WO2005044306A2 - Use of antagonist anti-cd40 antibodies for treatment of autoimmune and inflammatory diseases and organ transplant rejection - Google Patents

Use of antagonist anti-cd40 antibodies for treatment of autoimmune and inflammatory diseases and organ transplant rejection Download PDF

Info

Publication number
WO2005044306A2
WO2005044306A2 PCT/US2004/036957 US2004036957W WO2005044306A2 WO 2005044306 A2 WO2005044306 A2 WO 2005044306A2 US 2004036957 W US2004036957 W US 2004036957W WO 2005044306 A2 WO2005044306 A2 WO 2005044306A2
Authority
WO
WIPO (PCT)
Prior art keywords
seq
monoclonal antibody
antibody
sequence shown
chir
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/US2004/036957
Other languages
English (en)
French (fr)
Other versions
WO2005044306A3 (en
Inventor
Li Long
Mohammad Luqman
Asha Yabannavar
Isabel Zaror
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novartis Vaccines and Diagnostics Inc
Original Assignee
Chiron Corp
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=34577667&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO2005044306(A2) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to DE602004028505T priority Critical patent/DE602004028505D1/de
Priority to SI200431525T priority patent/SI1694360T1/sl
Priority to AU2004287482A priority patent/AU2004287482B2/en
Priority to KR1020067010894A priority patent/KR101125127B1/ko
Priority to AT04810420T priority patent/ATE476448T1/de
Priority to HK07102192.5A priority patent/HK1095091B/en
Priority to PL04810420T priority patent/PL1694360T3/pl
Priority to EP04810420A priority patent/EP1694360B1/en
Priority to CN200480037489.4A priority patent/CN1938045B/zh
Application filed by Chiron Corp filed Critical Chiron Corp
Priority to CA2544853A priority patent/CA2544853C/en
Priority to DK04810420.2T priority patent/DK1694360T3/da
Priority to JP2006538513A priority patent/JP4746552B2/ja
Publication of WO2005044306A2 publication Critical patent/WO2005044306A2/en
Publication of WO2005044306A3 publication Critical patent/WO2005044306A3/en
Anticipated expiration legal-status Critical
Priority to US11/932,472 priority patent/US8277810B2/en
Priority to US13/612,070 priority patent/US8637032B2/en
Priority to US14/134,339 priority patent/US20140205602A1/en
Priority to US15/241,136 priority patent/US20170081416A1/en
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2878Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the NGF-receptor/TNF-receptor superfamily, e.g. CD27, CD30, CD40, CD95
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/19Cytokines; Lymphokines; Interferons
    • A61K38/20Interleukins [IL]
    • A61K38/2013IL-2
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/395Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
    • A61K39/39533Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
    • A61K39/39558Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against tumor tissues, cells, antigens
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/04Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P11/00Drugs for disorders of the respiratory system
    • A61P11/06Antiasthmatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P13/00Drugs for disorders of the urinary system
    • A61P13/12Drugs for disorders of the urinary system of the kidneys
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00Drugs for dermatological disorders
    • A61P17/06Antipsoriatics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/02Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P19/00Drugs for skeletal disorders
    • A61P19/06Antigout agents, e.g. antihyperuricemic or uricosuric agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P21/00Drugs for disorders of the muscular or neuromuscular system
    • A61P21/04Drugs for disorders of the muscular or neuromuscular system for myasthenia gravis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/02Drugs for disorders of the nervous system for peripheral neuropathies
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P25/00Drugs for disorders of the nervous system
    • A61P25/28Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P33/00Antiparasitic agents
    • A61P33/02Antiprotozoals, e.g. for leishmaniasis, trichomoniasis, toxoplasmosis
    • A61P33/06Antimalarials
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • A61P35/02Antineoplastic agents specific for leukemia
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/02Immunomodulators
    • A61P37/06Immunosuppressants, e.g. drugs for graft rejection
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00Drugs for immunological or allergic disorders
    • A61P37/08Antiallergic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P43/00Drugs for specific purposes, not provided for in groups A61P1/00-A61P41/00
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/02Antithrombotic agents; Anticoagulants; Platelet aggregation inhibitors
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/04Antihaemorrhagics; Procoagulants; Haemostatic agents; Antifibrinolytic agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P7/00Drugs for disorders of the blood or the extracellular fluid
    • A61P7/06Antianaemics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/10Drugs for disorders of the cardiovascular system for treating ischaemic or atherosclerotic diseases, e.g. antianginal drugs, coronary vasodilators, drugs for myocardial infarction, retinopathy, cerebrovascula insufficiency, renal arteriosclerosis
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P9/00Drugs for disorders of the cardiovascular system
    • A61P9/14Vasoprotectives; Antihaemorrhoidals; Drugs for varicose therapy; Capillary stabilisers
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K2039/505Medicinal preparations containing antigens or antibodies comprising antibodies
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/21Immunoglobulins specific features characterized by taxonomic origin from primates, e.g. man
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/30Immunoglobulins specific features characterized by aspects of specificity or valency
    • C07K2317/34Identification of a linear epitope shorter than 20 amino acid residues or of a conformational epitope defined by amino acid residues
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/73Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
    • C07K2317/732Antibody-dependent cellular cytotoxicity [ADCC]
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/70Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
    • C07K2317/76Antagonist effect on antigen, e.g. neutralization or inhibition of binding
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/90Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
    • C07K2317/92Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value

Definitions

  • the invention relates to methods for treatment of autoimmune and inflammatory diseases using antagonist anti-CD40 monoclonal antibodies.
  • CD40 is a 55 kDa cell-surface antigen present on the surface of normal and neoplastic human B cells, dendritic cells, other antigen presenting cells (APCs), endothelial cells, monocytic cells, CD8 + T cells, and epithelial cells.
  • the CD40 antigen is also expressed on activated T cells, activated platelets, inflamed vascular smooth muscle cells, eosinophils, synovial membranes in rheumatoid arthritis, dermal fibroblasts, and other non-lymphoid cell types.
  • ligation can induce intercellular adhesion, differentiation, activation, and proliferation.
  • CD40L also designated CD 154
  • binding of CD40 to its cognate ligand, CD40L stimulates B-cell proliferation and differentiation into plasma cells, antibody production, isotype switching, and B-cell memory generation.
  • CD40 is expressed on pre-B cells but lost upon differentiation into plasma cells.
  • the CD40 ligand has been identified on the cell surface of activated T cells (Fenslow et al. (1992) J. Immunol. 149:655; Lane et al. (1992) Eur. J. Immunol. 22:2573; Noelle et al. (1992) Proc. Natl. Acad. Sci. USA 89:6550), but is not generally expressed on resting human T cells.
  • CD40L is a type-II transmembrane glycoprotein with homology to TNF- ⁇ (Armitage et al. (1992) Nature 357:80 and Spriggs et al. (1992) J. Exp. Med. 176:1543).
  • the extracellular domain of CD40L contains two arginine residues proximal to the transmembrane region, providing a potential proteolytic cleavage site that gives rise to a soluble form ofthe ligand (sCD40L).
  • sCD40L soluble form ofthe ligand
  • Overexpression of CD40L causes autoimmune diseases similar to systemic lupus erythromatosus in rodent models (Higuchi et al. (2002) J. Immunol. 168:9-12).
  • CD40 expression on APCs plays an important co-stimulatory role in the activation of these cells.
  • agonistic anti-CD40 monoclonal antibodies n Abs have been shown to mimic the effects of T helper cells in B-cell activation.
  • agonistic anti-CD40 mAbs can replace the T helper signal for secretion of IgM, IgG, and IgE in the presence of IL-4 (Gascan et al. (1991) J Immunol. 147:8).
  • agonistic anti-CD40 mAbs can prevent programmed cell death (apoptosis) of B cells isolated from lymph nodes.
  • CD40 signal transduction pathway depends on the coordinated regulation of many intracellular factors.
  • CD40 reacts with TRAF proteins (TNF receptor factor-associated proteins) such as TRAF2 and TRAF3, which mediate an intracellular signal following engagement of CD40 with CD40L (either solid phase CD40L or soluble CD40L).
  • TRAF proteins TRAF proteins (TNF receptor factor-associated proteins)
  • TRAF2 and TRAF3 TRAF proteins
  • CD40L either solid phase CD40L or soluble CD40L.
  • the TRAFs transduce a signal into the nucleus via map kinases such as NIK (NF- ⁇ B inducing kinase) and I-kappa B kinases (IKK oc/ ⁇ ), ultimately activating the transcription factor NF-KB (Young et al.
  • CD40 cell signaling includes PI3K/Akt pathway and P38 MAPK pathway (Craxton et al. (1998) J. Immunol. 5:439-447). Signaling via CD40 has been shown to prevent cell death from apoptosis (Makus et al. (2002) J. Immunol. 14:973-982). Apoptotic signals are necessary to induce programmed cell death in a coordinated manner.
  • Cell death signals can include intrinsic stimuli from within the cell such as endoplasmic reticulum stress or extrinsic stimuli such as receptor binding of FasL or TNF ⁇ .
  • the signaling pathway is complex, involving activation of caspases such as caspase 3 and 9, and of poly (ADP ribose) polymerase (PARP).
  • caspases such as caspase 3 and 9
  • PARP poly (ADP ribose) polymerase
  • anti-apoptotic signaling proteins such as Mcl-1 and BCLx
  • members of the IAP-family proteins such as X-Linked Inhibitor of Apoptosis
  • CD40 cell signaling can block apoptosis signals transduced by FasL (Bjorck et /. (1997) Int'l Immunol. 9:365-372).
  • FasL Bjorck et /. (1997) Int'l Immunol. 9:365-372).
  • CD40 engagement by CD40L and subsequent activation of CD40 signaling are necessary steps for normal immune responses; however, dysregulation of CD40 signaling can lead to disease.
  • the CD40 signaling pathway has been shown to be involved autoimmune disease (Ichikawa et al. (2002) J. Immunol. 169:2781-7 and Moore et al. (2002) J.
  • CD40/CD40L interaction plays an important role in inflammatory processes.
  • both CD40 and CD40 ligand are overexpressed in human and experimental atherosclerosis lesions.
  • CD40 stimulation induces expression of matrix-degrading enzymes and tissue factor expression in atheroma-associated cell types, such as endothelial cells, smooth muscle cells, and macrophages.
  • CD40 stimulation induces production of proinflammatory cytokines such as IL-1, IL-6, and IL-8, and adhesion molecules such as ICAM-1, E- selectin, and VCAM.
  • Inhibition of CD40/CD40L interaction prevents atherogenesis in animal models. In transplant models, blocking CD40/CD40L interaction prevents inflammation.
  • CD40/CD40L binding acts synergistically with the Alzheimer amyloid-beta peptide to promote microglial activation, thus leading to neurotoxicity.
  • RA rheumatoid arthritis
  • CD40 expression is increased on articular chondro cytes, thus, CD40 signaling likely contributes to production of damaging cytokines and matrix metalloproteinases. See, Gotoh et al. (2004) J. Rheumatol. 31:1506-12.
  • amplification ofthe synovial inflammatory response occurs through activation of mitogen-activated protein (MAP) kinases and nuclear factor kappaB (NFKB) via ligation of CD40 on CD14 + synovial cells from RA patients (Harigai et al. (2004) Arthritis. Rheum. 50:2167-77).
  • MAP mitogen-activated protein
  • NFKB nuclear factor kappaB
  • anti-CD40L antibody treatment prevented disease induction, joint inflammation, and anti-collagen antibody production (Durie et al. (1993) Science 261:1328).
  • RITUXAN® generally indicated for B cell lymphoma
  • Methods for treating a human subject with an autoimmune disease and/or inflammatory disease, comprising administering to the subject an anti-CD40 antibody or an antigen-binding fragment thereof that is free of significant agonist activity when bound to a CD40 antigen on a human CD40-expressing cell.
  • Methods for inhibiting the response of cells expressing CD40 antigen are also provided.
  • Suitable antagonist anti-CD40 antibodies for use in the methods ofthe present invention have a strong affinity for CD40. These monoclonal antibodies and antigen-binding fragments thereof are capable of specifically binding to human CD40 antigen expressed on the surface of a human cell. They are free of significant agonist activity but exhibit antagonist activity when bound to CD40 antigen on human cells.
  • the anti-CD40 antibody or fragment thereof exhibits antagonist activity when bound to CD40 antigen on antigen presenting cells such as B cells.
  • the antagonist antibodies are especially useful in preventing, ameliorating, or treating diseases comprising an autoimmune and/or inflammatory component.
  • diseases include but are not limited to autoimmune and inflammatory diseases such as systemic lupus erythematosus (SLE), discoid lupus, lupus nephritis, sarcoidosis, inflammatory arthritis, including, but not limited to, juvenile arthritis, rheumatoid arthritis, psoriatic arthritis, Reiter's syndrome, ankylosing spondylitis, and gouty arthritis, rejection of an organ or tissue transplant, hyperacute, acute, or chronic rejection and/or graft versus host disease, multiple sclerosis, hyper IgE syndrome, polyarteritis nodosa, primary biliary cirrhosis, inflammatory bowel disease, Crohn's disease, celia
  • Figure 1 sets forth the amino acid sequences for the light and heavy chains ofthe niAb CHIR-12.12.
  • the leader (residues 1-20 of SEQ ID NO:2), variable (residues 21- 132 of SEQ ID NO:2), and constant (residues 133-239 of SEQ ID NO:2) regions ofthe light chain are shown in Figure IA.
  • the leader (residues 1-19 of SEQ ID NO:4), variable (residues 20-139 of SEQ ID NO:4), and constant (residues 140-469 of SEQ ID NO:4) regions ofthe heavy chain are shown in Figure IB.
  • the alternative constant region for the heavy chain ofthe mAb CHIR-12.12 shown in Figure IB reflects a substitution of a serine residue for the alanine residue at position 153 of SEQ ID NO:4.
  • the complete sequence for this variant ofthe heavy chain ofthe mAb CHIR-12.12 is set forth in SEQ ID NO:5.
  • Figure 2 shows the coding sequence for the light chain (Figure 2A; SEQ ID NO:l) and heavy chain ( Figure 2B; SEQ ID NO:3) for the mAb CHIR-12.12.
  • Figure 3 sets forth the amino acid sequences for the light and heavy chains of mAb CHIR-5.9.
  • the leader (residues 1-20 of SEQ ID NO:6), variable (residues 21-132 of SEQ ID NO:6), and constant (residues 133-239 of SEQ ID NO:6) regions ofthe light chain are shown in Figure 3 A.
  • the leader (residues 1-19 of SEQ ID NO: 7), variable (residues 20-144 of SEQ ID NO:7), and constant (residues 145-474 of SEQ ID NO:7) regions o the heavy chain are shown in Figure 3B.
  • the alternative constant region for the heavy chain ofthe mAb CHIR-5.9 shown in Figure 3B reflects a substitution of a serine residue for the alanine residue at position 158 of SEQ ID NO:7.
  • the complete sequence for this variant ofthe heavy chain ofthe mAB CHIR-5.9 is set forth in SEQ ID NO:8.
  • Figure 4 shows the coding sequence ( Figure 4A; SEQ ID NO: 9) for the short isoform of human CD40 (amino acid sequence shown in Figure 4B; SEQ ID NO: 10), and the coding sequence (Figure 4C; SEQ ID NO: 11) for the long isoform of human CD40 (amino acid sequence shown in Figure 4D).
  • Figure 5 shows thermal melting temperature of CHIR-12.12 in different pH formulations measured by differential scanning calorimetry (DSC).
  • DSC differential scanning calorimetry
  • polypeptides ofthe latter kind are, for example, produced at low levels by the lymph system and at increased levels by myelomas.
  • antibody is used in the broadest sense and covers fully assembled antibodies, antibody fragments that can bind antigen (e.g., Fab', F'(ab) , Fv, single chain antibodies, diabodies), and recombinant peptides comprising the foregoing.
  • monoclonal antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts.
  • “Native antibodies” and “native immunoglobulins” are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (V H ) followed by a number of constant domains.
  • V H variable domain
  • Each light chain has a variable domain at one end (V L ) and a constant domain at its other end; the constant domain ofthe light chain is aligned with the first constant domain ofthe heavy chain, and the light chain variable domain is aligned with the variable domain ofthe heavy chain.
  • Particular amino acid residues are believed to form an interface between the light- and heavy-chain variable domains.
  • the term "variable” refers to the fact that certain portions ofthe variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called complementarity determining regions (CDRs) or hypervariable regions both in the light-chain and the heavy-chain variable domains.
  • CDRs complementarity determining regions
  • variable domains are celled the framework (FR) regions.
  • the variable domains of native heavy and light chains each comprise four FR regions, largely adopting a /3-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the /3-sheet structure.
  • the CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation ofthe antigen-binding site of antibodies (see Kabat et al. (1991) NIHPubl. No. 91-3242, Vol. I, pages 647-669).
  • the constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effecter functions, such as Fc receptor (FcR) binding, participation ofthe antibody in antibody-dependent cellular toxicity, opsonization, initiation of complement dependent cytotoxicity, and mast cell degranulation.
  • FcR Fc receptor
  • hypervariable region when used herein refers to the amino acid residues of an antibody that are responsible for antigen binding.
  • the hypervariable region comprises amino acid residues from a "complementarity determining region" or "CDR" (i.e., residues 24-34 (Ll), 50-56 (L2), and 89-97 (L3) in the light-chain variable domain and 31-35 (HI), 50-65 (H2), and 95-102 (H3) in the heavy-chain variable domain; Kabat et al.
  • CDR complementarity determining region
  • Antibody fragments comprise a portion of an intact antibody, preferably the antigen-binding or variable region ofthe intact antibody.
  • antibody fragments include Fab, Fab', F(ab')2, and Fv fragments; diabodies; linear antibodies (Zapata et al. (1995) Protein Eng. 8(10): 1057-1062); single-chain antibody molecules; and multispecific antibodies formed from antibody fragments.
  • Papain digestion of antibodies produces two identical antigen-binding fragments, called “Fab” fragments, each with a single antigen-binding site, and a residual "Fc” fragment, whose name reflects its ability to crystallize readily.
  • Fv is the minimum antibody fragment that contains a complete antigen recognition and binding site.
  • this region consists of a dimer of one heavy- and one light-chain variable domain in tight, non-covalent association, hi a single-chain Fv species, one heavy- and one light-chain variable domain can be covalently linked by flexible peptide linker such that the light and heavy chains can associate in a "dimeric" structure analogous to that in a two-chain Fv species.
  • variable domains interact to define an antigen- binding site on the surface ofthe VH-V L dimer.
  • the six CDRs confer antigen-binding specificity to the antibody.
  • a single variable domain or half of an Fv comprising only three CDRs specific for an antigen
  • the Fab fragment also contains the constant domain ofthe light chain and the first constant domain (C H I) ofthe heavy chain.
  • Fab fragments differ from Fab' fragments by the addition of a few residues at the carboxy terminus ofthe heavy-chain CHI domain including one or more cysteines from the antibody hinge region.
  • Fab'-SH is the designation herein for Fab' in which the cysteine residue(s) ofthe constant domains bear a free thiol group.
  • F(ab')2 antibody fragments originally were produced as pairs of Fab' fragments that have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
  • the "light chains" of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa (K) and lambda ( ⁇ ), based on the amino acid sequences of their constant domains. Depending on the amino acid sequence ofthe constant domain of their heavy chains, immunoglobulins can be assigned to different classes.
  • IgA immunoglobulins
  • IgD immunoglobulins
  • IgE immunoglobulins
  • IgG immunoglobulins
  • IgM immunoglobulins
  • label when used herein refers to a detectable compound or composition that is conjugated directly or indirectly to the antibody so as to generate a "labeled" antibody.
  • the label may be detectable by itself (e.g., radioisotope labels or fluorescent labels) or, in the case of an enzymatic label, may catalyze chemical alteration of a substrate compound or composition that is detectable.
  • antagonist is used in the broadest sense, and includes any molecule that partially or fully blocks, inhibits, or neutralizes a biological activity of a native target disclosed herein or the transcription or translation thereof.
  • Carriers as used herein include pharmaceutically acceptable carriers, excipients, or stabilizers that are nontoxic to the cell or mammal being exposed thereto at the dosages and concentrations employed. Often the physiologically acceptable carrier is an aqueous pH buffered solution.
  • physiologically acceptable carriers include buffers such as phosphate, citrate, succinate, and other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEEN, polyethylene glycol (PEG), and Pluronics.
  • buffers such as phosphate, citrate, succinate, and other organic acids
  • antioxidants including ascorbic acid
  • low molecular weight (less than about 10 residues) polypeptides proteins
  • a “host cell,” as used herein, refers to a microorganism or a eukaryotic cell or cell line cultured as a unicellular entity that can be, or has been, used as a recipient for a recombinant vector or other transfer polynucleotides, and include the progeny ofthe original cell that has been transfected. It is understood that the progeny of a single cell may not necessarily be completely identical in morphology or in genomic or total DNA complement as the original parent, due to natural, accidental, or deliberate mutation.
  • “Human effector cells” are leukocytes that express one or more FcRs and perform effector functions.
  • the cells express at least Fc ⁇ RIII and carry out antigen-dependent cell-mediated cyotoxicity (ADCC) effector function.
  • ADCC antigen- dependent cell-mediated cyotoxicity
  • human leukocytes that mediate ADCC include peripheral blood mononuclear cells (PBMC), natural killer (NK) cells, monocytes, macrophages, eosinophils, and neutrophils, with PBMCs and NK cells being preferred.
  • PBMCs and NK cells are preferred.
  • Antibodies that have ADCC activity are typically ofthe IgGl or IgG3 isotype.
  • ADCC-mediating antibodies can be made by engineering a variable region from a non-ADCC antibody or variable region fragment to an IgGl or IgG3 isotype constant region.
  • the terms "Fc receptor” or “FcR” are used to describe a receptor that binds to the Fc region of an antibody.
  • the preferred FcR is a native-sequence human FcR.
  • a preferred FcR is one that binds an IgG antibody (a gamma receptor) and includes receptors ofthe Fc ⁇ RI, Fc ⁇ RII, and FC7RIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
  • Fc ⁇ RII receptors include Fc ⁇ RIIA (anafib), Fc ⁇ RIIA (anethyl), Fc ⁇ RIIA, and FC7RIII subclasses, including allelic variants and alternatively spliced forms of these receptors.
  • Fc ⁇ RII receptors
  • activating receptor and Fc ⁇ RIIB (an “inhibiting receptor”), which have similar amino acid sequences that differ primarily in the cytoplasmic domains thereof.
  • Activating receptor Fc ⁇ RIIA contains an immunoreceptor tyrosine-based activation motif (IT AM) in its cytoplasmic domain.
  • Inhibiting receptor Fc ⁇ RIIB contains an immunoreceptor tyrosine-based inhibition motif (ITIM) in its cytoplasmic domain (see Daeron (1997) Annu. Rev. Immunol. 15:203-234).
  • ITIM immunoreceptor tyrosine-based inhibition motif
  • FcR neonatal receptor
  • FcRn neonatal receptor
  • secreting cells can be immortalized by infection with the Epstein-Barr virus (EBV).
  • EBV Epstein-Barr virus
  • transgenic animals e.g., mice
  • transgenic animals e.g., mice
  • transgenic animals that are capable, upon immunization, of producing a repertoire of human antibodies in the absence of endogenous immunoglobulin production
  • endogenous immunoglobulin production Jakobovits et al. (1993) Nature 362:255-258; Lonberg and Huszar (1995) Int. Rev. Immunol. 13:65-93; Fishwild et al. (1996) Nat. Biotechnol. 14:845-851; Mendez et al. (1997) Nat. Genet. 15:146-156; Green (1999) J. Immunol. Methods 231:11-23; Tomizuka et al. (2000) Proc. Natl. Acad. Sci.
  • mice that, when challenged with an antigen, generates high affinity fully human antibodies. This was achieved by germ-line integration of megabase human heavy-chain and light-chain loci into mice with deletion into endogenous JH segment as described above. These mice (XenoMouse II technology (Abgenix; Fremont, California)) harbor 1,020 kb of human heavy-chain locus containing approximately 66 V H genes, complete D H and JH regions, and three different constant regions, and also harbors 800 kb of human K locus containing 32 V/ genes, l ⁇ segments, and CK genes.
  • mice closely resemble that seen in humans in all respects, including gene rearrangement, assembly, and repertoire.
  • the human antibodies are preferentially expressed over endogenous antibodies due to deletion in endogenous segment that prevents gene rearrangement in the murine locus.
  • Such mice may be immunized with an antigen of particular interest. Sera from such immunized animals may be screened for antibody reactivity against the initial antigen.
  • Lymphocytes may be isolated from lymph nodes or spleen cells and may further be selected for B cells by selecting for CD138-negative and CD 19- positive cells, hi one aspect, such B cell cultures (BCCs) may be fused to myeloma cells to generate hybridomas as detailed above.
  • such B cell cultures may be screened further for reactivity against the initial antigen, preferably.
  • screening includes ELISA with the target/antigen protein, a competition assay with known antibodies that bind the antigen of interest, and in vitro binding to transiently transfected CHO or other cells that express the target antigen.
  • the present invention is directed to compositions and methods for treating human subjects having autoimmune diseases and or inflammatory diseases. The methods involve treatment with an anti-CD40 antibody described herein, or an antigen-binding fragment thereof, where administration ofthe antibody or antigen-binding fragment thereof promotes a positive therapeutic response within the subject undergoing this method of therapy.
  • autoimmune diseases such as systemic lupus erythematosus (SLE), discoid lupus, lupus nephritis, sarcoidosis, inflammatory arthritis, including juvenile arthritis, rheumatoid arthritis, psoriatic arthritis, Reiter's syndrome, ankylosing spondylitis, and gouty arthritis, rejection of an organ or tissue transplant, hyperacute, acute, or chronic rejection and/or graft versus host disease, multiple sclerosis, hyper IgE syndrome, polyarteritis nodosa, primary biliary cirrhosis, inflammatory bowel disease, Crohn's disease, celiac's disease (gluten-sensitive enteropathy), autoimmune hepatitis, pernicious anemia, autoimmune hemolytic anemia, psoriasis, scleroderma, myasthenia gravis, autoimmune thro
  • these antagonist anti-CD40 antibodies and antigen-binding fragments thereof are especially useful in treating diseases associated with inflammation, including, but not limited to, type 1, 2, 3, and 4 delayed-type hypersensitivity, allergy or allergic disorders, unwanted/unintended immune responses to therapeutic proteins (see for example, U.S. Patent Application No. US 2002/0119151 and Koren, et al. (2002) Curr. Pharm. Biotechnol. 3:349-60), asthma, Churg-Strauss syndrome (allergic granulomatosis), atopic dermatitis, allergic and irritant contact dermatitis, urtecaria, IgE-mediated allergy, atherosclerosis, vasculitis, idiopathic inflammatory myopathies, hemolytic disease,
  • Anti-CD40 antibodies suitable for use in the methods ofthe invention specifically bind a human CD40 antigen expressed on the surface of a human cell and are free of significant agonist activity, but exhibit antagonist activity when bound to the CD40 antigen on a human CD40-expressing cell.
  • anti-CD40 antibodies and antigen- binding fragments thereof are referred to herein as "antagonist anti-CD40 antibodies.”
  • Such antibodies include, but are not limited to, the fully human monoclonal antibodies CHIR-5.9 and CHIR-12.12 described below and monoclonal antibodies having the binding characteristics of monoclonal antibodies CHIR-5.9 and CHIR-12.12, also described below.
  • Antibodies that have the binding characteristics of monoclonal antibodies CHIR- 5.9 and CHIR-12.12 include antibodies that competitively interfere with binding CD40 and/or bind the same epitopes as CHIR-5.9 and CHIR-12.12.
  • One of skill in the art could determine whether an antibody competitively interferes with CHIR-5.9 or CHIR-12.12 using standard methods known in the art.
  • these antibodies bind CD40 displayed on the surface of human cells, such as, for example, human B cells, T cells, dendritic cells, endothelial cells, activated platelets, inflamed vascular smooth muscle cells, eosinophils, synovial membranes, dermal fibroblasts, and the like, the antibodies are free of significant agonist activity.
  • the antagonist anti-CD40 antibodies suitable for use in the methods ofthe invention include those monoclonal antibodies that can exhibit antagonist activity toward normal and abnormal human cells expressing the cell-surface CD40 antigen.
  • the monoclonal antibodies CHIR-5.9 and CHIR-12.12 represent suitable antagonist anti-CD40 antibodies for use in the methods ofthe present invention.
  • the monoclonal antibodies CHIR-5.9 and CHIR-12.12 represent suitable antagonist anti-CD40 antibodies for use in the methods ofthe present invention.
  • CHIR-5.9 and CHIR-12.12 antibodies are fully human anti-CD40 monoclonal antibodies ofthe IgGi isotype produced from the hybridoma cell lines 131.2F8.5.9 (referred to herein as the cell line 5.9) and 153.8E2.D10.D6.12.12 (referred to herein as the cell line 12.12). These cell lines were created using splenocytes from immunized xenotypic mice containing the human IgGi heavy chain locus and the human K chain locus
  • mice transgenic for human immunoglobulin loci were prepared similarly using mice transgenic for human immunoglobulin loci or by other methods known in the art and/or described herein.
  • nucleotide and amino acid sequences ofthe variable regions ofthe CHIR- 12.12 antibody, and the amino acid sequences ofthe variable regions ofthe CHIR-5.9 antibody are disclosed in copending provisional applications entitled “Antagonist Anti- CD40 Monoclonal Antibodies and Methods for Their Use,” filed November 4, 2003, November 26, 2003, and April 27, 2004, and assigned U.S. Patent Application Nos.
  • SEQ ID NO:2 complete sequence for the light chain of mAb CHIR-12.12
  • SEQ ID NO:4 complete sequence for the heavy chain for mAb CHIR-12.12
  • SEQ ID NO:5 complete sequence for a variant ofthe heavy chain for mAb CHIR-12.12 set forth in SEQ ID NO:4, where the variant comprises a serine substitution for the alanine residue at position 153 of SEQ ID NO:4.
  • the nucleotide sequences encoding the light chain and heavy chain for mAb CHIR-12.12 are set forth herein in Figures 2A and 2B, respectively.
  • SEQ ID NO:l coding sequence for the light chain for mAb CHIR-12.12
  • SEQ ID NO:3 coding sequence for the heavy chain for mAb CHIR-12.12
  • the amino acid sequences for the leader, variable, and constant regions for the light chain and heavy chain ofthe CHIR-5.9 mAb are set forth herein in Figures 3 A and 3B, respectively.
  • SEQ ID NO:6 complete sequence for the light chain of mAb CHIR-5.9
  • SEQ ID NO:7 complete sequence for the heavy chain of mAb CHIR-5.9
  • SEQ ID NO:8 complete sequence for a variant ofthe heavy chain of mAb CHIR-5.9 set forth in SEQ ID NO:7, where the variant comprises a serine substitution for the alanine residue at position 158 of SEQ ID NO:7).
  • hybridomas expressing CHIR-5.9 and CHIR-12.12 antibodies have been deposited with the ATCC with a patent deposit designation of PTA-5542 and PTA-5543, respectively.
  • the CHIR-5.9 and CHIR-12.12 monoclonal antibodies bind soluble CD40 in ELISA-type assays, prevent the binding of CD40-ligand to cell-surface CD40, and displace the pre-bound CD40-ligand, as determined by flow cytometric assays.
  • Antibodies CHIR-5.9 and CHIR-12.12 compete with each other for binding to CD40 but not with 15B8, the anti-CD40 monoclonal antibody described in U.S. Provisional Application Serial No. 60/237,556, titled "Human Anti-CD40 Antibodies " filed October 2, 2000, and PCT International Application No.
  • CHIR-5.9 and CHIR- 12.12 act as antagonistic anti-CD40 antibodies. Furthermore, CHIR-5.9 and CHIR-12.12 do not induce strong proliferation of human lymphocytes from normal subjects.
  • the binding affinity of CHIR-5.9 for human CD40 is 1.2xlO "8 M and the binding affinity of CHIR-12.12 is 5xl0 "10 M, as determined by the BiacoreTM assay.
  • Suitable antagonist anti-CD40 antibodies for use in the methods ofthe present invention exhibit a strong single-site binding affinity for the CD40 cell-surface antigen.
  • the monoclonal antibodies ofthe invention exhibit a dissociation equilibrium constant (K D ) for CD40 of at least 10 "5 M, at least 3 x 10 "5 M, preferably at least 10 "6 M to 10 "7 M, more preferably at least 10 "8 M to about 10 "12 M, measured using a standard assay such as BiacoreTM.
  • Biacore analysis is known in the art and details are provided in the "BIAapplications handbook.” Methods described in WO 01/27160 can be used to modulate the binding affinity.
  • CD40 antigen By “CD40 antigen,” “CD40 cell surface antigen,” “CD40 receptor,” or “CD40” is intended a transmembrane glycoprotein that belongs to the tumor necrosis factor (TNF) receptor family (see, for example, U.S. Patent Nos. 5,674,492 and 4,708,871; Stamenkovic et al. (1989) EMBO 8:1403; Clark (1990) Tissue Antigens 36:33; Barclay et al. (1997) The Leucocyte Antigen Facts Book (2d ed.; Academic Press, San Diego)). Two isoforms of human CD40, encoded by alternatively spliced transcript variants of this gene, have been identified.
  • TNF tumor necrosis factor
  • the first isoform (also known as the "long isoform” or “isoform 1”) is expressed as a 277-amino-acid precursor polypeptide (SEQ ID NO: 12 (first reported as GenBank Accession No. CAA43045, and identified as isoform 1 in GenBank Accession No. NP_001241), encoded by SEQ ID NO: 11 (see GenBank Accession Nos. X60592 and NM_001250)), which has a signal sequence represented by the first 19 residues.
  • the second isoform (also known as the "short isoform” or “isoform 2”) is expressed as a 203-amino-acid precursor polypeptide (SEQ ID NO: 10 (GenBank Accession No.
  • NP_690593 encoded by SEQ ID NO:9 (GenBank Accession No. NM_152854)), which also has a signal sequence represented by the first 19 residues.
  • the precursor polypeptides of these two isoforms of human CD40 share in common their first 165 residues (i.e., residues 1-165 of SEQ ID NO:10 and SEQ ID NO:12).
  • the precursor polypeptide ofthe short isoform (shown in SEQ ID NO: 10) is encoded by a transcript variant (SEQ ID NO:9) that lacks a coding segment, which leads to a translation frame shift; the resulting CD40 isoform contains a shorter and distinct C-terminus (residues 166-203 of SEQ ID NO: 10) from that contained in the long isoform of CD40 (C-terminus shown in residues 166-277 of SEQ ID NO: 12).
  • the term "CD40 antigen,” “CD40 cell surface antigen,” "CD40 receptor,” or "CD40” encompasses both the short and long isoforms of CD40.
  • the anti-CD40 antibodies ofthe present invention bind to an epitope of human CD40 that resides at the same location within either the short isoform or long isoform of this cell surface antigen as noted herein below.
  • the CD40 antigen is displayed on the surface of a variety of cell types, as described elsewhere herein. By “displayed on the surface” and “expressed on the surface” is intended that all or a portion ofthe CD40 antigen is exposed to the exterior of the cell.
  • the displayed or expressed CD40 antigen may be fully or partially glycosylated.
  • agonist activity is intended that the substance functions as an agonist. An agonist combines with a receptor on a cell and initiates a reaction or activity that is similar to or the same as that initiated by the receptor's natural ligand.
  • an agonist of CD40 induces any or all of, but not limited to, the following responses: cell proliferation and/or differentiation; upregulation of intercellular adhesion via such molecules as ICAM-1, E-selectin, VCAM, and the like; secretion of pro-inflammatory cytokines such as IL-1, IL-6, IL-8, IL-12, TNF, and the like; signal transduction through the CD40 receptor by such pathways as TRAF (e.g., TRAF2 and/or TRAF3), MAP kinases such as NIK (NF- ⁇ B inducing kinase), I-kappa B kinases (IKK ⁇ / ⁇ ), transcription factor NF- ⁇ B, Ras and the MEK/ERK pathway, the PI3K/Akt pathway, the P38 MAPK pathway, and the like; transduction of an anti-apoptotic signal by such molecules as XIAP, Mcl-1, BCLx, and the like; B and/or T cell memorv generation: B
  • an antagonist of CD40 prevents or reduces induction of any ofthe responses induced by binding ofthe CD40 receptor to an agonist ligand, particularly CD40L.
  • the antagonist may reduce induction of any one or more ofthe responses to agonist binding by 5%, 10%, 15%, 20%, 25%, 30%, 35%, preferably 40%, 45%, 50%, 55%, 60%, more preferably 70%, 80%, 85%, and most preferably 90%, 95%, 99%, or 100%.
  • Methods for measuring anti-CD40 antibody and CD40-ligand binding specificity and antagonist activity include, but are not limited to, standard competitive binding assays, assays for monitoring immunoglobulin secretion by B cells, B cell proliferation assays, Banchereau-Like-B cell proliferation assays, T cell helper assays for antibody production, co-stimulation of B cell proliferation assays, and assays for up-regulation of B cell activation markers. See, for example, such assays disclosed in WO 00/75348, U.S. Patent No.
  • significant agonist activity is intended an agonist activity of at least 30%, 35%, 40%, 45%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% greater than the agonist activity induced by a neutral substance or negative control as measured in a bioassay such as a B cell response assay.
  • "significant" agonist activity is an agonist activity that is at least 2-fold greater or at least 3 -fold greater than the agonist activity induced by a neutral substance or negative control as measured in a bioassay such as a B cell response assay.
  • a B cell proliferation assay is used, and "significant" agonist activity would be induction of a level of B cell proliferation that is at least 2-fold greater or at least 3 -fold greater than the level of B cell proliferation induced by a neutral substance or negative control.
  • a non-specific immunoglobulin for example IgGl, that does not bind to CD40 serves as the negative control.
  • a substance "free of significant agonist activity” would exhibit an agonist activity of not more than about 25% greater than the agonist activity induced by a neutral substance or negative control, preferably not more than about 20% greater, 15% greater, 10% greater, 5% greater, 1% greater, 0.5% greater, or even not more than about 0.1% greater than the agonist activity induced by a neutral substance or negative control as measured in a bioassay such as a B cell response assay.
  • the antagonist anti-CD40 antibodies useful in the methods ofthe present invention are free of significant agonist activity as noted above when bound to a CD40 antigen on a human cell. In one embodiment ofthe invention, the antagonist anti-CD40 antibody is free of significant agonist activity in one cellular response.
  • the antagonist anti-CD40 antibody is free of significant agonist activity in assays of more than one cellular response (e.g., proliferation and differentiation, or proliferation, differentiation, and, for B cells, antibody production).
  • anti-CD40 antibody encompasses any antibody that specifically recognizes the CD40 antigen, including polyclonal antibodies, monoclonal antibodies, single-chain antibodies, and fragments thereof such as Fab, F(ab') 2 , F v , and other fragments which retain the antigen binding function ofthe parent anti-CD40 antibody.
  • antagonist anti-CD40 antibodies that share the binding characteristics ofthe monoclonal antibodies CHIR-5.9 and CHIR-12.12 described above.
  • antibodies CHIR-5.9 and CHLR-12.12 include, but are not limited to, the following: (1) the monoclonal antibodies produced by the hybridoma cell lines designated 131.2F8.5.9 (referred to herein as the cell line 5.9) and 153.8E2.D10.D6.12.12 (referred to herein as the cell line 12.12), deposited with the ATCC as Patent Deposit No. PTA-5542 and Patent Deposit No.
  • antagonist anti-CD40 antibodies and antigen-binding fragments of these antibodies suitable for use in the methods disclosed herein include antagonist anti- CD40 antibodies and antigen-binding fragments thereof that are produced recombinantly using methods well known in the art and described herein below, and include, for example, monoclonal antibodies CHIR-5.9 and CHIR-12.12 that have been recombinantly produced.
  • the antagonist anti-CD40 antibodies for use in the methods ofthe present invention can be produced using any ofthe methods well known to those of skill in the art.
  • Polyclonal sera may be prepared by conventional methods. In general, a solution containing the CD40 antigen is first used to immunize a suitable animal, preferably a mouse, rat, rabbit, or goat. Rabbits or goats are preferred for the preparation of polyclonal sera due to the volume of serum obtainable, and the availability of labeled anti-rabbit and anti-goat antibodies.
  • Polyclonal sera can be prepared in a transgenic animal, preferably a mouse bearing human immunoglobulin loci. In a preferred embodiment, Sf9 cells expressing CD40 are used as the immunogen.
  • Immunization can also be performed by mixing or emulsifying the antigen-containing solution in saline, preferably in an adjuvant such as Freund's complete adjuvant, and injecting the mixture or emulsion parenterally (generally subcutaneously or intramuscularly). A dose of 50-200 ⁇ g/injection is typically sufficient. Immunization is generally boosted 2-6 weeks later with one or more injections ofthe protein in saline, preferably using Freund's incomplete adjuvant. One may alternatively generate antibodies by in vitro immunization using methods known in the art, which for the purposes of this invention is considered equivalent to in vivo immunization.
  • an adjuvant such as Freund's complete adjuvant
  • Polyclonal antisera are obtained by bleeding the immunized animal into a glass or plastic container, incubating the blood at 25°C for one hour, followed by incubating at 4°C for 2- 18 hours.
  • the serum is recovered by centrifugation (e.g., 1,000 x g for 10 minutes).
  • About 20-50 ml per bleed may be obtained from rabbits.
  • Production ofthe Sf 9 (Spodopterafrugiperda) cells is disclosed in U.S. Patent No. 6,004,552, incorporated herein by reference. Briefly, sequences encoding human CD40 were recombined into a baculovirus using transfer vectors. The plasmids were co- transfected with wild-type baculovirus DNA into Sf 9 cells.
  • the antibody is monoclonal in nature.
  • monoclonal antibody an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts.
  • the term is not limited regarding the species or source ofthe antibody.
  • the term encompasses whole immunoglobulins as well as fragments such as Fab, F(ab')2, Fv, and others which retain the antigen binding function ofthe antibody.
  • Monoclonal antibodies are highly specific, being directed against a single antigenic site, i.e., the CD40 cell surface antigen in the present invention. Furthermore, in contrast to conventional
  • polyclonal antibody preparations that typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
  • the modifier "monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method.
  • the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al. (1975) Nature 256:495, or may be made by recombinant DNA methods (see, e.g., U.S. Patent No. 4,816,567).
  • the “monoclonal antibodies” may also be isolated from phage antibody libraries using the techniques described in, for example, Clackson et al. (1991) Nature 352:624-628; Marks et al. (1991) J. Mol. Biol. 222:581-597; and U.S. Patent No. 5,514,548.
  • epipe is intended the part of an antigenic molecule to which an antibody is produced and to which the antibody will bind.
  • Epitopes can comprise linear amino acid residues (i.e., residues within the epitope are arranged sequentially one after another in a linear fashion), nonlinear amino acid residues (referred to herein as “nonlinear epitopes”; these epitopes are not arranged sequentially), or both linear and nonlinear amino acid residues.
  • CD40-antigen epitope refers to a three dimensional molecular structure (either linear or conformational) that is capable of immunoreactivity with the anti-CD40 monoclonal antibodies of this invention, excluding the CD40 antigen itself.
  • CD40-antigen epitopes may comprise proteins, protein fragments, peptides, carbohydrates, lipids, and other molecules, but for the purposes ofthe present invention are most commonly proteins, short oligopeptides, oligopeptide mimics (i.e., organic compounds which mimic the antibody binding properties ofthe CD40 antigen), or combinations thereof. Suitable oligopeptide mimics are described, inter alia, in PCT application US 91/04282. Monoclonal antibodies can be prepared using the method of Kohler et al. (1975) Nature 256:495-496, or a modification thereof. Typically, a mouse is immunized with a solution containing an antigen.
  • Immunization can be performed by mixing or emulsifying the antigen-containing solution in saline, preferably in an adjuvant such as Freund's complete adjuvant, and injecting the mixture or emulsion parenterally. Any method of immunization known in the art may be used to obtain the monoclonal antibodies ofthe invention. After immunization ofthe animal, the spleen (and optionally, several large lymph nodes) are removed and dissociated into single cells. The spleen cells may be screened by applying a cell suspension to a plate or well coated with the antigen of interest. The B cells expressing membrane bound immunoglobulin specific for the antigen bind to the plate and are not rinsed away.
  • an adjuvant such as Freund's complete adjuvant
  • Resulting B cells or all dissociated spleen cells, are then induced to fuse with myeloma cells to form hybridomas, and are cultured in a selective medium.
  • the resulting cells are plated by serial dilution and are assayed for the production of antibodies that specifically bind the antigen of interest (and that do not bind to unrelated antigens).
  • the selected monoclonal antibody (mAb)- secreting hybridomas are then cultured either in vitro (e.g., in tissue culture bottles or hollow fiber reactors), or in vivo (as ascites in mice).
  • the DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g. , by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies).
  • the hybridoma cells described herein serve as a preferred source of such DNA.
  • the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese Hamster Ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells.
  • antibody can be produced in a cell line such as a CHO cell line, as disclosed in U.S. Patent Nos. 5,545,403; 5,545,405; and 5,998,144; incorporated herein by reference. Briefly the cell line is transfected with vectors capable of expressing a light chain and a heavy chain, respectively. By transfecting the two proteins on separate vectors, chimeric antibodies can be produced. Another advantage is the correct glycosylation ofthe antibody.
  • the antagonist anti-CD40 antibody for example, the CHIR-12.12 or CHIR-5.9 antibody, or antigen-binding fragment thereof is produced in CHO cells using the GS gene expression system (Lonza Biologies, Portsmouth, New Hampshire), which uses glutamine synthetase as a marker. See, also U.S. Patent Nos. 5,122,464; 5,591,639; 5,658,759; 5,770,359; 5,827,739; 5,879,936; 5,891,693; and 5,981,216; the contents of which are herein incorporated by reference in their entirety. Monoclonal antibodies to CD40 are known in the art.
  • anti-CD40 antibody encompasses chimeric anti-CD40 antibodies; such chimeric anti-CD40 antibodies for use in the methods ofthe invention have the binding characteristics ofthe CHIR-5.9 and CHIR- 12.12 monoclonal antibodies described herein.
  • chimeric antibodies is intended antibodies that are most preferably derived using recombinant deoxyribonucleic acid techniques and which comprise both human (including immunologically "related" species, e.g., chimpanzee) and non-human components.
  • Rituxan ® is an example of a chimeric antibody with a murine variable region and a human constant region.
  • the constant region ofthe chimeric antibody is most preferably substantially identical to the constant region of a natural human antibody; the variable region ofthe chimeric antibody is most preferably derived from a non-human source and has the desired antigenic specificity to the CD40 cell-surface antigen.
  • the non-human source can be any vertebrate source that can be used to generate antibodies to a human CD40 cell-surface antigen or material comprising a human CD40 cell-surface antigen.
  • Such non-human sources include, but are not limited to, rodents (e.g., rabbit, rat, mouse, etc.; see, for example, U.S. Patent No.
  • chimeric anti-CD40 antibodies means a chimeric antibody that binds human CD40.
  • Humanized anti-CD40 antibodies represent additional anti-CD40 antibodies suitable for use in the methods ofthe present invention.
  • humanized is intended forms of anti-CD40 antibodies that contain minimal sequence derived from non-human immunoglobulin sequences.
  • humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region (also known as complementarity determining region or CDR) ofthe recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and capacity.
  • CDR complementarity determining region
  • donor antibody such as mouse, rat, rabbit, or nonhuman primate having the desired specificity, affinity, and capacity.
  • complementarity determining region refers to amino acid sequences which together define the binding affinity and specificity ofthe natural Fv region of a native immunoglobulin binding site. See, e.g., Chothia et al ( 1987) J. Mol. Biol. 196:901-917; Kabat et al (1991) U. S. Dept.
  • constant region refers to the portion ofthe antibody molecule that confers effector functions.
  • mouse constant regions were substituted by human constant regions.
  • the constant regions ofthe subject humanized antibodies were derived from human immunoglobulins.
  • these humanized antibodies still elicited an unwanted and potentially dangerous immune response in humans and there was a loss of affinity.
  • Humamzed anti-CD40 antibodies for use in the methods ofthe present invention have binding characteristics similar to those exhibited by the CHIR-5.9 and CHIR-12.12 monoclonal antibodies described herein.
  • humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance (e.g., to obtain desired affinity).
  • the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin sequence.
  • the humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.
  • Fc immunoglobulin constant region
  • Such "humanized” antibodies may include antibodies wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species.
  • humanized antibodies are typically human antibodies in which some CDR residues and possibly some framework residues are substituted by residues from analogous sites in rodent antibodies.
  • anti-CD40 antibodies are xenogeneic or modified anti-CD40 antibodies produced in a non-human mammalian host, more particularly a transgenic mouse, characterized by inactivated endogenous immunoglobulin (Ig) loci.
  • Ig immunoglobulin
  • transgenic animals competent endogenous genes for the expression of light and heavy subunits of host immunoglobulins are rendered non-functional and substituted with the analogous human immunoglobulin loci.
  • These transgenic animals produce human antibodies in the substantial absence of light or heavy host immunoglobulin subunits. See, for example, U.S. Patent Nos. 5,877,397 and 5,939,598, herein incorporated by reference.
  • fully human antibodies to CD40 are obtained by immunizing transgenic mice.
  • One such mouse is obtained using XenoMouse ® technology (Abgenix; Fremont, California) and is disclosed in U.S. Patent Nos. 6,075,181, 6,091,001, and 6,114,598, all of which are incorporated herein by reference.
  • mice transgenic for the human Ig Gi heavy chain locus and the human K light chain locus were immunized with Sf 9 cells expressing human CD40. Mice can also be transgenic for other isotypes.
  • Fully human antibodies useful in the methods ofthe present invention are characterized by binding properties similar to those exhibited by the CHIR-5.9 and CHIR-12.12 monoclonal antibodies disclosed herein. Fragments ofthe anti-CD40 antibodies are suitable for use in the methods ofthe invention so long as they retain the desired affinity ofthe full-length antibody. Thus, a fragment of an anti-CD40 antibody will retain the ability to bind to the CD40 B cell surface antigen.
  • Such fragments are characterized by properties similar to the corresponding full-length antagonist anti-CD40 antibody, that is, the fragments will specifically bind a human CD40 antigen expressed on the surface of a human cell, and are free of significant agonist activity but exhibit antagonist activity when bound to a CD40 antigen on a human CD40-expressing cell.
  • Such fragments are referred to herein as "antigen-binding" fragments.
  • Suitable antigen-binding fragments of an antibody comprise a portion of a full- length antibody, generally the antigen-binding or variable region thereof. Examples of antibody fragments include, but are not limited to, Fab, F(ab') 2 , and Fv fragments and single-chain antibody molecules.
  • Fab is intended a monovalent antigen-binding fragment of an immunoglobulin that is composed ofthe light chain and part ofthe heavy chain.
  • F(ab') 2 is intended a bivalent antigen-binding fragment of an immunoglobulin that contains both light chains and part of both heavy chains.
  • single-chain Fv or “sFv” antibody fragments is intended fragments comprising the VH and VL domains of an antibody, wherein these domains are present in a single polypeptide chain. See, for example, U.S. Patent Nos. 4,946,778, 5,260,203, 5,455,030, and 5,856,456, herein incorporated by reference.
  • the Fv polypeptide further comprises a polypeptide linker between the VH and V L domains that enables the sFv to form the desired structure for antigen binding.
  • a polypeptide linker between the VH and V L domains that enables the sFv to form the desired structure for antigen binding.
  • fragments can now be produced directly by recombinant host cells.
  • the antibody fragments can be isolated from the antibody phage libraries discussed above.
  • Fab'-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab') 2 fragments (Carter et al. (1992) Bio/Technology 10:163-167).
  • F(ab') 2 fragments can be isolated directly from recombinant host cell culture.
  • Other techniques for the production of antibody fragments will be apparent to the skilled practitioner.
  • Antagonist anti-CD40 antibodies useful in the methods ofthe present invention include the CHIR-5.9 and CHIR-12.12 monoclonal antibodies disclosed herein as well as antibodies differing from this antibody but retaining the CDRs; and antibodies with one or more amino acid addition(s), deletion(s), or substitution(s), wherein the antagonist activity is measured by inhibition of B-cell proliferation and/or differentiation.
  • the invention also encompasses de-immunized antagonist anti-CD40 antibodies, which can be produced as described in, for example, International Publication Nos. WO 98/52976 and WO 0034317; herein incorporated by reference.
  • fusion proteins comprising an antagonist anti-CD40 antibody ofthe invention, or a fragment thereof, which fusion proteins can be synthesized or expressed from corresponding polynucleotide vectors, as is known in the art. Such fusion proteins are described with reference to conjugation of antibodies as noted below.
  • the antibodies ofthe present invention can have sequence variations produced using methods described in, for example, Patent Publication Nos. EP 0 983 303 Al,
  • WO 00/34317, and WO 98/52976 incorporated herein by reference.
  • sequences within the CDR can cause an antibody to bind to MHC Class II and trigger an unwanted helper T cell response.
  • a conservative substitution can allow the antibody to retain binding activity yet lose its ability to trigger an unwanted T cell response. Any such conservative or non-conservative substitutions can be made using art-recognized methods, such as those noted elsewhere herein, and the resulting antibodies will fall within the scope ofthe invention.
  • the variant antibodies can be routinely tested for antagonist activity, affinity, and specificity using methods described herein.
  • the anti-CD40 antibodies useful in the practice ofthe invention can have one or many mechanisms of action.
  • an antibody produced by any ofthe methods described above, or any other method not disclosed herein, will fall within the scope ofthe invention if it possesses at least one ofthe following biological activities in vitro and/or in vivo: inhibition of immunoglobulin secretion by normal human peripheral B cells stimulated by T cells; inhibition of survival and/or proliferation of normal human peripheral B cells stimulated by CD40L-expressing cells or soluble CD40 ligand
  • sCD40L sCD40L
  • inhibition of survival and/or proliferation of normal human peripheral B cells stimulated by Jurkat T cells inhibition of "survival" anti-apoptotic intracellular signals in any cell stimulated by sCD40L or solid-phase CD40L
  • inhibition of CD40 signal transduction in any cell upon ligation with sCD40L or solid-phase CD40L deletion, anergy and/or tolerance induction of CD40-bearing target cells or cells bearing cognate ligands to CD40 including, but not limited to, T cells and B cells, induction of expansion or activation of CD4 + CD25 + regulatory T cells (see for example, donor alloantigen- specific tissue rejection via CD40-CD40L interference, van Maurik et al.
  • cytotoxicity via any mechanism (including, but not limited to, antibody-dependent cell-mediated cytotoxicity (ADCC), complement-dependent cytotoxicity (CDC), down-regulation of proliferation, and/or apoptosis in target cells), modulation of target cell cytokine secretion and/or cell surface molecule expression, and combinations thereof.
  • ADCC antibody-dependent cell-mediated cytotoxicity
  • CDC complement-dependent cytotoxicity
  • Assays for such biological activities can be performed as described herein and in copending provisional applications entitled "Antagonist Anti- CD40 Monoclonal Antibodies and Methods for Their Use," filed November 4, 2003, November 26, 2003, and April 27, 2004, and assigned U.S. Patent Application Nos. 60/517,337 (Attorney Docket No.
  • a representative assay to detect antagonistic anti-CD40 antibodies specific to the CD40-antigen epitopes identified herein is a "competitive binding assay.”
  • Competitive binding assays are serological assays in which unknowns are detected and quantitated by their ability to inhibit the binding of a labeled known ligand to its specific antibody.
  • labeled CD40 polypeptide is precipitated by candidate antibodies in a sample, for example, in combination with monoclonal antibodies raised against one or more epitopes ofthe monoclonal antibodies ofthe invention.
  • Anti-CD40 antibodies that specifically react with an epitope of interest can be identified by screening a series of antibodies prepared against a CD40 protein or fragment ofthe protein comprising the particular epitope ofthe CD40 protein of interest.
  • epitopes of interest include epitopes comprising linear and/or nonlinear amino acid residues ofthe short isoform of human CD40 (see GenBank Accession No.
  • NP_690593 set forth in Figure 4B (SEQ ID NO: 10), encoded by the sequence set forth in Figure 4A (SEQ ID NO:9; see also GenBank Accession No. NM_152854), or ofthe long isoform of human CD40 (see GenBank Accession Nos. CAA43045 and NP_001241) set forth in Figure 4D (SEQ ID NO:12), encoded by the sequence set forth in Figure 4C (SEQ ID NO: 11 ; see GenBank Accession Nos. X60592 and NM_001250).
  • competitive binding assays with previously identified suitable antagonist anti-CD40 antibodies could be used to select monoclonal antibodies comparable to the previously identified antibodies.
  • Antibodies employed in such immunoassays may be labeled or unlabeled. Unlabeled antibodies may be employed in agglutination; labeled antibodies may be employed in a wide variety of assays, employing a wide variety of labels. Detection of the formation of an antibody-antigen complex between an anti-CD40 antibody and an epitope of interest can be facilitated by attaching a detectable substance to the antibody. Suitable detection means include the use of labels such as radionuclides, enzymes, coenzymes, fluorescers, chemiluminescers, chromogens, enzyme substrates or co-factors, enzyme inhibitors, prosthetic group complexes, free radicals, particles, dyes, and the like.
  • suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ - galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes mclude streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fiuorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material is luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin; and examples of suitable radioactive material include 125 1, 131 I, 35 S, or 3 H.
  • Such labeled reagents may be used in a variety of well-known assays, such as radioimmunoassays, enzyme immunoassays, e.g., ELISA, fluorescent immunoassays, and the like. See for example, U.S. Patent Nos. 3,766,162; 3,791,932; 3,817,837; and 4,233,402. Any ofthe previously described antagonist anti-CD40 antibodies or antibody fragments thereof may be conjugated prior to use in the methods ofthe present invention. Methods for producing conjugated antibodies are known in the art.
  • the anti-CD40 antibody may be labeled using an indirect labeling or indirect labeling approach. Suitable labels include fluorophores, chromophores, radioactive atoms (particularly 32 P and 125 I), electron-dense reagents, enzymes, and ligands having specific binding partners.
  • Enzymes are typically detected by their activity. For example, horseradish peroxidase is usually detected by its ability to convert 3,3',5,5 '-tetramethylbenzidine (TMB) to a blue pigment, quantifiable with a spectra photometer.
  • TMB 3,3',5,5 '-tetramethylbenzidine
  • Specific binding partner refers to a protein capable of binding a ligand molecule with high specificity, as for example in the case of an antigen and a monoclonal antibody specific therefore.
  • Other specific binding partners include biotin and avidin or streptavidin, IgG and protein A, and the numerous receptor-ligand couples known in the art. It should be understood that the above description is not meant to categorize the various labels into distinct classes, as the same label may serve in several different modes.
  • HRP may serve as enzyme or as antigen for a mAb.
  • mAbs and avidin also require labels in the practice of this invention: thus, one might label a mAb with biotin, and detect its presence with avidin labeled with 125 I, or with an anti-biotin mAb labeled with HRP.
  • an antibody or fragment thereof may be conjugated to a therapeutic moiety such as a therapeutic agent for example.
  • the drug moiety may be a protein or polypeptide possessing a desired biological activity.
  • Such proteins may include, for example, a protein such as CTLA4-Ig, an antibody or any other protein; or, biological response modifiers such as, for example, lymphokines, tumor necrosis factor, interferon- alpha, interferon-beta, nerve growth factor, platelet derived growth factor, tissue plasminogen activator, BLyS (B Lymphocyte Stimulator), interleukin-1 ("IL-1"), interleukin-2 (“IL-2”), interleukin-6 (“IL-6”), granulocyte macrophage colony stimulating factor (“GM-CSF”), granulocyte colony stimulating factor (“G-CSF”), or other growth factors.
  • lymphokines tumor necrosis factor
  • interferon- alpha interferon-beta
  • nerve growth factor nerve growth factor
  • platelet derived growth factor platelet derived growth factor
  • tissue plasminogen activator tissue plasminogen activator
  • BLyS B Lymphocyte Stimulator
  • IL-1 interleukin-1
  • an antibody can be conjugated to a second antibody to form an antibody heteroconjugate as described in U.S. Patent No. 4,676,980.
  • linkers may be used between the labels and the antibodies ofthe invention (see U.S. Patent No. 4,831,175).
  • Antibodies or, antigen-binding fragments thereof may be directly or indirectly labeled (U.S. Patent No. 5,595,721).
  • Treatment may consist of a combination of treatment with conjugated and nonconjugated antibodies administered simultaneously or subsequently (WO 00/52031 and WO 00/52473).
  • Suitable biologically active variants ofthe antagonist anti-CD40 antibodies can be used in the methods ofthe present invention. Such variants will retain the desired binding properties ofthe parent antagonist anti-CD40 antibody.
  • Methods for making antibody variants are generally available in the art.
  • amino acid sequence variants of an antagonist anti-CD40 antibody for example, the CHIR-5.9 or CHIR-12.12 monoclonal antibody described herein, can be prepared by mutations in the cloned DNA sequence encoding the antibody of interest. Methods for mutagenesis and nucleotide sequence alterations are well known in the art. See, for example, Walker and Gaastra, eds.
  • variants ofthe antagonist anti-CD40 antibody polypeptide of interest modifications are made such that variants continue to possess the desired activity, i.e., similar binding affinity and are capable of specifically binding to a human CD40 antigen expressed on the surface of a human cell, and being free of significant agonist activity but exhibiting antagonist activity when bound to a CD40 antigen on a human CD40-expressing cell.
  • any mutations made in the DNA encoding the variant polypeptide must not place the sequence out of reading frame and preferably will not create complementary regions that could produce secondary mRNA structure.
  • the constant region of an antagonist anti-CD40 antibody can be mutated to alter effector function in a number of ways. For example, see U.S. Patent No. 6,737,056B1 and U.S. Patent Application Publication No. 2004/0132101 Al, which disclose Fc mutations that optimize antibody binding to Fc receptors.
  • variants of a reference antagonist anti-CD40 antibody have amino acid sequences that have at least 70% or 75% sequence identity, preferably at least 80% or 85% sequence identity, more preferably at least 90%, 91%, 92%, 93%, y4% or y:> % sequence identity to the amino acid sequence for the reference antagonist anti-CD40 antibody molecule, for example, the CHIR-5.9 or CHIR-12.12 monoclonal antibody described herein, or to a shorter portion ofthe reference antibody molecule. More preferably, the molecules share at least 96%, 97%, 98% or 99% sequence identity.
  • percent sequence identity is determined using the Smith-Waterman homology search algorithm using an affine gap search with a gap open penalty of 12 and a gap extension penalty of 2, BLOSUM matrix of 62.
  • the Smith- Waterman homology search algorithm is taught in Smith and Waterman (1981) Adv. Appl. Math. 2:482-489.
  • a variant may, for example, differ from the reference antagonist anti-CD40 antibody by as few as 1 to 15 amino acid residues, as few as 1 to 10 amino acid residues, such as 6-10, as few as 5, as few as 4, 3, 2, or even 1 amino acid residue.
  • the contiguous segment ofthe variant amino acid sequence may have additional amino acid residues or deleted amino acid residues with respect to the reference amino acid sequence.
  • the contiguous segment used for comparison to the reference amino acid sequence will include at least 20 contiguous amino acid residues, and may be 30, 40, 50, or more amino acid residues. Corrections for sequence identity associated with conservative residue substitutions or gaps can be made (see Smith- Waterman homology search algorithm). The precise chemical structure of a polypeptide capable of specifically binding
  • CD40 and retaining antagonist activity particularly when bound to CD40 antigen on malignant B cells, depends on a number of factors.
  • ionizable amino and carboxyl groups are present in the molecule, a particular polypeptide may be obtained as an acidic or basic salt, or in neutral form. All such preparations that retain their biological activity when placed in suitable environmental conditions are included in the definition of antagonist anti-CD40 antibodies as used herein.
  • the primary amino acid sequence ofthe polypeptide maybe augmented by derivatization using sugar moieties (glycosylation) or by other supplementary molecules such as lipids, phosphate, acetyl groups and the like. It may also be augmented by conjugation with saccharides.
  • Methods of Therapy Using the Antagonist Anti-CD40 Antibodies ofthe Invention are directed to the use of antagonist anti-CD40 antibodies to treat subjects (i.e., patients) having an autoimmune disease and/or inflammatory disease, or a predisposition to developing an autoimmune disease and/or inflammatory disease, wherein the disease and/or inflammation is mediated by CD40 ligand-mediated CD40 signaling on cells expressing the CD40 antigen.
  • CD40-expressing cell it is intended cells that express the CD40 antigen.
  • Methods for detecting CD40 expression in cells are well known in the art and include, but are not limited to, PCR techniques, immunohistochemistry, flow cytometry, Western blot, ELISA, and the like.
  • the methods ofthe invention are especially useful for treating inflammatory and/or autoimmune diseases wherein CD40L-mediated CD40 stimulation is involved.
  • the compositions ofthe invention may be administered prophylactically or therapeutically or a combination thereof.
  • Inflammatory diseases are characterized by inflammation and tissue destruction, or a combination thereof.
  • "Inflammatory disease” includes any inflammatory immune- mediated process where the initiating event or target ofthe immune response involves non-self antigen(s), including, for example, alloantigens, xenoantigens, viral antigens, bacterial antigens, unknown antigens, or allergens.
  • the term “inflammatory disease(s)” includes “autoimmune disease(s).”
  • autoimmunity is generally understood to encompass inflammatory immune-mediated processes involving "self antigens. In autoimmune diseases, self antigen(s) trigger host immune responses.
  • the present invention includes treatment of inflammation associated with tissue transplant rejection.
  • Transplant rejection or “graft rejection” refers to any host- mounted immune response against a graft including but not limited to HLA antigens, blood group antigens, and the like. The invention can also be used to treat graft versus host disease, such as that associated with bone marrow transplantation, for example.
  • the donor bone marrow includes lymphocytes and cells that mature into lymphocytes.
  • the donor's lymphocytes recognize the recipient's antigens as non-self and mount an inflammatory immune response.
  • graft versus host disease or “graft versus host reaction” refers to any T cell mediated immune response in which donor lymphocytes react to the host's antigens.
  • the antagonist anti-CD40 antibodies and antigen-binding fragments thereof described herein can be used in accordance with the methods ofthe invention to treat autoimmune and or inflammatory disorders including, but not limited to, systemic lupus erythematosus (SLE), discoid lupus, lupus nephritis, sarcoidosis, inflammatory arthritis, including juvenile arthritis, rheumatoid arthritis, psoriatic arthritis, Reiter's syndrome, ankylosing spondylitis, and gouty arthritis, rejection of an organ or tissue transplant, hyperacute, acute, or chronic rejection and/or graft versus host disease, multiple sclerosis, hyper IgE syndrome, polyarteritis nodosa, primary biliary cirrhosis, inflammatory bowel disease, Crohn's disease, celiac's disease (gluten-sensitive enteropathy), autoimmune hepatitis, pernicious anemia, autoimmune hemolytic anemia, psori
  • the antagonistic anti-CD40 antibodies ofthe invention are useful in treating pulmonary inflammation including but not limited to lung graft rejection, asthma, sarcoidosis, emphysema, cystic fibrosis, idiopathic pulmonary fibrosis, chronic bronchitis, allergic rhinitis and allergic diseases ofthe lung such as hypersensitivity pneumonitis, eosinophilic pneumonia, bronchiolitis obliterans due to bone marrow and/or lung transplantation or other causes, graft atherosclerosis/graft phlebosclerosis, as well as pulmonary fibrosis resulting from collagen, vascular, and autoimmune diseases such as rheumatoid arthritis and lupus erythematosus.
  • pulmonary inflammation including but not limited to lung graft rejection, asthma, sarcoidosis, emphysema, cystic fibrosis, idiopathic pulmonary fibrosis, chronic bronchitis, allergic
  • Treatment is herein defined as the application or administration of an antagonist anti-CD40 antibody or antigen-binding fragment thereof to a subject, or application or administration of an antagonist anti-CD40 antibody or antigen-binding fragment thereof to an isolated tissue or cell line from a subject, where the subject has an autoimmune disease and/or inflammatory disease, a symptom associated with an autoimmune disease and/or inflammatory disease, or a predisposition toward development of an autoimmune disease and/or inflammatory disease, where the purpose is to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the autoimmune disease and or inflammatory disease, any associated symptoms ofthe autoimmune disease and/or inflammatory disease, or the predisposition toward the development ofthe autoimmune disease and/or inflammatory disease.
  • treatment is also intended the application or administration of a pharmaceutical composition comprising an antagonist anti-CD40 antibodies or antigen-binding fragment thereof to a subject, or application or administration of a pharmaceutical composition comprising an antagonist anti-CD40 antibody or antigen-binding fragment thereof to an isolated tissue or cell line from a subject, where the subject has an autoimmune disease and/or inflammatory disease, a symptom associated with an autoimmune disease and/or inflammatory disease, or a predisposition toward development of an autoimmune disease and/or inflammatory disease, where the purpose is to cure, heal, alleviate, relieve, alter, remedy, ameliorate, improve, or affect the autoimmune disease and/or inflammatory disease, any associated symptoms ofthe autoimmune disease and/or inflammatory disease, or the predisposition toward the development ofthe autoimmune disease and/or inflammatory disease.
  • anti-inflammatory activity is intended a reduction or prevention of inflammation.
  • Therapy with at least one antagonist anti-CD40 antibody (or antigen- binding fragment thereof) as defined elsewhere herein causes a physiological response that is beneficial with respect to treatment of an autoimmune disease and/or inflammatory disease, where the disease involves cells expressing the CD40 antigen. It is recognized that the methods ofthe invention may be useful in preventing phenotypic change in cells such as proliferation, activation, and the like.
  • at least one antagonist anti-CD40 antibody (or antigen-binding fragment thereof) as defined elsewhere herein is used to promote a positive therapeutic response with respect to treatment or prevention of an autoimmune disease and/or inflammatory disease.
  • positive therapeutic response with respect to an autoimmune disease and/or inflammatory disease is intended an improvement in the disease in association with the anti-inflammatory activity of these antibodies or antigen-binding fragments thereof, and/or an improvement in the symptoms associated with the disease. That is, an anti-proliferative effect, the prevention of further proliferation ofthe CD40-ex ⁇ ressing cell, a reduction in the inflammatory response including but not limited to reduced secretion of inflammatory cytokines, adhesion molecules, proteases, immunoglobulins (in instances where the CD40 bearing cell is a B cell), combinations thereof, and the like, increased production of anti-inflammatory proteins, a reduction in the number of autoreactive cells, an increase in immune tolerance, inhibition of autoreactive cell survival, and/or a decrease in one or more symptoms mediated by stimulation of CD40-expressing cells can be observed.
  • Such positive therapeutic responses are not limited to the route of administration and may comprise administration to the donor, the donor tissue (such as for example organ perfusion), the host, any combination thereof, and the like.
  • Clinical response can be assessed using screening techniques such as magnetic resonance imaging (MRI) scan, x-radiographic imaging, computed tomographic (CT) scan, flow cytometry or fluorescence-activated cell sorter (FACS) analysis, histology, gross pathology, and blood chemistry, including but not limited to changes detectable by ELISA, RIA, chromatography, and the like, hi addition to these positive therapeutic responses, the subject undergoing therapy with the antagonist anti-CD40 antibody or antigen-binding fragment thereof may experience the beneficial effect of an improvement in the symptoms associated with the disease.
  • MRI magnetic resonance imaging
  • CT computed tomographic
  • FACS fluorescence-activated cell sorter
  • terapéuticaally effective dose or amount or “effective amount” is intended an amount of antagonist anti-CD40 antibody or antigen-binding fragment thereof that, when administered brings about a positive therapeutic response with respect to treatment of a subject with an autoimmune disease and/or inflammatory disease.
  • a therapeutically effective dose ofthe anti-CD40 antibody or fragment thereof is hi the range from about 0.01 mg/kg to about 40 mg/kg, from about 0.01 mg/kg to about 30 mg/kg, from about 0.1 mg/kg to about 30 mg/kg, from about 1 mg/kg to about 30 mg/kg, from about 3 mg/kg to about 30 mg/kg, from about 3 mg/kg to about 25 mg/kg, from about 3 mg/kg to about 20 mg/kg, from about 5 mg/kg to about 15 mg/kg, or from about 7 mg/kg to about 12 mg/kg.
  • the method of treatment may comprise a single administration of a therapeutically effective dose or multiple administrations of a therapeutically effective dose ofthe antagonist anti-CD40 antibody or antigen-binding fragment thereof.
  • a further embodiment of the invention is the use of antagonist anti-CD40 antibodies for diagnostic monitoring of protein levels in tissue as part of a clinical testing procedure, e.g., to determine the efficacy of a given treatment regimen. Detection can be facilitated by coupling the antibody to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials.
  • suitable enzymes include horseradish peroxidase, alkaline phosphatase, ⁇ -galactosidase, or acetylcholinesterase;
  • suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin;
  • suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin;
  • an example of a luminescent material includes luminol;
  • examples of bioluminescent materials include luciferase, luciferin, and aequorin;
  • suitable radioactive material include 125 1, 131 1, 35 S, or 3 H.
  • the antagonist anti-CD40 antibodies and suitable antigen-binding fragments thereof can be used in combination with any known therapies for autoimmune and inflammatory diseases, including any agent or combination of agents that are known to be useful, or which have been used or are currently in use, for treatment of autoimmune and inflammatory diseases.
  • therapies and therapeutic agents include, but are not limited to, surgery or surgical procedures (e.g.
  • splenectomy lymphadenectomy, thyroidectomy, plasmaphoresis, leukophoresis, cell, tissue, or organ transplantation, intestinal procedures, organ perfusion, and the like
  • radiation therapy such as steroid therapy and non-steroidal therapy
  • hormone therapy for example, topical agents used to treat skin conditions such as allergies, contact dermatitis, and psoriasis
  • immunosuppressive therapy for example, immunosuppressive therapy, and other anti- inflammatory monoclonal antibody therapy, and the like.
  • the antagonist anti-CD40 antibodies described herein, or antigen-binding fragments thereof are administered in combination with at least one other therapy, including, but not limited to, surgery, organ perfusion, radiation therapy, steroid therapy, non-steroidal therapy, antibiotic therapy, antifungal therapy, hormone therapy, cytokine therapy, therapy with dermatological agents (for example, topical agents used to treat skin conditions such as allergies, contact dermatitis, and psoriasis), immunosuppressive therapy, other anti- inflammatory monoclonal antibody therapy, combinations thereof, and the like.
  • at least one other therapy including, but not limited to, surgery, organ perfusion, radiation therapy, steroid therapy, non-steroidal therapy, antibiotic therapy, antifungal therapy, hormone therapy, cytokine therapy, therapy with dermatological agents (for example, topical agents used to treat skin conditions such as allergies, contact dermatitis, and psoriasis), immunosuppressive therapy, other anti- inflammatory monoclonal antibody therapy, combinations thereof, and the like.
  • the methods ofthe invention encompass coadministration, using separate formulations or a single pharmaceutical formulation, and consecutive administration in either order.
  • these therapies can be given simultaneously, i.e., the antagonist anti-CD40 antibody or antigen-binding fragment thereof is administered concurrently or within the same time frame as the other therapy (i.e., the therapies are going on concurrently, but the anti-CD40 antibody or antigen-binding fragment thereof is not admimstered precisely at the same time as the other therapy).
  • the antagonist anti-CD40 antibody of the present invention or antigen-binding fragment thereof may also be administered prior to or subsequent to the other therapy. Sequential administration ofthe different therapies may be performed regardless of whether the treated subject responds to the first course of therapy to decrease the possibility of remission or relapse.
  • the antagonist anti-CD40 antibodies described herein, or antigen-binding fragments thereof are administered in combination with immunosuppressive drugs or anti-inflammatory drugs, wherein the antibody and the therapeutic agent(s) may be admimstered sequentially, in either order, or simultaneously (i.e., concurrently or within the same time frame).
  • suitable immunosuppressive drugs that can be administered in combination with the antagonistic anti-CD40 antibodies ofthe invention include, but are not limited to, methotrexate, cyclophosphamide, mizoribine, chlorambucil, cyclosporine, such as, for example, aerosolized cyclosporine (see, U.S. Patent Application Publication No.
  • tacrolimus FK506; ProGrafTM
  • mycophenolate mofetil and azathioprine (6-mercaptopurine
  • sirolimus rapamycin
  • deoxyspergualin leflunomide and its malononitriloamide analogs
  • immunosuppressive proteins including, for example, anti-CTLA4 antibodies and Ig fusions, anti-B lymphocyte stimulator antibodies (e.g., LYMPHOSTAT-BTM) and Ig fusions (BLyS-Ig), anti-CD80 antibodies and etanercept (Enbrel ® ), as well as anti-T cell antibodies such as anti-CD3 (OKT3), anti-CD4, and the like.
  • Suitable anti- inflammatory agents include, but are not limited to, corticosteroids such as, for example, clobetasol, halobetasol, hydrocortisone, triamcinolone, betamethasone, fluocinole, fluocinonide, prednisone, prednisolone, methylprednisolone; non-steroidal anti- inflammatory drugs (NSAIDs) such as, for example, sulfasalazine, medications containing mesalamine (known as 5-ASA agents), celecoxib, diclofenac, etodolac, fenprofen, flurbiprofen, ibuprofen, ketoprofen, meclofamate, meloxicam , nabumetone, naproxen, oxaprozin, piroxicam, rofecoxib, salicylates, sulindac, and tolmetin; anti- inflammatory antibodies such as adali mumab
  • Transplant rejection and graft versus host disease can be hyperacute (humoral), acute (T cell mediated), or chronic (unknown etiology), or a combination thereof.
  • the antagonistic anti-CD40 antibodies ofthe invention are used in some embodiments to prevent and/or ameliorate rejection and/or symptoms associated with hyperacute, acute, and/or chronic transplant rejection of any tissue, including, but not limited to, liver, kidney, pancreas, pancreatic islet cells, small intestine, lung, heart, corneas, skin, blood vessels, bone, heterologous or autologous bone marrow, and the like.
  • Graft tissues may be obtained from any donor and transplanted into any recipient host, and thus the transplant procedure may comprise transplanting animal tissue to humans (e.g., xenografts), transplanting tissue from one human to another human (e.g., allografts), and/or transplanting tissue from one part of a human's body to another (e.g., autografts).
  • Treatment with the antibodies ofthe invention may also reduce transplantation sequelae such as fever, anorexia, hemodynamic abnormalities, leukopenia, white cell infiltration of the transplanted organ/tissue, as well as opportunistic infections.
  • the antagonistic anti-CD40 antibodies ofthe invention may be used alone or in combination with immunosuppressive drugs to treat and/or prevent transplant rejection such as hyperacute, acute, and/or chronic rejection and/or graft versus host disease.
  • the antibodies may used in combination with suitable immunosuppressive drugs, including, but not limited, to methotrexate; cyclophosphamide; mizoribine; chlorambucil; cyclosporine, such as, for example, aerosolized cyclosporine (see, U.S. Patent Application Publication No.
  • tacrolimus FK506; ProGrafTM
  • mycophenolate mofetil and azathioprine (6-mercaptopurine
  • sirolimus rapamycin
  • deoxyspergualin leflunomide and its malononitriloamide analogs
  • immunosuppressive proteins including, for example, anti-CTLA antibodies and Ig fusions, anti-B lymphocyte stimulator antibodies (e.g., LYMPHOSTAT-BTM) and Ig fusions (BLyS-Ig), anti-CD80 antibodies and etanercept (Enbrel ® ), as well as anti-T cell antibodies such as anti-CD3 (OKT3), anti-CD4, and the like.
  • compositions and methods ofthe invention are used in combination with other drugs to further improve symptoms and outcomes in transplant recipients, such as those receiving lung grafts, for example.
  • the antagonistic anti-CD40 antibodies ofthe invention are used to treat transplant rejection (such as, for example hyperacute, acute, and/or chronic rejection or graft versus host disease in lung transplant recipients) alone or in combination with parenterally and/or non-parenterally administered cyclosporine, including for example oral cyclosporine, injectable cyclosporine, aerosolized (e.g., inhaled) cyclosporine, and combinations thereof.
  • the cyclosporine is delivered to the lung ofthe recipient by inhalation of cyclosporine in aerosol spray form using, for example, a pressurized delivery device or nebulizer.
  • the cyclosporine may be administered in either dry powder or wet form.
  • the antagonistic anti-CD40 antibodies ofthe invention may be used alone or in combination with immunosuppressive drugs to treat and/or prevent rheumatoid arthritis.
  • the antibodies may used in combination with suitable immunosuppressive drags, including, but not limited to, methotrexate, cyclophosphamide, mizoribine, chlorambucil, cyclosporine, tacrolimus (FK506; PROGRAFTM), mycophenolate mofetil, and azathioprine (6-mercaptopurine), sirolimus (rapamycin), deoxyspergualin, leflunomide and its malononitriloamide analogs; and immunosuppressive proteins, including, for example, anti-CTLA antibodies and Ig fusions, anti-B lymphocyte stimulator antibodies (e.g., LYMPHOSTAT-BTM) and Ig fusions (BLyS-Ig), anti-CD20 antibodies (e.g.
  • suitable immunosuppressive drags including, but not limited to, methotrexate, cyclophosphamide, mizoribine, chlorambucil, cyclosporine, tacrolimus (FK506
  • treatment effectiveness may be assessed using any means and includes, but is not limited to, effectiveness as measured by clinical responses defined by the American College of Rheumatology criteria, the European League of Rheumatism criteria, or any other criteria.
  • the antagonistic anti-CD40 antibodies ofthe invention may be used alone or in combination with immunosuppressive drugs to treat and/or prevent multiple sclerosis.
  • the antibodies may used in combination with suitable immunosuppressive drugs, including, but not limited to, methotrexate, cyclophosphamide, mizoribine, chlorambucil, cyclosporine, tacrolimus (FK506; PROGRAFTM), mycophenolate mofetil, and azathioprine (6-mercaptopurine), sirolimus (rapamycin), deoxyspergualin, leflunomide and its malononitriloamide analogs; and immunosuppressive proteins, including, for example, anti-CTLA antibodies and Ig fusions, anti-B lymphocyte stimulator antibodies (e.g., LYMPHOSTAT-BTM) and Ig fusions (BLyS-Ig), anti-CD20 antibodies (e.g., RITUXAN®); the fully human antibody HuMax-CD20, R-1594, IMMU-106, TRU-015,
  • suitable immunosuppressive drugs including, but not limited to, methotrexate, cyclophos
  • the antagonist anti-CD40 antibodies of this invention are administered at a concentration that is therapeutically effective to prevent or treat autoimmune diseases and/or inflammatory diseases.
  • the antibodies may be formulated using a variety of acceptable excipients known in the art.
  • the antibodies are administered by injection, for example, either intravenously, intraperitoneally, or subcutaneously. Methods to accomplish this administration are known to those of ordinary skill in the art. It may also be possible to obtain compositions that may be topically or orally administered, or which may be capable of transmission across mucous membranes.
  • Intravenous administration occurs preferably by infusion over a period of about 1 to about 10 hours, more preferably over about 1 to about 8 hours, even more preferably over about 2 to about 7 hours, still more preferably over about 4 to about 6 hours, depending upon the anti-CD40 antibody being administered.
  • the initial infusion with the pharmaceutical composition may be given over a period of about 4 to about 6 hours with subsequent infusions delivered more quickly.
  • Subsequent infusions maybe administered over a period of about 1 to about 6 hours, including, for example, about 1 to about 4 hours, about 1 to about 3 hours, or about 1 to about 2 hours.
  • a pharmaceutical composition ofthe invention is formulated to be compatible with its intended route of administration.
  • Examples of possible routes of administration include parenteral, (e.g., intravenous (IV), intramuscular (IM), intradermal, subcutaneous (SC), or infusion), oral and pulmonary (e.g., inhalation), nasal, transdermal (topical), transmucosal, and rectal administration.
  • parenteral e.g., intravenous (IV), intramuscular (IM), intradermal, subcutaneous (SC), or infusion
  • IV intravenous
  • IM intramuscular
  • SC subcutaneous
  • oral and pulmonary e.g., inhalation
  • nasal, transdermal (topical) transmucosal
  • rectal administration e.g., rectal administration.
  • Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerin, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide.
  • a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerin, propylene glycol or other synthetic solvents
  • antibacterial agents such as benzyl alcohol or methyl parabens
  • antioxidants
  • the parenteral preparation can be enclosed in ampoules, disposable syringes, or multiple dose vials made of glass or plastic.
  • the antagonist anti-CD40 antibodies are typically provided by standard technique within a pharmaceutically acceptable buffer, for example, sterile saline, sterile buffered water, propylene glycol, combinations ofthe foregoing, etc.
  • a pharmaceutically acceptable buffer for example, sterile saline, sterile buffered water, propylene glycol, combinations ofthe foregoing, etc.
  • Methods for preparing parenterally administrable agents are described in Remington 's Pharmaceutical Sciences (18 th ed.; Mack Publishing Company, Eaton, Pennsylvania, 1990), herein incorporated by reference. See also, for example, WO 98/56418, which describes stabilized antibody pharmaceutical formulations suitable for use in the methods ofthe present invention.
  • the amount of at least one antagonist anti-CD40 antibody or fragment thereof to be administered is readily determined by one of ordinary skill in the art without undue experimentation. Factors influencing the mode of administration and the respective amount of at least one antagonist anti-CD40 antibody (or fragment thereof) include, but are not limited to, the particular disease undergoing therapy, the severity ofthe disease, the history ofthe disease, and the age, height, weight, health, and physical condition of the individual undergoing therapy. Similarly, the amount of antagonist anti-CD40 antibody or fragment thereof to be administered will be dependent upon the mode of administration and whether the subject will undergo a single dose or multiple doses of this agent. Generally, a higher dosage of anti-CD40 antibody or fragment thereof is preferred with increasing weight ofthe patient undergoing therapy.
  • the dose of anti- CD40 antibody or fragment thereof to be administered is in the range from about 0.003 mg/kg to about 50 mg/kg, preferably in the range of 0.01 mg/kg to about 40 mg/kg.
  • the dose can be 0.01 mg/kg, 0.03 mg/kg, 0.1 mg/kg, 0.3 mg/kg, 0.5 mg/kg, 1 mg/kg, 1.5 mg/kg, 2 mg/kg, 2.5 mg/kg, 3 mg/kg, 5 mg kg, 7 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 35 mg/kg, 40 mg/kg, 45 mg kg, or 50 mg/kg.
  • the method comprises admimstration of multiple doses of antagonist anti-CD40 antibody or fragment thereof.
  • the method may comprise administration of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, or more therapeutically effective doses of a pharmaceutical composition comprising an antagonist anti-CD40 antibody or fragment thereof.
  • the frequency and duration of administration of multiple doses ofthe pharmaceutical compositions comprising anti-CD40 antibody or fragment thereof can be readily determined by one of skill in the art without undue experimentation.
  • treatment of a subject with a therapeutically effective amount of an antibody can include a single treatment or, preferably, can include a series of treatments.
  • a subject is treated with antagonist anti-CD40 antibody or antigen-binding fragment thereof in the range of between about 0.1 to 20 mg/kg body weight, once per week for between about 1 to 10 weeks, preferably between about 2 to 8 weeks, more preferably between about 3 to 7 weeks, and even more preferably for about 4, 5, or 6 weeks. Treatment may occur annually to prevent relapse or upon indication of relapse. It will also be appreciated that the effective dosage of antibody or antigen-binding fragment thereof used for treatment may increase or decrease over the course of a particular treatment. Changes in dosage may result and become apparent from the results of diagnostic assays as described herein.
  • the dosing regimen includes a first administration of a therapeutically effective dose of at least one anti-CD40 antibody or fragment thereof on days 1, 7, 14, and 21 of a treatment period.
  • the dosing regimen includes a first administration of a therapeutically effective dose of at least one anti-CD40 antibody or fragment thereof on days 1, 2, 3, 4, 5, 6, and 7 of a week in a treatment period.
  • Treatment periods may be subsequent or separated from each other by a day, a week, 2 weeks, a month, 3 months, 6 months, or a year. ranges from about 0.003 mg/kg to about 50 mg/kg, from about 0.01 mg/kg to about 40 mg/kg, from about 0.01 mg/kg to about 30 mg/kg, from about 0.1 mg/kg to about 30 mg/kg, from about 0.5 mg/kg to about 30 mg/kg, from about 1 mg/kg to about 30 mg kg, from about 3 mg/kg to about 30 mg/kg, from about 3 mg/kg to about 25 mg/kg, from about 3 mg/kg to about 20 mg/kg, from about 5 mg/kg to about 15 mg/kg, or from about 7 mg kg to about 12 mg/kg.
  • the dose of any one antagonist anti- CD40 antibody or antigen-binding fragment thereof can be 0.003 mg/kg, 0.01 mg/kg, 0.03 mg/kg, 0.1 mg/kg, 0.3 mg/kg, 0.5 mg/kg, 1 mg/kg, 1.5 mg/kg, 2 mg/kg, 2.5 mg/kg, 3 mg/kg, 5 mg/kg, 7 mg/kg, 10 mg/kg, 15 mg/kg, 20 mg/kg, 25 mg/kg, 30 mg/kg, 35 mg/kg, 40 mg/kg, 45 mg/kg, 50 mg/kg, or other such doses falling within the range of about 0.003 mg/kg to about 50 mg/kg.
  • the same therapeutically effective dose of an antagonist anti-CD40 antibody or antigen-binding fragment thereof can be administered throughout each week of antibody dosing.
  • different therapeutically effective doses of an antagonist anti-CD40 antibody or antigen-binding fragment thereof can be used over the course of a treatment period.
  • the initial therapeutically effective dose of an antagonist anti-CD40 antibody or antigen-binding fragment thereof as defined elsewhere herein can be in the lower dosing range (i.e., about 0.003 mg/kg to about 20 mg/kg) with subsequent doses falling within the higher dosing range (i.e., from about 20 mg/kg to about 50 mg/kg).
  • the initial therapeutically effective dose of an antagonist anti-CD40 antibody or antigen-binding fragment thereof as defined elsewhere herein can be in the upper dosing range (i.e., about 20 mg/kg to about 50 mg/kg) with subsequent doses falling within the lower dosing range (i.e., 0.003 mg/kg to about 20 mg/kg).
  • the initial therapeutically effective dose ofthe antagonist anti-CD40 antibody or antigen-binding fragment thereof is about 20 mg/kg to about 35 mg/kg, including about 20 mg/kg, about 25 mgkg, about 30 mg kg, and about 35 mg/kg, and subsequent therapeutically effective doses ofthe antagonist anti-CD40 antibody or antigen binding fragment thereof are about 5 mg/kg to about 15 mg/kg, including about 5 mg/kg, 8 mg/kg, 10 mg/kg, 12 mg/kg, and about 15 mg/kg.
  • antagonist anti-CD40 antibody therapy is initiated by administering a "loading dose" ofthe antibody or antigen-binding fragment thereof to the subject in need of antagonist anti-CD40 antibody therapy.
  • loading dose is intended an initial dose ofthe antagonist anti-CD40 antibody or antigen-binding fragment thereof that is admimstered to the subject, where the dose ofthe antibody or antigen-binding fragment thereof administered falls within the higher dosing range (i.e., from about 20 mg/kg to about 50 mg/kg).
  • the "loading dose” can be administered as a single administration, for example, a single infusion where the antibody or antigen- binding fragment thereof is administered IV, or as multiple administrations, for example, multiple infusions where the antibody or antigen-binding fragment thereof is administered IV, so long as the complete "loading dose" is administered within about a 24-hour period.
  • the subject is then administered one or more additional therapeutically effective doses ofthe antagonist anti- CD40 antibody or antigen-binding fragment thereof.
  • additional therapeutically effective doses can be administered, for example, according to a weekly dosing schedule, or once every two weeks, once every three weeks, or once every four weeks. In such embodiments, the subsequent therapeutically effective doses generally fall within the lower dosing range (i.e., 0.003 mg/kg to about 20 mg/kg).
  • the subsequent therapeutically effective doses ofthe antagonist anti-CD40 antibody or antigen-binding fragment thereof are administered according to a "maintenance schedule," wherein the therapeutically effective dose ofthe antibody or antigen-binding fragment thereof is administered once a month, once every 6 weeks, once every two months, once every 10 weeks, once every three months, once every 14 weeks, once every four months, once every 18 weeks, once every five months, once every 22 weeks, once every six months, once every 7 months, once every 8 months, once every 9 months, once every 10 months, once every 11 months, or once every 12 months.
  • the therapeutically effective doses ofthe antagonist anti-CD40 antibody or antigen- binding fragment thereof fall within the lower dosing range (i.e., 0.003 mg/kg to about 20 mg/kg), particularly when the subsequent doses are administered at more frequent intervals, for example, once every two weeks to once every month, or within the higher dosing range (i.e., from about 20 mg kg to about 50 mg/kg), particularly when the subsequent doses are administered at less frequent intervals, for example, where subsequent doses are administered about one month to about 12 months apart.
  • the antagonist anti-CD40 antibodies present in the pharmaceutical compositions described herein for use in the methods ofthe invention may be native or obtained by recombinant techniques, and may be from any source, including mammalian sources such as, e.g., mouse, rat, rabbit, primate, pig, and human.
  • mammalian sources such as, e.g., mouse, rat, rabbit, primate, pig, and human.
  • polypeptides are derived from a human source, and more preferably are recombinant, human proteins from hybridoma cell lines.
  • the pharmaceutical compositions useful in the methods ofthe invention may comprise biologically active variants ofthe antagonist anti-CD40 antibodies ofthe invention.
  • variants should retain the desired biological activity ofthe native polypeptide such that the pharmaceutical composition comprising the variant polypeptide has the same therapeutic effect as the pharmaceutical composition comprising the native polypeptide when administered to a subject. That is, the variant anti-CD40 antibody will serve as a therapeutically active component in the pharmaceutical composition in a manner similar to that observed for the native antagonist antibody, for example CHIR-5.9 or CHIR-12.12 as expressed by the hybridoma cell line 5.9 or 12.12, respectively. Methods are available in the art for determining whether a variant anti-CD40 antibody retains the desired biological activity, and hence serves as a therapeutically active component in the pharmaceutical composition.
  • Biological activity of antibody variants can be measured using assays specifically designed for measuring activity ofthe native antagonist antibody, including assays described in the present invention.
  • Any pharmaceutical composition comprising an antagonist anti-CD40 antibody having the binding properties described herein as the therapeutically active component can be used in the methods ofthe invention.
  • liquid, lyophilized, or spray-dried compositions comprising one or more ofthe antagonist anti-CD40 antibodies ofthe invention may be prepared as an aqueous or nonaqueous solution or suspension for subsequent administration to a subject in accordance with the methods ofthe invention.
  • Each of these compositions will comprise at least one ofthe antagonist anti-CD40 antibodies ofthe present invention as a therapeutically or prophylactically active component.
  • the anti-CD40 antibody is specifically incorporated into the composition to bring about a desired therapeutic or prophylactic response with regard to treatment, prevention, or diagnosis of a disease or condition within a subject when the pharmaceutical composition is administered to that subject.
  • the pharmaceutical compositions comprise appropriate stabilizing agents, bulking agents, or both to minimize problems associated with loss of protein stability and biological activity during preparation and storage.
  • Formulants may be added to pharmaceutical compositions comprising an antagonist anti-CD40 antibody ofthe invention. These formulants may include, but are not limited to, oils, polymers, vitamins, carbohydrates, amine acids, salts, buffers, albumin, surfactants, or bulking agents.
  • carbohydrates include sugar or sugar alcohols such as mono-, di-, or polysaccharides, or water soluble glucans.
  • the saccharides or glucans can include fructose, glucose, mannose, sorbose, xylose, maltose, sucrose, dextran, pullulan, dextrin, and ⁇ cyclodex trin, soluble starch, hydroxye thyl starch, and carboxymethylcellulose, or mixtures thereof.
  • “Sugar alcohol” is defined as a C to C 8 hydrocarbon having a hydroxyl group and includes galactitol, inositol, mannitol, xylitol, sorbitol, glycerol, and arabitol. These sugars or sugar alcohols may be used individually or in combination.
  • the sugar or sugar alcohol concentration is between 1.0% and 7% w/v., more preferably between 2.0% and 6.0% w/v.
  • amino acids include levorotary (L) forms of carnitine, arginine, andbetaine; however, other amino acids may be added.
  • Preferred polymers include polyvinylpyrrolidone (PVP) with an average molecular weight between 2,000 and 3,000, or polyethylene glycol (PEG) with an average molecular weight between 3,000 and 5,000.
  • PVP polyvinylpyrrolidone
  • PEG polyethylene glycol
  • Surfactants that can be added to the formulation are shown in EP Nos. 270,799 and 268,110.
  • antibodies can be chemically modified by covalent conjugation to a polymer to increase their circulating half-life, for example.
  • Preferred polymers, and methods to attach them to peptides are shown in U.S. Patent Nos. 4,766,106; 4,179,337; 4,495,285; and 4,609,546; which are all hereby incorporated by reference in their entireties.
  • Preferred polymers are polyoxyethylated polyols and polyethylene glycol (PEG).
  • PEG is soluble in water at room temperature and has the general formula: R(O— CH 2 --CH 2 ) n O--R where R can be hydrogen, or a protective group such as an alkyl or alkanol group.
  • R can be hydrogen, or a protective group such as an alkyl or alkanol group.
  • the protective group has between 1 and 8 carbons, more preferably it is methyl.
  • n is a positive integer, preferably between 1 and 1,000, more preferably between 2 and 500.
  • the PEG has a preferred average molecular weight between 1,000 and 40,000, more preferably between 2,000 and 20,000, most preferably between 3,000 and 12,000.
  • PEG has at least one hydroxy group, more preferably it is a terminal hydroxy group. It is this hydroxy group which is preferably activated to react with a free amino group on the inhibitor.
  • the type and amount ofthe reactive groups may be varied to achieve a covalently conjugated PEG/antibody ofthe present invention.
  • Water-soluble polyoxyethylated polyols are also useful in the present invention. They include polyoxyethylated sorbitol, polyoxyethylated glucose, polyoxyethylated glycerol (POG), and the like. POG is preferred.
  • the glycerol backbone of polyoxyethylated glycerol is the same backbone occurring naturally in, for example, animals and humans in mono-, di-, triglycerides. Therefore, this branching would not necessarily be seen as a foreign agent in the body.
  • the POG has a preferred molecular weight in the same range as PEG.
  • the structure for POG is shown in Knauf et al. (1988) J. Bio. Chem. 263:15064-15070, and a discussion of POG/IL-2 conjugates is found in U.S. Patent No. 4,766,106, both of which are hereby incorporated by reference in their entireties.
  • Another drug delivery system for increasing circulatory half-life is the liposome.
  • the antagonist anti-CD40 antibody or antigen-binding fragment thereof should retain its physical and/or chemical stability and have the desired biological activity, i.e., one or more ofthe antagonist activities defined herein above, including, but not limited to, inhibition of immunoglobulin secretion by normal human peripheral B cells stimulated by T cells; inhibition of survival and/or proliferation of normal human peripheral B cells stimulated by Jurkat T cells; inhibition of survival and/or proliferation of normal human peripheral B cells stimulated by CD40L-expressing cells or soluble
  • CD40 ligand sCD40L
  • inhibition of "survival" anti-apoptotic intracellular signals in any cell stimulated by sCD40L or solid-phase CD40L inhibition of CD40 signal transduction in any cell upon ligation with sCD40L or solid-phase CD40L
  • inhibition of proliferation of human malignant B cells as noted elsewhere herein.
  • Methods for monitoring protein stability are well known in the art. See, for example, Jones (1993) Adv. Drug Delivery Rev. 10:29-90; Lee, ed. (1991) Peptide and Protein Drug Delivery (Marcel Dekker, Inc., New York, New York); and the stability assays disclosed herein below. Generally, protein stability is measured at a chosen temperature for a specified period of time.
  • a stable antibody pharmaceutical formulation provides for stability ofthe antagonist anti-CD40 antibody or antigen-binding fragment thereof when stored at room temperature (about 25 °C) for at least 1 month, at least 3 months, or at least 6 months, and/or is stable at about 2-8°C for at least 6 months, at least 9 months, at least 12 months, at least 18 months, at least 24 months.
  • a protein such as an antibody when formulated in a pharmaceutical composition, is considered to retain its physical stability at a given point in time if it shows no visual signs (i.e., discoloration or loss of clarity) or measurable signs (for example, using size- exclusion chromatography (SEC) or UV light scattering) of precipitation, aggregation, and/or denaturation in that pharmaceutical composition.
  • SEC size- exclusion chromatography
  • UV light scattering for example, using size- exclusion chromatography (SEC) or UV light scattering
  • a protein such as an antibody when formulated in a pharmaceutical composition, is considered to retain its chemical stability at a given point in time if measurements of chemical stability are indicative that the protein (i.e., antibody) retains the biological activity of interest in that pharmaceutical composition.
  • Methods for monitoring changes in chemical stability include, but are not limited to, methods to detect chemically altered forms ofthe protein such as result from clipping, using, for example, SDS-PAGE, SEC, and/or matrix-assisted laser desorption ionization/time of flight mass spectrometry; and degradation associated with changes in molecular charge (for example, associated with deamidation), using, for example, ion-exchange chromatography. See, for example, the methods disclosed herein below.
  • An antagonist anti-CD40 antibody or antigen-binding fragment thereof when formulated in a pharmaceutical composition, is considered to retain a desired biological activity at a given point in time if the desired biological activity at that time is within about 30%, preferably within about 20% ofthe desired biological activity exhibited at the time the pharmaceutical composition was prepared as determined in a suitable assay for the desired biological activity.
  • Assays for measuring the desired biological activity ofthe antagonist anti-CD40 antibodies disclosed herein, and antigen-binding fragments thereof can be performed as described in the Examples herein. See also the assays described in Schultze et al. (1998) Proc. Natl. Acad. Sci. USA 92:8200-8204; Denton et al. (1998) Pediatr. Transplant.
  • the antagonist anti-CD40 antibody for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof is formulated in a liquid pharmaceutical formulation.
  • the antagomst anti-CD40 antibody or antigen binding fragment thereof can be prepared using any method known in the art, including those methods disclosed herein above.
  • the antagonist anti-CD40 antibody for example, the CHIR-12.12 or CHIR- 5.9 monoclonal antibody, or antigen-binding fragment thereof is recombinantly produced in a CHO cell line. Following its preparation and purification, the antagonist anti-CD40 antibody or antigen-binding fragment thereof can be formulated as a liquid pharmaceutical formulation in the manner set forth herein.
  • the antagonist anti-CD40 antibody or antigen-binding fragment thereof is to be stored prior to its formulation, it can be frozen, ro example, at -20°C, and then thawed at room temperature for further formulation.
  • the liquid pharmaceutical formulation comprises a therapeutically effective amount of the antagonist anti-CD40 antibody or antigen-binding fragment thereof.
  • the amount of antibody or antigen-binding fragment thereof present in the formulation takes into consideration the route of administration and desired dose volume.
  • the liquid pharmaceutical composition comprises the antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 antibody, or antigen- binding fragment thereof at a concentration of about 0.1 mg/ml to about 50.0 mg/ml, about 0.5 mg/ml to about 40.0 mg/ml, about 1.0 mg/ml to about 30.0 mg/ml, about 5.0 mg/ml to about 25.0 mg/ml, about 5.0 mg/ml to about 20.0 mg/ml, or about 15.0 mg/ml to about 25.0 mg/ml.
  • the antagonist anti-CD40 antibody for example, the CHIR-12.12 or CHIR-5.9 antibody, or antigen- binding fragment thereof at a concentration of about 0.1 mg/ml to about 50.0 mg/ml, about 0.5 mg/ml to about 40.0 mg/ml, about 1.0 mg/ml to about 30.0 mg/ml, about 5.0 mg/ml to about 25.0 mg/ml, about 5.0 mg/ml to about 20.0 mg/
  • the liquid pharmaceutical composition comprises the antagonist anti-CD40 antibody or antigen-binding fragment thereof at a concentration of about 0.1 mg/ml to about 5.0 mg/ml, about 5.0 mg/ml to about 10.0 mg/ml, about 10.0 mg/ml to about 15.0 mg/ml, about 15.0 mg/ml to about 20.0 mg ml, about 20.0 mg/ml to about 25.0 mg/ml, about 25.0 mg/ml to about 30.0 mg/ml, about 30.0 mg/ml to about 35.0 mg/ml, about 35.0 mg/ml to about 40.0 mg/ml, about 40.0 mg/ml to about 45.0 mg/ml, or about 45.0 mg/ml to about 50.0 mg/ml.
  • the liquid pharmaceutical composition comprises the antagonist anti-CD40 antibody or antigen-binding fragment thereof at a concentration of about 15.0 mg/ml, about 16.0 mg/ml, about 17.0 mg/ml, about 18.0 mg/ml, about 19.0 mg/ml, about 20.0 mg/ml, about 21.0 mg/ml, about 22.0 mg/ml, about 23.0 mg/ml, about 24.0 mg/ml, or about 25.0 mg/ml.
  • the liquid pharmaceutical composition comprises the antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 antibody, or antigen- binding fragment thereof and a buffer that maintains the pH ofthe formulation in the range of about pH 5.0 to about pH 7.0, including about pH 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.1, 6.8, 6.9, 7.0, and other such values within the range of about pH 5.0 to about pH 7.0.
  • a buffer that maintains the pH ofthe formulation in the range of about pH 5.0 to about pH 7.0, including about pH 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.1, 6.8, 6.9, 7.0, and other such values within the range of about pH 5.0 to about pH 7.0.
  • the buffer maintains the pH ofthe formulation in the range of about pH 5.0 to about pH 6.5, about pH 5.0 to about pH 6.0, about pH 5.0 to about pH 5.5, about pH 5.5 to about 7.0, about pH 5.5 to about pH 6.5, or about pH 5.5 to about pH 6.0.
  • Any suitable buffer that maintains the pH ofthe liquid anti-CD40 antibody formulation in the range of about pH 5.0 to about pH 7.0 can be used in the formulation, so long as the physicochemical stability and desired biological activity ofthe antibody are retained as noted herein above.
  • Suitable buffers include, but are not limited to, conventional acids and salts thereof, where the counter ion can be, for example, sodium, potassium, ammonium, calcium, or magnesium.
  • Examples of conventional acids and salts thereof that can be used to buffer the pharmaceutical liquid formulation include, but are not limited to, succinic acid or succinate, citric acid or citrate, acetic acid or acetate, tartaric acid or tartarate, phosphoric acid or phosphate, gluconic acid or gluconate, glutamic acid or glutamate, aspartic acid or aspartate, maleic acid or maleate, and malic acid or malate buffers.
  • the buffer concentration within the formulation can be from about 1 mM to about 50 mM, including about 1 mM, 2 mM, 5 mM, 8 mM, 10 mM, 15 mM, 20 mM, 25 mM, 30 mM, 35 mM, 40 mM, 45 mM, 50 mM, or other such values within the range of about 1 mM to about 50 mM.
  • the buffer concentration within the formulation is from about 5 mM to about 15 mM, including about 5 mM, 6 mM, 7 mM, 8 mM, 9 mM, 10 mM, 11 mM, 12 mM, 13 mM, 14 mM, 15 mM, or other such values within the range of about 5 mM to about 15 mM.
  • the liquid pharmaceutical formulation comprises a therapeutically effective amount ofthe antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof and succinate buffer or citrate buffer at a concentration that maintains the pH ofthe formulation in the range of about pH 5.0 to about pH 7.0, preferably about pH 5.0 to about pH 6.5.
  • succinate buffer or "citrate buffer” is intended a buffer comprising a salt of succinic acid or a salt of citric acid, respectively.
  • the succinate or citrate counterion is the sodium cation, and thus the buffer is sodium succinate or sodium citrate, respectively. However, any cation is expected to be effective.
  • succinate or citrate cations include, but are not limited to, potassium, ammonium, calcium, and magnesium.
  • the succinate or citrate buffer concentration within the formulation can be from about 1 mM to about 50 mM, including about 1 mM, 2 mM, 5 mM, 8 mM, 10 mM, 15 mM, 20 mM, 25 mM, 30 mM, 35 mM, 40 mM, 45 mM, 50 mM, or other such values within the range of about 1 mM to about 50 mM.
  • the buffer concentration within the formulation is from about 5 mM to about 15 mM, including about 5 mM, 6 mM, 7 mM, 8 mM, 9 mM, 10 mM, 11 mM, 12 mM, 13 mM, 14 mM, or about 15 mM.
  • the liquid pharmaceutical formulation comprises the antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen- binding fragment thereof at a concentration of about 0.1 mg/ml to about 50.0 mg/ml, or about 5.0 mg/ml to about 25.0 mg/ml, and succinate or citrate buffer, for example, sodium succinate or sodium citrate buffer, at a concentration of about 1 mM to about 20 mM, about 5 mM to about 15 mM, preferably about 10 mM.
  • the antagonist anti-CD40 antibody for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen- binding fragment thereof at a concentration of about 0.1 mg/ml to about 50.0 mg/ml, or about 5.0 mg/ml to about 25.0 mg/ml
  • succinate or citrate buffer for example, sodium succinate or sodium citrate buffer
  • the liquid pharmaceutical formulation comprising a therapeutically effective amount of the antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof, and a buffer to maintain the pH ofthe formulation within the range of about pH 5.0 to about pH 7.0 can further comprise an amount of an isotonizing agent sufficient to render the formulation near isotonic.
  • the antagonist anti-CD40 antibody for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof
  • a buffer to maintain the pH ofthe formulation within the range of about pH 5.0 to about pH 7.0 can further comprise an amount of an isotonizing agent sufficient to render the formulation near isotonic.
  • the aqueous formulation has an osmolarity of about 240 mmol/kg to about 360 mmol kg, preferably about 240 to about 340 mmol/kg, more preferably about 250 to about 330 mmol kg, even more preferably about 260 to about 320 mmol/kg, still more preferably about 270 to about 310 mmol/kg.
  • Methods of determining the isotonicity of a solution are known to those skilled in the art. See, for example, Setnikar et al. (1959) J. Am. Pharm. Assoc. 48:628.
  • the isotonizing agent can be any reagent capable of adjusting the osmotic pressure ofthe liquid pharmaceutical formulation ofthe present invention to a value nearly equal to that of a body fluid. It is desirable to use a physiologically acceptable isotonizing agent.
  • the liquid pharmaceutical formulation comprising a therapeutically effective amount of the antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof, and a buffer to maintain the pH ofthe formulation within the range of about pH 5.0 to about pH 7.0, can further comprise components that can be used to provide isotonicity, for example, sodium chloride; amino acids such as alanine, valine, and glycine; sugars and sugar alcohols (polyols), including, but not limited to, glucose, dextrose, fructose, sucrose, maltose, mannitol, trehalose, glycerol, sorbitol, and xylitol; acetic acid, other organic acids or their salts, and relatively minor amounts of citrates or phosphates.
  • the antagonist anti-CD40 antibody for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof,
  • the liquid pharmaceutical formulation comprising a therapeutically effective amount ofthe antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof, and a buffer to maintain the pH ofthe formulation within the range of about pH 5.0 to about pH 7.0, further comprises sodium chloride as the isotonizing agent.
  • concentration of sodium chloride in the formulation will depend upon the contribution of other components to tonicity.
  • the concentration of sodium chloride is about 50 mM to about 300 mM, about 50 mM to about 250 mM, about 50 mM to about 200 mM, about 50 mM to about 175 mM, about 50 mM to about 150 mM, about 75 mM to about 175 mM, about 75 mM to about 150 mM, about 100 mM to about 175 mM, about 100 mM to about 200 mM, about 100 mM to about 150 mM, about 125 mM to about 175 mM, about 125 mM to about 150 mM, about 130 mM to about 170 mM, about 130 mM to about 160 mM, about 135 mM to about 155 mM, about 140 mM to about 155 mM, or about 145 mM to about 155 mM.
  • the concentration of sodium chloride is about 150 mM. In other such embodiments, the concentration of sodium chloride is about 150 mM, the buffer is sodium succinate or sodium citrate buffer at a concentration of about 5 mM to about 15 mM, the liquid pharmaceutical formulation comprises a therapeutically effective amount ofthe antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof, and the formulation has a pH of about pH 5.0 to about pH 7.0, about pH 5.0 to about pH 6.0, or about pH 5.5 to about pH 6.5.
  • the liquid pharmaceutical formulation comprises the antagonist anti- CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof, at a concentration of about 0.1 mg/ml to about 50.0 mg/ml or about 5.0 mg/ml to about 25.0 mg/ml, about 150 mM sodium chloride, and about 10 mM sodium succinate or sodium citrate, at a pH of about pH 5.5.
  • Protein degradation due to freeze thawing or mechanical shearing during processing of a liquid pharmaceutical formulations ofthe present invention can be inhibited by incorporation of surfactants into the formulation in order to lower the surface tension at the solution-air interface.
  • the liquid pharmaceutical formulation comprises a therapeutically effective amount ofthe antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof, a buffer to maintain the pH ofthe formulation within the range of about pH 5.0 to about pH 7.0, and further comprises a surfactant.
  • the antagonist anti-CD40 antibody for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof
  • a buffer to maintain the pH ofthe formulation within the range of about pH 5.0 to about pH 7.0
  • a surfactant for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof.
  • the liquid pharmaceutical formulation comprises a therapeutically effective amount ofthe antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof, a buffer to maintain the pH ofthe formulation within the range of about pH 5.0 to about pH 7.0, an isotonizing agent such as sodium chloride at a concentration of about 50 mM to about 300 mM, and further comprises a surfactant.
  • the antagonist anti-CD40 antibody for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof
  • a buffer to maintain the pH ofthe formulation within the range of about pH 5.0 to about pH 7.0
  • an isotonizing agent such as sodium chloride at a concentration of about 50 mM to about 300 mM
  • surfactant further comprises a surfactant.
  • Typical surfactants employed are nonionic surfactants, including polyoxyethylene sorbitol esters such as polysorbate 80 (Tween 80) and polysorbate 20 (Tween 20); polyoxypropylene-polyoxyethylene esters such as Pluronic F68; polyoxyethylene alcohols such as Brij 35; simethicone; polyethylene glycol such as PEG400; lysophosphatidylcholine; andpolyoxyethylene-p-t-octylphenol such as Triton X-100.
  • Classic stabilization of pharmaceuticals by surfactants or emulsifiers is described, for example, in Levine et al. (1991) J. Parenteral Sci. Technol. 45 (3): 160- 165, herein incorporated by reference.
  • a preferred surfactant employed in the practice ofthe present invention is polysorbate 80. Where a surfactant is included, it is typically added in an amount from about 0.001 % to about 1.0% (w/v), about 0.001% to about 0.5%, about 0.001% to about 0.4%, about 0.001% to about 0.3%, about 0.001% to about 0.2%, about 0.005% to about 0.5%, about 0.005% to about 0.2%, about 0.01% to about 0.5%, about 0.01% to about 0.2%, about 0.03% to about 0.5%, about 0.03% to about 0.3%, about 0.05% to about 0.5%, or about 0.05% to about 0.2%.
  • the liquid pharmaceutical formulation comprises a therapeutically effective amount ofthe antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof
  • the buffer is sodium succinate or sodium citrate buffer at a concentration of about 1 mM to about 50 mM, about 5 mM to about 25 mM, or about 5 mM to about 15 mM
  • the formulation has a pH of about pH 5.0 to about pH 7.0, about pH 5.0 to about pH 6.0, or about pH 5.5 to about pH 6.5
  • the formulation further comprises a surfactant, for example, polysorbate 80, in an amount from about 0.001% to about 1.0% or about 0.001% to about 0.5%.
  • Such formulations can optionally comprise an isotonizing agent, such as sodium chloride at a concentration of about 50 mM to about 300 mM, about 50 mM to about 200 mM, or about 50 mM to about 150 mM.
  • the liquid pharmaceutical formulation comprises the antagonist anti-CD40 antibody, for example, the CHIR-12.12 or CHIR-5.9 monoclonal antibody, or antigen-binding fragment thereof, at a concentration of about 0.1 mg/ml to about 50.0 mg/ml or about 5.0 mg/ml to about 25.0 mg/ml, including about 20.0 mg/ml; about 50 mM to about 200 mM sodium chloride, including about 150 mM sodium chloride; sodium succinate or sodium citrate at about 5 mM to about 20 mM, including about 10 mM sodium succinate or sodium citrate; sodium chloride at a concentration of about 50 mM to about 200 mM, including about 150 mM; and optionally a surfactant, for example, poly(s
  • the liquid pharmaceutical formulation can be essentially free of any preservatives and other carriers, excipients, or stabilizers noted herein above.
  • the formulation can include one or more preservatives, for example, antibacterial agents, pharmaceutically acceptable carriers, excipients, or stabilizers described herein above provided they do not adversely affect the physicochemical stability ofthe antagonist anti- CD40 antibody or antigen-binding fragment thereof.
  • acceptable carriers, excipients, and stabilizers include, but are not limited to, additional buffering agents, co- solvents, surfactants, antioxidants including ascorbic acid and methionine, chelating agents such as EDTA, metal complexes (for example, Zn-protein complexes), and biodegradable polymers such as polyesters.
  • liquid pharmaceutical formulation or other pharmaceutical composition described herein can be lyophilized to prevent degradation.
  • Methods for lyophilizing liquid compositions are known to those of ordinary skill in the art.
  • the composition may be reconstituted with a sterile diluent (Ringer's solution, distilled water, or sterile saline, for example) that may include additional ingredients.
  • the composition is preferably administered to subjects using those methods that are known to those skilled in the art.
  • the present invention also provides for the use of an antagonist anti-CD40 antibody or antigen-binding fragment thereof in the manufacture of a medicament for treating an autoimmune disease and or inflammatory disease in a subject, wherein the medicament is coordinated with treatment with at least one other therapy.
  • an antagonist anti-CD40 antibody or antigen-binding fragment thereof in the manufacture of a medicament for treating an autoimmune disease and or inflammatory disease in a subject, wherein the medicament is coordinated with treatment with at least one other therapy.
  • coordinated is intended the medicament is to be used either prior to, during, or after treatment ofthe subject with at least one other therapy.
  • other therapies include, but are not limited to, those described herein above, i.e., surgery or surgical procedures (e.g.
  • the present invention provides for the use ofthe monoclonal antibody CHIR-12.12 or CHIR-5.9 in the manufacture of a medicament for treating an autoimmune disease and/or inflammatory disease in a subject, wherein the medicament is coordinated with treatment with at least one other therapy as noted herein above
  • the medicament comprising the antagonist anti-CD40 antibody for example, the monoclonal antibody CHIR-12.12 or CHIR-5.9 disclosed herein, or antigen-binding fragment thereof is coordinated with treatment with two other therapies.
  • the medicament comprising the antagonist anti-CD40 antibody is coordinated with two other therapies, use ofthe medicament can be prior to, during, or after treatment ofthe subject with either or both ofthe other therapies.
  • the invention also provides for the use of an antagonist anti-CD40 antibody, for example, the monoclonal antibody CHIR-12.12 or CHIR-5.9 disclosed herein, or antigen- binding fragment thereof in the manufacture of a medicament for treating an autoimmune disease and/or inflammatory disease in a subject, wherein the medicament is used in a subject that has been pretreated with at least one other therapy.
  • an antagonist anti-CD40 antibody for example, the monoclonal antibody CHIR-12.12 or CHIR-5.9 disclosed herein, or antigen- binding fragment thereof in the manufacture of a medicament for treating an autoimmune disease and/or inflammatory disease in a subject, wherein the medicament is used in a subject that has been pretreated with at least one other therapy.
  • pretreated or “pretreatment” is intended the subject has been treated with one or more other therapies prior to receiving the medicament comprising the antagonist anti-CD40 antibody or antigen-binding fragment thereof.
  • Pretreated or “pretreatment” includes subjects that have been treated with the other therapy, or other therapies, within 2 years, within 18 months, within 1 year, within 6 months, within 2 months, within 6 weeks, within 1 month, within 4 weeks, within 3 weeks, within 2 weeks, within 1 week, within 6 days, within 5 days, within 4 days, within 3 days, within 2 days, or even within 1 day prior to initiation of treatment with the medicament comprising the antagonist anti-CD40 antibody, for example, the monoclonal antibody CHIR-12.12 or CHIR-5.9 disclosed herein, or antigen-binding fragment thereof. It is not necessary that the subject was a responder to pretreatment with the prior therapy, or prior therapies.
  • the subject that receives the medicament comprising the antagonist anti-CD40 antibody or antigen- binding fragment thereof could have responded, or could have failed to respond, to pretreatment with the prior therapy, or to one or more ofthe prior therapies where pretreatment comprised multiple therapies.
  • the following examples are offered by way of illustration and not by way of limitation.
  • the antagonist anti-CD40 antibodies used in the examples below are CHIR-5.9 and CHIR-12.12.
  • the CHIR-5.9 and CHIR-12.12 anti-CD40 antibodies are human IgGi subtype anti-human CD40 monoclonal antibodies (mAbs) generated by immunization of transgenic mice bearing the human IgGi heavy chain locus and the human K light chain locus (XenoMouse ® technology (Abgenix; Fremont, California)).
  • SF9 insect cells expressing CD40 extracellular domain were used as immunogen.
  • splenocytes from immunized mice were fused with SP 2/0 or P 3 x 63Ag8.653 murine myeloma cells at a ratio of 10:1 using 50% polyethylene glycol as previously described by de Boer et al. (1988) J. Immunol. Meth. 113:143.
  • the fused cells were resuspended in complete IMDM medium supplemented with hypoxanthine ( 0.1 mM), aminopterin ( 0.01 mM), thymidine ( 0.016 mM), and 0.5 ng/ml hIL-6 (Genzyme, Cambridge, Massachusetts).
  • the fused cells were then distributed between the wells of 96-well tissue culture plates, so that each well contained 1 growing hybridoma on average. After 10-14 days, the supernatants ofthe hybridoma populations were screened for specific antibody production. For the screening of specific antibody production by the hybridoma clones, the supernatants from each well were pooled and tested for anti- CD40 activity specificity by ELISA first. The positives were then used for fluorescent cell staining of EBV-transformed B cells using a standard FACS assay. Positive hybridoma cells were cloned twice by limiting dilution in IMDM/FBS containing 0.5 ng/ml hIL-6.
  • mice spleens were fused with the mouse myeloma SP2/0 cells to generate 895 antibodies that recognize recombinant CD40 in ELISA.
  • approximately 10% of hybridomas produced using Abgenix XenoMouse ® technology may contain mouse lambda light chain instead of human kappa chain.
  • the antibodies containing mouse light lambda chain were selected out.
  • a subset of 260 antibodies that also showed binding to cell-surface CD40 were selected for further analysis.
  • Stable hybridomas selected during a series of subcloning procedures were used for further characterization in binding and functional assays. For further details ofthe selection process, see copending provisional applications both entitled "Antagonist Anti-CD40 Monoclonal Antibodies and Methods for Their Use" filed
  • CMCC#12047 Mouse hybridoma line 131.2F8.5.9 (CMCC#12047) and hybridoma line 153.8E2.D10.D6.12.12 (CMCC#12056) have been deposited with the American Type Culture Collection (ATCC; 10801 University Boulevard., Manassas, Virginia 20110-2209 (USA)) under Patent Deposit Number PTA-5542 and PTA-5543, respectively.
  • ATCC American Type Culture Collection
  • the cDNAs encoding the variable regions ofthe candidate antibodies were amplified by PCR, cloned, and sequenced.
  • the amino acid sequences for the light chain and heavy chain ofthe CHIR-12.12 antibody are set forth in Figures 1 A and IB, respectively.
  • SEQ LD NO: 1 coding sequence for light chain for mAb CHIR-12.12
  • SEQ ID NO:3 coding sequence for heavy chain for mAb CHIR-12.12
  • the amino acid sequences for the light chain and heavy chain ofthe CHIR-5.9 antibody are set forth in Figures 3 A and 3B, respectively.
  • SEQ ID NO:6 light chain for mAb CfflR-5.9
  • SEQ ID NO:7 heavy chain for mAb CHIR-5.9
  • a variant ofthe heavy chain for mAb CHIR-5.9 is shown in Figure 3B (see also SEQ LD NO:8), which differs from SEQ ID NO:7 in having a serine residue substituted for the alanine residue at position 158 of SEQ ID NO:7.
  • CDRs complementarity determining regions
  • the diversity in the CDR3 region of V H is believed to most significantly determine antibody specificity.
  • CHIR-5.9 and CHIR-12.12 bind specifically to human CD40 and can prevent CD40-ligand binding. Both mAbs can compete off CD40- ligand pre-bound to cell surface CD40.
  • CHIR-5.9 The binding affinity of CHIR-5.9 to human CD40 is 1.2xl0 "8 M and the binding affinity of CHIR-12.12 to human CD40 is 5xl0 "10 M.
  • the CHIR-12.12 and CHIR-5.9 monoclonal antibodies are strong antagonists and inhibit in vitro CD40 ligand-mediated proliferation of normal B cells.
  • Example 1 Blocks CD40L-Mediated Cell Signaling Soluble CD40 ligand (CD40L) activates B cells and induces various aspects of functional responses, including enhancement of survival and proliferation, and activation of NFKB, ERK MAPK, PI3K/Akt, and ⁇ 38 signaling pathways.
  • CD40L- mediated CD40 stimulation provides survival signals by reduction of cleaved PARP and induction ofthe anti-apoptotic proteins, XIAP and Mcl-1, in normal B cells.
  • CD40L- mediated CD40 stimulation also recruits TRAF2 and TRAF3 to bind CD40 cytoplasmic domain. The following studies demonstrate that CHIR-12.12 directly inhibited all of these stimulation effects on normal human B cells.
  • CHIR-12.12 treatment resulted in increased cleavage of caspase-9, caspase-3, and PARP as well as reduction of XIAP and Mcl-1 in a time- and dose-dependent manner, restoring B cell apoptosis.
  • Treatment with CHIR-12.12 also inhibited phosphorylation of IKB kinase (IKK) ⁇ and ⁇ (NFKB pathway), ERK, Akt, and p38 in response to CD40L-mediated CD40 stimulation. Further, it was found that CHIR-12.12 did not trigger these apoptotic effects without initial CD40L-mediated CD40 stimulation.
  • IKK IKB kinase
  • CHIR-12.12 inhibited survival mediated by CD40 ligand by inducing cleavage of PARP.
  • 0.6 x 10 6 normal human B cells from healthy donors were stimulated with 1 ⁇ g/ml sCD40L (Alexis Corp., Bingham, Nottinghamshire, UK).
  • CHIR-12.12 (10 ⁇ g/ml) and control IgG were then added. Cells were collected at 0, 20 minutes, 2 hours, 6 hours, 18 hours, and 26 hours.
  • Cleaved caspase-9, cleaved caspase-3, cleaved PARP, and ⁇ -actin controls were detected in cell lysates by Western blot.
  • CD40L-mediated CD40 stimulation provided survival signals as it did not result in increases of cleaved caspase-9, cleaved caspase-3, or cleaved PARP over time, indicating that the cells were not undergoing apoptosis.
  • treatment with CHIR-12.12 resulted in an increase of these cleavage products, indicating that CHIR- 12.12 treatment abrogated the effects of CD40L binding on survival signaling in sCD40L-stimulated normal B cells, restoring B cell apoptosis (data not shown).
  • CHIR-12.12 inhibited expression of "survival" anti-apoptotic proteins.
  • 0.6 x 10 normal human B cells from healthy donors 0.6 x 10 normal human B cells from healthy donors
  • sCD40L (Alexis Corp., Bingham, Nottinghamshire, UK). CHIR-12.12 (10 ⁇ g/ml) and control IgG were then added. Cells were collected at 0, 20 minutes, 2 hours, 6 hours, 18 hours, and 26 hours. Mcl-1, XIAP, CD40, and ⁇ -actin controls were detected in cell lysates by Western blot. Briefly, sCD40L stimulation resulted in sustained expression of Mcl-1 and XIAP over time. However, treatment ofthe sCD40L-stimulated cells with CHIR 12.12 resulted in a decrease in expression of these proteins overtime (data not shown).
  • CHIR-12.12 treatment inhibited phosphorylation oflKKa (Ser 180) and IKK ⁇ (Ser 181) in normal B cells.
  • 1.0 x 10 6 normal human B cells from healthy donors were stimulated with 1 ⁇ g/ml sCD40L (Alexis Corp., Bingham, Nottinghamshire, UK).
  • CHIR-12.12 (10 ⁇ g/ml) and control IgG were then added. Cells were collected at 0 and 20 minutes.
  • Phosphorylated IKK (Serl80) and IKK ⁇ (Ser 181) and total IKK ⁇ controls were detected in cell lysates by Western blot.
  • CHIR-12.12 treatment inhibited survival mediated by CD40 ligand in a dose-dependent manner.
  • 0.6 x 10 6 normal human B cells from healthy donors percent purity between 85-95%) were stimulated with 1 ⁇ g/ml sCD40L (Alexis Corp., Bingham, Nottinghamshire, UK).
  • CHIR-12.12 (0.01, 0.1, 0.2, 0.5, 1.0 ⁇ g/ml) and control IgG were then added. Cells were collected at 24 hours. Cleaved PARP, and ⁇ -actin controls were detected in cell lysates by Western blot.
  • CHIR-12.12 treatment resulted in increase of PARP cleavage in sCD40L stimulated cells in a dose-dependent manner and therefore abrogated the survival signaling pathway in sCD40L-stimulated normal B cells (data not shown).
  • CHIR-12.12 inhibited expression of "survival" anti-apoptotic proteins in a dose- dependent manner.
  • 0.6 x 10 6 normal human B cells from healthy donors were stimulated with 1 ⁇ g/ml sCD40L (Alexis Corp., Bingham, Nottinghamshire, UK).
  • CHIR-12.12 0.5, 2, and 10 ⁇ g ml
  • control IgG were then added.
  • Cells were collected at 22 hours.
  • Mcl-1, XIAP, cleaved PARP, and ⁇ - actin controls were detected in cell lysates by Western blot.
  • CHIR-12.12 treatment reduced Mcl-1 and XIAP expression and increased cleaved PARP expression in sCD40L-stimulated cells in a dose-dependent manner, and thus abrogated these blockades to the apoptotic pathway in sCD40L-stimulated no ⁇ nal B cells (data not shown).
  • CHIR-12.12 did not affect expression of anti-apoptotic proteins, cleaved-PARP, and XIAP, in the absence of soluble CD40L signaling.
  • 1.0 x 10° normal human B cells from healthy donors (percent purity between 85-95%) were treated with CHIR-12.12 (10 ⁇ g/ml) and control IgG only (i.e., cells were not pre-stimulated with sCD40L before adding antibody). Cells were collected at 0, 4, 14, and 16 hours.
  • XIAP, cleaved PARP, and ⁇ -actin controls were detected in cell lysates by Western blot.
  • CHIR-12.12 inhibits phosphorylation ofIKKa (Serl80) andIKK ⁇ (Serl81), Akt, ERK, andp38 in normal B cells. ha these experiments, 1.0 x 10 6 normal human B cells from healthy donors (percent purity between 85-95%) were serum starved in 1% FBS-containing media and stimulated with 1 ⁇ g/ml sCD40L (Alexis Corp., Bingham, Nottinghamshire, UK). The cultures were treated with CHIR-12.12 (1 and 10 ⁇ g/ml) and control IgG. Cells were collected at 0 and 20 minutes.
  • Phospho-IKK ⁇ , phospho-IKK ⁇ , total KK ⁇ , phospho- ERK, total ERK, phospho-Akt, total Akt, phospho-p38, and total p38 were detected in cell lysates by Western blot. Briefly, sCD40L stimulation resulted in increases in IKK ⁇ / ⁇ phosphorylation, ERK phosphorylation, Akt phosphorylation, and p38 phosphorylation, thus leading to survival and or proliferation ofthe cells. Treatment ofthe cells with CHIR-12.12 abrogated the effects of sCD40L stimulation on these signaling pathways in normal B cells (data not shown).
  • CHIR 12.12 inhibits multiple signaling pathways such as PI3K and MEK /ERK in the CD40 signaling cascade.
  • 1.0 x 10 6 normal human B cells from healthy donors (percent purity between 85-95%) were serum starved in 1% FBS-containing media and stimulated with 1 ⁇ g/ml sCD40L (Alexis Corp., Bingham, Nottinghamshire, UK).
  • the cultures were also treated with CHIR-12.12 (1 and 10 ⁇ g/ml), Wortmanin, (a PI3K Akt inhibitor; 1 and 10 ⁇ M), LY 294002 (a PI3K/Akt inhibitor; 10 and 30 ⁇ M), and PD 98095 (a MEK inhibitor; 10 and 30 ⁇ g/ml).
  • CHIR-12.12 inhibits the binding of signaling molecules TRAF2 and TRAF3 to the cytoplasmic domain ofCD40 in normal B cells.
  • 4.0 x 10 6 normal human B cells from healthy donors (percent purity between 85-95%) were serum starved for four hours in 1% FBS- containing media and stimulated with 1 ⁇ g/ml sCD40L (Alexis Corp., Bingham, Nottinghamshire, UK) for 20 minutes. Cells were collected at 0 and 20 minutes.
  • CD40 was immunoprecipitated using polyclonal anti-CD40 (Santa Cruz Biotechnology, CA), and was probed in a Western blot with anti-TRAF2 mAb (Santa Cruz Biotechnology, CA), anti-TRAF3 mAb (Santa Cruz Biotechnology, CA), and anti-CD40 mAb (Santa Cruz Biotechnology, CA). Briefly, the results show that TRAF2 and TRAF3 co-precipitated with CD40 after sCD40L stimulation. In contrast, treatment with CHIR-12.12 abrogated formation ofthe CD40-TRAF2/3 signaling complex in sCD40L-stimulated normal B cells. There were no changes in CD40 expression (data not shown).
  • CHIR-12.12 is a dual action antagonist anti-CD40 monoclonal antibody having a unique combination of attributes.
  • This fully human monoclonal antibody blocks CD40L-mediated CD40 signaling pathways for survival and proliferation of B cells; this antagonism leads to ultimate cell death.
  • CHIR-12.12 also mediates recognition and binding by effector cells, initiating antibody dependent cellular cytotoxicity (ADCC). Once CHIR-12.12 is bound to effector cells, cytolytic enzymes are released, leading to B-cell apoptosis and lysis.
  • CHJR-12.12 is a more potent anti-tumor antibody than is rituximab when compared in pre-clinical tumor models.
  • Example 2 CHIR-5.9 and CHIR-12.12 Bind to a Different Epitope on CD40 than 15B8
  • the candidate monoclonal antibodies CHIR-5.9 and CHIR-12.12 compete with each other for binding to CD40 but not with 15B8, an IgG anti-CD40 mAb (see International Publication No. WO 02/28904).
  • Antibody competition binding studies using Biacore were designed using CM5 biosensor chips with protein A immobilized via amine coupling, which was used to capture either anti-CD40, CHIR-12.12, or 15B8. Normal association/dissociation binding curves are observed with varying concentrations of CD40-his (data not shown). For competition studies, either CHIR-12.12 or 15B8 were captured onto the protein A surface.
  • Example 4 Characterization of Epitope for Monoclonal Antibodies CHIR-12.12 and CHIR-5.9 To determine the location ofthe epitope on CD40 recognized by monoclonal antibodies CHIR-12.12 and CHIR-5.9, SDS-PAGE and Western blot analysis were performed. Purified CD40 (0.5 ⁇ g) was separated on a 4-12% NUPAGE gel under reducing and non-reducing conditions, transferred to PVDF membranes, and probed with monoclonal antibodies at 10 ⁇ g/ml concentration. Blots were probed with alkaline phosphatase conjugated anti-human IgG and developed using the Western Blue R stabilized substrate for alkaline phosphatase (Promega).
  • results indicate that anti-CD40 monoclonal antibody CHIR-12.12 recognizes epitopes on both the non-reduced and reduced forms of CD40, with the non-reduced form of CD40 exhibiting greater intensity than the reduced form of CD40 (Table 3; blots not shown).
  • the fact that recognition was positive for both forms of CD40 indicates that this antibody interacts with a conformational epitope part of which is a linear sequence.
  • Monoclonal antibody CHIR-5.9 primarily recognizes the non-reduced form of CD40 suggesting that this antibody interacts with a primarily conformational epitope (Table 3; blots not shown).
  • peptides were synthesized from the extracellular Domain 2 of CD40, which corresponds to the sequence PCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICT (residues 61-104 ofthe sequence shown in SEQ ID NO:10 or SEQ ID NO: 12).
  • SPOTs membranes (Sigma) containing thirty-five lOmer peptides with a 1-amino-acid offset were generated.
  • Western blot analysis with mAb CHIR-12.12 and anti-human IgG beta- galactosidase as secondary antibody was performed.
  • the linear epitopes identified by the SPOTs analyses are within the CD40 Bl module.
  • the sequence ofthe CD40 Bl module is: HKYCDPNLGLRVQQKGTSETDTIC (residues 80-103 of SEQ ID NO:10 or 12).
  • Within the linear epitope identified for CHIR-12.12 is C83. It is known that this cysteine residue forms a disulphide bond with C103. It is likely that the conformational epitope ofthe CHIR-12.12 mAb contains this disulfide bond (C83-C103) and/or surrounding amino acids conformationally close to C 103.
  • CHIR-12.12 is tested in a model of human systemic lupus erythematosus (SLE) in which peripheral blood mononuclear cells (PMBCs) from SLE patients are engrafted into SCID mice. See, for example, the model described in Duchosal et al. (1990) J. Exp . Med. 172:985-8. After transfer of PBMCs from SLE patients into SCID mice, it is determined whether or not CHIR-12.12 treatment influences the T lymphocyte response to auto- antigen and auto-antibody production and disease manifestations such as glomerulonephritis. The first set of studies tests CHIR-12.12 as a single agent followed by testing the effect in a combination with other agents such as CTLA4-Ig.
  • Marmoset monkey experimental autoimmune encephalitis is a model for human multiple sclerosis. See, for example, the model described in Raine et al. (1999) Ann. Neurol. 46:144-60 and Hart et al. (2004; Lancet Neurol. 3 :588-97. CHIR-12.12 binds to marmoset CD40 and is tested for efficacy in this model.
  • CHIR-12.12 is tested in vitro for its ability to inhibit CD40L-induced production of matrix-degrading enzymes, tissue factor expression, proinflammatory cytokines, and upregulation of adhesion molecules. Subsequent studies test the ability of CHIR-12.12 to show anti-inflammatory activities in vivo using transgenic mice expressing the human CD40 molecule. See, for example, the model described in Yasui (2002) Int. Immunol. 14:319-29.
  • CHIR-12.12 is tested for its ability to prevent transplant rejection in non-human primate models. Cynomolgus monkey renal allograft recipients are treated with CHIR- 12.12 antibody to demonstrate the effect on graft acceptance with or without additional immunosuppressive drags such as cyclosporine, FK506, rapamycin, corticosteroids, CTLA4-Ig, and anti-B Lymphocyte Stimulator antibody, and the like. See, the model described in Wee et al. (1992) Transplantation 53:501-7.
  • CHIR-12.12 is tested first in vitro for its ability to block microglial activation. In vivo efficacy studies with CHIR-12.12 are conducted in double-transgenic mice expressing human CD40 and overproducing amyloid-beta peptide. See, for example, the model described in Tan et al. (2002) Nat. Neurosci. 5:1288-93.
  • Example 6 Clinical Studies with CHIR-5.9 and CHIR-12.12 Clinical Objectives The overall objective is to provide an effective therapy for rheumatoid arthritis (RA) by targeting cells with an antagonistic anti-CD40 IgGi.
  • the signal for this disease is determined in phase I although some measure of activity may be obtained in phase I. Initially the agent is studied as a single agent, but will be combined with other therapeutic agents as development proceeds.
  • Phase I Evaluate safety and pharmacokinetics - dose escalation in subjects with RA. • Choose dose based on safety, tolerability, and change in serum markers of CD40. In general an MTD is sought but other indications of efficacy (depletion of CD40 bearing cells, etc.) may be adequate for dose finding. • Consideration of more than one dose, as some dose finding may be necessary in phase II. • Patients are dosed weekly with real-time pharmacokinetic (Pk) sampling. Initially a 4-week cycle is the maximum dosing allowed. The Pk may be highly variable depending on the disease state, density of CD40 etc. • This trial(s) is open to subjects with RA. • Decision to discontinue or continue studies is based on safety, dose, and preliminary evidence of therapeutic activity. • Activity of drug as determined by response rate is determined in Phase II. • Identify dose(s) for Phase II.
  • RA nonsteroidal antiinflammatory drags
  • DMARDs disease-modifying antirheumatic drugs
  • Phase III Phase III will depend on where the signal is detected in phase II, and what competing therapies are considered to be the standard. If the signal is in a stage of disease where there is no standard of therapy, then a single arm, well-controlled study could serve as a pivotal trial. If there are competing agents that are considered standard, then head-to-head studies are conducted.
  • Example 7 Liquid Pharmaceutical Formulation for Antagonist Anti-CD40 Antibodies
  • the objective of this study was to investigate the effects of solution pH on stability ofthe antagonist anti-CD40 antibody CHIR-12.12 by both biophysical and biochemical methods in order to select the optimum solution environment for this antibody.
  • Differential Scanning Calorimetry (DSC) results showed that the conformation stability of CHIR-12.12 is optimal in formulations having pH 5.5-6.5.
  • SEC-HPLC Size-Exclusion HPLC
  • CEX-HPLC Cation-Exchange HPLC
  • one recommended liquid pharmaceutical formulation comprising this antibody is a formulation comprising CHIR-12.12 at about 20 mg/ml formulated in about 10 mM sodium succinate, about 150 mM sodium chloride, and having a pH of about pH 5.5.
  • CHIR-12.12 antibody used in the formulation studies is a human monoclonal antibody produced by a CHO cell culture process.
  • This MAb has a molecular weight of 150 kDa and consists of two light chains and two heavy chains linked together by disulfide bands. It is targeted against the CD40 cell surface receptor on CD40-expressing cells, including normal and malignant B cells, for treatment of various cancers and autoimmune/inflammatory diseases.
  • the anti-CD40 drug substance used for this study was a CHO-derived purified anti-CD40 (CHIR-12.12) bulk lot.
  • the composition ofthe drag substance was 9.7 mg/ml CHIR-12.12 antibody in 10 mM sodium citrate, 150 mM sodium chloride, at pH 6.5.
  • the control sample in the study was the received drug substance, followed by freezing at ⁇ - 60°C, thawing at RT and testing along with stability samples at predetermined time points.
  • the stability samples were prepared by dialysis ofthe drug substance against different pH solutions and the CHIR-12.12 concentration in each sample was determined by UV 280 as presented in Table 7.
  • DSC Conformational stability of different formulation samples was monitored using a MicroCal VP-DSC upon heating 15°C to 90°C at l°C/min.
  • SDS-PAGE Fragmentation and aggregation were estimated using 4-20% Tris-Glycine Gel under non-reducing and reducing conditions. Protein was detected by Coomassie blue staining.
  • CEX-HPLC Cation Exchange Chromatography
  • SEC-HPLC analysis detected the intact CHIR-12.12 as the main peak species, an aggregation species as a front peak species separate from the main peak species, a large fragment species as a shoulder peak on the back ofthe main peak species, and small fragment species were detected post-main peak species. After incubation at 5°C and 25°C for 3 months, negligible amounts of protein fragments and aggregates ( ⁇ 1.0% ) were detected in the above formulations and the CHIR-12.12 main peak species remained greater than 99% purity (data not shown). However, protein fragments gradually developed upon storage at 40°C and more fragments formed at pH 4.5 and pH 6.5-9.0, as shown in Table 8.
  • CEX-HPLC analysis detected the intact CHIR-12.12 as the main peak species, acidic variants eluted earlier than the main peak species, and C-terminal lysine addition variants eluted post-main peak species.
  • Table 9 shows the dependence ofthe percentages ofthe remaining main peak CHIR-12.12 species and acidic variants on solution pH.
  • the control sample akeady contained a high degree of acidic species (-33%), probably due to early-stage fermentation and purification processes.
  • pH has a significant effect on conformational and physicochemical stabilities of CHIR-12.12. Charge change-related degradation was determined to be the main degradation pathway for CHIR-12.12, which was minimized at pH 5.0-5.5. Based on overall stability data, one recommended liquid pharmaceutical formulation comprising this antibody is a formulation comprising CHIR-12.12 at about 20 mg/ml formulated in about 10 mM sodium succinate, about 150 mM sodium chloride, and having a pH of about pH 5.5.
  • the strains will be maintained for a period of at least 30 years from date or deposit, or five years aXWr the most recent re uest tor a gsii ⁇ ple, whic ever is longer. he United States atid Dumm trther countries are signatory to the Budapest Treaty. The viability ottixe cnKuro dted above was tertcd geptcmhfe 23, __003. On thf-t date, the cultures were viable. International Depository Authority: American Type Culture CollwJti u, Wfonawa?, v * M 110-320$ USA. Slg ⁇ ature u Cpcra.
  • n torrjnR turthnrity to represent ⁇ CC 'V t**: A JgjtAJ Date fis_2t_ ⁇ _ ⁇ _ ⁇ £-Stl M ⁇ * «. tt-irrila, Paten Specialist, ATCC Patent Depository cci Lisa Alexander

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • General Chemical & Material Sciences (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Immunology (AREA)
  • Neurology (AREA)
  • Diabetes (AREA)
  • Biomedical Technology (AREA)
  • Hematology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Physical Education & Sports Medicine (AREA)
  • Pulmonology (AREA)
  • Neurosurgery (AREA)
  • Orthopedic Medicine & Surgery (AREA)
  • Cardiology (AREA)
  • Rheumatology (AREA)
  • Heart & Thoracic Surgery (AREA)
  • Oncology (AREA)
  • Urology & Nephrology (AREA)
  • Vascular Medicine (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Pain & Pain Management (AREA)
  • Dermatology (AREA)
  • Epidemiology (AREA)
  • Gastroenterology & Hepatology (AREA)
PCT/US2004/036957 2003-11-04 2004-11-04 Use of antagonist anti-cd40 antibodies for treatment of autoimmune and inflammatory diseases and organ transplant rejection Ceased WO2005044306A2 (en)

Priority Applications (16)

Application Number Priority Date Filing Date Title
DK04810420.2T DK1694360T3 (da) 2003-11-04 2004-11-04 Anvendelse af antagonist anti-CD40-antistoffer til behandling af autoimmune og inflammatoriske sygdomme og organtransplantationafstødning
CA2544853A CA2544853C (en) 2003-11-04 2004-11-04 Use of antagonist anti-cd40 antibodies for treatment of autoimmune and inflammatory diseases, and organ transplant rejection
AU2004287482A AU2004287482B2 (en) 2003-11-04 2004-11-04 Use of antagonist anti-CD40 antibodies for treatment of autoimmune and inflammatory diseases and organ transplant rejection
KR1020067010894A KR101125127B1 (ko) 2003-11-04 2004-11-04 자가면역 및 염증성 질병과 기관 이식 거부반응의 치료를위해 사용되는 길항제 항-cd40 항체의 사용 방법
AT04810420T ATE476448T1 (de) 2003-11-04 2004-11-04 Verwendung von antagonist-anti-cd40-antikörpern zur behandlung von autoimmunkrankheiten und entzündlichen erkrankungen und organtransplantat- abstossung
HK07102192.5A HK1095091B (en) 2003-11-04 2004-11-04 Use of antagonist anti-cd40 antibodies for treatment of autoimmune and inflammatory diseases and organ transplant rejection
PL04810420T PL1694360T3 (pl) 2003-11-04 2004-11-04 Zastosowanie antagonistycznych przeciwciał anty-CD40 do leczenia chorób autoimmunologicznych i zapalnych oraz odrzucenia przeszczepu narządów
EP04810420A EP1694360B1 (en) 2003-11-04 2004-11-04 Use of antagonist anti-cd40 antibodies for treatment of autoimmune and inflammatory diseases and organ transplant rejection
CN200480037489.4A CN1938045B (zh) 2003-11-04 2004-11-04 治疗自身免疫和炎性疾病以及器官移植排异的拮抗性抗-cd40抗体的应用
DE602004028505T DE602004028505D1 (de) 2003-11-04 2004-11-04 Verwendung von antagonist-anti-cd40-antikörpern zur behandlung von autoimmunkrankheiten und entzündlichen erkrankungen und organtransplantat-abstossung
JP2006538513A JP4746552B2 (ja) 2003-11-04 2004-11-04 自己免疫疾患および炎症性疾患ならびに臓器移植拒絶の処置のためのアンタゴニスト抗cd40抗体の使用
SI200431525T SI1694360T1 (sl) 2003-11-04 2004-11-04 Uporaba antagonističnih anti-CD40 protiteles za zdravljenje avtoimunskih in vnetnih bolezni in zavrnitve transplantata organa
US11/932,472 US8277810B2 (en) 2003-11-04 2007-10-31 Antagonist anti-CD40 antibodies
US13/612,070 US8637032B2 (en) 2003-11-04 2012-09-12 Antagonist anti-CD40 monoclonal antibodies and methods for their use
US14/134,339 US20140205602A1 (en) 2003-11-04 2013-12-19 Antagonist anti-cd40 monoclonal antibodies and methods for their use
US15/241,136 US20170081416A1 (en) 2003-11-04 2016-08-19 Antagonist anti-cd40 monoclonal antibodies and methods for their use

Applications Claiming Priority (6)

Application Number Priority Date Filing Date Title
US51733703P 2003-11-04 2003-11-04
US60/517,337 2003-11-04
US52557903P 2003-11-26 2003-11-26
US60/525,579 2003-11-26
US56571004P 2004-04-27 2004-04-27
US60/565,710 2004-04-27

Related Child Applications (4)

Application Number Title Priority Date Filing Date
PCT/US2004/036958 Continuation-In-Part WO2005044294A2 (en) 2003-11-04 2004-11-04 Method of therapy for cancers expressing the cd40 antigen
US10576943 A-371-Of-International 2006-12-01
US10578590 Continuation-In-Part 2007-03-05
US11/932,472 Continuation-In-Part US8277810B2 (en) 2003-11-04 2007-10-31 Antagonist anti-CD40 antibodies

Publications (2)

Publication Number Publication Date
WO2005044306A2 true WO2005044306A2 (en) 2005-05-19
WO2005044306A3 WO2005044306A3 (en) 2005-09-15

Family

ID=34577667

Family Applications (3)

Application Number Title Priority Date Filing Date
PCT/US2004/036957 Ceased WO2005044306A2 (en) 2003-11-04 2004-11-04 Use of antagonist anti-cd40 antibodies for treatment of autoimmune and inflammatory diseases and organ transplant rejection
PCT/US2004/037152 Ceased WO2005044854A2 (en) 2003-11-04 2004-11-04 Antagonist anti-cd40 monoclonal antibodies and methods for their use
PCT/US2004/036958 Ceased WO2005044294A2 (en) 2003-11-04 2004-11-04 Method of therapy for cancers expressing the cd40 antigen

Family Applications After (2)

Application Number Title Priority Date Filing Date
PCT/US2004/037152 Ceased WO2005044854A2 (en) 2003-11-04 2004-11-04 Antagonist anti-cd40 monoclonal antibodies and methods for their use
PCT/US2004/036958 Ceased WO2005044294A2 (en) 2003-11-04 2004-11-04 Method of therapy for cancers expressing the cd40 antigen

Country Status (22)

Country Link
EP (6) EP1682180B1 (https=)
JP (6) JP4765039B2 (https=)
KR (2) KR101125127B1 (https=)
CN (2) CN1905897B (https=)
AT (3) ATE447412T1 (https=)
AU (3) AU2004287879C1 (https=)
CA (3) CA2544948A1 (https=)
CY (3) CY1110231T1 (https=)
DE (3) DE602004028505D1 (https=)
DK (4) DK1682178T3 (https=)
EC (2) ECSP066607A (https=)
ES (3) ES2435410T3 (https=)
HR (2) HRP20100066T1 (https=)
IL (1) IL175225A (https=)
MA (1) MA28331A1 (https=)
PL (4) PL1682178T3 (https=)
PT (4) PT1694360E (https=)
RS (2) RS53073B (https=)
SG (1) SG148143A1 (https=)
SI (3) SI1682180T1 (https=)
WO (3) WO2005044306A2 (https=)
ZA (1) ZA200604419B (https=)

Cited By (36)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2005108428A3 (en) * 2004-02-26 2006-08-03 Compugen Ltd Cd40 splice variants and their uses
WO2006125117A3 (en) * 2005-05-18 2007-01-18 Novartis Ag Methods for diagnosis and treatment of diseases having an autoimmune and/or inflammatory component
WO2007124299A2 (en) 2006-04-21 2007-11-01 Novartis Ag Antagonist anti-cd40 antibody pharmaceutical compositions
JP2009513712A (ja) * 2005-11-01 2009-04-02 ノバルティス アーゲー 抗cd40抗体の使用
WO2012065950A1 (en) 2010-11-15 2012-05-24 Novartis Ag Silent fc variants of anti-cd40 antibodies
WO2012075111A1 (en) 2010-11-30 2012-06-07 Novartis Ag Uses of anti-cd40 antibodies in combination therapy for b cell-related cancers
US8277810B2 (en) 2003-11-04 2012-10-02 Novartis Vaccines & Diagnostics, Inc. Antagonist anti-CD40 antibodies
US8337851B2 (en) * 2005-05-18 2012-12-25 Novartis Ag Methods of monitoring the efficacy of anti-CD40 antibodies in treating a subject for a CD40-expressing cancer
WO2013164789A2 (en) 2012-05-04 2013-11-07 Novartis Ag Antibody formulatoin
US8926979B2 (en) 2005-11-01 2015-01-06 Novartis Ag Treatment of cancer or pre-malignant conditions using anti-CD40 antibodies
US9062101B2 (en) 2010-08-14 2015-06-23 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
US9624310B2 (en) 2011-11-17 2017-04-18 Gundram Jung Methods of using bi-specific antibodies for treating B-cell-mediated autoimmune diseases or auto-reactive B-cells
AU2016201742B2 (en) * 2010-11-15 2017-11-02 Novartis Ag Silent Fc variants of anti-CD40 antibodies
US9822339B2 (en) 2005-12-09 2017-11-21 Academisch Medisch Centrum Bij De Universiteit Van Amsterdam Means and methods for influencing the stability of antibody producing cells
US9822171B2 (en) 2010-04-15 2017-11-21 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
WO2017220988A1 (en) 2016-06-20 2017-12-28 Kymab Limited Multispecific antibodies for immuno-oncology
US9951125B2 (en) 2006-11-30 2018-04-24 Abbvie Inc. Aβ conformer selective anti-Aβ globulomer monoclonal antibodies
US9969795B2 (en) 2010-12-02 2018-05-15 Aimm Therapeutics B.V. Means and methods for producing high affinity antibodies
US10077427B2 (en) 2005-12-09 2018-09-18 Academisch Medisch Centrum Bij De Universiteit Van Amsterdam Means and methods for influencing the stability of cells
US10208109B2 (en) 2005-11-30 2019-02-19 Abbvie Inc. Monoclonal antibodies against amyloid beta protein and uses thereof
US10344076B2 (en) 2009-07-15 2019-07-09 Aimm Therapeutics B.V. Means and methods for producing high affinity antibodies
US10464976B2 (en) 2003-01-31 2019-11-05 AbbVie Deutschland GmbH & Co. KG Amyloid β(1-42) oligomers, derivatives thereof and antibodies thereto, methods of preparation thereof and use thereof
WO2019241730A2 (en) 2018-06-15 2019-12-19 Flagship Pioneering Innovations V, Inc. Increasing immune activity through modulation of postcellular signaling factors
US10538581B2 (en) 2005-11-30 2020-01-21 Abbvie Inc. Anti-Aβ globulomer 4D10 antibodies
US10590202B2 (en) 2012-11-19 2020-03-17 Baliopharm Ag Recombinant bispecific antibody binding to CD20 and CD95
US10611829B2 (en) 2014-01-31 2020-04-07 Aimm Therapeutics B.V. Means and methods for producing stable antibodies
US10633444B2 (en) 2016-04-18 2020-04-28 Celldex Therapeutics, Inc. Agonistic antibodies that bind CD40
WO2020227159A2 (en) 2019-05-03 2020-11-12 Flagship Pioneering Innovations V, Inc. Methods of modulating immune activity
WO2021127217A1 (en) 2019-12-17 2021-06-24 Flagship Pioneering Innovations V, Inc. Combination anti-cancer therapies with inducers of iron-dependent cellular disassembly
WO2022006179A1 (en) 2020-06-29 2022-01-06 Flagship Pioneering Innovations V, Inc. Viruses engineered to promote thanotransmission and their use in treating cancer
US11492405B2 (en) 2014-03-12 2022-11-08 Yeda Research And Development Co. Ltd Reducing systemic regulatory t cell levels or activity for treatment of disease and injury of the CNS
CN115812082A (zh) * 2021-07-14 2023-03-17 舒泰神(北京)生物制药股份有限公司 特异性识别cd40的抗体及其应用
US11643464B2 (en) 2014-03-12 2023-05-09 Yeda Research and Develpment & Co. Ltd Reducing systemic regulatory T cell levels or activity for treatment of a retinal degeneration disorder
US11884728B2 (en) 2014-03-12 2024-01-30 Yeda Research And Development Co. Ltd. Reducing systemic regulatory T cell levels or activity for treatment of amyotrophic lateral sclerosis
WO2024151687A1 (en) 2023-01-09 2024-07-18 Flagship Pioneering Innovations V, Inc. Genetic switches and their use in treating cancer
EP4406971A4 (en) * 2021-09-24 2026-01-14 Chia Tai Tianqing Pharmaceutical Group Co Ltd Anti-CD40 Antibody and Its Use

Families Citing this family (50)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7658924B2 (en) 2001-10-11 2010-02-09 Amgen Inc. Angiopoietin-2 specific binding agents
PT1694360E (pt) * 2003-11-04 2010-12-13 Novartis Vaccines & Diagnostic Utilização de anticorpos monoclonais antagonistas anti-cd40 para o tratamento de doenças auto-imunes e inflamatórias e da rejeição ao transplante de orgãos
EP1844815B1 (en) * 2003-11-04 2011-09-14 Novartis Vaccines and Diagnostics, Inc. Combination therapy comprising anti-CD20 and anti-CD40 antibodies for the treatment of B cell-related cancers
MX2007015476A (es) 2005-06-14 2008-02-25 Amgen Inc Formulaciones de proteina autoamortiguadoras.
AR059066A1 (es) 2006-01-27 2008-03-12 Amgen Inc Combinaciones del inhibidor de la angiopoyetina -2 (ang2) y el inhibidor del factor de crecimiento endotelial vascular (vegf)
JP5577098B2 (ja) * 2006-12-21 2014-08-20 アムジエン・インコーポレーテツド ポリペプチドを含有する安定な緩衝化された製剤
EP2124952A2 (en) 2007-02-27 2009-12-02 Abbott GmbH & Co. KG Method for the treatment of amyloidoses
EP2170268A2 (en) 2007-06-25 2010-04-07 Amgen, Inc. Compositions of specific binding agents to hepatocyte growth factor
MX2010005080A (es) 2007-11-07 2010-07-28 Genentech Inc Metodos y composiciones para determinar la sensibilidad de linfoma de celula b al tratamiento con anticuerpos anti-cd40.
MX2010005099A (es) * 2007-11-09 2010-05-27 Novartis Ag Usos de anticuerpos anti-cd40.
JO2913B1 (en) 2008-02-20 2015-09-15 امجين إنك, Antibodies directed towards angiopoietin-1 and angiopoietin-2 proteins and their uses
KR101787768B1 (ko) 2009-04-18 2017-10-18 제넨테크, 인크. 항-cd40 항체를 사용한 치료에 대한 b-세포 림프종의 반응성 평가를 위한 방법
PE20141162A1 (es) 2010-11-04 2014-09-18 Boehringer Ingelheim Int Anticuerpos anti-il-23
JP5458188B2 (ja) * 2011-02-17 2014-04-02 協和発酵キリン株式会社 抗cd40抗体の高濃度製剤
ES2653639T3 (es) * 2011-02-28 2018-02-08 Napajen Pharma, Inc. Complejo ácido nucleico-polisacárido
HUE065915T2 (hu) 2011-03-11 2024-06-28 Beth Israel Deaconess Medical Ct Inc Anti-CD40 antitestek és alkalmazásaik
BR112013026828A2 (pt) * 2011-04-21 2016-11-29 Bristol Myers Squibb Co polipeptídeos de anticorpo que antagonizam cd40
SG10201604104PA (en) 2011-10-25 2016-07-28 Prothena Therapeutics Ltd Antibody formulations and methods
EP4039275A1 (en) * 2012-05-03 2022-08-10 Boehringer Ingelheim International GmbH Anti-il-23p19 antibodies
AU2013337903B2 (en) * 2012-10-30 2018-08-16 Apexigen, Inc. Anti-CD40 antibodies and methods of use
WO2014200349A1 (en) * 2013-06-13 2014-12-18 Fast Forward Pharmaceutical B.V. Cd40 signalling inhibitor and a further compound, wherein the further compound is a bile acid, a bile acid derivative, an tgr5-receptor agonist, an fxr agonist or a combination thereof, for the treatment of chronic inflammation, and the prevention of gastrointestinal cancer or fibrosis.
WO2015134988A1 (en) 2014-03-07 2015-09-11 Bristol-Myers Squibb Company Method of using antibody polypeptides that antagonize cd40 to treat ibd
CN108025068A (zh) * 2014-03-12 2018-05-11 耶达研究与开发有限公司 降低系统性调节性t细胞水平或活性来治疗cns的疾病和损伤
EA201691634A1 (ru) * 2014-03-19 2016-11-30 Бристол-Маерс Сквибб Компани Способы лечения отторжения трансплантата с использованием доменного антитела, направленного против cd40l
EP3172339A1 (en) 2014-07-24 2017-05-31 Boehringer Ingelheim International GmbH Biomarkers useful in the treatment of il-23a related diseases
WO2016029043A1 (en) 2014-08-21 2016-02-25 The General Hospital Corporation Tumor necrosis factor superfamily and tnf-like ligand muteins and methods of preparing and using the same
UA123624C2 (uk) 2014-09-03 2021-05-05 Бьорінґер Інґельхайм Інтернаціональ Ґмбх Сполука, специфічна до іл-23а та фнп-альфа, та її застосування
AU2015360502A1 (en) 2014-12-10 2017-06-29 Regents Of The University Of Minnesota Genetically modified cells, tissues, and organs for treating disease
CN107206081A (zh) 2015-02-04 2017-09-26 勃林格殷格翰国际有限公司 治疗炎性疾病的方法
US10174121B2 (en) 2015-05-29 2019-01-08 Abbvie, Inc. Anti-CD40 antibodies
LT4209499T (lt) 2015-08-13 2024-11-25 Amgen Inc. Antigeną surišančių baltymų įkrautas giluminis filtravimas
WO2017040932A1 (en) 2015-09-04 2017-03-09 Primatope Therapeutics Inc. Humanized anti-cd40 antibodies and uses thereof
CR20180177A (es) * 2015-09-30 2018-06-22 Janssen Biotech Inc Anticuerpos agonistas que se unen específicamente a cd40 humana y método de uso
SG11201811431VA (en) 2016-07-14 2019-01-30 Genmab As Multispecific antibodies against cd40 and cd137
MX2019014375A (es) * 2017-06-01 2020-01-23 Jiangsu Hengrui Medicine Co Anticuerpo anti-cd40, fragmento de union a antigeno del mismo, y uso medico del mismo.
WO2018222019A1 (ko) * 2017-06-01 2018-12-06 서울대학교 산학협력단 신규한 항-cd40 항체 및 이의 용도
SG11202000198QA (en) 2017-08-04 2020-02-27 Genmab As Binding agents binding to pd-l1 and cd137 and use thereof
HRP20240485T1 (hr) 2017-08-24 2024-07-05 Novo Nordisk A/S Pripravci glp-1 i njihova upotreba
EP3746478A4 (en) * 2018-01-29 2022-01-19 The Regents of The University of California THERAPIES AND METHODS OF TREATING TLR2-MEDIATED DISEASES AND DISORDERS
CA3090322A1 (en) * 2018-02-12 2019-08-15 Diabetes-Free, Inc. Improved antagonistic anti-human cd40 monoclonal antibodies
WO2020102454A1 (en) 2018-11-13 2020-05-22 Regents Of The University Of Minnesota Cd40 targeted peptides and uses thereof
AR117091A1 (es) * 2018-11-19 2021-07-07 Bristol Myers Squibb Co Anticuerpos monoclonales antagonistas contra cd40 y sus usos
US12577297B2 (en) 2019-09-09 2026-03-17 Boehringer Ingelheim International Gmbh Anti-IL-23p19 antibody formulations
PE20230819A1 (es) 2020-02-18 2023-05-19 Novo Nordisk As Composiciones y usos de glp-1
CN111763259B (zh) * 2020-09-03 2020-12-15 北京百奥赛图基因生物技术有限公司 抗cd40抗体及其用途
FI4284512T3 (fi) 2021-01-28 2025-05-22 Regeneron Pharma Koostumuksia ja menetelmiä sytokiinien vapautumisoireyhtymän hoitamiseksi
US12234294B2 (en) 2021-11-05 2025-02-25 Kiniksa Pharmaceuticals, Gmbh Pharmaceutical composition of a humanized anti-CD40 antibody
CN117229396A (zh) * 2022-06-06 2023-12-15 普米斯生物技术(珠海)有限公司 抗cd40抗体及其用途
WO2025184567A1 (en) 2024-03-01 2025-09-04 Regeneron Pharmaceuticals, Inc. Methods and compositions for re-dosing aav using anti-cd40 antagonistic antibody to suppress host anti-aav antibody response
WO2025184603A2 (en) 2024-03-01 2025-09-04 Regeneron Pharmaceuticals, Inc. The use of cd40 inhibitors for inhibiting an immune response and enabling immunogen administration and re-administration

Family Cites Families (99)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
FR901228A (fr) 1943-01-16 1945-07-20 Deutsche Edelstahlwerke Ag Système d'aimant à entrefer annulaire
NL154600B (nl) 1971-02-10 1977-09-15 Organon Nv Werkwijze voor het aantonen en bepalen van specifiek bindende eiwitten en hun corresponderende bindbare stoffen.
US3817837A (en) 1971-05-14 1974-06-18 Syva Corp Enzyme amplification assay
US3766162A (en) 1971-08-24 1973-10-16 Hoffmann La Roche Barbituric acid antigens and antibodies specific therefor
US4179337A (en) 1973-07-20 1979-12-18 Davis Frank F Non-immunogenic polypeptides
US4233402A (en) 1978-04-05 1980-11-11 Syva Company Reagents and method employing channeling
NZ201918A (en) 1981-09-18 1987-04-30 Genentech Inc N-terminal methionyl analogues of bovine growth hormone
JPS5896026A (ja) 1981-10-30 1983-06-07 Nippon Chemiphar Co Ltd 新規ウロキナ−ゼ誘導体およびその製造法ならびにそれを含有する血栓溶解剤
CA1341562C (en) 1982-03-31 2007-11-27 Tadatsugu Taniguchi Gene coded for interleukin-2 polypeptide, recombinant dna carrying the said gene, a living cell line possessing the recombinant dna, and method for producing interleukin-2 using the said cell
DE3377363D1 (en) 1982-03-31 1988-08-18 Ajinomoto Kk Gene coding for interleukin-2 polypeptide, recombinant dna carrying said gene, cell lines possessing the recombinant dna,and method for producing interleukin-2 using said cells
BE893016R (fr) 1982-04-29 1982-08-16 Amatucci Aldo Turbine a vent
EP0098110B1 (en) 1982-06-24 1989-10-18 NIHON CHEMICAL RESEARCH KABUSHIKI KAISHA also known as JAPAN CHEMICAL RESEARCH CO., LTD Long-acting composition
US4992271A (en) 1982-09-23 1991-02-12 Cetus Corporation Formulation for lipophilic IL-2 proteins
FI82266C (fi) 1982-10-19 1991-02-11 Cetus Corp Foerfarande foer framstaellning av il-2 -mutein.
US5700913A (en) 1982-12-15 1997-12-23 Ajinomoto Co., Inc. Unglycosylated human interleukin-2 polypeptides
US4708871A (en) 1983-03-08 1987-11-24 Commonwealth Serum Laboratories Commission Antigenically active amino acid sequences
US4816567A (en) 1983-04-08 1989-03-28 Genentech, Inc. Recombinant immunoglobin preparations
US4518584A (en) 1983-04-15 1985-05-21 Cetus Corporation Human recombinant interleukin-2 muteins
WO1985000817A1 (en) 1983-08-10 1985-02-28 Amgen Microbial expression of interleukin ii
US4569790A (en) 1984-03-28 1986-02-11 Cetus Corporation Process for recovering microbially produced interleukin-2 and purified recombinant interleukin-2 compositions
US4530787A (en) 1984-03-28 1985-07-23 Cetus Corporation Controlled oxidation of microbially produced cysteine-containing proteins
US4604377A (en) 1984-03-28 1986-08-05 Cetus Corporation Pharmaceutical compositions of microbially produced interleukin-2
US4656132A (en) 1984-03-28 1987-04-07 Cetus Corporation Method of improving the yield of heterologous protein produced by cultivating recombinant bacteria
US4572798A (en) 1984-12-06 1986-02-25 Cetus Corporation Method for promoting disulfide bond formation in recombinant proteins
US4752585A (en) 1985-12-17 1988-06-21 Cetus Corporation Oxidation-resistant muteins
CA1340265C (en) 1985-01-18 1998-12-15 Kirston E. Koths Oxidation resistant muteins
US5981216A (en) 1985-04-01 1999-11-09 Alusuisse Holdings A.G. Transformed myeloma cell-line and a process for the expression of a gene coding for a eukaryotic polypeptide employing same
US5206344A (en) 1985-06-26 1993-04-27 Cetus Oncology Corporation Interleukin-2 muteins and polymer conjugation thereof
US4766106A (en) 1985-06-26 1988-08-23 Cetus Corporation Solubilization of proteins for pharmaceutical compositions using polymer conjugation
US4748234A (en) 1985-06-26 1988-05-31 Cetus Corporation Process for recovering refractile bodies containing heterologous proteins from microbial hosts
US4676980A (en) 1985-09-23 1987-06-30 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Target specific cross-linked heteroantibodies
US4816440A (en) 1985-09-26 1989-03-28 Cetus Corporation Stable formulation of biologically active proteins for parenteral injection
GB8601597D0 (en) 1986-01-23 1986-02-26 Wilson R H Nucleotide sequences
US5225539A (en) 1986-03-27 1993-07-06 Medical Research Council Recombinant altered antibodies and methods of making altered antibodies
US4745180A (en) 1986-06-27 1988-05-17 Cetus Corporation Solubilization of proteins for pharmaceutical compositions using heparin fragments
US5260203A (en) 1986-09-02 1993-11-09 Enzon, Inc. Single polypeptide chain binding molecules
US4946778A (en) 1987-09-21 1990-08-07 Genex Corporation Single polypeptide chain binding molecules
US4931544A (en) 1986-09-04 1990-06-05 Cetus Corporation Succinylated interleukin-2 for pharmaceutical compositions
US4831175A (en) 1986-09-05 1989-05-16 The United States Of America As Represented By The Secretary Of The Department Of Health And Human Services Backbone polysubstituted chelates for forming a metal chelate-protein conjugate
CA1294215C (en) 1986-10-27 1992-01-14 Ze'ev Shaked Pharmaceutical compositions of recombinant beta-interferon and formulation processes
CA1292686C (en) 1986-10-27 1991-12-03 Ze'ev Shaked Pharmaceutical compositions of recombinant interleukin-2 and formulation process
US4894226A (en) 1986-11-14 1990-01-16 Cetus Corporation Solubilization of proteins for pharmaceutical compositions using polyproline conjugation
US4873192A (en) 1987-02-17 1989-10-10 The United States Of America As Represented By The Department Of Health And Human Services Process for site specific mutagenesis without phenotypic selection
US4931543A (en) 1987-05-11 1990-06-05 Cetus Corporation Process for recovering microbially produced interleukin-2
GB8717430D0 (en) 1987-07-23 1987-08-26 Celltech Ltd Recombinant dna product
US5879936A (en) 1988-04-18 1999-03-09 Aluguisse Holding A.G. Recombinant DNA methods, vectors and host cells
US5078997A (en) 1988-07-13 1992-01-07 Cetus Corporation Pharmaceutical composition for interleukin-2 containing physiologically compatible stabilizers
US5530101A (en) 1988-12-28 1996-06-25 Protein Design Labs, Inc. Humanized immunoglobulins
DE69019727T2 (de) 1989-09-21 1995-10-19 Idemitsu Kosan Co Arylstyrolpolymer und -copolymer und verfahren zu ihrer herstellung.
US5859205A (en) 1989-12-21 1999-01-12 Celltech Limited Humanised antibodies
EP1690934A3 (en) 1990-01-12 2008-07-30 Abgenix, Inc. Generation of xenogeneic antibodies
US6075181A (en) 1990-01-12 2000-06-13 Abgenix, Inc. Human antibodies derived from immunized xenomice
US5891693A (en) 1990-01-25 1999-04-06 Alusuisse Holdings A.G. Recombinant DNA methods vectors and host cells
IE66205B1 (en) 1990-06-14 1995-12-13 Paul A Bartlett Polypeptide analogs
US5877397A (en) 1990-08-29 1999-03-02 Genpharm International Inc. Transgenic non-human animals capable of producing heterologous antibodies of various isotypes
GB9022543D0 (en) 1990-10-17 1990-11-28 Wellcome Found Antibody production
US5756096A (en) 1991-07-25 1998-05-26 Idec Pharmaceuticals Corporation Recombinant antibodies for human therapy
IE922437A1 (en) 1991-07-25 1993-01-27 Idec Pharma Corp Recombinant antibodies for human therapy
US5962406A (en) 1991-10-25 1999-10-05 Immunex Corporation Recombinant soluble CD40 ligand polypeptide and pharmaceutical composition containing the same
US5229109A (en) 1992-04-14 1993-07-20 Board Of Regents, The University Of Texas System Low toxicity interleukin-2 analogues for use in immunotherapy
US5397703A (en) * 1992-07-09 1995-03-14 Cetus Oncology Corporation Method for generation of antibodies to cell surface molecules
US5874082A (en) * 1992-07-09 1999-02-23 Chiron Corporation Humanized anti-CD40 monoclonal antibodies and fragments capable of blocking B cell proliferation
WO1994012520A1 (en) 1992-11-20 1994-06-09 Enzon, Inc. Linker for linked fusion polypeptides
DE614989T1 (de) 1993-02-17 1995-09-28 Morphosys Proteinoptimierung Verfahren für in vivo Selektion von Ligandenbindende Proteine.
US5595721A (en) 1993-09-16 1997-01-21 Coulter Pharmaceutical, Inc. Radioimmunotherapy of lymphoma using anti-CD20
EP0751781B1 (en) 1993-12-23 2004-05-26 Immunex Corporation Use of monoclonal antibodies or soluble oligomeric ligands in the manufacture of a medicament for the prevention or treatment of neoplastic disorders
WO1995023512A1 (en) 1994-03-03 1995-09-08 Alexion Pharmaceuticals, Inc. Terminal complement inhibitor fusion genes and proteins
US6091001A (en) 1995-03-29 2000-07-18 Abgenix, Inc. Production of antibodies using Cre-mediated site-specific recombination
US5830698A (en) 1997-03-14 1998-11-03 Idec Pharmaceuticals Corporation Method for integrating genes at specific sites in mammalian cells via homologous recombination and vectors for accomplishing the same
WO1998052976A1 (en) 1997-05-21 1998-11-26 Biovation Limited Method for the production of non-immunogenic proteins
EP0999853B1 (en) 1997-06-13 2003-01-02 Genentech, Inc. Stabilized antibody formulation
WO1998058672A1 (en) 1997-06-20 1998-12-30 Biogen, Inc. Cd154 blockade therapy for therapeutic protein inhibitor syndrome
US6051228A (en) * 1998-02-19 2000-04-18 Bristol-Myers Squibb Co. Antibodies against human CD40
DZ2788A1 (fr) 1998-05-15 2003-12-01 Bayer Ag Agonistes et antagonistes selectifs à IL-2.
US6168785B1 (en) 1998-07-16 2001-01-02 Institut Pasteur Biological applications of new peptides of IL-2 and derivatives and use as therapeutic agents
WO2000034317A2 (en) 1998-12-08 2000-06-15 Biovation Limited Method for reducing immunogenicity of proteins
US6737056B1 (en) 1999-01-15 2004-05-18 Genentech, Inc. Polypeptide variants with altered effector function
US20020006901A1 (en) 1999-02-05 2002-01-17 Aldo T. Iacono Use of aerosolized cyclosporine for prevention and treatment of pulmonary disease
MY133346A (en) 1999-03-01 2007-11-30 Biogen Inc Kit for radiolabeling ligands with yttrium-90
US20020102208A1 (en) 1999-03-01 2002-08-01 Paul Chinn Radiolabeling kit and binding assay
AU4057300A (en) 1999-03-30 2000-10-16 Board Of Regents, The University Of Texas System Compositions and methods for modifying toxic effects of proteinacious compounds
WO2000063395A1 (en) 1999-04-16 2000-10-26 F. Hoffmann-La Roche Ag Nucleic acids encoding cd40/cd40l chimeric polypeptides, methods for their production and uses thereof
US6946129B1 (en) 1999-06-08 2005-09-20 Seattle Genetics, Inc. Recombinant anti-CD40 antibody and uses thereof
DE60031999T2 (de) 1999-10-04 2007-06-06 Novartis Vaccines and Diagnostics, Inc., Emeryville Stabilisierte flüssige polypeptid-haltige pharmazeutische zusammensetzungen
US6849425B1 (en) 1999-10-14 2005-02-01 Ixsys, Inc. Methods of optimizing antibody variable region binding affinity
WO2001034649A2 (en) * 1999-11-09 2001-05-17 Chiron Corporation Compositions and methods for treating autoimmune diseases and transplant rejections
EP2206720A1 (en) 2000-04-12 2010-07-14 Human Genome Sciences, Inc. Albumin fusion proteins
AU2001259215A1 (en) * 2000-04-28 2001-11-12 La Jolla Institute For Allergy And Immunology Human anti-cd40 antibodies and methods of making and using same
US20030059427A1 (en) * 2000-04-28 2003-03-27 Force Walker R. Isolation and characterization of highly active anti-CD40 antibody
JP4202127B2 (ja) 2000-10-02 2008-12-24 ノバルティス バクシンズ アンド ダイアグノスティックス,インコーポレーテッド アンタゴニスト抗cd40抗体を用いるb細胞悪性腫瘍の治療方法
AR039067A1 (es) 2001-11-09 2005-02-09 Pfizer Prod Inc Anticuerpos para cd40
AU2002346581A1 (en) * 2001-11-26 2003-06-10 Chiron Corporation Antagonist anti-cd40 monoclonal antibody therapy for multiple sclerosis treatment
US20040132101A1 (en) 2002-09-27 2004-07-08 Xencor Optimized Fc variants and methods for their generation
EP1844815B1 (en) * 2003-11-04 2011-09-14 Novartis Vaccines and Diagnostics, Inc. Combination therapy comprising anti-CD20 and anti-CD40 antibodies for the treatment of B cell-related cancers
CA2544951A1 (en) * 2003-11-04 2005-05-19 Chiron Corporation Use of antagonist anti-cd40 monoclonal antibodies for treatment of multiple myeloma
PT1694360E (pt) * 2003-11-04 2010-12-13 Novartis Vaccines & Diagnostic Utilização de anticorpos monoclonais antagonistas anti-cd40 para o tratamento de doenças auto-imunes e inflamatórias e da rejeição ao transplante de orgãos
ATE474598T1 (de) * 2003-11-04 2010-08-15 Novartis Vaccines & Diagnostic Verwendung von antagonisten-anti-cd40-antikörpern zur behandlung von chronisch lymphozytischer leukämie
EP1680141B8 (en) * 2003-11-04 2011-01-12 Novartis Vaccines and Diagnostics, Inc. Methods of therapy for solid tumors expressing the cd40 cell-surface antigen
JP6039343B2 (ja) 2012-10-04 2016-12-07 キヤノン株式会社 電子機器、電子機器の制御方法、プログラム、記憶媒体

Cited By (69)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US10464976B2 (en) 2003-01-31 2019-11-05 AbbVie Deutschland GmbH & Co. KG Amyloid β(1-42) oligomers, derivatives thereof and antibodies thereto, methods of preparation thereof and use thereof
US8637032B2 (en) 2003-11-04 2014-01-28 Novartis Vaccines And Diagnostics, Inc. Antagonist anti-CD40 monoclonal antibodies and methods for their use
US8277810B2 (en) 2003-11-04 2012-10-02 Novartis Vaccines & Diagnostics, Inc. Antagonist anti-CD40 antibodies
WO2005108428A3 (en) * 2004-02-26 2006-08-03 Compugen Ltd Cd40 splice variants and their uses
WO2006125117A3 (en) * 2005-05-18 2007-01-18 Novartis Ag Methods for diagnosis and treatment of diseases having an autoimmune and/or inflammatory component
EP2312315A1 (en) * 2005-05-18 2011-04-20 Novartis AG Methods for diagnosis and treatment of diseases having an autoimmune and/or inflammatory component
US8333970B2 (en) 2005-05-18 2012-12-18 Novartis Ag Methods of monitoring the efficacy of anti-CD40 antibodies in treating a subject having an inflammatory or autoimmune disease
US8337851B2 (en) * 2005-05-18 2012-12-25 Novartis Ag Methods of monitoring the efficacy of anti-CD40 antibodies in treating a subject for a CD40-expressing cancer
JP2009513712A (ja) * 2005-11-01 2009-04-02 ノバルティス アーゲー 抗cd40抗体の使用
US8926979B2 (en) 2005-11-01 2015-01-06 Novartis Ag Treatment of cancer or pre-malignant conditions using anti-CD40 antibodies
KR101395005B1 (ko) * 2005-11-01 2014-05-21 조마 테크놀로지 리미티드 항­cd40 항체의 용도
US10323084B2 (en) 2005-11-30 2019-06-18 Abbvie Inc. Monoclonal antibodies against amyloid beta protein and uses thereof
US10208109B2 (en) 2005-11-30 2019-02-19 Abbvie Inc. Monoclonal antibodies against amyloid beta protein and uses thereof
US10538581B2 (en) 2005-11-30 2020-01-21 Abbvie Inc. Anti-Aβ globulomer 4D10 antibodies
US10774308B2 (en) 2005-12-09 2020-09-15 Academisch Medisch Centrum Bij De Universiteit Van Amsterdam Means and methods for influencing the stability of cells
US10273454B2 (en) 2005-12-09 2019-04-30 Academisch Medisch Centrum Bij De Universiteit Van Amsterdam Means and methods for influencing the stability of antibody producing cells
US10077427B2 (en) 2005-12-09 2018-09-18 Academisch Medisch Centrum Bij De Universiteit Van Amsterdam Means and methods for influencing the stability of cells
US9822339B2 (en) 2005-12-09 2017-11-21 Academisch Medisch Centrum Bij De Universiteit Van Amsterdam Means and methods for influencing the stability of antibody producing cells
JP2009534401A (ja) * 2006-04-21 2009-09-24 ノバルティス アーゲー 拮抗剤抗cd40抗体薬学的組成物
US8945564B2 (en) 2006-04-21 2015-02-03 Novartis Ag Antagonist anti-CD40 antibody pharmaceutical compositions
WO2007124299A2 (en) 2006-04-21 2007-11-01 Novartis Ag Antagonist anti-cd40 antibody pharmaceutical compositions
JP2013129673A (ja) * 2006-04-21 2013-07-04 Novartis Ag 拮抗剤抗cd40抗体薬学的組成物
US9951125B2 (en) 2006-11-30 2018-04-24 Abbvie Inc. Aβ conformer selective anti-Aβ globulomer monoclonal antibodies
US10344076B2 (en) 2009-07-15 2019-07-09 Aimm Therapeutics B.V. Means and methods for producing high affinity antibodies
US9822171B2 (en) 2010-04-15 2017-11-21 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
US9062101B2 (en) 2010-08-14 2015-06-23 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
US10047121B2 (en) 2010-08-14 2018-08-14 AbbVie Deutschland GmbH & Co. KG Amyloid-beta binding proteins
EP3502138A1 (en) 2010-11-15 2019-06-26 Novartis AG Silent fc variants of anti-cd40 antibodies
EP3222636A1 (en) 2010-11-15 2017-09-27 Novartis AG Silent fc variants of anti-cd40 antibodies
US9828433B2 (en) 2010-11-15 2017-11-28 Novartis Ag Nucleic acids encoding silent Fc variants of anti-CD40 antibodies
TWI608016B (zh) * 2010-11-15 2017-12-11 諾華公司 抗-CD40抗體之靜默Fc變體
US11124578B2 (en) 2010-11-15 2021-09-21 Novartis Ag Method of treating transplant rejection with silent Fc variants of anti-CD40 antibodies
CN103209996B (zh) * 2010-11-15 2016-07-20 诺瓦提斯公司 抗CD40抗体的沉默的Fc变体
US9688768B2 (en) 2010-11-15 2017-06-27 Novartis Ag Silent Fc variants of anti-CD40 antibodies
US9221913B2 (en) 2010-11-15 2015-12-29 Novartis Ag Silent Fc variants of anti-CD40 antibodies
AU2011331288B2 (en) * 2010-11-15 2014-09-11 Novartis Ag Silent Fc variants of anti-CD40 antibodies
AU2016201742B2 (en) * 2010-11-15 2017-11-02 Novartis Ag Silent Fc variants of anti-CD40 antibodies
US8828396B2 (en) 2010-11-15 2014-09-09 Novartis Ag Silent Fc variants of anti-CD40 antibodies
EP4023676A1 (en) 2010-11-15 2022-07-06 Novartis AG Silent fc variants of anti-cd40 antibodies
CN103209996A (zh) * 2010-11-15 2013-07-17 诺瓦提斯公司 抗CD40抗体的沉默的Fc变体
US10323096B2 (en) 2010-11-15 2019-06-18 Novartis Ag Nucleic acids encoding silent Fc variants of anti-CD40 antibodies
WO2012065950A1 (en) 2010-11-15 2012-05-24 Novartis Ag Silent fc variants of anti-cd40 antibodies
WO2012075111A1 (en) 2010-11-30 2012-06-07 Novartis Ag Uses of anti-cd40 antibodies in combination therapy for b cell-related cancers
US9969795B2 (en) 2010-12-02 2018-05-15 Aimm Therapeutics B.V. Means and methods for producing high affinity antibodies
US9624310B2 (en) 2011-11-17 2017-04-18 Gundram Jung Methods of using bi-specific antibodies for treating B-cell-mediated autoimmune diseases or auto-reactive B-cells
US10111958B2 (en) 2012-05-04 2018-10-30 Novartis Ag Anti-CD40 antibody formulation
US11612659B2 (en) 2012-05-04 2023-03-28 Novartis Ag Anti-CD40 antibody formulation delivery device
US10588976B2 (en) 2012-05-04 2020-03-17 Novartis Ag Anti-CD40 antibody formulation
EP3693016A1 (en) 2012-05-04 2020-08-12 Novartis AG Lyophilised and aqueous anti-cd40 antibody formulations
WO2013164789A2 (en) 2012-05-04 2013-11-07 Novartis Ag Antibody formulatoin
US10590202B2 (en) 2012-11-19 2020-03-17 Baliopharm Ag Recombinant bispecific antibody binding to CD20 and CD95
US10611829B2 (en) 2014-01-31 2020-04-07 Aimm Therapeutics B.V. Means and methods for producing stable antibodies
US11884728B2 (en) 2014-03-12 2024-01-30 Yeda Research And Development Co. Ltd. Reducing systemic regulatory T cell levels or activity for treatment of amyotrophic lateral sclerosis
US11643464B2 (en) 2014-03-12 2023-05-09 Yeda Research and Develpment & Co. Ltd Reducing systemic regulatory T cell levels or activity for treatment of a retinal degeneration disorder
US11492405B2 (en) 2014-03-12 2022-11-08 Yeda Research And Development Co. Ltd Reducing systemic regulatory t cell levels or activity for treatment of disease and injury of the CNS
US10941201B2 (en) 2016-04-18 2021-03-09 Celldex Therapeutics, Inc. Methods of inducing or enhancing an immune response comprising administering agonistic anti-CD40 antibodies
US10865244B2 (en) 2016-04-18 2020-12-15 Celldex Therapeutics, Inc. Nucleic acids encoding agonistic antibodies that bind CD40
US10633444B2 (en) 2016-04-18 2020-04-28 Celldex Therapeutics, Inc. Agonistic antibodies that bind CD40
US12297266B2 (en) 2016-04-18 2025-05-13 Celldex Therapeutics, Inc. Agonistic antibodies that bind human CD40 and uses thereof
WO2017220989A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 and il-2 cytokines
WO2017220988A1 (en) 2016-06-20 2017-12-28 Kymab Limited Multispecific antibodies for immuno-oncology
WO2017220990A1 (en) 2016-06-20 2017-12-28 Kymab Limited Anti-pd-l1 antibodies
WO2019241730A2 (en) 2018-06-15 2019-12-19 Flagship Pioneering Innovations V, Inc. Increasing immune activity through modulation of postcellular signaling factors
WO2020227159A2 (en) 2019-05-03 2020-11-12 Flagship Pioneering Innovations V, Inc. Methods of modulating immune activity
WO2021127217A1 (en) 2019-12-17 2021-06-24 Flagship Pioneering Innovations V, Inc. Combination anti-cancer therapies with inducers of iron-dependent cellular disassembly
WO2022006179A1 (en) 2020-06-29 2022-01-06 Flagship Pioneering Innovations V, Inc. Viruses engineered to promote thanotransmission and their use in treating cancer
CN115812082A (zh) * 2021-07-14 2023-03-17 舒泰神(北京)生物制药股份有限公司 特异性识别cd40的抗体及其应用
EP4406971A4 (en) * 2021-09-24 2026-01-14 Chia Tai Tianqing Pharmaceutical Group Co Ltd Anti-CD40 Antibody and Its Use
WO2024151687A1 (en) 2023-01-09 2024-07-18 Flagship Pioneering Innovations V, Inc. Genetic switches and their use in treating cancer

Also Published As

Publication number Publication date
EP2255828A1 (en) 2010-12-01
DE602004023961D1 (de) 2009-12-17
EP1682178B8 (en) 2010-09-01
JP2011126900A (ja) 2011-06-30
ECSP12006607A (es) 2012-04-30
AU2004287482B2 (en) 2011-04-14
ES2346977T3 (es) 2010-10-22
AU2004287879C1 (en) 2011-05-26
CA2544853C (en) 2014-05-20
JP2011072317A (ja) 2011-04-14
KR20060111555A (ko) 2006-10-27
JP2007512243A (ja) 2007-05-17
RS53073B (sr) 2014-04-30
JP2011105769A (ja) 2011-06-02
WO2005044294A2 (en) 2005-05-19
ATE473016T1 (de) 2010-07-15
WO2005044854A3 (en) 2005-08-11
HK1095091A1 (en) 2007-04-27
SI1694360T1 (sl) 2010-12-31
KR101403910B1 (ko) 2014-06-09
IL175225A0 (en) 2006-09-05
DE602004028505D1 (de) 2010-09-16
CA2544853A1 (en) 2005-05-19
AU2011201529A1 (en) 2011-04-28
HK1094156A1 (en) 2007-03-23
DK1682178T3 (da) 2010-10-04
CN1938045B (zh) 2014-03-26
JP4746552B2 (ja) 2011-08-10
JP4765039B2 (ja) 2011-09-07
EP1682180B1 (en) 2009-11-04
AU2004287879B2 (en) 2011-01-06
EP1694360B1 (en) 2010-08-04
DK1682180T3 (da) 2010-01-11
KR101125127B1 (ko) 2012-03-16
CN1905897A (zh) 2007-01-31
HRP20131085T1 (hr) 2013-12-20
CN1938045A (zh) 2007-03-28
SI1682180T1 (sl) 2010-03-31
AU2004287879A1 (en) 2005-05-19
HK1095270A1 (en) 2007-05-04
ES2435410T3 (es) 2013-12-19
PL1682178T3 (pl) 2010-12-31
HRP20100066T1 (hr) 2010-03-31
ZA200604419B (en) 2008-06-25
WO2005044854A2 (en) 2005-05-19
WO2005044306A3 (en) 2005-09-15
DE602004028037D1 (de) 2010-08-19
CA2544948A1 (en) 2005-05-19
EP2149585B1 (en) 2013-08-14
PL1682180T3 (pl) 2010-04-30
PT1682180E (pt) 2010-02-10
DK2149585T3 (da) 2013-10-21
IL175225A (en) 2011-12-29
PL1694360T3 (pl) 2011-04-29
PT2149585E (pt) 2013-11-27
JP2007510666A (ja) 2007-04-26
KR20060132602A (ko) 2006-12-21
ECSP066607A (es) 2006-10-25
CY1110803T1 (el) 2015-06-10
HK1139964A1 (en) 2010-09-30
WO2005044294A3 (en) 2005-09-15
EP1682180A2 (en) 2006-07-26
PT1694360E (pt) 2010-12-13
EP1682178B1 (en) 2010-07-07
EP2248830A1 (en) 2010-11-10
EP1682178A2 (en) 2006-07-26
CA2544949A1 (en) 2005-05-19
DK1694360T3 (da) 2010-10-18
PL2149585T3 (pl) 2014-01-31
ES2333971T3 (es) 2010-03-03
JP2008502309A (ja) 2008-01-31
SG148143A1 (en) 2008-12-31
ATE476448T1 (de) 2010-08-15
SI1682178T1 (sl) 2010-11-30
CY1110839T1 (el) 2015-06-10
EP2149585A1 (en) 2010-02-03
ATE447412T1 (de) 2009-11-15
PT1682178E (pt) 2010-10-21
CN1905897B (zh) 2012-09-05
JP5019881B2 (ja) 2012-09-05
EP1694360A2 (en) 2006-08-30
RS51230B (sr) 2010-12-31
AU2004287482A1 (en) 2005-05-19
AU2011201529B2 (en) 2012-11-01
MA28331A1 (fr) 2006-12-01
CA2544949C (en) 2014-02-25
CY1110231T1 (el) 2015-01-14

Similar Documents

Publication Publication Date Title
EP1694360B1 (en) Use of antagonist anti-cd40 antibodies for treatment of autoimmune and inflammatory diseases and organ transplant rejection
EP1684805B1 (en) Use of antagonist anti-cd40 monoclonal antibodies for treatment of multiple myeloma
US8945564B2 (en) Antagonist anti-CD40 antibody pharmaceutical compositions
EP1957538B1 (en) Uses of anti-cd40 antibodies
AU2004287480B2 (en) Use of antagonist anti-CD40 antibodies for treatment of chronic lymphocytic leukemia
US20080057070A1 (en) Antagonist Anti-Cd40 Monoclonal Antibodies and Methods for Their Use
ES2348087T3 (es) Uso de anticuerpos anti-cd40 antagonistas para tratamiento de enfermedades inflamatorias y autoinmunes y rechazo de transplante de organos.
HK1095091B (en) Use of antagonist anti-cd40 antibodies for treatment of autoimmune and inflammatory diseases and organ transplant rejection
HK1094162B (en) Use of antagonist anti-cd40 monoclonal antibodies for treatment of multiple myeloma
HK1095269B (en) Use of antagonist anti-cd40 antibodies for treatment of chronic lymphocytic leukemia
HK1095270B (en) Antagonist anti-cd40 monoclonal antibodies and methods for their use
HK1139964B (en) Use of antagonistic anti-cd40 monoclonal antibodies
HK1122579B (en) Uses of anti-cd40 antibodies

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 200480037489.4

Country of ref document: CN

AK Designated states

Kind code of ref document: A2

Designated state(s): AE AG AL AM AT AU AZ BA BB BG BR BW BY BZ CA CH CN CO CR CU CZ DE DK DM DZ EC EE EG ES FI GB GD GE GH GM HR HU ID IL IN IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MA MD MG MK MN MW MX MZ NA NI NO NZ OM PG PH PL PT RO RU SC SD SE SG SK SL SY TJ TM TN TR TT TZ UA UG US UZ VC VN YU ZA ZM ZW

AL Designated countries for regional patents

Kind code of ref document: A2

Designated state(s): GM KE LS MW MZ NA SD SL SZ TZ UG ZM ZW AM AZ BY KG KZ MD RU TJ TM AT BE BG CH CY CZ DE DK EE ES FI FR GB GR HU IE IS IT LU MC NL PL PT RO SE SI SK TR BF BJ CF CG CI CM GA GN GQ GW ML MR NE SN TD TG

121 Ep: the epo has been informed by wipo that ep was designated in this application
WWE Wipo information: entry into national phase

Ref document number: 2544853

Country of ref document: CA

Ref document number: 2006538513

Country of ref document: JP

WWE Wipo information: entry into national phase

Ref document number: 2004287482

Country of ref document: AU

WWE Wipo information: entry into national phase

Ref document number: 2004810420

Country of ref document: EP

WWE Wipo information: entry into national phase

Ref document number: 1020067010894

Country of ref document: KR

WWE Wipo information: entry into national phase

Ref document number: 1537/KOLNP/2006

Country of ref document: IN

ENP Entry into the national phase

Ref document number: 2004287482

Country of ref document: AU

Date of ref document: 20041104

Kind code of ref document: A

WWP Wipo information: published in national office

Ref document number: 2004287482

Country of ref document: AU

WWP Wipo information: published in national office

Ref document number: 2004810420

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 1020067010894

Country of ref document: KR