WO2007033230A2 - Anti-cd3 antibody formulations - Google Patents
Anti-cd3 antibody formulations Download PDFInfo
- Publication number
- WO2007033230A2 WO2007033230A2 PCT/US2006/035615 US2006035615W WO2007033230A2 WO 2007033230 A2 WO2007033230 A2 WO 2007033230A2 US 2006035615 W US2006035615 W US 2006035615W WO 2007033230 A2 WO2007033230 A2 WO 2007033230A2
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- antibody
- day
- formulation
- range
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Ceased
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2809—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against the T-cell receptor (TcR)-CD3 complex
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39591—Stabilisation, fragmentation
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/06—Immunosuppressants, e.g. drugs for graft rejection
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/545—Medicinal preparations containing antigens or antibodies characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/02—Inorganic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/08—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing oxygen, e.g. ethers, acetals, ketones, quinones, aldehydes, peroxides
- A61K47/12—Carboxylic acids; Salts or anhydrides thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/16—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite containing nitrogen, e.g. nitro-, nitroso-, azo-compounds, nitriles, cyanates
- A61K47/18—Amines; Amides; Ureas; Quaternary ammonium compounds; Amino acids; Oligopeptides having up to five amino acids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/06—Organic compounds, e.g. natural or synthetic hydrocarbons, polyolefins, mineral oil, petrolatum or ozokerite
- A61K47/26—Carbohydrates, e.g. sugar alcohols, amino sugars, nucleic acids, mono-, di- or oligo-saccharides; Derivatives thereof, e.g. polysorbates, sorbitan fatty acid esters or glycyrrhizin
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/34—Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
Definitions
- This invention relates to formulation and dosing of anti-CD3 antibodies as well as to methods for use thereof.
- Antibodies to the CD3 epsilon signaling molecule of the T-cell receptor complex have proven to be useful as immunosuppressants and in the treatment of autoimmune disorders. Thus, improved methods of preparing anti-CD3 antibodies, methods of purifying anti-CD3 antibodies and pharmaceutical formulations containing anti-CD3 antibodies would be useful.
- the present invention provides formulation and dosing for monoclonal antibodies specifically directed against CD3.
- the invention also provides methods of manufacturing anti-CD3 monoclonal antibodies and methods of purifying anti-CD3 antibodies.
- the pharmaceutical formulations of an anti-CD3 antibody described herein include a pH buffering agent effective in the range of 3.0 to 6.2; a salt; a surfactant; and pharmaceutically effective quantity of an anti-CD3 antibody.
- the salt is, for example, sodium chloride;
- the surfactant is, e.g. , an ionic, anionic or zwitterionic surfactant.
- the surfactant is an ionic surfactant such as a polysorbate, e.g., polysorbate 80.
- the pH buffering agent includes, for example, sodium acetate. In some embodiments, the pH buffering agent is selected from a sodium citrate/citric acid, and sodium acetate/acetic acid.
- the pH buffering agent is effective in a range of 10 mM to 50 mM.
- the pH buffering agent used in the formulations described herein provides a pH range between 5.0 and 6.0.
- the pH buffering agent provides a pH range between 5.2 and 5.8.
- the pH buffering agent provides a pH range between 5.4 and 5.6.
- the pH buffering agent provides a pH of about 5.5.
- the salt is present in a range of lOO mM to 140 mM.
- the surfactant is 0.02% by weight/volume.
- the pharmaceutically effective quantity of the anti-CD3 antibody is formulated to provide a quantity per dose in the range of 0.05 mg to 10 mg of anti-CD3 antibody.
- the pharmaceutically effective quantity of the anti-CD3 antibody is formulated to provide a quantity per dose in the range of 0.1 mg to 5.0 mg of anti-CD3 antibody.
- the pharmaceutically effective quantity of the anti-CD3 antibody is formulated to provide a quantity per dose in the range of 0.5 mg to 3.0 mg of anti-CD3 antibody.
- the anti-CD3 antibody is, e.g., 28Fl 1, 27H5, 23F10, 15C3, Orthoclone OKT3, human OKT3 ⁇ l (HOKT3 ⁇ l) or ChAglyCD3.
- Anti-CD3 antibody pharmaceutical formulations provided herein include a pH buffering agent comprising sodium acetate effective in the range of 3.0 to 6.2, sodium chloride, a surfactant comprising a polysorbate, and a pharmaceutically effective quantity of an anti-CD3 antibody.
- the polysorbate is, for example, polysorbate 80.
- the pH buffering agent is effective in a range of 10 inM to 50 mM.
- the pH buffering agent used in the formulations described herein provides a pH range between 5.0 and 6.0.
- the pH buffering agent provides a pH range between 5.2 and 5.8.
- the pH buffering agent provides a pH range between 5.4 and 5.6.
- the pH buffering agent provides a pH of about 5.5.
- the salt is present in a range of 100 mM to 140 mM.
- the surfactant is 0.02% by weight/volume.
- the pharmaceutically effective quantity of the anti-CD3 antibody is formulated to provide a quantity per dose in the range of 0.05 mg to 10 mg of anti-CD3 antibody.
- the pharmaceutically effective quantity of the anti-CD3 antibody is formulated to provide a quantity per dose in the range of 0.1 mg to 5.0 mg of anti-CD3 antibody.
- the pharmaceutically effective quantity of the anti-CD3 antibody is formulated to provide a quantity per dose in the range of 0.5 mg to 3.0 mg of anti-CD3 antibody.
- the anti-CD3 antibody is, e.g., 28Fl 1, 27H5, 23F10, 15C3, Orthoclone OKT3, human OKT3 ⁇ l (HOKT3 ⁇ l) or ChAglyCD3.
- the pharmaceutical formulation contains an effective quantity per dose of anti-CD3 antibody in the range of 0.5 mg to 3.0 mg, between 1 to 3 mg sodium acetate, between 5 to 9 mg of sodium chloride, and between 0.1 to 0.3 micrograms Polysorbate 80, such that the formulation is adjusted to 1.0 mL with water.
- the pharmaceutical formulation contains 2.05 mg sodium acetate, 7.31 mg sodium chloride and 0.216 micrograms Polysorbate 80.
- the pH of the pharmaceutical formulation is, e.g., 5.5.
- an effective dose of an anti-CD3 antibody formulated to provide a quantity per dose in the range of 0.05 mg to 10 mg of anti-CD3 antibody per day for a period of five days.
- the effective dose of an anti-CD3 antibody is formulated to provide a quantity per dose in the range of 0.1 mg to 5.0 mg of anti-CD3 antibody per day for a period of five days.
- the effective dose of an anti-CD3 antibody is formulated to provide a quantity per dose in the range of 0.5 mg to 3.0 mg of anti-CD3 antibody per day for a period of five days.
- the anti-CD3 antibody formulation is administered intravenously.
- the formulation is administered via continuous intravenous infusion.
- the anti-CD3 antibody formulation is administered intravenously.
- the formulation is administered via continuous intravenous infusion.
- the effective dose of anti- CD3 antibody results in a level of cytokine release that is less than 3 on the WHO toxicity grading scale.
- the anti-CD3 antibody formulations provided herein are administered in a dosage in the range between 0.05 mg/day and 10 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage between 0.1 mg/day to 5.0 mg/day, and more preferably, the anti-CD3 antibody formulation is administered in a dosage between 0.5 mg/day to 3.0 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage selected from 0.5 mg/day, 0.6 mg/day, 0.7 mg/day, 0.8 mg/day, 0.9 mg/day, 1.0 mg/day, 1.1 mg/day, 1.2 mg/day, 1.3 mg/day, 1.4 mg/day, 1.5 mg/day, 1.6 mg/day, 1.7 mg/day, 1.8 mg/day, 1.9 mg/day, 2.0 mg/day, 2.1 mg/day, 2.2 mg/day, 2.3 mg/day, 2.4 mg/day, 2.5 mg/day, 2.6 mg/day, 2.7 mg/day, 2.8 mg/day, 2.9 mg/day, and 3.0 mg/day.
- Exemplary monoclonal antibodies include 28Fl 1, 27H5, 23F10, and 15C3 provided herein, as well as Orthoclone OKT3, human OKT3 ⁇ l (HOKT3 ⁇ l) and
- the monoclonal antibody is an antibody that binds to the same epitope as 28Fl 1, 27H5, 23F10 or 15C3.
- the antibodies are MIy human antibodies ("huCD3 antibodies").
- the anti-CD3 antibody has one or more of the following characteristics: the antibody binds to CD3 positive (CD3+) cells but not CD3 negative (CD3-) cells; the anti-CD3 antibody induces antigenic modulation which involves alteration (e.g., decrease) of the cell surface expression level or activity of CD3 or the T cell receptor (TcR); the anti-CD3 antibody inhibits binding of the murine anti- human 0KT3 monoclonal antibody to T-lymphocytes; or the anti-CD3 antibody binds an epitope of CD3 that wholly or partially includes the amino acid sequence EMGGITQTPYKVSISGT (SEQ ID NO:57).
- the anti-CD3 antibody competes with the murine anti-CD3 antibody OKT3 for binding to CD3, and
- Inhibiting the binding of the murine anti-human OKT3 monoclonal antibody to a T-lymphocyte is defined as a decrease in the ability of the murine OKT3 antibody to form a complex with CD3 on the cell surface of a T-lymphocyte.
- An anti-CD3 antibody contains a heavy chain variable having the amino acid sequence of SEQ ID NOS: 2, 6, 10 or 22 and a light chain variable having the amino acid sequence of SEQ ID NOS: 4, 8, 16-20 or 25-26.
- the three heavy chain CDRs include an amino acid sequence at least 90%, 92%, 95%, 97% 98%, 99% or more identical a sequence selected from the group consisting of GYGMH (SEQ ID NO:27);
- VIWYDGSKKYYVDSVKG (SEQ ID NO:28); QMGYWHFDL (SEQ ID NO:29); SYGMH (SEQ ID NO:33); IIWYDGSKKNYADSVKG (SEQ ID NO:34); GTGYNWFDP (SEQ ID NO:35); and AIWYNGRKQDYADSVKG (SEQ ID NO:44) and a light chain with three CDR that include an amino acid sequence at least 90%, 92%, 95%, 97% 98%, 99% or more identical to a sequence selected from the group consisting of the amino acid sequence of RASQS VSSYLA (SEQ ID NO:30); DASNRAT (SEQ ID NO:31); QQRSNWPPLT (SEQ ID NO:32); RASQSVSSSYLA (SEQ ID NO:36); GASSRAT (SEQ ID NO:37); QQYGSSPIT (SEQ ID NO:38); RASQGISSALA (SEQ ID NO:39); YASSLQS
- an anti-CD3 antibody provided herein exhibits at least two or more (i.e., two or more, three or more, four or more, five or more, six or more, seven or more, eight or more, nine or more, ten or more, eleven or more) of the following characteristics: the antibody contains a variable heavy chain region (V H ) encoded by a human DP50 V H germline gene sequence, or a nucleic acid sequence that is homologous to the human DP50 V H germline gene sequence; the antibody contains a variable light chain region (V L ) encoded by a human L6 V L germline gene sequence, or a nucleic acid sequence homologous to the human L6 V L germline gene sequence; the antibody contains a V L encoded by a human L4/18a V L germline gene sequence, or a nucleic acid sequence homologous to the human L4/18a V L germline gene sequence; the antibody includes a V H CDRl region comprising the amino acid sequence YGMH (SEQ ID NO:58);
- the anti-CD3 antibody may contain an amino acid mutation.
- the mutation is in the constant region.
- the mutation results in an antibody that has an altered effector function.
- An effector function of an antibody is altered by altering, i.e., enhancing or reducing, the affinity of the antibody for an effector molecule such as an Fc receptor or a complement component.
- the mutation results in an antibody that is capable of reducing cytokine release from a T-cell.
- the mutation is in the heavy chain at amino acid residue 234, 235, 265, or 297 or combinations thereof.
- the mutation results in an alanine residue at either position 234, 235, 265 or 297, or a glutamate residue at position 235, or a combination thereof.
- cytokine refers to all human cytokines known within the art that bind extracellular receptors expressed on the cell surface and thereby modulate cell function, including but not limited to IL-2, IFN-gamma, TNF-a, IL-4, IL-5, IL-6, IL-9, IL-10, and IL-13.
- the anti-CD3 antibody provided herein contains one or more mutations that prevent heavy chain constant region-mediated release of one or more cytokine(s) in vivo.
- the fully human CD3 antibodies provided herein include, for example, a L 234 L 235 -> A 234 E 23i mutation in the Fc region, such that cytokine release upon exposure to the anti-CD3 antibody is significantly reduced or eliminated.
- the L 234 L 235 -> A 234 E 235 mutation in the Fc region of the anti-CD3 antibodies provided herein reduces or eliminates cytokine release when the anti-CD3 antibodies are exposed to human leukocytes, whereas the mutations described below maintain significant cytokine release capacity.
- a significant reduction in cytokine release is defined by comparing the release of cytokines upon exposure to the anti-CD3 antibody having a L L 235 -> A 234 E 235 mutation in the Fc region to level of cytokine release upon exposure to another anti-CD3 antibody having one or more of the mutations described below.
- Other mutations in the Fc region include, for example, L 234 L 235 -» A 234 A 235 , L 235 ⁇ » E 235 , N 297 -» A 297 , and D 265 -> A 265 .
- the anti-CD3 antibody is encoded by a nucleic acid that includes one or more mutations that replace a nucleic acid residue with a germline nucleic acid residue.
- germline nucleic acid residue is meant the nucleic acid residue that naturally occurs in a germline gene encoding a constant or variable region.
- the antibodies provided herein include one or more mutations that replace a nucleic acid with the germline nucleic acid residue.
- Germline antibody genes include, for example, DP50 (Accession number: IMGT/EMBL/GenBank/ DDBJ:L06618), L6 (Accession number: IMGT/EMBL/GenBank/DDBJ:X01668) and L4/18a (Accession number: EMBL/GenBank/DDBJ: Z00006).
- the heavy chain of a huCD3 antibody is derived from a germ line V (variable) gene such as, for example, the DP50 germline gene.
- the nucleic acid and amino acid sequences for the DP50 germline gene include, for example, the nucleic acid and amino acid sequences shown below:
- the huCD3 antibodies include a variable heavy chain (V H ) region encoded by a human DP50 V H germline gene sequence.
- a DP50 V H germline gene sequence is shown, e.g., in SEQ ID NO:48 in Figure 5.
- the huCD3 antibodies provided herein include a VH region that is encoded by a nucleic acid sequence that is at least 80% homologous to the DP50 VH germline gene sequence.
- the nucleic acid sequence is at least 90%, 95%, 96%, 97% homologous to the DP50 VH germline gene sequence, and more preferably, at least 98%, 99% homologous to the DP50 VH germline gene sequence.
- the V H region of the huCD3 antibody is at least 80% homologous to the amino acid sequence of the V H region encoded by the DP50 VH germline gene sequence.
- the amino acid sequence of V H region of the huCD3 antibody is at least 90%, 95%, 96%, 97% homologous to the amino acid sequence encoded by the DP50 VH germline gene sequence, and more preferably, at least 98%, 99% homologous to the sequence encoded by the DP50 VH germline gene sequence.
- the huCD3 antibodies also include a variable light chain (V L ) region encoded by a human L6 or L4/18a V L germline gene sequence.
- V L variable light chain
- a human L6 VL germline gene sequence is shown, e.g., in SEQ ID NO:56 in Figure 6, and a human L4/18a VL germline gene sequence is shown, for example, in SEQ ID NO:53 in Figure 7.
- the huCD3 antibodies include a VL region that is encoded by a nucleic acid sequence that is at least 80% homologous to either the L6 or L4/18a VL germline gene sequence.
- the nucleic acid sequence is at least 90%, 95%, 96%, 97% homologous to either the L6 or L4/18a VL germline gene sequence, and more preferably, at least 98%, 99% homologous to either the L6 or L4/18a VL germline gene sequence.
- the V L region of the huCD3 antibody is at least 80% homologous to the amino acid sequence of the V L region encoded by either the L6 or L4/18a V L germline gene sequence.
- the amino acid sequence of V L region of the huCD3 antibody is at least 90%, 95%, 96%, 97% homologous to the amino acid sequence encoded by either the L6 or L4/18a V L ge ⁇ nline gene sequence, and more preferably, at least 98%, 99% homologous to the sequence encoded by either the L6 or L4/18a VL germline gene sequence.
- the huCD3 antibodies have, for example, partially conserved amino acid sequences that are derived from the DP50 germline.
- the CDRl region of huCD3 antibodies used herein have at least the contiguous amino acid sequence YGMH (SEQ ID NO: 58).
- the CDR2 of the anti-CD3 antibodies includes, e.g., at least the contiguous amino acid sequence DSVKG (SEQ ID NO: 59) .
- the CDR2 region includes the contiguous amino acid sequence IWYX 1 GX 2 X 3 X 4 X 5 YX 6 DSVKG (SEQ ID NO:60), ⁇ where X 1 , X 2 , X 3 , X 4 , X 5 and X 6 represent any amino acid.
- Xi, X 2 , X 3 and X 4 are hydrophilic amino acids.
- Xi is asparagine or aspartate
- X 2 is arginine or serine
- X 3 is lysine or asparagine
- X 4 is lysine or glutamine
- X5 is aspartate
- X 6 is valine or alanine.
- the V H CDR2 region includes an amino acid sequence selected from the group consisting of AIWYNGRKQD YADSVKG (SEQ ID NO:69), IIWYDGSKKNYADSVKG (SEQ ID NO:70), VIWYDGSKKYYVDSVKG (SEQ ID NO:71) and VIWYDGSNKYYADSVKG (SEQ ID NO:72).
- the CDR3 region of anti-CD3 antibodies contain, for example, at least the contiguous amino acid sequence XAX J BGYXCXDFDX E (SEQ ID NO:61), where X A , X B , Xc, XD, and XE represent any amino acid.
- X A and XB are neutral amino acids
- XD is an aromatic amino acid
- XE is a hydrophobic amino acid.
- X ⁇ is glycine or glutamine
- XB is threonine or methionine
- X c is asparagine or tryptophan
- X D is tryptophan or histidine
- X E is proline or leucine.
- the CDR3 region includes either the contiguous amino acid sequence GTGYNWFDP (SEQ ID NO:62) or the contiguous amino acid sequence QMGYWHFDL (SEQ ID NO: 63).
- the anti-CD3 antibodies include a framework 2 region (FRW2) that contains the amino acid sequence WVRQAPGKGLEWV (SEQ ID NO:73).
- Anti-CD3 antibodies used herein include a framework 3 region (FRW3) that contains the amino acid sequence RFTISRDNSKNTLYLQMNSLRAEDTAVYYCA (SEQ ID NO:74).
- Some anti-CD3 antibodies include the contiguous amino acid sequence VTVSS (SEQ ID NO: 64) at a position that is C-terminal to CDR3 region.
- the antibody contains the contiguous amino acid sequence GTLVTVSS (SEQ ID NO:65) at a position that is C-terminal to the CDR3 region.
- Other anti-CD3 antibodies include the contiguous amino acid sequence WGRGTLVTVSS (SEQ ID NO: 66) at a position that is C-terminal to the CDR3 region.
- the arginine residue in SEQ ID NO: 66 is shown, for example, in the V H sequences for the 28Fl 1 huCD3 antibody (SEQ ID NO:2) and the 23F10 huCD3 antibody (SEQ ID NO:6).
- the invention provides methods of treating, preventing or alleviating a symptom of an immune-related disorder by administering an anti-CD3 antibody formulation to a subject.
- the anti-CD3 antibody formulations provided herein are administered in a dosage in the range between 0.05 mg/day and 10 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage between 0.1 mg/day to 5.0 mg/day, and more preferably, the anti-CD3 antibody formulation is administered in a dosage between 0.5 mg/day to 3.0 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage selected from 0.5 mg/day, 0.6 mg/day, 0.7 mg/day, 0.8 mg/day, 0.9 mg/day, 1.0 mg/day, 1.1 mg/day, 1.2 mg/day, 1.3 mg/day, 1.4 mg/day, 1.5 mg/day, 1.6 mg/day, 1.7 mg/day, 1.8 mg/day, 1.9 mg/day, 2.0 mg/day, 2.1 mg/day, 2.2 mg/day, 2.3 mg/day, 2.4 mg/day, 2.5 mg/day, 2.6 mg/day, 2.7 mg/day, 2.8 mg/day, 2.9 mg/day, and 3.0 mg/day
- the anti-CD3 antibody formulation is administered to a patient suffering from or predisposed to inflammatory bowel disorder, ulcerative colitis, Crohn's disease, multiple sclerosis, rheumatoid arthritis or Type I diabetes.
- the formulation is administered, e.g., intravenously.
- Other routes of administration are contemplated.
- the anti-CD3 antibody formulations are administered subcutaneously, orally, parenterally, nasally, intramuscularly, or any combination of these routes of administration.
- the invention provides methods of treating or preventing transplant rejection by administering to a subject an anti-CD3 antibody at a dosage in the range between 0.05 mg/day and 10 mg/day after transplant and increasing the dosage each day thereafter until a level of 50% or greater TCR-CD3 saturation is achieved, followed by 5 daily doses with the total course of treatment not to exceed eight days.
- the anti-CD3 antibody formulation is administered in a dosage between 0.1 mg/day to 5.0 mg/day, and more preferably, the anti-CD3 antibody formulation is administered in a dosage between 0.5 mg/day to 3.0 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage selected from 0.5 mg/day, 0.6 mg/day, 0.7 mg/day, 0.8 mg/day, 0.9 mg/day, 1.0 mg/day, 1.1 mg/day, 1.2 mg/day, 1.3 mg/day, 1.4 mg/day, 1.5 mg/day, 1.6 mg/day, 1.7 mg/day, 1.8 mg/day, 1.9 mg/day, 2.0 mg/day, 2.1 mg/day, 2.2 mg/day, 2.3 mg/day, 2.4 mg/day, 2.5 mg/day, 2.6 mg/day, 2.7 mg/day, 2.8 mg/day, 2.9 mg/day, and 3.0 mg/day.
- the anti-CD3 antibody formulation is used to treat or prevent renal rejection after organ or tissue transplantation.
- the formulation is administered prophylactically (e.g., prior to an acute rejection episode to prevent an episode), and/or the formulation is used as a treatment for an acute rejection episode following transplantation.
- the formulation is administered, e.g., intravenously.
- Other routes of administration are contemplated.
- the anti-CD3 antibody formulations are administered subcutaneously, orally, parenterally, nasally, intramuscularly, or any combination of these routes of administration.
- the anti-CD3 antibody formulations provided herein are stored in appropriate containers, such as vials, such that the dosage per container of anti-CD3 antibody formulation is in the range of 1 to 10 mg/container.
- the dosage per container of anti-CD3 antibody formulation is in the range of 2 to 5 mg/container.
- the dosage per container is in the range of 3.5 to 4.5 mg/container, e.g., the dosage per container is 4 mg/container.
- the subject is further administered with a second agent such as, but not limited to, anti-inflammatory compounds or immunosuppressive compounds.
- a second agent such as, but not limited to, anti-inflammatory compounds or immunosuppressive compounds.
- Suitable compounds include, but are not limited to methotrexate, cyclosporin A (including, for example, cyclosporin microemulsion), tacrolimus, corticosteroids, statins, type I interferons, Remicade (Infliximab), Enbrel (Etanercept) and Humira (Adalimumab).
- subjects with Type I diabetes or Latent Autoimmune Diabetes in the Adult are also administered a second agent, such as, for example, GLP-I or a beta cell resting compound (i.e., a compound that reduces or otherwise inhibits insulin release, such as potassium channel openers).
- a second agent such as, for example, GLP-I or a beta cell resting compound (i.e., a compound that reduces or otherwise inhibits insulin release, such as potassium channel openers).
- the invention provides methods of purifying an anti-CD3 antibody by affinity chromatography, ion-exchange chromatography and hydroxyapatite chromatography.
- affinity chromatography is protein A chromatography.
- the ion exchange chromatography is, e.g., anion exchange chromatography.
- Figures IA- ID are a series of representations of the nucleotide sequence and amino acid sequences for the variable light and variable heavy regions of the huCD3 antibody 28Fl 1 , wherein the CDRs are highlighted with boxes.
- Figures 2A-2D are a series of representations of the nucleotide sequence and amino acid sequences for the variable light and variable heavy regions of the huCD3 antibody 23F10,
- Figures 3A-3D are a series of representations of the nucleotide sequence and amino acid sequences for the variable light and variable heavy regions of the huCD3 antibody 27H5.
- Figure 3E is an alignment of the five light chains from the clone 27H5, where an asterisk (*) represents a conserved amino acid; a colon (:) represents a conservative mutation; and a period (.) represents a semiconservative mutation.
- Figures 4A-4D are a series of representations of the nucleotide sequence and amino acid sequences for the variable light and variable heavy regions of the huCD3 antibody 15C3.
- Figure 5 is an alignment depicting the variable heavy chain regions of the 15C3, 27H5 and 28Fl 1 huCD3 antibodies as well as the DP-50 germline sequence, the human heavy joining 5-02 sequence, and the human heavy joining 2 sequence. The CDR regions are indicated for each sequence.
- Figure 6 is an alignment depicting the VKIII variable regions of the 15C3 (variable light chain 1, i.e., "VLl") and 28Fl 1 huCD3 antibodies, as well as the L6 germline sequence, the human kappa joining 4 sequence and the human kappa joining 1 sequence. The CDR regions are indicated for each sequence.
- Figure 7 is an alignment depicting the VKI variable regions of the 15C3 (variable light chain 2, i.e. , "VL2”) and 27H5 VL2 huCD3 antibodies, as well as the L4/18a germline sequence, the human kappa joining 4 sequence and the human kappa joining 5 sequence.
- the CDR regions are indicated for each sequence.
- Figure 8 is an alignment depicting the VKII variable regions of the 27H5 VLl huCD3 antibody and DPK22, as well as human kappa joining 5 sequence. The CDR regions are indicated for each sequence. DETAILED DESCRIPTION
- the present invention provides formulations and dosing for monoclonal antibody, e.g., fully human monoclonal antibodies, specific against CD3 epsilon chain (CD3 ⁇ ).
- the fully human antibodies provided herein are referred to as huCD3 antibodies.
- the formulations provided herein have a pH in the range of 3.0 to 7.0.
- the formulation has a pH in the range of 5.0 to 6.0, and more preferably, the formulation has a pH in the range of 5.2 to 5.8, and most preferably, the formulation has a pH in the range of 5.4 to 5.6.
- the formulation has a pH of 5.5.
- the anti-CD3 antibodies used herein bind to a CD3 that wholly or partially includes the amino acid residues from position 27 to position 43 of the processed human CD3 epsilon subunit (i.e., without the leader sequence).
- the amino acid sequence of the human CD3 epsilon subunit is shown, for example, in GenBank Accession Nos. NP_000724; AAA52295; P07766; A32069; CAA27516; and AAH49847.
- the anti-CD3 antibody binds a CD3 epitope that wholly or partially includes the amino acid sequence of EMGGITQTPYKVSISGT (SEQ ID NO: 57).
- the 28Fl 1 antibody includes a heavy chain variable region (SEQ ED NO:2) encoded by the nucleic acid sequence shown below in SEQ ID NO: 1, and a light chain variable region (SEQ H) NO:4) encoded by the nucleic acid sequence shown in SEQ ID NO:3 ( Figures 1A-1D).
- the amino acids encompassing the complementarity determining regions (CDR) as defined by Chothia et al. 1989, E. A. Kabat et al., 1991 are highlighted with boxes in Figures IB and ID and Figures 5 and 6. (See Chothia, C, et al, Nature 342:877-883 (1989); Kabat, EA, et al, Sequences of Protein of immunological interest, Fifth Edition, US Department of Health and Human Services, US Government Printing Office (1991)).
- the heavy chain CDRs of the 28Fl 1 antibody have the following sequences: GYGMH (SEQ ID NO:27) VIWYDGSKKYYVDSVKG (SEQ ID NO:28) and QMGYWHFDL (SEQ ID NO:29).
- the light chain CDRs of the 28Fl 1 antibody have the following sequences: RASQSVSSYLA (SEQ ID NO:30) DASNRAT (SEQ ID NO:31) and QQRSNWPPLT (SEQ ID NO:32
- the 23F10 antibody includes a heavy chain variable region (SEQ ID NO:6) encoded by the nucleic acid sequence of SEQ ID NO:5, and a light chain variable region (SEQ ID NO: 8) encoded by the nucleic acid sequence of SEQ ID NO:7.
- the amino acids encompassing the CDR as defined by Chothia et al. 1989, E.A. Kabat et al., 1991 are highlighted in Figures 2B, 2D.
- the heavy chain CDRs of the 23F10 antibody have the following sequences: GYGMH (SEQ ID NO:27) VIWYDGSKKYYVDSVKG (SEQ ID NO:28) and QMGYWHFDL (SEQ ID NO:29).
- the light chain CDRs of the 23F10 antibody have the following sequences: RASQSVSSYLA (SEQ ID NO:30) DASNRAT (SEQ ID NO:31) and QQRSNWPPLT (SEQ ID NO:32).
- the 27H5 antibody includes a heavy chain variable region (SEQ ID NO: 10) encoded by the nucleic acid sequence of SEQ ID NO:9, and a light chain variable region selected from the amino acid sequences of SEQ ID NOS: 16-20 and encoded by the nucleic acid sequences of SEQ ID NO: 11-15.
- the amino acids encompassing the CDR as defined by Chothia et al. 1989, E.A. Kabat et al., 1991 are highlighted with boxes in Figures 3B, 3D, 5, and 7-8.
- the heavy chain CDRs of the 27H5 antibody have the following sequences: SYGMH (SEQ ID NO:33)
- the light chain CDRs of the 27H5 antibody have the following sequences: RASQS VSSSYLA (SEQ ID NO:36); GASSRAT (SEQ ID NO:37); QQYGSSPIT (SEQ ID NO:38); RASQGISSALA (SEQ ID NO:39); YASSLQS (SEQ ID NO:40); QQYYSTLT (SEQ ID NO:41); DASSLGS (SEQ ID NO:42); and WASQGISSYLA (SEQ ID NO:43).
- the 15C3 antibody includes a heavy chain variable region (SEQ ID NO:22) encoded by the nucleic acid sequence of SEQ ID NO:21, and a light chain variable region selected from the amino acid sequences shown in SEQ ID NOS: 25-26 and encoded by the nucleic acid sequences shown in SEQ ID NO:23-24.
- SEQ ID NO:22 a heavy chain variable region encoded by the nucleic acid sequence of SEQ ID NO:21
- a light chain variable region selected from the amino acid sequences shown in SEQ ID NOS: 25-26 and encoded by the nucleic acid sequences shown in SEQ ID NO:23-24.
- the amino acids encompassing the CDR as defined by Chothia et al. ,1989, E.A. Kabat et al., 1991 are highlighted with boxes in Figures 4B, 4D, and 5-7.
- the heavy chain CDRs of the 15C3 antibody have the following sequences: SYGMH (SEQ ID NO:33) AIWYNGRKQDYADSVKG (SEQ ID NO:44) and GTGYNWFDP (SEQ ID NO:35).
- the light chain CDRs of the 15C3 antibody have the following sequences: RASQSVSSYLA (SEQ ID NO:30); DASNRAT (SEQ ID NO:31); QQRSNWPWT (SEQ ID NO:45); RASQGISSALA (SEQ ID NO:39); DASSLES (SEQ ID NO:46); QQFNSYPIT (SEQ ID NO:47).
- anti-CD3 antibodies used herein also include antibodies that include a heavy chain variable amino acid sequence that is at least 90%, 92%, 95%, 97% 98%, 99% or more identical the amino acid sequence of SEQ ID NO: 2, 6, 10 or 22 and/or a light chain variable amino acid that is at least 90%, 92%, 95%, 97% 98%, 99% or more identical the amino acid sequence of SEQ ID NO:4, 8, 16-20 or 25-26.
- the monoclonal antibody is an antibody that binds to the same epitope as 28Fl 1, 27H5, 23F10 or 15C3.
- antibody refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen.
- immunoglobulin (Ig) molecules i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen.
- Such antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, single chain, F a b, F a b' and F( a b')2 fragments, and an F ab expression library.
- the basic antibody structural unit is known to comprise a tetramer.
- Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light” (about 25 kDa) and one "heavy” chain (about 50-70 kDa).
- the amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition.
- the carboxy-terminal portion of each chain defines a constant region primarily responsible for effector function.
- Human light chains are classified as kappa and lambda light chains.
- Heavy chains are classified as mu, delta, gamma, alpha, or epsilon, and define the antibody's isotype as IgM, IgD, IgA, and IgE, respectively.
- variable and constant regions are joined by a "J" region of about 12 or more amino acids, with the heavy chain also including a "D” region of about 10 more amino acids.
- J Fundamental Immunology Ch. 7
- D variable region of about 10 more amino acids.
- MAb monoclonal antibody
- CDRs complementarity determining regions
- antibody molecules obtained from humans relate to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule. Certain classes have subclasses as well, such as IgGi, IgG 2 , and others. Furthermore, in humans, the light chain may be a kappa chain or a lambda chain.
- epitopic determinants include any protein determinant capable of specific binding to an immunoglobulin, a scFv, or a T-cell receptor.
- epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
- An antibody is said to specifically bind an antigen when the dissociation constant is ⁇ 1 ⁇ M; preferably ⁇ 100 nM and most preferably ⁇ 10 nM.
- immunological binding refers to the non-covalent interactions of the type which occur between an immunoglobulin molecule and an antigen for which the immunoglobulin is specific.
- the strength, or affinity of immunological binding interactions can be expressed in te ⁇ ns of the dissociation constant (K d ) of the interaction, wherein a smaller K d represents a greater affinity.
- Immunological binding properties of selected polypeptides are quantified using methods well known in the art. One such method entails measuring the rates of antigen- binding site/antigen complex formation and dissociation, wherein those rates depend on the concentrations of the complex partners, the affinity of the interaction, and geometric parameters that equally influence the rate in both directions.
- both the "on rate constant” (K 0n ) and the “off rate constant” (K off ) can be determined by calculation of the concentrations and the actual rates of association and dissociation. (See Nature 361 :186- 87 (1993)).
- the ratio of K off /K 0n enables the cancellation of all parameters not related to affinity, and is equal to the dissociation constant Kd. (See, generally, Davies et al. (1990) Annual Rev Biochem 59:439-473).
- An antibody of the present invention is said to specifically bind to a CD3 epitope when the equilibrium binding constant (Ka) is ⁇ 1 ⁇ M, preferably ⁇ 100 nM, more preferably ⁇ 10 nM, and most preferably ⁇ 100 pM to about 1 pM, as measured by assays such as radioligand binding assays or similar assays known to those skilled in the art.
- Ka equilibrium binding constant
- a human monoclonal antibody has the same specificity as a human monoclonal antibody used herein (e.g., monoclonal antibody 28Fl 1, 27H5, 23F10 or 15C3) by ascertaining whether the former prevents the latter from binding to a CD3 antigen polypeptide. If the human monoclonal antibody being tested competes with a human monoclonal antibody used herein, as shown by a decrease in binding by the human monoclonal antibody used herein, then the two monoclonal antibodies bind to the same, or a closely related, epitope.
- Another way to determine whether a human monoclonal antibody has the specificity of a human monoclonal antibody used herein is to pre- incubate the human monoclonal antibody used herein with the CD3 antigen polypeptide with which it is normally reactive, and then add the human monoclonal antibody being tested to determine if the human monoclonal antibody being tested is inhibited in its ability to bind the CD3 antigen polypeptide. If the human monoclonal antibody being tested is inhibited then, in all likelihood, it has the same, or functionally equivalent, epitopic specificity as the monoclonal antibody used herein.
- sequence identity means that two polynucleotide or amino acid sequences are identical (i.e., on a nucleotide-by-nucleotide or residue-by-residue basis) over the comparison window.
- percentage of sequence identity is calculated by comparing two optimally aligned sequences over the window of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U or I) or residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the comparison window (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity.
- substantially identical denotes a characteristic of a polynucleotide or amino acid sequence, wherein the polynucleotide or amino acid comprises a sequence that has at least 85 percent sequence identity, preferably at least 90 to 95 percent sequence identity, more usually at least 99 percent sequence identity as compared to a reference sequence over a comparison window of at least 18 nucleotide (6 amino acid) positions, frequently over a window of at least 24-48 nucleotide (8-16 amino acid) positions, wherein the percentage of sequence identity is calculated by comparing the reference sequence to the sequence which may include deletions or additions which total 20 percent or less of the reference sequence over the comparison window.
- the reference sequence may be a subset of a larger sequence.
- Examples of unconventional amino acids include: 4 hydroxyproline, ⁇ -carboxyglutamate, ⁇ -N,N,N-trimethyllysine, ⁇ -N-acetyllysine, O-phosphoserine, N- acetylserine, N- fomiylmethionine, 3-methylhistidine, 5-hydroxylysine, ⁇ -N-methylarginine, and other similar amino acids and imino acids (e.g., 4- hydroxyproline).
- the lefthand direction is the amino terminal direction and the righthand direction is the carboxy-terminal direction, in accordance with standard usage and convention.
- Conservative amino acid substitutions refer to the interchangeability of residues having similar side chains.
- a group of amino acids having aliphatic side chains is glycine, alanine, valine, leucine, and isoleucine; a group of amino acids having aliphatic-hydroxyl side chains is serine and threonine; a group of amino acids having amide- containing side chains is asparagine and glutamine; a group of amino acids having aromatic side chains is phenylalanine, tyrosine, and tryptophan; a group of amino acids having basic side chains is lysine, arginine, and histidine; and a group of amino acids having sulfur- containing side chains is cysteine and methionine.
- Preferred conservative amino acids substitution groups are: valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine, alanine valine, glutamic- aspartic, and asparagine-glutamine.
- amino acid sequences of antibodies or immunoglobulin molecules are contemplated as being encompassed by the present invention, providing that the variations in the amino acid sequence maintain at least 75%, more preferably at least 80%, 90%, 95%, and most preferably 99%.
- conservative amino acid replacements are contemplated. Conservative replacements are those that take place within a family of amino acids that are related in their side chains.
- amino acids are generally divided into families: (1) acidic amino acids are aspartate, glutamate; (2) basic amino acids are lysine, arginine, histidine; (3) non-polar amino acids are alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan, and (4) uncharged polar amino acids are glycine, asparagine, glutamine, cysteine, serine, threonine, tyrosine.
- the hydrophilic amino acids include arginine, asparagine, aspartate, glutamine, glutamate, histidine, lysine, serine, and threonine.
- the hydrophobic amino acids include alanine, cysteine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, tyrosine and valine.
- Other families of amino acids include (i) serine and threonine, which are the aliphatic-hydroxy family; (ii) asparagine and glutamine, which are the amide containing family; (iii) alanine, valine, leucine and isoleucine, which are the aliphatic family; and (iv) phenylalanine, tryptophan, and tyrosine, which are the aromatic family.
- agent is used herein to denote a chemical compound, a mixture of chemical compounds, a biological macromolecule, or an extract made from biological materials.
- the term patient includes human and veterinary subjects.
- the invention also includes F v , F at ,, F a b' and F( a iy)2 anti-CD3 fragments, single chain anti-CD3 antibodies, bispecific anti-CD3 antibodies, heteroconjugate anti-CD3 antibodies, trispecific antibodies, immunoconjugates and fragments thereof.
- Bispecific antibodies are antibodies that have binding specificities for at least two different antigens. In the present case, one of the binding specificities is for CD3.
- the second binding target is any other antigen, and advantageously is a cell-surface protein or receptor or receptor subunit.
- formulations include, for example, powders, pastes, ointments, jellies, waxes, oils, lipids, lipid (cationic or anionic) containing vesicles (such as LipofectinTM), DNA conjugates, anhydrous absorption pastes, oil-in-water and water-in-oil emulsions, emulsions carbowax (polyethylene glycols of various molecular weights), semi-solid gels, and semi-solid mixtures containing carbowax. Any of the foregoing mixtures may be appropriate in treatments and therapies in accordance with the present invention, provided that the active ingredient in the formulation is not inactivated by the formulation and the formulation is physiologically compatible and tolerable with the route of administration.
- the formulations are, preferably, substantially pure.
- substantially pure means an object species is the predominant species present (i.e., on a molar basis it is more abundant than any other individual species in the composition), and preferably a substantially purified fraction is a composition wherein the object species comprises at least about 50 percent (on a molar basis) of all macromolecular species present.
- a substantially pure composition will comprise more than about 80 percent of all macromolecular species present in the composition, more preferably more than about 85%, 90%, 95%, and 99%.
- the object species is purified to essential homogeneity (contaminant species cannot be detected in the composition by conventional detection methods) wherein the composition consists essentially of a single macromolecular species.
- Therapeutic formulations provided herein which include an anti-CD3 antibody used herein, are used to treat or alleviate a symptom associated with an immune-related disorder, such as, for example, an autoimmune disease or an inflammatory disorder.
- Autoimmune diseases include, for example, Acquired Immunodeficiency Syndrome (AIDS, which is a viral disease with an autoimmune component), alopecia areata, ankylosing spondylitis, antipliospholipid syndrome, autoimmune Addison's disease, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease (AIED), autoimmune lymphoproliferative syndrome (ALPS), autoimmune thrombocytopenic purpura (ATP), Behcet's disease, cardiomyopathy, celiac sprue- dermatitis hepetiformis; chronic fatigue immune dysfunction syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy (CIPD), cicatricial pemphigoid, cold agglutinin disease, crest syndrome, Crohn's disease, Degos' disease, dermatomyositis- juvenile, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia-fibro
- Inflammatory disorders include, for example, chronic and acute inflammatory disorders.
- inflammatory disorders include Alzheimer's disease, asthma, atopic allergy, allergy, atherosclerosis, bronchial asthma, eczema, glomerulonephritis, graft vs. host disease, hemolytic anemias, osteoarthritis, sepsis, stroke, transplantation of tissue and organs, vasculitis, diabetic retinopathy and ventilator induced lung injury.
- the formulations of anti-CD3 antibody are administered to a subject suffering from an immune-related disorder, such as an autoimmune disease or an inflammatory disorder.
- an immune-related disorder such as an autoimmune disease or an inflammatory disorder.
- a subject suffering from an autoimmune disease or an inflammatory disorder is identified by methods known in the art.
- subjects suffering from an autoimmune disease such as Crohn's disease, ulcerative colitis or inflammatory bowel disease, are identified using any of a variety of clinical and/or laboratory tests such as, physical examination, radiologic examination, and blood, urine and stool analysis to evaluate immune status.
- patients suffering from multiple sclerosis are identified , e.g., by using magnetic resonance imaging the presence of central nervous system (CNS) lesions that are disseminated in time and space (i.e., occur in different parts of the CNS at least three months apart).
- CNS central nervous system
- Patients suffering from rheumatoid arthritis are identified using, e.g., blood tests and/or x-ray or other imaging evaluation.
- Patients suffering from Type I diabetes are identified, e.g., when any three of these tests is positive, followed by a second positive test on a different day: (1) fasting plasma glucose of greater than or equal to 126 mg/dl with symptoms of diabetes; (2) casual plasma glucose (taken at any time of the day) of greater than or equal to 200 mg/dl with the symptoms of diabetes; or (3) oral glucose tolerance test (OGTT) value of greater than or equal to 200 mg/dl measured at a two-hour interval (the OGTT is given over a three-hour time span).
- OGTT oral glucose tolerance test
- an anti-CD3 antibody formulation to a patient suffering from an immune-related disorder such as an autoimmune disease or an inflammatory disorder is considered successful if any of a variety of laboratory or clinical results is achieved.
- administration of an anti-CD3 antibody formulation to a patient suffering from an immune-related disorder such as an autoimmune disease or an inflammatory disorder is considered successful if one or more of the symptoms associated with the disorder is alleviated, reduced, inhibited or does not progress to a further, i.e. , worse, state.
- Administration of an anti-CD3 antibody formulation to a patient suffering from an immune-related disorder such as an autoimmune disease or an inflammatory disorder is considered successful if the disorder, e.g.
- an autoimmune disorder enters remission or does not progress to a further, i.e., worse, state.
- the anti-CD3 antibody formulations provided herein are used in the treatment, diagnosis and/or prevention of inflammatory bowel disorder (IBD).
- IBD is the chronic inflammation and irritation of tissue in the gastrointestinal (GI) tract. IBD is associated with symptoms such as abdominal cramping and pain, diarrhea, rectal bleeding, fever and elevated white blood cell count.
- the anti-CD3 antibody formulations provided herein are administered to a subject that is suffering from, has been diagnosed with, or is predisposed to IBD.
- the anti-CD3 antibody formulations provided herein are administered at a dosage that is sufficient to alleviate at least one symptom of IBD, to treat IBD, to prevent IBD, and/or to prevent IBD from progressing to a further disease state in a subject.
- the anti-CD3 antibody formulation is administered in a dosage in the range between 0.05 mg/day and 10 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage between 0.1 mg/day to 5.0 mg/day, and more preferably, the anti-CD3 antibody formulation is administered in a dosage between 0.5 mg/day to 3.0 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage selected from 0.5 mg/day, 0.6 mg/day, 0.7 mg/day, 0.8 mg/day, 0.9 mg/day, 1.0 mg/day, 1.1 mg/day, 1.2 mg/day, 1.3 mg/day, 1.4 mg/day, 1.5 mg/day, 1.6 mg/day, 1.7 mg/day, 1.8 mg/day, 1.9 mg/day, 2.0 mg/day, 2.1 mg/day, 2.2 mg/day, 2.3 mg/day, 2.4 mg/day, 2.5 mg/day, 2.6 mg/day, 2.7 mg/day, 2.8 mg/day, 2.9 mg/day, and 3.0 mg/day.
- the anti-CD3 antibody formulations provided herein are used in the treatment, diagnosis and/or prevention of ulcerative colitis. Ulcerative colitis is the chronic inflammation and irritation of the colon. Ulcerative colitis is associated with symptoms such as anemia; fatigue; weight loss; loss of appetite; rectal bleeding; loss of body fluids and nutrients; skin lesions; joint pain; and growth failure (specifically in children).
- the anti-CD3 antibody formulations provided herein are administered to a subject that is suffering from, has been diagnosed with, or is predisposed to ulcerative colitis.
- the anti-CD3 antibody formulations provided herein are administered at a dosage that is sufficient to alleviate at least one symptom of ulcerative colitis, to treat ulcerative colitis, to prevent ulcerative colitis, and/or to prevent ulcerative colitis from progressing to a further disease state in a subject.
- the anti-CD3 antibody formulation is administered in a dosage in the range between 0.05 mg/day and 10 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage between 0.1 mg/day to 5.0 mg/day, and more preferably, the anti-CD3 antibody formulation is administered in a dosage between 0.5 mg/day to 3.0 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage selected from 0.5 mg/day, 0.6 mg/day, 0.7 mg/day, 0.8 mg/day, 0.9 mg/day, 1.0 mg/day, 1.1 mg/day, 1.2 mg/day, 1.3 mg/day, 1.4 mg/day, 1.5 mg/day, 1.6 mg/day, 1.7 mg/day, 1.8 mg/day, 1.9 mg/day, 2.0 mg/day, 2.1 mg/day, 2.2 mg/day, 2.3 mg/day, 2.4 mg/day, 2.5 mg/day, 2.6 mg/day, 2.7 mg/day, 2.8 mg/day, 2.9 mg/day, and 3.0 mg/day.
- the anti-CD3 antibody formulations provided herein are used in the treatment, diagnosis and/or prevention of Crohn's disease.
- Crohn's disease is the chronic inflammation and irritation of the intestines. Crohn's disease is associated with symptoms such as abdominal pain, diarrhea, weight loss, poor appetite, fever, night sweats, rectal pain, and rectal bleeding.
- the anti-CD3 antibody formulations provided herein are administered to a subject that is suffering from, has been diagnosed with, or is predisposed to Crohn's disease.
- the anti-CD3 antibody formulations provided herein are administered at a dosage that is sufficient to alleviate at least one symptom of Crohn's disease, to treat Crohn's disease, to prevent Crohn's disease, and/or to prevent Crohn's disease from progressing to a further disease state in a subject.
- the anti-CD3 antibody formulation is administered in a dosage in the range between 0.05 mg/day and 10 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage between 0.1 mg/day to 5.0 mg/day, and more preferably, the anti-CD3 antibody formulation is administered in a dosage between 0.5 mg/day to 3.0 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage selected from 0.5 mg/day, 0.6 mg/day, 0.7 mg/day, 0.8 mg/day, 0.9 mg/day, 1.0 mg/day, 1.1 mg/day, 1.2 mg/day, 1.3 mg/day, 1.4 mg/day, 1.5 mg/day, 1.6 mg/day, 1.7 mg/day, 1.8 mg/day, 1.9 mg/day, 2.0 mg/day, 2.1 mg/day, 2.2 mg/day, 2.3 mg/day, 2.4 mg/day, 2.5 mg/day, 2.6 mg/day, 2.7 mg/day, 2.8 mg/day, 2.9 mg/day, and 3.0 mg/day.
- the anti-CD3 antibody formulations provided herein are used in the treatment, diagnosis and/or prevention of multiple sclerosis (MS).
- MS is a chronic, inflammatory disease that affects the central nervous system (CNS). Symptoms of MS include, for example, changes in sensation, visual problems, muscle weakness, depression, difficulties with coordination and speech, and pain.
- the anti-CD3 antibody formulations provided herein are administered to a subject that is suffering from, has been diagnosed with, or is predisposed to MS.
- the anti-CD3 antibody formulations provided herein are administered at a dosage that is sufficient to alleviate at least one symptom of MS, to treat MS, to prevent MS, and/or to prevent MS from progressing to a further disease state in a subject.
- the anti-CD3 antibody formulation is administered in a dosage in the range between 0.05 mg/day and 10 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage between 0.1 mg/day to 5.0 mg/day, and more preferably, the anti-CD3 antibody formulation is administered in a dosage between 0.5 mg/day to 3.0 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage selected from 0.5 mg/day, 0.6 mg/day, 0.7 mg/day, 0.8 mg/day, 0.9 mg/day, 1.0 mg/day, 1.1 mg/day, 1.2 mg/day, 1.3 mg/day, 1.4 mg/day, 1.5 mg/day, 1.6 mg/day, 1.7 mg/day, 1.8 mg/day, 1.9 mg/day, 2.0 mg/day, 2.1 mg/day, 2.2 mg/day, 2.3 mg/day, 2.4 mg/day, 2.5 mg/day, 2.6 mg/day, 2.7 mg/day, 2.8 mg/day, 2.9 mg/day, and 3.0 mg/day.
- the anti-CD3 antibody formulations provided herein are used in the treatment, diagnosis and/or prevention of insulin-dependent diabetes mellitus (Type I diabetes).
- Type I diabetes is a disease characterized by persistent hyperglycemia (high blood sugar levels) resulting from inadequate secretion of the hormone insulin.
- Type I diabetes is characterized by loss of the insulin-producing beta cells of the islets of Langerhans of the pancreas.
- Type I diabetes is an autoimmune disorder, in which the body's own immune system attacks the beta cells in the Islets of Langerhans of the pancreas, destroying them or damaging them sufficiently to reduce or eliminate insulin production.
- Type I diabetes Symptoms of Type I diabetes include, for example, increased thirst, increased urination, weight loss despite increased appetite, nausea, vomiting, abdominal pain, and fatigue.
- the anti-CD3 antibody formulations provided herein are administered to a subject that is suffering from, has been diagnosed with, or is predisposed to Type I diabetes.
- the anti-CD3 antibody formulations provided herein are administered at a dosage that is sufficient to alleviate at least one symptom of Type I diabetes, to treat Type I diabetes, to prevent Type I diabetes, and/or to prevent Type I diabetes from progressing to a further disease state in a subject.
- the anti-CD3 antibody formulation is administered in a dosage in the range between 0.05 mg/day and 10 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage between 0.1 mg/day to 5.0 mg/day, and more preferably, the anti-CD3 antibody formulation is administered in a dosage between 0.5 mg/day to 3.0 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage selected from 0.5 mg/day, 0.6 mg/day, 0.7 mg/day, 0.8 mg/day, 0.9 mg/day, 1.0 mg/day, 1.1 mg/day, 1.2 mg/day, 1.3 mg/day, 1.4 mg/day, 1.5 mg/day, 1.6 mg/day, 1.7 mg/day, 1.8 mg/day, 1.9 mg/day, 2.0 mg/day, 2.1 mg/day, 2.2 mg/day, 2.3 mg/day, 2.4 mg/day, 2.5 mg/day, 2.6 mg/day, 2.7 mg/day, 2.8 mg/day, 2.9 mg/day, and 3.0 mg/day.
- the anti-CD3 antibody formulations provided herein are used in the treatment, diagnosis and/or prevention of rheumatoid arthritis (RA).
- Rheumatoid arthritis is an autoimmune disease that causes chronic inflammation of the joints. Rheumatoid arthritis can also cause inflammation of the tissue around the joints, as well as other organs in the body.
- RA is associated with symptoms such as fatigue, lack of appetite, low grade fever, muscle and joint aches, and stiffness.
- the anti-CD3 antibody formulations provided herein are administered to a subject that is suffering from, has been diagnosed with, or is predisposed to RA.
- the anti-CD3 antibody formulations provided herein are administered at a dosage that is sufficient to alleviate at least one symptom of RA, to treat RA, to prevent RA, and/or to prevent RA from progressing to a further disease state in a subject.
- the anti-CD3 antibody formulation is administered in a dosage in the range between 0.05 mg/day and 10 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage between 0.1 mg/day to 5.0 mg/day, and more preferably, the anti-CD3 antibody formulation is administered in a dosage between 0.5 mg/day to 3.0 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage selected from 0.5 mg/day, 0.6 mg/day, 0.7 mg/day, 0.8 mg/day, 0.9 mg/day, 1.0 mg/day, 1.1 mg/day, 1.2 mg/day, 1.3 mg/day, 1.4 mg/day, 1.5 mg/day, 1.6 mg/day, 1.7 mg/day, 1.8 mg/day, 1.9 mg/day, 2.0 mg/day, 2.1 mg/day, 2.2 mg/day, 2.3 mg/day, 2.4 mg/day, 2.5 mg/day, 2.6 mg/day, 2.7 mg/day, 2.8 mg/day, 2.9 mg/day, and 3.0 mg/day.
- the present invention also provides methods of treating or alleviating a symptom associated with an immune-related disorder or a symptom associated with rejection following organ transplantation.
- the formulations used herein are used to treat or alleviate a symptom of any of the autoimmune diseases and inflammatory disorders provided herein.
- immunosuppression agent refers to an agent whose action on the immune system leads to the immediate or delayed reduction of the activity of at least one pathway involved in an immune response, whether this response is naturally occurring or artificially triggered, whether this response takes place as part of the innate immune system, the adaptive immune system, or both.
- immunosuppressive anti-CD3 antibody formulations are administered to a subject prior to, during and/or after organ or tissue transplantation.
- an anti-CD3 antibody formulation provided herein is used to treat or prevent rejection after organ or tissue transplantation.
- the anti-CD3 antibody formulation is administered in a dosage in the range between 0.05 mg/day and 10 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage between 0.1 mg/day to 5.0 mg/day, and more preferably, the anti-CD3 antibody formulation is administered in a dosage between 0.5 mg/day to 3.0 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage selected from 0.5 mg/day, 0.6 mg/day, 0.7 mg/day, 0.8 mg/day, 0.9 mg/day, 1.0 mg/day, 1.1 mg/day, 1.2 mg/day, 1.3 mg/day, 1.4 mg/day, 1.5 mg/day, 1.6 mg/day, 1.7 mg/day, 1.8 mg/day, 1.9 mg/day, 2.0 mg/day, 2.1 mg/day, 2.2 mg/day, 2.3 mg/day, 2.4 mg/day, 2.5 mg/day, 2.6 mg/day, 2.7 mg/day, 2.8 mg/day, 2.9 mg/day, and 3.0 mg/day.
- the therapeutic anti-CD3 antibody formulations provided herein are administered to a subject intravenously or subcutaneously.
- Other routes of administration are contemplated.
- the anti-CD3 antibody formulations are administered intravenously, subcutaneously, orally, parenterally, nasally, intramuscularly, or any combination of these routes of administration.
- the anti-CD3 antibody formulations used herein are administered in conjunction with a second agent such as, for example, GLP-I or a beta cell resting compound (i.e., a compound that reduces or otherwise inhibits insulin release, such as potassium channel openers).
- a second agent such as, for example, GLP-I or a beta cell resting compound (i.e., a compound that reduces or otherwise inhibits insulin release, such as potassium channel openers).
- GLP-I i.e., the published application U.S. 20040037826, and suitable beta cell resting compounds are described in published application U.S. 20030235583, each of which is hereby incorporated by reference in its entirety.
- the anti-CD3 antibody formulations used to treat an immune-related disorder are administered in combination with any of a variety of known anti-inflammatory and/or immunosuppressive compounds.
- suitable known compounds include, but are not limited to methotrexate, cyclosporin A (including, for example, cyclosporin microemulsion), tacrolimus, corticosteroids, statins, interferon beta, Remicade (Infliximab), Enbrel (Etanercept) and Humira (Adalimumab).
- the anti-CD3 antibody formulations used herein can be co-administered with corticosteroids, methotrexate, cyclosporin A, statins, Remicade (Infliximab), Enbrel (Etanercept) and/or Humira (Adalimumab).
- the anti-CD3 antibody formulations can be administered in conjunction with, e.g., corticosteroids, methotrexate, cyclosporin A, cyclophosphamide and/or statins.
- patients afflicted with a disease such as Crohn's Disease or psoriasis can be treated with a combination of an anti-CD3 antibody composition used herein and Remicaid (Infliximab), and/or Humira (Adalimumab).
- Patients with multiple sclerosis can receive a combination of an anti-CD3 antibody composition used herein in combination with, e.g., glatiramer acetate (Copaxone), interferon beta-la (Avonex), interferon beta-la (Rebif), interferon beta-lb (Betaseron or Betaferon), mitoxantrone (Novantrone), dexamethasone (Decadron), methylprednisolone (Depo-Medrol), and/or prednisone (Deltasone) and/or statins.
- glatiramer acetate Copaxone
- interferon beta-la Avonex
- interferon beta-la Rebif
- interferon beta-lb Betaseron or Betaferon
- mitoxantrone Novantrone
- Dexamethasone Decadron
- methylprednisolone Depo-Medrol
- prednisone Del
- the immunosuppressive anti-CD3 antibody formulations used herein are administered in conjunction with a second agent such as, for example, GLP-I or a beta cell resting compound, as described above.
- these immunosuppressive anti-CD3 antibody formulations are administered in combination with any of a variety of known anti-inflammatory and/or immunosuppressive compounds.
- Suitable anti-inflammatory and/or immunosuppressive compounds for use with the anti-CD3 antibodies used herein include, but are not limited to, methotrexate, cyclosporin A (including, for example, cyclosporin niicroemulsion), tacrolimus, corticosteroids and statins.
- an anti-CD3 antibody composition is administered to a human individual upon detection of the presence of auto-reactive antibodies within the human individual.
- auto-reactive antibodies are known within the art as antibodies with binding affinity to one or more proteins expressed endogenously within the human individual.
- the human individual is tested for the presence of auto-reactive antibodies specifically involved in one or more autoimmune diseases as are well known within the art.
- a human patient is tested for the presence of antibodies against insulin, glutamic acid decarboxylase and/or the IA-2 protein, and subsequently administered with an anti-CD3 antibody upon positive detection of one or more such auto-reactive antibodies.
- an anti-CD3 antibody composition is administered to human subjects to prevent, reduce or decrease the recruitment of immune cells into human tissues.
- An anti-CD3 antibody used herein is administered to a subject in need thereof to prevent and treat conditions associated with abnormal or deregulated immune cell recruitment into tissue sites of human disease.
- an anti-CD3 antibody composition is administered to human subjects to prevent, reduce or decrease the extravasation and diapedesis of immune cells into human tissues.
- the anti-CD3 antibodies used herein are administered to prevent and/or treat conditions associated with abnormal or deregulated immune cell infiltration into tissue sites of human disease.
- an anti-CD3 antibody composition is administered to human subjects to prevent, reduce or decrease the effects mediated by the release of cytokines within the human body.
- cytokine refers to all human cytokines known within the art that bind extracellular receptors upon the cell surface and thereby modulate cell function, including but not limited to IL-2, IFN-g, TNF-a, IL-4, IL- 5, IL-6, IL-9, IL-IO, and IL-13.
- an anti-CD3 antibody composition is administered to human subjects to prevent, reduce or decrease the effects mediated by the release of cytokine receptors within the human body.
- cytokine receptor refers to all human cytokine receptors within the art that bind one or more cytokine(s), as defined herein, including but not limited to receptors of the aforementioned cytokines.
- an anti-CD3 antibody used herein is administered to treat and/or prevent conditions mediated through abnormal activation, binding or ligation of one or more cytokine receptor(s) within the human body. It is further envisioned that administration of the anti-CD3 antibody in vivo will deplete the intracellular signaling mediated by cytokine receptor(s) within such human subject.
- an anti-CD3 antibody composition is administered to a human individual upon decrease of pancreatic beta-cell function therein.
- the individual is tested for beta-cell function, insulin secretion or c-peptide levels as are known within the art. Subsequently, upon notice of sufficient decrease of either the indicator, the human individual is administered with a sufficient dosage regimen of an anti-CD3 antibody to prevent further progression of autoimmune destruction of beta- cell function therein.
- the anti-CD3 antibody formulations are used in diagnostic and prophylactic formulations.
- an anti-CD3 MAb formulation provided herein is administered to patients that are at risk of developing one of the aforementioned autoimmune diseases.
- a patient's predisposition to one or more of the aforementioned autoimmune diseases can be determined using genotypic, serological or biochemical markers. For example, the presence of particular HLA subtypes and serological autoantibodies (against insulin, GAD65 and IA-2) are indicative of Type I diabetes.
- an anti-CD3 antibody formulation is administered to human individuals diagnosed with one or more of the aforementioned autoimmune diseases. Upon diagnosis, an anti-CD3 antibody is administered to mitigate or reverse the effects of autoimmunity.
- a human individual diagnosed with Type I diabetes is administered with sufficient dose of an anti-CD3 antibody to restore pancreatic function and minimize damage of autoimmune infiltration into the pancreas.
- a human individual diagnosed with rheumatoid arthritis is administered with an anti-CD3 antibody to reduce immune cell infiltration into and destruction of limb j oints.
- the therapeutic, diagnostic and/or prophylactic anti-CD3 antibody formulations provided herein are administered to a subject intravenously or subcutaneously.
- Other routes of administration are contemplated.
- the anti- CD3 antibody formulations are administered intravenously, subcutaneously, orally, parenterally, nasally, intramuscularly, or any combination of these routes of administration.
- the formulations studied comprised acetate, citrate and phosphate buffering agents covering a pH range of pH 4.0 to 8.0 and included selected excipients Tween 80, mamiitol,
- a variety of stability indicating methods were used to monitor the different physical and chemical properties of the product. These methods were selected from those used for batch release testing of product integrity and included pH, protein concentration, visual appearance, gel permeation chromatography (GP HPLC), SDS PAGE (reducing and non-reducing) and isoelectric focusing.
- the stability of the product was assessed in each formulation at the intended storage temperature of 5 ⁇ 3°C and the elevated storage temperatures of 25 ⁇ 3°C and 40 ⁇ 3 0 C.
- the elevated temperatures were used to provide accelerated stability data in each formulation, which were used to support the selection of formulation determined from the real time data.
- samples were stored at - 20 ⁇ 5 0 C to investigate the effect of freeze-thawing on the stability of the molecule.
- 25mM sodium acetate / 125mM sodium chloride / 0.02% Tween 80, pH 5.5 was selected as the final formulation buffer for the anti-CD3 antibody.
- the formulations provided herein have a pH in the range of 3.0 to 7.0.
- the formulation has a pH in the range of 5.0 to 6.0, and more preferably, the formulation has a pH in the range of 5.2 to 5.8, and most preferably, the formulation has a pH in the range of 5.4 to 5.6.
- the formulation has a pH of 5.5.
- the dose selection process described herein was used to identify doses that would encompass the therapeutic window for the anti-CD3 antibody formulations to be tested in larger studies. At the same time, the initial dose to be tested was chosen to be non harmful to patients.
- anti-CD3 monoclonal antibodies described herein e.g., 28Fl 1, 15C3, 27H5 and 23F10
- do not cross-react with "standard" laboratory species CD3 toxicology and efficacy data cannot be obtained in toxicology and preclinical pharmacology.
- GLP studies have demonstrated that there is no cross-reactivity with mouse, rat, rabbit, rhesus monkey, cynomolgus monkey, and baboon CD3 for some of the anti- CD3 monoclonal antibodies described herein.
- the dose selection process was, therefore, guided by data obtained in vitro on human T-cells, comparing an anti-CD3 antibody that does not cross-react with standard laboratory species CD3 (i.e., a "non-cross-reactive CD3 antibody”) to other currently marketed anti-CD3 antibodies, using the information published on anti-CD3 antibodies that are currently in development or on the market (see e.g., Orthoclone marketed sheet; Woodle Transplantation 1999; Friend Transplantation
- ChAglyCD3 ranges between 10-14, 7-14 and 6 consecutive days, respectively;
- patients will receive 5 daily consecutive doses of a non-cross-reactive CD3 antibody.
- the dose course, for five consecutive days, in patients will be between 0.5 mg/day and 5.0 mg/day, which is significantly lower than the effective dose of
- the dose course, for five consecutive days is between 0.7 mg/day and 2 mg/day.
- the dose course, for five consecutive days is 0.7 mg/day, 0.8 mg/day, 0.9 mg/day, 1.0 mg/day, 1.1 mg/day, 1.2 mg/day, 1.3 mg/day, 1.4 mg/day, 1.5 mg/day, 1.6 mg/day, 1.7 mg/day, 1.8 mg/day, 1.9 mg/day, or 2.0 mg/day.
- the in-process product is 0.2 ⁇ m filtered.
- the time between removing in-process product from 5 ⁇ 3°C storage, performing the purification step and returning processed 0.2 ⁇ m filtered product to the cold room must not exceed 36 hours.
- composition of the final formulation buffer is as follows:
- CM34 medium which contains base solutions, is used during cell banking.
- the initial master cell bank is cryopreserved in CM34 medium supplemented with dimethyl sulphoxide.
- CM41 medium containing base solutions and chemicals, is used during inoculum preparation. Additionally, Supplement E, which contains salts, is added to the basal medium prior to use.
- CM42 medium which contains base solutions, chemicals and amino acids, is used during the fermentation step.
- CM42 medium is supplemented with SF31, SF32 and Supplement E feeds. These feeds contain base powders, salts, amino acids, glucose, vitamins, chemicals and trace elements. All amino acids used in the media and feed formulations are derived from non-animal sources.
- EXAMPLE 4 Treatment Regimen for Use of Anti-CD3 Antibody Formulations in Treatment of Autoimmune Disease
- An anti-CD3 antibody formulation is administered by intravenous infusion on study days 1 through 5, at a dose in the range between 0.05 mg/day and 10 mg/day or placebo.
- the anti-CD3 antibody formulation is administered in a dosage between 0.1 mg/day to 5.0 mg/day, and more preferably, the anti-CD3 antibody formulation is administered in a dosage between 0.5 mg/day to 3.0 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage selected from 0.5 mg/day, 0.6 mg/day, 0.7 mg/day, 0.8 mg/day, 0.9 mg/day, 1.0 mg/day, 1.1 mg/day, 1.2 mg/day, 1.3 mg/day, 1.4 mg/day, 1.5 mg/day, 1.6 mg/day, 1.7 mg/day, 1.8 mg/day, 1.9 mg/day, 2.0 mg/day, 2.1 mg/day, 2.2 mg/day, 2.3 mg/day, 2.4 mg/day, 2.5 mg/day, 2.6 mg/day, 2.7 mg/day, 2.8 mg/day, 2.9 mg/day, and 3.0 mg/day.
- a dose level is associated with a significant modulation of the CD3 complex on T-cells and/or with a significant cytokine release syndrome, one or more lower dose level(s) is tested in place of one or more of the higher dose level(s).
- the desired dose level of the anti-CD3 antibody formulation results in a level of cytokine i"elease that is less than "3" on the WHO scale for cytokine release.
- the criteria for level 3 on the WHO scale for cytokine release symptoms are shown below in Table 5.
- An anti-CD3 antibody formulation is administered daily until greater than 50% TCR-CD3 coating/saturation is observed.
- the anti-CD3 antibody formulation is administered daily until the observed TCR-CD3 coating/saturation level is greater than 60%, greater than 70% or greater than 80%.
- the initial dose is in the range between 0.05 mg/day and 10 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage between 0.1 mg/day to 5.0 mg/day, and more preferably, the anti-CD3 antibody formulation is administered in a dosage between 0.5 mg/day to 3.0 mg/day.
- the anti-CD3 antibody formulation is administered in a dosage selected from 0.5 mg/day, 0.6 mg/day, 0.7 mg/day, 0.8 mg/day, 0.9 mg/day, 1.0 mg/day, 1.1 mg/day, 1.2 mg/day, 1.3 mg/day, 1.4 mg/day, 1.5 mg/day, 1.6 mg/day, 1.7 mg/day, 1.8 mg/day, 1.9 mg/day, 2.0 mg/day, 2.1 mg/day, 2.2 mg/day, 2.3 mg/day, 2.4 mg/day, 2.5 mg/day, 2.6 mg/day, 2.7 mg/day, 2.8 mg/day, 2.9 mg/day, and 3.0 mg/day.
- TCR-CD3 saturation is less than 50%, the dose is increased each day until the coating/saturation target is reached. Once the target has been reached, the dosing is followed for 5 days but for a maximum total course of treatment not to exceed 8 days.
- the anti-CD3 antibody formulation is administered via intravenous (iv) infusion.
- the iv infusion is continuous infusion over a time frame between 30 minutes and 3 hours, and more preferably between 1 hour and 2 hours.
- the anti-CD3 antibody formulation is administered via continuous iv infusion for 2 hours each day.
- the length of time of continuous iv infusion is directly related to the dosage of formulation administered and the volume of the iv bag. Calculating the necessary time for continuous infusion for a given dosage level and bag volume is within the ordinary skill in the art.
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Medicinal Chemistry (AREA)
- Life Sciences & Earth Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Organic Chemistry (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Epidemiology (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Dermatology (AREA)
- Pain & Pain Management (AREA)
- Rheumatology (AREA)
- Transplantation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Medicinal Preparation (AREA)
Priority Applications (9)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CA002625815A CA2625815A1 (en) | 2005-09-12 | 2006-09-12 | Anti-cd3 antibody formulations |
| BRPI0615745-9A BRPI0615745A2 (pt) | 2005-09-12 | 2006-09-12 | formulação de anticorpo anti-cd3 |
| EA200800812A EA014025B1 (ru) | 2005-09-12 | 2006-09-12 | Композиции антитела против cd3 |
| US11/991,811 US20100209437A1 (en) | 2005-09-12 | 2006-09-12 | Anti-CD3 Antibody Fromulations |
| EP06790218A EP1933868A2 (en) | 2005-09-12 | 2006-09-12 | Anti-cd3 antibody formulations |
| AU2006291005A AU2006291005A1 (en) | 2005-09-12 | 2006-09-12 | Anti-CD3 antibody formulations |
| JP2008530034A JP2009507838A (ja) | 2005-09-12 | 2006-09-12 | 抗cd3抗体製剤 |
| IL189876A IL189876A0 (en) | 2005-09-12 | 2008-03-02 | Pharmaceutical formulations containing anti-cd3 antibody |
| NO20081124A NO20081124L (no) | 2005-09-12 | 2008-03-04 | Anti-CD 3 antistoff-formuleringer |
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US71631105P | 2005-09-12 | 2005-09-12 | |
| US60/716,311 | 2005-09-12 |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| WO2007033230A2 true WO2007033230A2 (en) | 2007-03-22 |
| WO2007033230A3 WO2007033230A3 (en) | 2007-09-13 |
Family
ID=37865544
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/US2006/035615 Ceased WO2007033230A2 (en) | 2005-09-12 | 2006-09-12 | Anti-cd3 antibody formulations |
Country Status (16)
| Country | Link |
|---|---|
| US (2) | US20100209437A1 (https=) |
| EP (2) | EP2354162A1 (https=) |
| JP (1) | JP2009507838A (https=) |
| KR (1) | KR20080042905A (https=) |
| CN (1) | CN101309703A (https=) |
| AR (1) | AR057807A1 (https=) |
| AU (1) | AU2006291005A1 (https=) |
| BR (1) | BRPI0615745A2 (https=) |
| CA (1) | CA2625815A1 (https=) |
| EA (1) | EA014025B1 (https=) |
| IL (1) | IL189876A0 (https=) |
| NO (1) | NO20081124L (https=) |
| SG (1) | SG174779A1 (https=) |
| UA (1) | UA92505C2 (https=) |
| WO (1) | WO2007033230A2 (https=) |
| ZA (1) | ZA200802051B (https=) |
Cited By (74)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| WO2008119566A3 (en) * | 2007-04-03 | 2009-01-08 | Micromet Ag | Cross-species-specific bispecific binders |
| WO2009005673A1 (en) * | 2007-06-28 | 2009-01-08 | Schering Corporation | Anti-igf1r |
| WO2008119567A3 (en) * | 2007-04-03 | 2009-01-08 | Micromet Ag | Cross-species-specific cd3-epsilon binding domain |
| WO2008119565A3 (en) * | 2007-04-03 | 2009-01-08 | Micromet Ag | Cross-species-specific binding domain |
| WO2010132872A1 (en) * | 2009-05-15 | 2010-11-18 | Novimmune S.A | Combination therapies and methods using anti-cd3 modulating agents and anti-tnf antagonists |
| WO2011121110A1 (en) | 2010-04-01 | 2011-10-06 | Micromet Ag | CROSS-SPECIES-SPECIFIC PSMAxCD3 BISPECIFIC SINGLE CHAIN ANTIBODY |
| WO2012098238A1 (en) | 2011-01-21 | 2012-07-26 | Novimmune S.A. | Combination therapies and methods using anti-cd3 modulating agents and anti-il-6 antagonists |
| US20120207749A1 (en) * | 2011-02-07 | 2012-08-16 | Glaxo Group Limited | Dosing regimen |
| WO2013073968A3 (en) * | 2011-09-12 | 2013-06-20 | Industrial Research Limited | Agents for modulation of cell signalling |
| RU2535992C2 (ru) * | 2007-04-03 | 2014-12-20 | Эмджен Рисерч (Мьюник) Гмбх | Биспецифические связывающие агенты с межвидовой специфичностью |
| JP2016007217A (ja) * | 2008-10-01 | 2016-01-18 | アムゲン リサーチ (ミュンヘン) ゲーエムベーハー | PSCA×CD3、CD19×CD3、C−MET×CD3、エンドシアリン×CD3、EpCAM×CD3、IGF−1R×CD3、またはFAPアルファ×CD3の異種間特異的二重特異性単鎖抗体 |
| EP2968535A2 (en) * | 2013-03-15 | 2016-01-20 | Glaxosmithkline Intellectual Property (No. 2) Limited | Low concentration antibody formulations |
| EP3106468A1 (en) | 2008-10-01 | 2016-12-21 | Amgen Research (Munich) GmbH | Cross-species-specific psmaxcd3 bispecific single chain antibody |
| WO2018044948A1 (en) * | 2016-08-29 | 2018-03-08 | Tiziana Life Sciences Plc | Anti-cd3 antibody formulations |
| EP3375790A1 (en) | 2008-10-01 | 2018-09-19 | Amgen Research (Munich) GmbH | Cross-species-specific single domain bispecific single chain antibody |
| US10106624B2 (en) | 2013-03-15 | 2018-10-23 | Xencor, Inc. | Heterodimeric proteins |
| US10131710B2 (en) | 2013-01-14 | 2018-11-20 | Xencor, Inc. | Optimized antibody variable regions |
| US10227410B2 (en) | 2015-12-07 | 2019-03-12 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and PSMA |
| US10259887B2 (en) | 2014-11-26 | 2019-04-16 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
| US10287364B2 (en) | 2013-03-15 | 2019-05-14 | Xencor, Inc. | Heterodimeric proteins |
| US10316088B2 (en) | 2016-06-28 | 2019-06-11 | Xencor, Inc. | Heterodimeric antibodies that bind somatostatin receptor 2 |
| US10428155B2 (en) | 2014-12-22 | 2019-10-01 | Xencor, Inc. | Trispecific antibodies |
| US10472427B2 (en) | 2013-01-14 | 2019-11-12 | Xencor, Inc. | Heterodimeric proteins |
| US10487155B2 (en) | 2013-01-14 | 2019-11-26 | Xencor, Inc. | Heterodimeric proteins |
| US10501543B2 (en) | 2016-10-14 | 2019-12-10 | Xencor, Inc. | IL15/IL15Rα heterodimeric Fc-fusion proteins |
| US10544187B2 (en) | 2013-03-15 | 2020-01-28 | Xencor, Inc. | Targeting regulatory T cells with heterodimeric proteins |
| WO2020076992A1 (en) | 2018-10-11 | 2020-04-16 | Inhibrx, Inc. | 5t4 single domain antibodies and therapeutic compositions thereof |
| WO2020076977A2 (en) | 2018-10-11 | 2020-04-16 | Inhibrx, Inc. | Dll3 single domain antibodies and therapeutic compositions thereof |
| WO2020076970A1 (en) | 2018-10-11 | 2020-04-16 | Inhibrx, Inc. | B7h3 single domain antibodies and therapeutic compositions thereof |
| WO2020077257A1 (en) | 2018-10-11 | 2020-04-16 | Inhibrx, Inc. | Pd-1 single domain antibodies and therapeutic compositions thereof |
| US10669337B2 (en) | 2014-07-25 | 2020-06-02 | Cytomx Therapeutics, Inc. | Bispecific anti-CD3 antibodies, bispecific activatable anti-CD3 antibodies, and methods of using the same |
| US10738133B2 (en) | 2013-01-14 | 2020-08-11 | Xencor, Inc. | Heterodimeric proteins |
| US10787518B2 (en) | 2016-06-14 | 2020-09-29 | Xencor, Inc. | Bispecific checkpoint inhibitor antibodies |
| US10793632B2 (en) | 2016-08-30 | 2020-10-06 | Xencor, Inc. | Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors |
| US10851178B2 (en) | 2011-10-10 | 2020-12-01 | Xencor, Inc. | Heterodimeric human IgG1 polypeptides with isoelectric point modifications |
| US10889653B2 (en) | 2014-11-26 | 2021-01-12 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
| WO2021006199A1 (ja) | 2019-07-05 | 2021-01-14 | 小野薬品工業株式会社 | Pd-1/cd3二重特異性タンパク質による血液がん治療 |
| US10981992B2 (en) | 2017-11-08 | 2021-04-20 | Xencor, Inc. | Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors |
| US10982006B2 (en) | 2018-04-04 | 2021-04-20 | Xencor, Inc. | Heterodimeric antibodies that bind fibroblast activation protein |
| WO2021097186A1 (en) | 2019-11-13 | 2021-05-20 | Amunix Pharmaceuticals, Inc. | Barcoded xten polypeptides and compositions thereof, and methods for making and using the same |
| US11053316B2 (en) | 2013-01-14 | 2021-07-06 | Xencor, Inc. | Optimized antibody variable regions |
| US11084863B2 (en) | 2017-06-30 | 2021-08-10 | Xencor, Inc. | Targeted heterodimeric Fc fusion proteins containing IL-15 IL-15alpha and antigen binding domains |
| US11161906B2 (en) | 2013-07-25 | 2021-11-02 | Cytomx Therapeutics, Inc. | Multispecific antibodies, multispecific activatable antibodies and methods of using the same |
| US11312770B2 (en) | 2017-11-08 | 2022-04-26 | Xencor, Inc. | Bispecific and monospecific antibodies using novel anti-PD-1 sequences |
| US11319355B2 (en) | 2017-12-19 | 2022-05-03 | Xencor, Inc. | Engineered IL-2 Fc fusion proteins |
| US11358999B2 (en) | 2018-10-03 | 2022-06-14 | Xencor, Inc. | IL-12 heterodimeric Fc-fusion proteins |
| US11427826B2 (en) | 2017-08-11 | 2022-08-30 | City of Hopw | RNA aptamers against transferrin receptor (TfR) |
| US11472890B2 (en) | 2019-03-01 | 2022-10-18 | Xencor, Inc. | Heterodimeric antibodies that bind ENPP3 and CD3 |
| WO2022221767A1 (en) * | 2021-04-16 | 2022-10-20 | Tiziana Life Sciences Plc | Subcutaneous administration of antibodies for the treatment of disease |
| US11505595B2 (en) | 2018-04-18 | 2022-11-22 | Xencor, Inc. | TIM-3 targeted heterodimeric fusion proteins containing IL-15/IL-15RA Fc-fusion proteins and TIM-3 antigen binding domains |
| US11524991B2 (en) | 2018-04-18 | 2022-12-13 | Xencor, Inc. | PD-1 targeted heterodimeric fusion proteins containing IL-15/IL-15Ra Fc-fusion proteins and PD-1 antigen binding domains and uses thereof |
| EP4129327A1 (en) | 2015-08-28 | 2023-02-08 | Amunix Pharmaceuticals, Inc. | Chimeric polypeptide assembly and methods of making and using the same |
| US11591401B2 (en) | 2020-08-19 | 2023-02-28 | Xencor, Inc. | Anti-CD28 compositions |
| EP4172179A1 (en) | 2020-06-25 | 2023-05-03 | Amunix Pharmaceuticals, Inc. | Her-2 targeted bispecific compositions and methods for making and using the same |
| US11739148B2 (en) | 2015-07-10 | 2023-08-29 | Merus N.V. | Human CD3 binding antibody |
| US11739144B2 (en) | 2021-03-09 | 2023-08-29 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and CLDN6 |
| US11814423B2 (en) | 2013-03-15 | 2023-11-14 | Xencor, Inc. | Heterodimeric proteins |
| US11840579B2 (en) | 2014-03-28 | 2023-12-12 | Xencor, Inc. | Bispecific antibodies that bind to CD38 and CD3 |
| US11859012B2 (en) | 2021-03-10 | 2024-01-02 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and GPC3 |
| US11919956B2 (en) | 2020-05-14 | 2024-03-05 | Xencor, Inc. | Heterodimeric antibodies that bind prostate specific membrane antigen (PSMA) and CD3 |
| US12060418B2 (en) | 2012-09-27 | 2024-08-13 | Merus N.V. | Bispecific IgG antibodies as T cell engagers |
| WO2024168279A2 (en) | 2023-02-10 | 2024-08-15 | Amunix Pharmaceuticals, Inc. | Compositions targeting prostate-specific membrane antigen (psma) and methods for making and using the same |
| US12122850B2 (en) | 2022-03-14 | 2024-10-22 | LamKap Bio gamma AG | Bispecific GPC3xCD28 and GPC3xCD3 antibodies and their combination for targeted killing of GPC3 positive malignant cells |
| WO2024220397A1 (en) | 2023-04-17 | 2024-10-24 | Amunix Pharmaceuticals, Inc. | Compositions targeting epidermal growth factor receptor and methods for making and using the same |
| US12129309B2 (en) | 2014-11-26 | 2024-10-29 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and CD38 |
| WO2025029019A1 (ko) | 2023-07-31 | 2025-02-06 | 한국과학기술원 | 종양 침투 t세포의 종양 내 다클론성 증식을 통한 재조합 면역세포 기반 암 치료용 세포 치료제 |
| US12281176B2 (en) | 2011-11-15 | 2025-04-22 | Amgen Inc. | Binding molecules for BCMA and CD3 |
| WO2025193146A1 (en) | 2024-03-13 | 2025-09-18 | Berg Thoren Fredrik | Trail receptor binding molecules |
| WO2025199352A2 (en) | 2024-03-20 | 2025-09-25 | Juno Therapeutics, Inc. | Antibodies specific for solute carrier family 34 member 2 (slc34a2) |
| US12466897B2 (en) | 2011-10-10 | 2025-11-11 | Xencor, Inc. | Heterodimeric human IgG1 polypeptides with isoelectric point modifications |
| WO2025240670A2 (en) | 2024-05-15 | 2025-11-20 | Abalytics Oncology, Inc. | Anti-pd-1 antibodies and related binding molecules and methods and uses thereof |
| US12479929B2 (en) | 2010-11-30 | 2025-11-25 | Chugai Seiyaku Kabushiki Kaisha | Cytotoxicity-inducing therapeutic agent |
| WO2026024863A2 (en) | 2024-07-24 | 2026-01-29 | Amunix Pharmaceuticals, Inc. | Compositions targeting prostate-specific membrane antigen (psma) in combination with androgen receptor antagonists |
| US12617815B2 (en) | 2020-11-13 | 2026-05-05 | Amunix Pharmaceuticals, Inc. | Barcoded XTEN polypeptides and compositions thereof, and methods for making and using the same |
Families Citing this family (39)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2173163A4 (en) * | 2007-07-06 | 2010-12-08 | Glaxosmithkline Llc | ANTIBODY FORMULATIONS |
| WO2009111889A1 (en) * | 2008-03-13 | 2009-09-17 | The Hospital For Sick Children | Lymphocyte control of obesity and insulin resistance |
| CA2778334A1 (en) * | 2009-10-20 | 2011-04-28 | Charlotte Mckee | Anti-cd3 antibody dosing in autoimmune disease |
| NZ602685A (en) | 2010-03-01 | 2014-10-31 | Cytodyn Inc | Concentrated protein formulations and uses thereof |
| EP2683735A1 (en) | 2011-03-10 | 2014-01-15 | HCO Antibody, Inc. | Bispecific three-chain antibody-like molecules |
| KR102060389B1 (ko) | 2011-05-21 | 2019-12-31 | 마크로제닉스, 인크. | 사람 및 비-사람 cd3에 결합할 수 있는 cd3-결합 분자 |
| UA115789C2 (uk) | 2012-09-05 | 2017-12-26 | Трейкон Фармасутікалз, Інк. | Композиція антитіла до cd105 та її застосування |
| UA117466C2 (uk) | 2012-12-13 | 2018-08-10 | Мерк Шарп Енд Доме Корп. | СТАБІЛЬНИЙ СКЛАД У ВИГЛЯДІ РОЗЧИНУ АНТИТІЛА ДО IL-23p19 |
| JP6594855B2 (ja) * | 2013-03-15 | 2019-10-23 | ゼンコア インコーポレイテッド | ヘテロ二量体タンパク質 |
| EP3415534A1 (en) * | 2013-05-10 | 2018-12-19 | Numab Therapeutics AG | Bispecific constructs and their use in the treatment of various diseases |
| WO2016001810A1 (en) | 2014-07-01 | 2016-01-07 | Pfizer Inc. | Bispecific heterodimeric diabodies and uses thereof |
| CA2966905A1 (en) | 2014-11-12 | 2016-05-19 | Tracon Pharmaceuticals, Inc. | Anti-endoglin antibodies and uses thereof |
| KR20250175345A (ko) | 2016-06-21 | 2025-12-16 | 테네오바이오, 인코포레이티드 | Cd3 결합 항체 |
| PE20241349A1 (es) | 2016-09-14 | 2024-07-03 | Teneobio Inc | Anticuerpos de union a cd3 |
| WO2018106945A1 (en) | 2016-12-07 | 2018-06-14 | Progenity Inc. | Gastrointestinal tract detection methods, devices and systems |
| IL317134A (en) | 2016-12-21 | 2025-01-01 | Teneobio Inc | An antibody containing only heavy chains that binds a human B-cell maturation antigen, a pharmaceutical composition containing the same, its use in the treatment of B-cell disorders and a method for its preparation |
| WO2018183929A1 (en) | 2017-03-30 | 2018-10-04 | Progenity Inc. | Treatment of a disease of the gastrointestinal tract with an immune modulatory agent released using an ingestible device |
| JOP20190260A1 (ar) | 2017-05-02 | 2019-10-31 | Merck Sharp & Dohme | صيغ ثابتة لأجسام مضادة لمستقبل الموت المبرمج 1 (pd-1) وطرق استخدامها |
| JP7382232B2 (ja) | 2017-05-02 | 2023-11-16 | メルク・シャープ・アンド・ドーム・エルエルシー | 抗lag3抗体の製剤および抗lag3抗体と抗pd-1抗体との共製剤 |
| AU2018269370B2 (en) | 2017-05-16 | 2025-06-05 | The Johns Hopkins University | Manabodies and methods of using |
| EP3634478A4 (en) * | 2017-06-06 | 2021-03-24 | The Brigham and Women's Hospital, Inc. | METHOD OF SUPPRESSION OF MICROGLIA ACTIVATION |
| CN110945026B (zh) | 2017-06-20 | 2024-03-19 | 特纳奥尼股份有限公司 | 仅有重链的抗bcma抗体 |
| KR20250007003A (ko) | 2017-06-20 | 2025-01-13 | 테네오바이오, 인코포레이티드 | 항-bcma 중쇄-단독 항체 |
| JP2021508479A (ja) | 2017-12-27 | 2021-03-11 | テネオバイオ, インコーポレイテッド | ヘテロ二量体特異的抗体上のcd3デルタ及びcd3イプシロン |
| WO2019246312A1 (en) | 2018-06-20 | 2019-12-26 | Progenity, Inc. | Treatment of a disease of the gastrointestinal tract with an immunomodulator |
| WO2019246317A1 (en) | 2018-06-20 | 2019-12-26 | Progenity, Inc. | Treatment of a disease or condition in a tissue originating from the endoderm |
| WO2020081408A1 (en) | 2018-10-18 | 2020-04-23 | Merck Sharp & Dohme Corp. | Formulations of anti-rsv antibodies and methods of use thereof |
| MX2021004928A (es) | 2018-10-31 | 2021-06-08 | Merck Sharp & Dohme Llc | Cristales de anticuerpo anti-pd-1 humano y metodos de uso de los mismos. |
| EP3876990A4 (en) | 2018-11-07 | 2023-09-06 | Merck Sharp & Dohme LLC | CO-FORMULATIONS OF ANTI-LAG3 ANTIBODIES AND ANTI-PD-1 ANTIBODIES |
| EP3883635A1 (en) | 2018-11-19 | 2021-09-29 | Progenity, Inc. | Methods and devices for treating a disease with biotherapeutics |
| KR20210096640A (ko) * | 2018-11-29 | 2021-08-05 | 하버 바이오메드 테라푸틱스 리미티드 | 항-pd-l1 항체 제제 |
| WO2020206330A1 (en) | 2019-04-05 | 2020-10-08 | Teneobio, Inc. | Heavy chain antibodies binding to psma |
| WO2020232247A1 (en) | 2019-05-14 | 2020-11-19 | Provention Bio, Inc. | Methods and compositions for preventing type 1 diabetes |
| CR20210622A (es) | 2019-06-14 | 2022-06-27 | Teneobio Inc | Anticuerpos multiespecíficos de cadena pesada que se unen a cd22 y cd3 |
| CN115666704B (zh) | 2019-12-13 | 2025-09-26 | 比特比德科有限责任公司 | 用于将治疗剂递送至胃肠道的可摄取装置 |
| IL297601A (en) | 2020-04-29 | 2022-12-01 | Teneobio Inc | Multispecific heavy chain antibodies with modified heavy chain constant regions |
| MX2022013797A (es) | 2020-05-08 | 2022-11-30 | Genmab As | Anticuerpos biespecificos contra cd3 y cd20. |
| IL298999A (en) | 2020-06-11 | 2023-02-01 | Provention Bio Inc | Methods and compositions for the prevention of type 1 diabetes |
| JP2024520444A (ja) | 2021-05-24 | 2024-05-24 | プロヴェンション・バイオ・インコーポレイテッド | 1型糖尿病を治療するための方法 |
Family Cites Families (35)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6025477A (en) * | 1986-03-31 | 2000-02-15 | Calenoff; Emanuel | Atherosclerotic plaque specific antigens, antibodies thereto, and uses thereof |
| JP3101690B2 (ja) * | 1987-03-18 | 2000-10-23 | エス・ビィ・2・インコーポレイテッド | 変性抗体の、または変性抗体に関する改良 |
| GB8823869D0 (en) * | 1988-10-12 | 1988-11-16 | Medical Res Council | Production of antibodies |
| US5530101A (en) * | 1988-12-28 | 1996-06-25 | Protein Design Labs, Inc. | Humanized immunoglobulins |
| WO1991006319A1 (en) * | 1989-10-27 | 1991-05-16 | Arch Development Corporation | Methods and compositions for promoting immunopotentiation |
| US6406696B1 (en) * | 1989-10-27 | 2002-06-18 | Tolerance Therapeutics, Inc. | Methods of stimulating the immune system with anti-CD3 antibodies |
| US6750325B1 (en) * | 1989-12-21 | 2004-06-15 | Celltech R&D Limited | CD3 specific recombinant antibody |
| US6150584A (en) * | 1990-01-12 | 2000-11-21 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| US6075181A (en) * | 1990-01-12 | 2000-06-13 | Abgenix, Inc. | Human antibodies derived from immunized xenomice |
| PT1024191E (pt) * | 1991-12-02 | 2008-12-22 | Medical Res Council | Produção de auto-anticorpos a partir de reportórios de segmentos de anticorpo e exibidos em fagos |
| US5777085A (en) * | 1991-12-20 | 1998-07-07 | Protein Design Labs, Inc. | Humanized antibodies reactive with GPIIB/IIIA |
| ATE208374T1 (de) * | 1992-02-18 | 2001-11-15 | Otsuka Kagaku Kk | Beta-laktam und cepham verbindungen und ihre herstellung |
| US5714350A (en) * | 1992-03-09 | 1998-02-03 | Protein Design Labs, Inc. | Increasing antibody affinity by altering glycosylation in the immunoglobulin variable region |
| GB9206422D0 (en) * | 1992-03-24 | 1992-05-06 | Bolt Sarah L | Antibody preparation |
| JPH05320072A (ja) * | 1992-05-20 | 1993-12-03 | Taiho Yakuhin Kogyo Kk | 虚血性脳疾患治療薬 |
| US6491916B1 (en) * | 1994-06-01 | 2002-12-10 | Tolerance Therapeutics, Inc. | Methods and materials for modulation of the immunosuppresive activity and toxicity of monoclonal antibodies |
| US5885573A (en) * | 1993-06-01 | 1999-03-23 | Arch Development Corporation | Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies |
| US20030108548A1 (en) * | 1993-06-01 | 2003-06-12 | Bluestone Jeffrey A. | Methods and materials for modulation of the immunosuppressive activity and toxicity of monoclonal antibodies |
| US5834597A (en) * | 1996-05-20 | 1998-11-10 | Protein Design Labs, Inc. | Mutated nonactivating IgG2 domains and anti CD3 antibodies incorporating the same |
| US7041289B1 (en) * | 1997-12-05 | 2006-05-09 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Method for treating established spontaneous auto-immune diseases in mammals |
| WO2001047554A1 (fr) * | 1999-12-28 | 2001-07-05 | Chugai Seiyaku Kabushiki Kaisha | Compositions d'anticorps stables et preparations pour injection |
| IL161677A0 (en) * | 2001-11-08 | 2004-09-27 | Protein Design Labs | Stable liquid pharmaceutical formulation of igg antibodies |
| CN101721362B (zh) * | 2002-02-14 | 2018-07-03 | 中外制药株式会社 | 包含抗体的溶液制剂 |
| US20030216551A1 (en) * | 2002-03-08 | 2003-11-20 | Diabetogen Biosciences Inc. | Fully human anti-CD3 monoclonal antibodies |
| US20030235583A1 (en) | 2002-06-14 | 2003-12-25 | Jeppe Sturis | Combined use of a modulator of CD3 and a beta cell resting compound |
| US20040037826A1 (en) | 2002-06-14 | 2004-02-26 | Michelsen Birgitte Koch | Combined use of a modulator of CD3 and a GLP-1 compound |
| US20070224191A1 (en) * | 2002-12-05 | 2007-09-27 | Pdl Biopharma, Inc. | Methods of treatment of Ulcerative Colitis and Crohn's disease with anti-CD3 antibodies |
| US20040253237A1 (en) * | 2002-12-05 | 2004-12-16 | Ian Walters | Methods of treatment of ulcerative colitis with anti-CD3 antibodies |
| DK2236154T3 (en) * | 2003-02-10 | 2018-06-25 | Biogen Ma Inc | IMMUNOGLOBULIN INFORMATION AND METHOD OF PREPARING IT |
| KR101235507B1 (ko) * | 2003-02-28 | 2013-02-20 | 추가이 세이야쿠 가부시키가이샤 | 단백질을 함유하는 안정화 제제 |
| EP1725254A4 (en) * | 2004-02-04 | 2008-02-13 | Univ Columbia | ANTI-CD3 IMMUNOTHERAPY AND SPECIFIC ANTIGENS FOR THE TREATMENT OF AUTOIMMUNITY |
| CA2569509C (en) * | 2004-06-03 | 2014-08-12 | Novimmune S.A. | Anti-cd3 antibodies and methods of use thereof |
| WO2007009064A2 (en) * | 2005-07-11 | 2007-01-18 | Macrogenics, Inc. | Methods for the treatment of autoimmune disorders using immunosuppressive monoclonal antibodies with reduced toxicity |
| US20070190052A1 (en) * | 2005-09-14 | 2007-08-16 | The Trustees Of Columbia University In The City Of New York | Regulatory CD8cells induced with anti-CD3 antibody |
| SG177907A1 (en) * | 2006-06-14 | 2012-02-28 | Macrogenics Inc | Methods for the treatment of autoimmune disorders using immunosuppressive monoclonal antibodies with reduced toxicity |
-
2006
- 2006-09-12 CN CNA2006800334114A patent/CN101309703A/zh active Pending
- 2006-09-12 EP EP10184453A patent/EP2354162A1/en not_active Withdrawn
- 2006-09-12 KR KR1020087007421A patent/KR20080042905A/ko not_active Ceased
- 2006-09-12 JP JP2008530034A patent/JP2009507838A/ja active Pending
- 2006-09-12 EA EA200800812A patent/EA014025B1/ru not_active IP Right Cessation
- 2006-09-12 UA UAA200803005A patent/UA92505C2/ru unknown
- 2006-09-12 EP EP06790218A patent/EP1933868A2/en not_active Withdrawn
- 2006-09-12 US US11/991,811 patent/US20100209437A1/en not_active Abandoned
- 2006-09-12 AU AU2006291005A patent/AU2006291005A1/en not_active Abandoned
- 2006-09-12 BR BRPI0615745-9A patent/BRPI0615745A2/pt not_active Application Discontinuation
- 2006-09-12 SG SG2011064219A patent/SG174779A1/en unknown
- 2006-09-12 AR ARP060103968A patent/AR057807A1/es unknown
- 2006-09-12 US US11/520,312 patent/US20070065437A1/en not_active Abandoned
- 2006-09-12 CA CA002625815A patent/CA2625815A1/en not_active Abandoned
- 2006-09-12 WO PCT/US2006/035615 patent/WO2007033230A2/en not_active Ceased
-
2008
- 2008-03-02 IL IL189876A patent/IL189876A0/en unknown
- 2008-03-04 ZA ZA200802051A patent/ZA200802051B/xx unknown
- 2008-03-04 NO NO20081124A patent/NO20081124L/no not_active Application Discontinuation
Cited By (136)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101687915B8 (zh) * | 2007-04-03 | 2018-08-03 | 安进研发(慕尼黑)股份有限公司 | 跨物种特异性CD3-ε结合结构域 |
| RU2769948C2 (ru) * | 2007-04-03 | 2022-04-11 | Эмджен Рисерч (Мьюник) Гмбх | CD3-Эпсилон-связывающий домен с межвидовой специфичностью |
| WO2008119567A3 (en) * | 2007-04-03 | 2009-01-08 | Micromet Ag | Cross-species-specific cd3-epsilon binding domain |
| WO2008119565A3 (en) * | 2007-04-03 | 2009-01-08 | Micromet Ag | Cross-species-specific binding domain |
| KR20100016199A (ko) * | 2007-04-03 | 2010-02-12 | 마이크로메트 에이지 | 종간 특이적 이중특이적인 결합제들 |
| KR20100016206A (ko) * | 2007-04-03 | 2010-02-12 | 마이크로메트 에이지 | 종간 특이적 cd3―입실론 결합 도메인 |
| US20100150918A1 (en) * | 2007-04-03 | 2010-06-17 | Micromet Ag | Cross-species-specific binding domain |
| CN109456410B (zh) * | 2007-04-03 | 2022-01-28 | 安进研发(慕尼黑)股份有限公司 | 跨物种特异性CD3-ε结合结构域 |
| EP2520590A3 (en) * | 2007-04-03 | 2013-04-17 | Amgen Research (Munich) GmbH | Cross-species-specific binding domain |
| EP2155783B2 (en) † | 2007-04-03 | 2022-10-19 | Amgen Research (Munich) GmbH | Cross-species-specific cd3-epsilon binding domain |
| CN101687915B (zh) * | 2007-04-03 | 2017-02-08 | 安进研发(慕尼黑)股份有限公司 | 跨物种特异性CD3‑ε结合结构域 |
| KR101773696B1 (ko) | 2007-04-03 | 2017-08-31 | 암젠 리서치 (뮌헨) 게엠베하 | 종간 특이적 cd3―입실론 결합 도메인 |
| WO2008119566A3 (en) * | 2007-04-03 | 2009-01-08 | Micromet Ag | Cross-species-specific bispecific binders |
| CN101675077B (zh) * | 2007-04-03 | 2013-09-04 | 安进研发(慕尼黑)股份有限公司 | 跨种特异性的双特异性结合剂 |
| RU2535992C2 (ru) * | 2007-04-03 | 2014-12-20 | Эмджен Рисерч (Мьюник) Гмбх | Биспецифические связывающие агенты с межвидовой специфичностью |
| CN109456410A (zh) * | 2007-04-03 | 2019-03-12 | 安进研发(慕尼黑)股份有限公司 | 跨物种特异性CD3-ε结合结构域 |
| RU2561457C2 (ru) * | 2007-04-03 | 2015-08-27 | Эмджен Рисерч (Мьюник) Гмбх | Cd3-эпсилон-связывающий домен с межвидовой специфичностью |
| CN103694350B (zh) * | 2007-04-03 | 2018-04-24 | 安进研发(慕尼黑)股份有限公司 | 跨物种特异性CD3-ε结合结构域 |
| KR20170102032A (ko) * | 2007-04-03 | 2017-09-06 | 암젠 리서치 (뮌헨) 게엠베하 | 종간 특이적 cd3―입실론 결합 도메인 |
| KR101589759B1 (ko) | 2007-04-03 | 2016-01-29 | 암젠 리서치 (뮌헨) 게엠베하 | 종간 특이적 cd3―입실론 결합 도메인 |
| KR101626988B1 (ko) | 2007-04-03 | 2016-06-02 | 암젠 리서치 (뮌헨) 게엠베하 | 종간 특이적 이중특이적인 결합제들 |
| KR101940944B1 (ko) | 2007-04-03 | 2019-01-22 | 암젠 리서치 (뮌헨) 게엠베하 | 종간 특이적 cd3―입실론 결합 도메인 |
| WO2009005673A1 (en) * | 2007-06-28 | 2009-01-08 | Schering Corporation | Anti-igf1r |
| EP3106468A1 (en) | 2008-10-01 | 2016-12-21 | Amgen Research (Munich) GmbH | Cross-species-specific psmaxcd3 bispecific single chain antibody |
| EP4180458A1 (en) | 2008-10-01 | 2023-05-17 | Amgen Research (Munich) GmbH | Cross-species-specific psma x cd3 bispecific single chain antibody |
| US11472886B2 (en) | 2008-10-01 | 2022-10-18 | Amgen Research (Munich) Gmbh | Cross-species-specific PSMAxCD3 bispecific single chain antibody |
| JP2016007217A (ja) * | 2008-10-01 | 2016-01-18 | アムゲン リサーチ (ミュンヘン) ゲーエムベーハー | PSCA×CD3、CD19×CD3、C−MET×CD3、エンドシアリン×CD3、EpCAM×CD3、IGF−1R×CD3、またはFAPアルファ×CD3の異種間特異的二重特異性単鎖抗体 |
| US12281172B2 (en) | 2008-10-01 | 2025-04-22 | Amgen Research (Munich) Gmbh | Cross-species-specific PSMAxCD3 bispecific single chain antibody |
| EP3375790A1 (en) | 2008-10-01 | 2018-09-19 | Amgen Research (Munich) GmbH | Cross-species-specific single domain bispecific single chain antibody |
| WO2010132872A1 (en) * | 2009-05-15 | 2010-11-18 | Novimmune S.A | Combination therapies and methods using anti-cd3 modulating agents and anti-tnf antagonists |
| WO2011121110A1 (en) | 2010-04-01 | 2011-10-06 | Micromet Ag | CROSS-SPECIES-SPECIFIC PSMAxCD3 BISPECIFIC SINGLE CHAIN ANTIBODY |
| US12522669B2 (en) | 2010-11-30 | 2026-01-13 | Chugai Seiyaku Kabushiki Kaisha | Cytotoxicity-inducing therapeutic agent |
| US12479929B2 (en) | 2010-11-30 | 2025-11-25 | Chugai Seiyaku Kabushiki Kaisha | Cytotoxicity-inducing therapeutic agent |
| WO2012098238A1 (en) | 2011-01-21 | 2012-07-26 | Novimmune S.A. | Combination therapies and methods using anti-cd3 modulating agents and anti-il-6 antagonists |
| US8974782B2 (en) * | 2011-02-07 | 2015-03-10 | Glaxo Group Limited | Treatment of stroke comprising anti-MAG antibodies |
| US20120207749A1 (en) * | 2011-02-07 | 2012-08-16 | Glaxo Group Limited | Dosing regimen |
| WO2013073968A3 (en) * | 2011-09-12 | 2013-06-20 | Industrial Research Limited | Agents for modulation of cell signalling |
| US12466897B2 (en) | 2011-10-10 | 2025-11-11 | Xencor, Inc. | Heterodimeric human IgG1 polypeptides with isoelectric point modifications |
| US10851178B2 (en) | 2011-10-10 | 2020-12-01 | Xencor, Inc. | Heterodimeric human IgG1 polypeptides with isoelectric point modifications |
| US12281176B2 (en) | 2011-11-15 | 2025-04-22 | Amgen Inc. | Binding molecules for BCMA and CD3 |
| US12281175B2 (en) | 2011-11-15 | 2025-04-22 | Amgen Inc. | Binding molecules for BCMA and CD3 |
| US12060418B2 (en) | 2012-09-27 | 2024-08-13 | Merus N.V. | Bispecific IgG antibodies as T cell engagers |
| US11718667B2 (en) | 2013-01-14 | 2023-08-08 | Xencor, Inc. | Optimized antibody variable regions |
| US10472427B2 (en) | 2013-01-14 | 2019-11-12 | Xencor, Inc. | Heterodimeric proteins |
| US10487155B2 (en) | 2013-01-14 | 2019-11-26 | Xencor, Inc. | Heterodimeric proteins |
| US11634506B2 (en) | 2013-01-14 | 2023-04-25 | Xencor, Inc. | Heterodimeric proteins |
| US10131710B2 (en) | 2013-01-14 | 2018-11-20 | Xencor, Inc. | Optimized antibody variable regions |
| US10738133B2 (en) | 2013-01-14 | 2020-08-11 | Xencor, Inc. | Heterodimeric proteins |
| US11053316B2 (en) | 2013-01-14 | 2021-07-06 | Xencor, Inc. | Optimized antibody variable regions |
| US11299554B2 (en) | 2013-03-15 | 2022-04-12 | Xencor, Inc. | Heterodimeric proteins |
| US10544187B2 (en) | 2013-03-15 | 2020-01-28 | Xencor, Inc. | Targeting regulatory T cells with heterodimeric proteins |
| EP2968535A2 (en) * | 2013-03-15 | 2016-01-20 | Glaxosmithkline Intellectual Property (No. 2) Limited | Low concentration antibody formulations |
| US10537638B2 (en) | 2013-03-15 | 2020-01-21 | Glaxosmithkline Intellectual Property (No.2) Limited | Low concentration antibody formulations |
| US10106624B2 (en) | 2013-03-15 | 2018-10-23 | Xencor, Inc. | Heterodimeric proteins |
| US11814423B2 (en) | 2013-03-15 | 2023-11-14 | Xencor, Inc. | Heterodimeric proteins |
| EP3686217A1 (en) * | 2013-03-15 | 2020-07-29 | GlaxoSmithKline Intellectual Property (No.2) Limited | Low concentration antibody formulations |
| US12415849B2 (en) | 2013-03-15 | 2025-09-16 | Xencor, Inc. | Heterodimeric proteins |
| US10287364B2 (en) | 2013-03-15 | 2019-05-14 | Xencor, Inc. | Heterodimeric proteins |
| US11161906B2 (en) | 2013-07-25 | 2021-11-02 | Cytomx Therapeutics, Inc. | Multispecific antibodies, multispecific activatable antibodies and methods of using the same |
| US11840579B2 (en) | 2014-03-28 | 2023-12-12 | Xencor, Inc. | Bispecific antibodies that bind to CD38 and CD3 |
| US11802158B2 (en) | 2014-07-25 | 2023-10-31 | Cytomx Therapeutics, Inc. | Bispecific anti-CD3 antibodies, bispecific activatable anti-CD3 antibodies, and methods of using the same |
| US10669337B2 (en) | 2014-07-25 | 2020-06-02 | Cytomx Therapeutics, Inc. | Bispecific anti-CD3 antibodies, bispecific activatable anti-CD3 antibodies, and methods of using the same |
| US11945880B2 (en) | 2014-11-26 | 2024-04-02 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
| US12129309B2 (en) | 2014-11-26 | 2024-10-29 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and CD38 |
| US11673972B2 (en) | 2014-11-26 | 2023-06-13 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
| US11225528B2 (en) | 2014-11-26 | 2022-01-18 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
| US11859011B2 (en) | 2014-11-26 | 2024-01-02 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
| US10889653B2 (en) | 2014-11-26 | 2021-01-12 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
| US12359002B2 (en) | 2014-11-26 | 2025-07-15 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
| US10259887B2 (en) | 2014-11-26 | 2019-04-16 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and tumor antigens |
| US10428155B2 (en) | 2014-12-22 | 2019-10-01 | Xencor, Inc. | Trispecific antibodies |
| US11739148B2 (en) | 2015-07-10 | 2023-08-29 | Merus N.V. | Human CD3 binding antibody |
| US11713358B2 (en) | 2015-08-28 | 2023-08-01 | Amunix Pharmaceuticals, Inc. | Chimeric polypeptide assembly and methods of making and using the same |
| US11981744B2 (en) | 2015-08-28 | 2024-05-14 | Amunix Pharmaceuticals, Inc. | Chimeric polypeptide assembly and methods of making and using the same |
| EP4129327A1 (en) | 2015-08-28 | 2023-02-08 | Amunix Pharmaceuticals, Inc. | Chimeric polypeptide assembly and methods of making and using the same |
| US10227410B2 (en) | 2015-12-07 | 2019-03-12 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and PSMA |
| US11623957B2 (en) | 2015-12-07 | 2023-04-11 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and PSMA |
| US11236170B2 (en) | 2016-06-14 | 2022-02-01 | Xencor, Inc. | Bispecific checkpoint inhibitor antibodies |
| US11492407B2 (en) | 2016-06-14 | 2022-11-08 | Xencor, Inc. | Bispecific checkpoint inhibitor antibodies |
| US10787518B2 (en) | 2016-06-14 | 2020-09-29 | Xencor, Inc. | Bispecific checkpoint inhibitor antibodies |
| US12054545B2 (en) | 2016-06-28 | 2024-08-06 | Xencor, Inc. | Heterodimeric antibodies that bind somatostatin receptor 2 |
| US10316088B2 (en) | 2016-06-28 | 2019-06-11 | Xencor, Inc. | Heterodimeric antibodies that bind somatostatin receptor 2 |
| US11225521B2 (en) | 2016-06-28 | 2022-01-18 | Xencor, Inc. | Heterodimeric antibodies that bind somatostatin receptor 2 |
| EP4406554A3 (en) * | 2016-08-29 | 2024-10-30 | Tiziana Life Sciences PLC | Anti-cd3 antibody formulations |
| IL264502B2 (en) * | 2016-08-29 | 2023-09-01 | Tiziana Life Sciences Plc | Anti-cd3 antibody formulations |
| IL264502B1 (en) * | 2016-08-29 | 2023-05-01 | Tiziana Life Sciences Plc | Anti-cd3 antibody formulations |
| US10688186B2 (en) | 2016-08-29 | 2020-06-23 | Tiziana Life Sciences Plc | Anti-CD3 antibody formulations |
| IL301948B2 (en) * | 2016-08-29 | 2024-09-01 | Tiziana Life Sciences Plc | Anti-cd3 antibody formulations |
| AU2017319318B2 (en) * | 2016-08-29 | 2024-09-19 | Tiziana Life Sciences Plc | Anti-CD3 antibody formulations |
| IL301948B1 (en) * | 2016-08-29 | 2024-05-01 | Tiziana Life Sciences Plc | Anti-CD3 antibody formulations |
| WO2018044948A1 (en) * | 2016-08-29 | 2018-03-08 | Tiziana Life Sciences Plc | Anti-cd3 antibody formulations |
| US10793632B2 (en) | 2016-08-30 | 2020-10-06 | Xencor, Inc. | Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors |
| US10550185B2 (en) | 2016-10-14 | 2020-02-04 | Xencor, Inc. | Bispecific heterodimeric fusion proteins containing IL-15-IL-15Rα Fc-fusion proteins and PD-1 antibody fragments |
| US10501543B2 (en) | 2016-10-14 | 2019-12-10 | Xencor, Inc. | IL15/IL15Rα heterodimeric Fc-fusion proteins |
| US11084863B2 (en) | 2017-06-30 | 2021-08-10 | Xencor, Inc. | Targeted heterodimeric Fc fusion proteins containing IL-15 IL-15alpha and antigen binding domains |
| US11427826B2 (en) | 2017-08-11 | 2022-08-30 | City of Hopw | RNA aptamers against transferrin receptor (TfR) |
| US12152076B2 (en) | 2017-11-08 | 2024-11-26 | Xencor, Inc. | Bispecific and monospecific antibodies using novel anti-PD-1 sequences |
| US10981992B2 (en) | 2017-11-08 | 2021-04-20 | Xencor, Inc. | Bispecific immunomodulatory antibodies that bind costimulatory and checkpoint receptors |
| US11312770B2 (en) | 2017-11-08 | 2022-04-26 | Xencor, Inc. | Bispecific and monospecific antibodies using novel anti-PD-1 sequences |
| US11319355B2 (en) | 2017-12-19 | 2022-05-03 | Xencor, Inc. | Engineered IL-2 Fc fusion proteins |
| US12180302B2 (en) | 2018-04-04 | 2024-12-31 | Xencor, Inc. | Heterodimeric antibodies that bind fibroblast activation protein |
| US10982006B2 (en) | 2018-04-04 | 2021-04-20 | Xencor, Inc. | Heterodimeric antibodies that bind fibroblast activation protein |
| US11505595B2 (en) | 2018-04-18 | 2022-11-22 | Xencor, Inc. | TIM-3 targeted heterodimeric fusion proteins containing IL-15/IL-15RA Fc-fusion proteins and TIM-3 antigen binding domains |
| US11524991B2 (en) | 2018-04-18 | 2022-12-13 | Xencor, Inc. | PD-1 targeted heterodimeric fusion proteins containing IL-15/IL-15Ra Fc-fusion proteins and PD-1 antigen binding domains and uses thereof |
| US11358999B2 (en) | 2018-10-03 | 2022-06-14 | Xencor, Inc. | IL-12 heterodimeric Fc-fusion proteins |
| US12365728B2 (en) | 2018-10-11 | 2025-07-22 | Inhibrx Biosciences, Inc. | DLL3 single domain antibodies and therapeutic compositions thereof |
| US11208485B2 (en) | 2018-10-11 | 2021-12-28 | Inhibrx, Inc. | PD-1 single domain antibodies and therapeutic compositions thereof |
| WO2020077257A1 (en) | 2018-10-11 | 2020-04-16 | Inhibrx, Inc. | Pd-1 single domain antibodies and therapeutic compositions thereof |
| WO2020076977A2 (en) | 2018-10-11 | 2020-04-16 | Inhibrx, Inc. | Dll3 single domain antibodies and therapeutic compositions thereof |
| WO2020076992A1 (en) | 2018-10-11 | 2020-04-16 | Inhibrx, Inc. | 5t4 single domain antibodies and therapeutic compositions thereof |
| US12590169B2 (en) | 2018-10-11 | 2026-03-31 | Inhibrx Biosciences, Inc. | 5T4 single domain antibodies and therapeutic compositions thereof |
| WO2020076970A1 (en) | 2018-10-11 | 2020-04-16 | Inhibrx, Inc. | B7h3 single domain antibodies and therapeutic compositions thereof |
| US12297271B2 (en) | 2018-10-11 | 2025-05-13 | Inhibrx Biosciences, Inc. | PD-1 single domain antibodies and therapeutic compositions thereof |
| US11945869B2 (en) | 2018-10-11 | 2024-04-02 | Inhibrx, Inc. | PD-1 single domain antibodies and therapeutic compositions thereof |
| US11472890B2 (en) | 2019-03-01 | 2022-10-18 | Xencor, Inc. | Heterodimeric antibodies that bind ENPP3 and CD3 |
| WO2021006199A1 (ja) | 2019-07-05 | 2021-01-14 | 小野薬品工業株式会社 | Pd-1/cd3二重特異性タンパク質による血液がん治療 |
| WO2021097186A1 (en) | 2019-11-13 | 2021-05-20 | Amunix Pharmaceuticals, Inc. | Barcoded xten polypeptides and compositions thereof, and methods for making and using the same |
| US11919956B2 (en) | 2020-05-14 | 2024-03-05 | Xencor, Inc. | Heterodimeric antibodies that bind prostate specific membrane antigen (PSMA) and CD3 |
| US12404329B2 (en) | 2020-05-14 | 2025-09-02 | Xencor, Inc. | Heterodimeric antibodies that bind prostate specific membrane antigen (PSMA) and CD3 |
| EP4172179A1 (en) | 2020-06-25 | 2023-05-03 | Amunix Pharmaceuticals, Inc. | Her-2 targeted bispecific compositions and methods for making and using the same |
| US12215156B2 (en) | 2020-06-25 | 2025-02-04 | Amunix Pharmaceuticals, Inc. | HER-2 targeted bispecific compositions and methods for making and using the same |
| US11919958B2 (en) | 2020-08-19 | 2024-03-05 | Xencor, Inc. | Anti-CD28 compositions |
| US11591401B2 (en) | 2020-08-19 | 2023-02-28 | Xencor, Inc. | Anti-CD28 compositions |
| US12617815B2 (en) | 2020-11-13 | 2026-05-05 | Amunix Pharmaceuticals, Inc. | Barcoded XTEN polypeptides and compositions thereof, and methods for making and using the same |
| US11739144B2 (en) | 2021-03-09 | 2023-08-29 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and CLDN6 |
| US12398207B2 (en) | 2021-03-09 | 2025-08-26 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and CLDN6 |
| US11859012B2 (en) | 2021-03-10 | 2024-01-02 | Xencor, Inc. | Heterodimeric antibodies that bind CD3 and GPC3 |
| WO2022221767A1 (en) * | 2021-04-16 | 2022-10-20 | Tiziana Life Sciences Plc | Subcutaneous administration of antibodies for the treatment of disease |
| US12122850B2 (en) | 2022-03-14 | 2024-10-22 | LamKap Bio gamma AG | Bispecific GPC3xCD28 and GPC3xCD3 antibodies and their combination for targeted killing of GPC3 positive malignant cells |
| WO2024168279A2 (en) | 2023-02-10 | 2024-08-15 | Amunix Pharmaceuticals, Inc. | Compositions targeting prostate-specific membrane antigen (psma) and methods for making and using the same |
| WO2024220397A1 (en) | 2023-04-17 | 2024-10-24 | Amunix Pharmaceuticals, Inc. | Compositions targeting epidermal growth factor receptor and methods for making and using the same |
| WO2025029019A1 (ko) | 2023-07-31 | 2025-02-06 | 한국과학기술원 | 종양 침투 t세포의 종양 내 다클론성 증식을 통한 재조합 면역세포 기반 암 치료용 세포 치료제 |
| WO2025193146A1 (en) | 2024-03-13 | 2025-09-18 | Berg Thoren Fredrik | Trail receptor binding molecules |
| WO2025199352A2 (en) | 2024-03-20 | 2025-09-25 | Juno Therapeutics, Inc. | Antibodies specific for solute carrier family 34 member 2 (slc34a2) |
| WO2025240670A2 (en) | 2024-05-15 | 2025-11-20 | Abalytics Oncology, Inc. | Anti-pd-1 antibodies and related binding molecules and methods and uses thereof |
| WO2026024863A2 (en) | 2024-07-24 | 2026-01-29 | Amunix Pharmaceuticals, Inc. | Compositions targeting prostate-specific membrane antigen (psma) in combination with androgen receptor antagonists |
Also Published As
| Publication number | Publication date |
|---|---|
| KR20080042905A (ko) | 2008-05-15 |
| SG174779A1 (en) | 2011-10-28 |
| AR057807A1 (es) | 2007-12-19 |
| EP2354162A1 (en) | 2011-08-10 |
| UA92505C2 (ru) | 2010-11-10 |
| NO20081124L (no) | 2008-05-22 |
| AU2006291005A1 (en) | 2007-03-22 |
| CN101309703A (zh) | 2008-11-19 |
| EA014025B1 (ru) | 2010-08-30 |
| BRPI0615745A2 (pt) | 2011-05-24 |
| US20100209437A1 (en) | 2010-08-19 |
| US20070065437A1 (en) | 2007-03-22 |
| EA200800812A1 (ru) | 2008-08-29 |
| ZA200802051B (en) | 2008-12-31 |
| EP1933868A2 (en) | 2008-06-25 |
| CA2625815A1 (en) | 2007-03-22 |
| IL189876A0 (en) | 2008-11-03 |
| WO2007033230A3 (en) | 2007-09-13 |
| JP2009507838A (ja) | 2009-02-26 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| WO2007033230A2 (en) | Anti-cd3 antibody formulations | |
| JP7461401B2 (ja) | 抗-cd3抗体製剤 | |
| JP7766392B2 (ja) | 治療用抗cd40リガンド抗体 | |
| AU2013334740A1 (en) | Stable, low viscosity antibody formulation | |
| EA031436B1 (ru) | Водная фармацевтическая композиция, содержащий ее предварительно заполненный шприц и применение композиции в лечении аутоиммунных заболеваний | |
| IL302516A (en) | FCRN antibodies and methods of using them | |
| CN108513615A (zh) | 结合人大麻素1(cb1)受体的抗体 | |
| WO2010132872A1 (en) | Combination therapies and methods using anti-cd3 modulating agents and anti-tnf antagonists | |
| US12617859B2 (en) | Therapeutic anti-CD40 ligand antibodies | |
| WO2023218100A1 (en) | Nasal formulations of foralumab | |
| CN116782939A (zh) | FcRn抗体及其使用方法 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| WWE | Wipo information: entry into national phase |
Ref document number: 200680033411.4 Country of ref document: CN |
|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application | ||
| WWE | Wipo information: entry into national phase |
Ref document number: 189876 Country of ref document: IL |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 930/KOLNP/2008 Country of ref document: IN |
|
| ENP | Entry into the national phase |
Ref document number: 2625815 Country of ref document: CA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2008530034 Country of ref document: JP |
|
| WWE | Wipo information: entry into national phase |
Ref document number: MX/a/2008/003483 Country of ref document: MX |
|
| NENP | Non-entry into the national phase |
Ref country code: DE |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006291005 Country of ref document: AU |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 1020087007421 Country of ref document: KR |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 2006790218 Country of ref document: EP |
|
| ENP | Entry into the national phase |
Ref document number: 2006291005 Country of ref document: AU Date of ref document: 20060912 Kind code of ref document: A |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 200800812 Country of ref document: EA |
|
| WWE | Wipo information: entry into national phase |
Ref document number: 11991811 Country of ref document: US |
|
| ENP | Entry into the national phase |
Ref document number: PI0615745 Country of ref document: BR Kind code of ref document: A2 Effective date: 20080312 |