Sunol Molecular Corporation Fusion proteins comprising bacteriophage coat protein and a single-chain t cell receptor
JP2002534966A (ja) 1999-01-19 2002-10-22 マキシジェン, インコーポレイテッド オリゴヌクレオチド媒介核酸組換え
JP4972264B2 (ja) 1999-12-06 2012-07-11 ボード オブ トラスティーズ オブ ザ ユニバーシティ オブ イリノイ 高親和性tcrタンパク質および方法
EP1118661A1 (en) 2000-01-13 2001-07-25 Het Nederlands Kanker Instituut T cell receptor libraries
JP2003274960A (ja) 2000-02-03 2003-09-30 Japan Science & Technology Corp 可溶性t細胞受容体タンパク質およびその作成方法
WO2001062908A2 (en) * 2000-02-22 2001-08-30 Ahuva Nissim Chimeric and tcr phage display libraries, chimeric and tcr reagents and methods of use thereof
WO2001070947A2 (en) 2000-03-20 2001-09-27 Maxygen, Inc. Method for generating recombinant dna molecules in complex mixtures
JP2002058479A (ja) * 2000-08-14 2002-02-26 Canon Inc 構造認識アミノ酸配列の取得方法
PT1355919E (pt) 2000-12-12 2011-03-02 Medimmune Llc Moléculas com semivida longa, composições que as contêm e suas utilizações
WO2002059263A2 (en) 2000-12-19 2002-08-01 Sunol Molecular Corporation Transgenic animals comprising a humanized immune system
IL141539A0 (en) 2001-02-20 2002-03-10 Yeda Res & Dev Dna molecules and cells transfected therewith
EP1281757A1 (en) 2001-07-31 2003-02-05 Direvo Biotech AG Method for the production of nucleic acids consisting of stochastically combined parts of source nucleic acids
JP4317940B2 (ja) * 2001-08-31 2009-08-19 イミュノコア・リミテッド 物質
EP1394251A1 (en) 2002-08-23 2004-03-03 Direvo Biotech AG Method for the selective randomization of polynucleotides
US7569664B2 (en) 2002-10-09 2009-08-04 Immunocore Limited Single chain recombinant T cell receptors
PT1558643E (pt) 2002-11-09 2009-08-24 Immunocore Ltd Apresentação de um receptor das células t
EP1567553A2 (en) 2002-12-03 2005-08-31 Avidex Ltd. Complexes of receptors
US20040266993A1 (en) * 2003-06-30 2004-12-30 Evans Glen A. Non-immunoglobulin binding polypeptides
DE602005011617D1 (de) 2004-05-19 2009-01-22 Medigene Ltd Hochaffiner ny-eso-t-zellen-rezeptor
WO2005114215A2 (en) 2004-05-19 2005-12-01 Avidex Ltd Method of improving t cell receptors
GB0411773D0 (en) 2004-05-26 2004-06-30 Avidex Ltd Method for the identification of polypeptides which bind to a given peptide mhc complex or cd 1-antigen complex
CA2580412A1 (en) * 2004-09-13 2006-03-23 Government Of The United States Of America, Represented By The Secretary , Department Of Health And Human Services Compositions comprising t cell receptors and methods of use thereof
JP2008514685A (ja) 2004-10-01 2008-05-08 メディジーン リミテッド 治療剤に連結した、非天然型ジスルフィド鎖間結合を含有するt細胞レセプター
GB0425732D0 (en) 2004-11-23 2004-12-22 Avidex Ltd Gamma-delta t cell receptors

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2004074322A1 (en) * 2003-02-22 2004-09-02 Avidex Ltd Modified soluble t cell receptor
WO2006054096A2 (en) 2004-11-18 2006-05-26 Avidex Ltd Soluble bifunctional proteins
WO2006072620A1 (en) * 2005-01-05 2006-07-13 F-Star Biotechnologische Forschungs- Und Entwicklungsges.M.B.H. Synthetic immunoglobulin domains with binding properties engineered in regions of the molecule different from the complementarity determining regions

Non-Patent Citations (11)

* Cited by examiner, † Cited by third party
Title
BOULTER J M ET AL: "Stable, soluble, high-affinity, engineered T cell receptors: novel antibody-like proteins for specific targeting of peptide antigens", CLINICAL AND EXPERIMENTAL IMMUNOLOGY, vol. 142, no. 3, December 2005 (2005-12-01), pages 454 - 460, XP002449079, ISSN: 0009-9104 *
BOULTER JONATHAN M ET AL: "Stable, soluble T-cell receptor molecules for crystallization and therapeutics", PROTEIN ENGINEERING, OXFORD UNIVERSITY PRESS, SURREY, GB, vol. 16, no. 9, September 2003 (2003-09-01), pages 707 - 711, XP002275339, ISSN: 0269-2139 *
CARD ET AL.: "Fusion of single-chain TCRs to IL-2 has been reported to reduce lung metastases in a transgenic mouse tumor mcdel", CANCER IMMUNOL IMMUNOTHER, vol. 53, 2004, pages 345 - 357
CHARLES A.; TRAVERS, PAUL; WALPORT, MARK; SHLOMCHIK, MARK.: "Immunobiology.", 2001, GARLAND PUBLISHING
EPEL ET AL.: "describes a functional recombinant single-chain T cell receptor fragment fused to exotoxin A protein, capable of selectively targeting antigen- presenting cells", CANCER IMMUNOL IMMUNOTHER, vol. 51, 2002, pages 565 - 573
LAUGEL BRUNO ET AL: "Design of soluble recombinant T cell receptors for antigen targeting and T cell inhibition", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 280, no. 3, 21 January 2005 (2005-01-21), pages 1882 - 1892, XP002449078, ISSN: 0021-9258 *
MOLLOY P E ET AL: "Soluble T cell receptors: novel immunotherapies", CURRENT OPINION IN PHARMACOLOGY, ELSEVIER SCIENCE PUBLISHERS,, NL, vol. 5, no. 4, August 2005 (2005-08-01), pages 438 - 443, XP004969013, ISSN: 1471-4892 *
MOSQUERA ET AL.: "describes a novel antibody-like single-chain TCR human IgGl fusion protein", J IMMUNOL, vol. 174, 2005, pages 4381 - 4388
REITER Y ET AL: "CONSTRUCTION OF A FUNCTIONAL DISULFIDE-STABILIZED TCR FV INDICATES THAT ANTIBODY AND TCR FV FRAMEWORKS ARE VERY SIMILAR IN STRUCTURE", IMMUNITY, CELL PRESS, US, vol. 2, no. 3, March 1995 (1995-03-01), pages 281 - 287, XP009004075, ISSN: 1074-7613 *
SIMON T ET AL: "A FUNCTIONAL ANTIBODY MUTANT WITH AN INSERTION IN THE FRAMEWORK REGION 3 LOOP OF THE V-H DOMAIN IMPLICATIONS FOR ANTIBODY ENGINEERING", PROTEIN ENGINEERING, vol. 5, no. 3, 1992, pages 229 - 234, XP008083103, ISSN: 0269-2139 *
WEBER K SCOTT ET AL: "Class II-restricted T cell receptor engineered in vitro for higher affinity retains peptide specificity and function", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA, vol. 102, no. 52, December 2005 (2005-12-01), pages 19033 - 19038, XP002449077, ISSN: 0027-8424 *

Cited By (82)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP2423222B2 (en) 2007-01-30 2020-07-29 Epivax, Inc. Regulatory t cell epitopes, compositions and uses thereof
WO2009042570A3 (en) * 2007-09-25 2009-06-04 Us Health Modified t cell receptors and related materials and methods
US9493578B2 (en) 2009-09-02 2016-11-15 Xencor, Inc. Compositions and methods for simultaneous bivalent and monovalent co-engagement of antigens
US9605061B2 (en) 2010-07-29 2017-03-28 Xencor, Inc. Antibodies with modified isoelectric points
US12466897B2 (en) 2011-10-10 2025-11-11 Xencor, Inc. Heterodimeric human IgG1 polypeptides with isoelectric point modifications
US10851178B2 (en) 2011-10-10 2020-12-01 Xencor, Inc. Heterodimeric human IgG1 polypeptides with isoelectric point modifications
US9701759B2 (en) 2013-01-14 2017-07-11 Xencor, Inc. Heterodimeric proteins
US9650446B2 (en) 2013-01-14 2017-05-16 Xencor, Inc. Heterodimeric proteins
US10738132B2 (en) 2013-01-14 2020-08-11 Xencor, Inc. Heterodimeric proteins
US10738133B2 (en) 2013-01-14 2020-08-11 Xencor, Inc. Heterodimeric proteins
US11718667B2 (en) 2013-01-14 2023-08-08 Xencor, Inc. Optimized antibody variable regions
US10487155B2 (en) 2013-01-14 2019-11-26 Xencor, Inc. Heterodimeric proteins
US10131710B2 (en) 2013-01-14 2018-11-20 Xencor, Inc. Optimized antibody variable regions
US11634506B2 (en) 2013-01-14 2023-04-25 Xencor, Inc. Heterodimeric proteins
US10472427B2 (en) 2013-01-14 2019-11-12 Xencor, Inc. Heterodimeric proteins
US11053316B2 (en) 2013-01-14 2021-07-06 Xencor, Inc. Optimized antibody variable regions
US9738722B2 (en) 2013-01-15 2017-08-22 Xencor, Inc. Rapid clearance of antigen complexes using novel antibodies
US10968276B2 (en) 2013-03-12 2021-04-06 Xencor, Inc. Optimized anti-CD3 variable regions
US10287364B2 (en) 2013-03-15 2019-05-14 Xencor, Inc. Heterodimeric proteins
US10858417B2 (en) 2013-03-15 2020-12-08 Xencor, Inc. Heterodimeric proteins
US11299554B2 (en) 2013-03-15 2022-04-12 Xencor, Inc. Heterodimeric proteins
US10106624B2 (en) 2013-03-15 2018-10-23 Xencor, Inc. Heterodimeric proteins
US9605084B2 (en) 2013-03-15 2017-03-28 Xencor, Inc. Heterodimeric proteins
US10519242B2 (en) 2013-03-15 2019-12-31 Xencor, Inc. Targeting regulatory T cells with heterodimeric proteins
US11814423B2 (en) 2013-03-15 2023-11-14 Xencor, Inc. Heterodimeric proteins
US10544187B2 (en) 2013-03-15 2020-01-28 Xencor, Inc. Targeting regulatory T cells with heterodimeric proteins
US12415849B2 (en) 2013-03-15 2025-09-16 Xencor, Inc. Heterodimeric proteins
US10919951B2 (en) 2013-10-10 2021-02-16 Autolus Limited Chimeric antigen receptor
US10160794B2 (en) 2013-10-10 2018-12-25 Ucl Business Plc Chimeric antigen receptor
CN105658671A (zh) * 2013-10-10 2016-06-08 Ucl商务股份有限公司 嵌合抗原受体
US10752665B2 (en) 2014-02-27 2020-08-25 Ucl Business Ltd April variants
US10611811B2 (en) 2014-02-27 2020-04-07 Ucl Business Ltd Ligand
US10858451B2 (en) 2014-03-28 2020-12-08 Xencor, Inc. Bispecific antibodies that bind to CD38 and CD3
US11840579B2 (en) 2014-03-28 2023-12-12 Xencor, Inc. Bispecific antibodies that bind to CD38 and CD3
US9822186B2 (en) 2014-03-28 2017-11-21 Xencor, Inc. Bispecific antibodies that bind to CD38 and CD3
US11111315B2 (en) 2014-11-26 2021-09-07 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US10526417B2 (en) 2014-11-26 2020-01-07 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CD38
US10889653B2 (en) 2014-11-26 2021-01-12 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US10913803B2 (en) 2014-11-26 2021-02-09 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US11673972B2 (en) 2014-11-26 2023-06-13 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US10259887B2 (en) 2014-11-26 2019-04-16 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US9850320B2 (en) 2014-11-26 2017-12-26 Xencor, Inc. Heterodimeric antibodies to CD3 X CD20
US12359002B2 (en) 2014-11-26 2025-07-15 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US11859011B2 (en) 2014-11-26 2024-01-02 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US11945880B2 (en) 2014-11-26 2024-04-02 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US12129309B2 (en) 2014-11-26 2024-10-29 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CD38
US9856327B2 (en) 2014-11-26 2018-01-02 Xencor, Inc. Heterodimeric antibodies to CD3 X CD123
US11352442B2 (en) 2014-11-26 2022-06-07 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CD38
US11225528B2 (en) 2014-11-26 2022-01-18 Xencor, Inc. Heterodimeric antibodies that bind CD3 and tumor antigens
US10428155B2 (en) 2014-12-22 2019-10-01 Xencor, Inc. Trispecific antibodies
US10227411B2 (en) 2015-03-05 2019-03-12 Xencor, Inc. Modulation of T cells with bispecific antibodies and FC fusions
US11091548B2 (en) 2015-03-05 2021-08-17 Xencor, Inc. Modulation of T cells with bispecific antibodies and Fc fusions
US11623957B2 (en) 2015-12-07 2023-04-11 Xencor, Inc. Heterodimeric antibodies that bind CD3 and PSMA
US10227410B2 (en) 2015-12-07 2019-03-12 Xencor, Inc. Heterodimeric antibodies that bind CD3 and PSMA
US11236170B2 (en) 2016-06-14 2022-02-01 Xencor, Inc. Bispecific checkpoint inhibitor antibodies
US11492407B2 (en) 2016-06-14 2022-11-08 Xencor, Inc. Bispecific checkpoint inhibitor antibodies
US10787518B2 (en) 2016-06-14 2020-09-29 Xencor, Inc. Bispecific checkpoint inhibitor antibodies
US11225521B2 (en) 2016-06-28 2022-01-18 Xencor, Inc. Heterodimeric antibodies that bind somatostatin receptor 2
US12054545B2 (en) 2016-06-28 2024-08-06 Xencor, Inc. Heterodimeric antibodies that bind somatostatin receptor 2
US10316088B2 (en) 2016-06-28 2019-06-11 Xencor, Inc. Heterodimeric antibodies that bind somatostatin receptor 2
US10793632B2 (en) 2016-08-30 2020-10-06 Xencor, Inc. Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors
US10550185B2 (en) 2016-10-14 2020-02-04 Xencor, Inc. Bispecific heterodimeric fusion proteins containing IL-15-IL-15Rα Fc-fusion proteins and PD-1 antibody fragments
US10501543B2 (en) 2016-10-14 2019-12-10 Xencor, Inc. IL15/IL15Rα heterodimeric Fc-fusion proteins
US11084863B2 (en) 2017-06-30 2021-08-10 Xencor, Inc. Targeted heterodimeric Fc fusion proteins containing IL-15 IL-15alpha and antigen binding domains
US10981992B2 (en) 2017-11-08 2021-04-20 Xencor, Inc. Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors
US12152076B2 (en) 2017-11-08 2024-11-26 Xencor, Inc. Bispecific and monospecific antibodies using novel anti-PD-1 sequences
US11312770B2 (en) 2017-11-08 2022-04-26 Xencor, Inc. Bispecific and monospecific antibodies using novel anti-PD-1 sequences
US11319355B2 (en) 2017-12-19 2022-05-03 Xencor, Inc. Engineered IL-2 Fc fusion proteins
US10982006B2 (en) 2018-04-04 2021-04-20 Xencor, Inc. Heterodimeric antibodies that bind fibroblast activation protein
US12180302B2 (en) 2018-04-04 2024-12-31 Xencor, Inc. Heterodimeric antibodies that bind fibroblast activation protein
US11524991B2 (en) 2018-04-18 2022-12-13 Xencor, Inc. PD-1 targeted heterodimeric fusion proteins containing IL-15/IL-15Ra Fc-fusion proteins and PD-1 antigen binding domains and uses thereof
US11505595B2 (en) 2018-04-18 2022-11-22 Xencor, Inc. TIM-3 targeted heterodimeric fusion proteins containing IL-15/IL-15RA Fc-fusion proteins and TIM-3 antigen binding domains
US11358999B2 (en) 2018-10-03 2022-06-14 Xencor, Inc. IL-12 heterodimeric Fc-fusion proteins
US11472890B2 (en) 2019-03-01 2022-10-18 Xencor, Inc. Heterodimeric antibodies that bind ENPP3 and CD3
US11919956B2 (en) 2020-05-14 2024-03-05 Xencor, Inc. Heterodimeric antibodies that bind prostate specific membrane antigen (PSMA) and CD3
US12404329B2 (en) 2020-05-14 2025-09-02 Xencor, Inc. Heterodimeric antibodies that bind prostate specific membrane antigen (PSMA) and CD3
US11919958B2 (en) 2020-08-19 2024-03-05 Xencor, Inc. Anti-CD28 compositions
US11591401B2 (en) 2020-08-19 2023-02-28 Xencor, Inc. Anti-CD28 compositions
US11739144B2 (en) 2021-03-09 2023-08-29 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CLDN6
US12398207B2 (en) 2021-03-09 2025-08-26 Xencor, Inc. Heterodimeric antibodies that bind CD3 and CLDN6
US11859012B2 (en) 2021-03-10 2024-01-02 Xencor, Inc. Heterodimeric antibodies that bind CD3 and GPC3
WO2023047124A3 (en) * 2021-09-24 2023-06-08 Reflection Therapeutics Limited Targeted cell therapies

Also Published As

Publication number Publication date
HUE024559T2 (hu) 2016-02-29
JP2009540838A (ja) 2009-11-26
US20170015727A1 (en) 2017-01-19
EP2051996A1 (en) 2009-04-29
PL2051996T3 (pl) 2015-05-29
US20100009863A1 (en) 2010-01-14
AT503861B1 (de) 2008-06-15
SI2051996T1 (sl) 2015-04-30
EP2051996B1 (en) 2014-12-10
JP5864520B2 (ja) 2016-02-17
JP5426372B2 (ja) 2014-02-26
DK2051996T3 (en) 2015-03-02
AT503861A1 (de) 2008-01-15
US20130040836A1 (en) 2013-02-14
ES2531515T3 (es) 2015-03-16
JP2014042532A (ja) 2014-03-13
EP2894164A1 (en) 2015-07-15

Similar Documents

Publication Publication Date Title
EP2051996B1 (en) Method for engineering t-cell receptors
EP3293200B1 (en) Method for engineering immunoglobulins
US11499249B2 (en) Synthetic immunoglobulin domains with binding properties engineered in regions of the molecule different from the complementarity determining regions
EP2046831B1 (en) Novel multivalent immunoglobulins
EP1975178A1 (en) Transcytotic modular antibody
HK1251239B (en) Method for engineering immunoglobulins

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 07763740

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 2009516818

Country of ref document: JP

NENP Non-entry into the national phase

Ref country code: DE

WWE Wipo information: entry into national phase

Ref document number: 2007763740

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: RU

WWE Wipo information: entry into national phase

Ref document number: 12307582

Country of ref document: US