WO1997031943A1 - Use of a pharmaceutical composition comprising an appetite-suppressing peptide - Google Patents

Use of a pharmaceutical composition comprising an appetite-suppressing peptide Download PDF

Info

Publication number
WO1997031943A1
WO1997031943A1 PCT/DK1997/000086 DK9700086W WO9731943A1 WO 1997031943 A1 WO1997031943 A1 WO 1997031943A1 DK 9700086 W DK9700086 W DK 9700086W WO 9731943 A1 WO9731943 A1 WO 9731943A1
Authority
WO
WIPO (PCT)
Prior art keywords
peptide
composition according
appetite
glp
arg
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/DK1997/000086
Other languages
English (en)
French (fr)
Inventor
Lars Thim
Birgitte Schjellerup Wulff
Martin Edward Judge
Ole Dragsbæk MADSEN
Jens Juul Holst
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Novo Nordisk AS
Original Assignee
Novo Nordisk AS
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Family has litigation
First worldwide family litigation filed litigation Critical https://patents.darts-ip.com/?family=26063575&utm_source=google_patent&utm_medium=platform_link&utm_campaign=public_patent_search&patent=WO1997031943(A1) "Global patent litigation dataset” by Darts-ip is licensed under a Creative Commons Attribution 4.0 International License.
Priority to HU9902670A priority Critical patent/HU229234B1/hu
Priority to IL12580597A priority patent/IL125805A0/xx
Priority to CA2246733A priority patent/CA2246733C/en
Application filed by Novo Nordisk AS filed Critical Novo Nordisk AS
Priority to DK97905000T priority patent/DK0891378T3/da
Priority to JP53052497A priority patent/JP4064460B2/ja
Priority to DE69717092T priority patent/DE69717092T2/de
Priority to ES08103786T priority patent/ES2364705T3/es
Priority to PL97328732A priority patent/PL187095B1/pl
Priority to AT97905000T priority patent/ATE227737T1/de
Priority to AU18715/97A priority patent/AU710818B2/en
Priority to BR9707807A priority patent/BR9707807A/pt
Priority to EP97905000A priority patent/EP0891378B1/en
Priority to UA98084651A priority patent/UA70283C2/uk
Publication of WO1997031943A1 publication Critical patent/WO1997031943A1/en
Priority to NO19984005A priority patent/NO323043B1/no
Anticipated expiration legal-status Critical
Priority to NO2013006C priority patent/NO2013006I1/no
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/575Hormones
    • C07K14/605Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides
    • A61K38/16Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • A61K38/17Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • A61K38/22Hormones
    • A61K38/26Glucagons
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/04Anorexiants; Antiobesity agents
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00Drugs for disorders of the metabolism
    • A61P3/08Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Definitions

  • the present invention relates to use of a pharmaceutical composition comprising an appetite-suppressing peptide or an appetite-suppressing peptide-containing fraction, as well as a method of obtaining appetite regulation by means of said peptide.
  • Glucagon is produced by the pancreatic A-cell and released in response to low blood glucose levels. Its major site of action is the liver where it stimulates glucose production. It is thus the major hormone counteracting insulin in blood glucose homeostasis (Unger, R. H. and L. Orci (1990). Glucagon, in: Diabetes Mellitus, 4th ed. New York, Elsevier, pp 104-120).
  • Glucagon is processed from a larger precursor by limited proteolysis. Molecular cloning of the glucagon gene revealed that the proglucagon precursor contained not only glucagon but also two additional glucagon-like peptides named GLP-1 and GLP-2. GLP-1 and GLP-2 are encoded by separate exons suggesting distinct biological activities. It was later demonstrated that the proglucagon precursor was subjected to differential processing in the three different tissues known to produce proglucagon: the pancreatic A-cell, the intestinal L-cell, and in the central nervous system (CNS).
  • CNS central nervous system
  • Glucagon is thus selectively excised from the precursor in the islet A-cell, while GLP-1 and GLP-2 are selectively liberated from the intestinal L-cell and the CNS [reviewed in (Unger, R. H. and L. Orci (1990). Glucagon. in: Diabetes Mellitus. 4th ed. New York, Elsevier, pp 104-120)].
  • Specific GLP-1 receptors have been identified (Thorens, B. (1992) Proc.Natl. Acad. Sci. USA 89: 8641-8645) which are clearly distinct from the glucagon receptor (L. J Jelinek, et al. (1993) Science 259: 1614-1616) and they have different tissue distributions (R.
  • GLP-1 is released from the L-cell after a meal and functions as an incretin hormone (i.e. it potentiates glucose induced insulin release from the pancreatic B-cell).
  • the GLP-1 receptor is thus expressed at high levels on the surface of islet B-celis (K. Moens, et al. (1996) Diabetes 45: 257-261 ).
  • the glucagonoma associated anorexia is very severe: it has an acute onset and leads after few days to a complete stop in food intake. This severity of anorexia is hardly matched by other experimental tumors in rodents and suggests the production by the glucagonoma of a very powerful satiety factor which acts by a peripheral route of administration. It has previously been demonstrated that the anorectic glucagonomas displayed an unphysiological processing resulting in the formation of both glucagon and GLP-1 (O. D. Madsen, et al. (1993) Endocrinology 133: 2022-2030). Moreover, a non- anorectic glucagonoma variant was unable to process the precursor (O. D.
  • Glucagon has been shown to be involved in the regulation of spontaneous meal size in rats but the overall effect is minimal and is exerted via the vagal connections to the liver (N. Geary, et al. (1993) Am. J. Physiol. 264: R116- R122). This effect is observed only by hepatic portal infusion of glucagon while intraperitoneal administration of pharmacological doses show no effect on food intake in fasted rats (O. D. Madsen, et al. (1993) Endocrinology 133: 2022-2030).
  • GLP-1 A central role for GLP-1 in the regulation of feeding was recently reported (M. D. Turton, et al. (1996) Nature 379: 69-72). Intracerebroventricular (ICV) administration of GLP-1 inhibited feeding in fasted rats. Again peripheral administration of GLP-1 had no effect on feeding behaviour (M. D. Turton, et al. (1996) Nature 379: 69-72; O. D. Madsen, et al. (1993) Endocrinology 133: 2022-2030) suggesting that tumor produced GLP-1 may not contribute significantly to the observed anorexia.
  • ICV Intracerebroventricular
  • GLP-2 has a powerful effect on inhibiting food intake when administered peripherally.
  • GLP-2 normally released together with GLP-1 from the intestinal L-cell serves its own distinct role as a peripheral satiety factor.
  • the present invention relates to use of a pharmaceutical composition
  • a pharmaceutical composition comprising, together with a pharmaceutically acceptable excipient or vehicle, an HPLC fraction of a glucagonoma tumour extract prepared by acid ethanol extraction, gel filtration and preparative HPLC, said fraction being shown as fraction G4H9 in Fig.2 and containing glucagon-like peptide 2 (GLP-2) as a major component (i.e. more than 40%) or comprising any single component of said fraction or a combination of two or more of the components of said fraction.
  • GLP-2 glucagon-like peptide 2
  • the invention relates to use of a pharmaceutical composition comprising glucagon-like peptide-2 (GLP-2) or a variant or homologue thereof for the prohylaxis or treatment of diseases or disorders associated with impaired appetite regulation.
  • GLP-2 glucagon-like peptide-2
  • the invention relates to use of a pharmaceutical composition
  • a pharmaceutical composition comprising a peptide with the following amino acid sequence
  • X 1 is NH 2 , DFPEEVAIVEELGRR, DFPEEVTIVEELGRR, DFPEEVNIVEEL- RRR, or a fragment thereof
  • X 2 is Ala or Gly
  • X 3 is lie or Val
  • X 4 is Asn
  • Ser or His is Ala or Thr
  • X 6 is Arg or Lys
  • X 7 is lie or Leu
  • X 8 is Gin or His, or
  • X 9 is OH, Lys, Arg, Arg-Lys, Lys-Arg, Arg-Arg or Lys-Lys for the prohylaxis or treatment of diseases or disorders associated with impaired appetite regulation.
  • the invention relates to method of treating diseases or disorders associated with impaired appetite regulation, the method comprising administering to an individual in need of such treatment an amount of a peptide as specified herein sufficient to suppress appetite or induce satiety in said individual.
  • the invention relates to the use of a peptide as speci ⁇ fied herein for the manufacture of a medicament for the prophylaxis or treat ⁇ ment of diseases or disorders associated with impaired appetite regulation.
  • the term "peptide” is understood to include the mature GLP-2 peptide or a precursor form thereof as well a functional frag ⁇ ment thereof which essentially has the activity of the full-length peptide.
  • the term "peptide” is intended to include homologues of said peptide. Such homologues comprise an amino acid sequence exhibiting a degree of identity of at least 50 %, such as at least 75 %, and more particu ⁇ larly at least 90% identity with the amino acid sequence of human GLP-2. The degree of identity may be determined by conventional methods, see for instance, Altshul et al., Bull. Math. Bio. 48: 603-616, 1986, and Henikoff and Henikoff, Proc. Natl. Acad. Sci.
  • Homologues of the present peptide may have one or more amino acid substitutions, deletions or additions. These changes may be of a minor nature, that is conservative amino acid substitutions that do not significantly affect the folding or activity of the peptide, small deletions, typically of one to about five amino acids, small amino- or carboyxyl-terminal extensions, such as an a ino-terminal methionine residue, a small linker peptide of up to about 15 residues, or a small extension that facilitates purification, such as a poly- histidine tract, an antigenic epitope or a binding domain. See in general Ford et al., Protein Expression and Purification 2: 95-107, 1991.
  • conservative substitutions are within the group of basic amino acids (such as arginine, lysine, histidine), acidic amino acids (such as glutamic acid and aspartic acid), polar amino acids (such as glutamine and asparagine), hydrophobic amino acids (such as leucine, isoleucine, valine), aromatic amino acids (such as phenylalanine, tryptophan, tyrosine) and small amino acids (such as glycine, alanine, serine, threonine, methionine).
  • basic amino acids such as arginine, lysine, histidine
  • acidic amino acids such as glutamic acid and aspartic acid
  • polar amino acids such as glutamine and asparagine
  • hydrophobic amino acids such as leucine, isoleucine, valine
  • aromatic amino acids such as phenylalanine, tryptophan, tyrosine
  • small amino acids such as glycine, alanine, serine,
  • the homologue may be an allelic variant, i.e. an alternative form of a gene that arises through mutation, or an altered peptide encoded by the mutated gene, but having substantially the same activity as the native GLP-2 peptide. Hence mutations can be silent (no change in the encoded peptide) or may encode peptides having altered amino acid sequence.
  • the homologue of the present peptide may also be a species homologue, i.e. a peptide with a similar activity derived from another species.
  • species homologues of the GLP-2 peptide are human, bovine, rat, hamster, guinea pig and porcine GLP-2.
  • the GLP-2 peptide is one in which X 1 is NH 2 , X 2 is Ala, X 3 is lie, X 4 is Asn, X 5 is Ala, X 6 is Arg, X 7 is lie, X ⁇ is Gin, or X 9 is OH.
  • the peptide has the following amino acid sequence
  • HADG S FSDEM NTI LDN LAARDFI NW LI QTKITD human GLP-2
  • HADGSFSDEMNTILDNLATRDFINWLI QTKITD rat GLP-2
  • a homologue of the peptide may be isolated by preparing a genomic or cDNA library of a cell of the species in question, and screening for DNA sequences coding for all or part of the homologue by using synthetic oligonucleotide probes in accordance with standard techniques, e.g. as described by Sam- brook et al., Molecular Cloning:A Laboratory Manual.2nd. Ed. Cold Spring Harbor Laboratory, Cold Spring Harbor, New York, 1989, or by means of polymerase chain reaction (PCR) using specific primers as described by Sambrook et al., supra.
  • the present invention also relates to a composition
  • a composition comprising a variant of the GLP-2 peptide.
  • the variant is one in which one or more amino acid residues have been substituted by other amino acid residues.
  • Ala has been substituted by Gly in position 2 of the mature peptide. It is expected that this variant will exhibit a longer plasma half-life than the native peptide, which is an advantage because the dosage required to obtain an adequate appetite-suppressing or satiety-inducing effect will generally be smaller.
  • the GLP-2 peptide or homologue or variant thereof as specified above may be made by recombinant DNA techniques in accordance with procedures well established in the art. More specifically, a DNA sequence encoding the GLP-2 peptide may be isolated or synthesized on the basis of the published human preproglucagon DNA sequence (cf. J.W. White et al., Nucleic Acids Res. 14, 1986, pp. 4719- 4730; G.I. Bell et al., Nature 304, 1983, pp.
  • the DNA sequence encoding the GLP-2 peptide is preferably of human origin.
  • the DNA construct encoding the GLP-2 peptide may also be prepared syn ⁇ thetically by established standard methods, e.g. the phosphoamidite method described by Beaucage and Caruthers, Tetrahedron Letters 22 (1981 ), 1859- 1869, or the method described by Matthes et al., EMBO Journal 3 (1984), 801-805.
  • phosphoamidite method oligonucleotides are synthesized, e.g. in an automatic DNA synthesizer, purified, annealed, ligated and cloned in suitable vectors.
  • the DNA construct may be of mixed synthetic and genomic, mixed synthetic and cDNA or mixed genomic and cDNA origin prepared by ligating fragments of synthetic, genomic or cDNA origin (as appropriate), the fragments corresponding to various parts of the entire DNA construct, in accordance with standard techniques.
  • the DNA construct may also be prepared by polymerase chain reaction using specific primers, for instance as described in US 4,683,202 or Saiki et al.. Science 239 (1988), 487 - 491 , or Sambrook et al., supra.
  • the DNA construct comprises the DNA sequence shown in Fig. 3 of G.I. Bell et al., Nature 304, 1983, pp. 368-371 , as well as nucleic acid sequences encoding human GLP-2, but which differ from the DNA sequence shown in Fig. 3 of Bell et al., supra, by virtue of the degeneracy of the genetic code.
  • the DNA construct further includes nucleic acid sequences which hybridize to a nucleic acid molecule (either genomic, synthetic or cDNA or RNA) encoding human GLP-2 under the conditions of high stringency (i.e. presoaking in 5X SSC and prehydbridizing for 1 hr.
  • the DNA construct encoding the GLP-2 peptide is inserted into an appropriate recombinant vector.
  • This may be any vector which may conveniently be subjected to recombinant DNA procedures, and the choice of vector will often depend on the host cell into which it is to be introduced.
  • the vector may be an autonomously replicating vector, i.e. a vector which exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g. a plasmid.
  • the vector may be one which, when introduced into a host cell, is integrated into the host cell genome and replicated together with the chromosome(s) into which it has been integrated.
  • the vector is preferably an expression vector in which the DNA sequence encoding the GLP-2 peptide is operably linked to additional segments required for transcription of the DNA.
  • the expression vector is derived from plasmid or viral DNA, or may contain elements of both.
  • operably linked indicates that the segments are arranged so that they function in concert for their intended purposes, e.g. transcription initiates in a promoter and proceeds through the DNA sequence coding for the peptide.
  • the promoter may be any DNA sequence which shows transcriptional activity in the host cell of choice and may be derived from genes encoding proteins either homologous or heterologous to the host cell.
  • Suitable promoters for directing the transcription of the DNA encoding the GLP-2 peptide in mammalian cells are the SV40 promoter (Subramani et al., Mol. Cell Biol. 1 (1981 ), 854 -864), the MT-1 (metallothio- effet gene) promoter (Palmiter et al., Science 222 (1983), 809 - 814) or the adenovirus 2 major late promoter.
  • a suitable promoter for use in insect cells is the polyhedrin promoter (US 4,745,051 ; Vasuvedan et al., FEBS Lett. 31 1. (1992) 7 - 11 ), the P10 promoter (J.M. Vlak et al., J. Gen. Virology 69. 1988, pp. 765-776), the Autographa californica polyhedrosis virus basic protein promoter (EP 397 485), the baculovirus immediate early gene 1 promoter (US 5,155,037; US 5,162,222), or the baculovirus 39K delayed-early gene promoter (US 5,155,037; US 5,162,222).
  • the polyhedrin promoter US 4,745,051 ; Vasuvedan et al., FEBS Lett. 31 1. (1992) 7 - 11
  • the P10 promoter J.M. Vlak et al., J. Gen. Virology 69. 1988, pp. 765-776
  • promoters for use in yeast host cells include promoters from yeast glycolytic genes (Hitzeman et al., J. Biol. Chem. 255 (1980), 12073 - 12080; Alber and Kawasaki. J. Mol. APPI. Gen. 1 (1982). 419 - 434) or alcohol dehydrogenase genes (Young et al., in Genetic Engineering of Microorganisms for Chemicals (Hollaender et al, eds.), Plenum Press, New York, 1982), or the TPI1 (US 4,599,311 ) or ADH2-4c (Russell et al., Nature 304 (1983), 652 - 654) promoters.
  • suitable promoters for use in filamentous fungus host cells are, for instance, the ADH3 promoter (McKnight et al., The EMBO J. 4 (1985), 2093 - 2099) or the tpiA promoter.
  • suitable promoters are those derived from the gene encoding A. oryzae TAKA amylase, Rhizomucor miehei aspartic proteinase, A. niger neutral ⁇ -amylase, A. niger acid stable ⁇ - amylase, A. niger ox A. awamori glucoamylase (gluA), Rhizomucor miehei lipase, A.
  • oryzae alkaline protease A. oryzae t ose phosphate isomerase or A. nidulans acetamidase.
  • suitable promoters for use in bacterial host cells include the promoter of the Bacillus stearothermophilus maltogenic amylase gene, the Bacillus licheniformis alpha-amylase gene, the Bacillus amyloliquefaciens BAN amylase gene, the Bacillus subtilis alkaline protease gen, or the Bacillus pumilus xylosidase gene, or by the phage Lambda P R or P L promoters or the E. coli jac, irfi or lac . promoters.
  • the DNA sequence encoding the GLP-2 peptide may also, if necessary, be operably connected to a suitable terminator, such as the human growth hormone terminator (Palmiter et al., op. cit-) or (for fungal hosts) the TPI1 (Alber and Kawasaki, QSL. cit.) or ADH3 (McKnight et al., QJJ cjt terminators.
  • the vector may further comprise elements such as polyadenylation signals (e.g. from SV40 or the adenovirus 5 Elb region), transcriptional enhancer sequences (e.g. the SV40 enhancer) and translational enhancer sequences (e.g. the ones encoding adenovirus VA RNAs).
  • the recombinant vector may further comprise a DNA sequence enabling the vector to replicate in the host cell in question.
  • a DNA sequence enabling the vector to replicate in the host cell in question.
  • An example of such a sequence is the SV40 origin of replication.
  • suitable sequences enabling the vector to replicate are the yeast plasmid 2 ⁇ replication genes REP 1-3 and origin of replication.
  • the vector may also comprise a selectable marker, e.g. a gene the product of which complements a defect in the host cell, such as the gene coding for dihydrofolate reductase (DHFR) or the Schizosaccharomyces pombe TPI gene (described by P.R. Russell, Gene 40, 1985, pp. 125-130), or one which confers resistance to a drug, e.g. ampicillin, kanamycin, tetracyclin, chloramphenicol, neomycin, hygromycin or methotrexate.
  • selectable markers include amdS. pyrG. argB. niaD. sC.
  • a secretory signal sequence (also known as a leader sequence, preprosequence or presequence) may be provided in the recombinant vector.
  • the secretory signal sequence is joined to the DNA sequence encoding the peptide in the correct reading frame.
  • Secretory signal sequences are commonly positioned 5' to the DNA sequence encoding the peptide.
  • the secretory signal sequence may be that normally associated with the peptide or may be from a gene encoding another secreted protein.
  • the secretory signal sequence may encode any signal peptide which ensures efficient direction of the expressed peptide into the secretory pathway of the cell.
  • the signal peptide may be naturally occurr ⁇ ing signal peptide, or a functional part thereof, or it may be a synthetic peptide.
  • Suitable signal peptides have been found to be the ⁇ -f actor signal peptide (cf. US 4,870,008), the signal peptide of mouse salivary amylase (cf. O. Hagenbuchle et al., Nature 289. 1981 , pp. 643-646), a modified carboxy- peptidase signal peptide (cf. L.A. Vails et al., £ 48, 1987, pp.
  • yeast BAR1 signal peptide cf. WO 87/02670
  • yeast aspartic protease 3 YAP3
  • a sequence encoding a leader peptide may also be inserted downstream of the signal sequence and uptream of the DNA sequence encoding the GLP-2 peptide.
  • the function of the leader peptide is to allow the expressed peptide to be directed from the endoplasmic reticulum to the Golgi apparatus and further to a secretory vesicle for secretion into the culture medium (i.e. export of the peptide across the cell wall or at least through the cellular membrane into the periplasmic space of the yeast cell).
  • the leader peptide may be the yeast ⁇ -factor leader (the use of which is described in e.g.
  • the leader peptide may be a synthetic leader peptide, which is to say a leader peptide not found in nature. Synthetic leader peptides may, for instance, be constructed as described in WO 89/02463 or WO 92/1 1378.
  • the signal peptide may conveniently be derived from a gene encoding an Aspergillus sp. amylase or glucoamylase, a gene encoding a Rhizomucor miehei lipase or protease, a Humicola lanuginosa lipase.
  • the signal peptide is preferably derived from a gene encoding A. oryzae TAKA amylase, A. niger neutral ⁇ -amylase, A. niger acid-stable amylase, or A. niger glucoamylase.
  • the signal peptide may conveniently be derived from an insect gene (cf. WO 90/05783), such as the lepidopteran Manduca sexta adipokinetic hormone precursor signal peptide (cf. US 5,023,328).
  • the procedures used to ligate the DNA sequences coding for the GLP-2 peptide, the promoter and optionally the terminator and/or secretory signal sequence, respectively, and to insert them into suitable vectors containing the information necessary for replication, are well known to persons skilled in the art (cf., for instance, Sambrook et al., op.cit.l.
  • the DNA sequence encoding the GLP-2 peptide introduced into the host cell may be either homologous or heterologous to the host in question. If homologous to the host cell, i.e. produced by the host cell in nature, it will typically be operably connected to another promoter sequence or, if appli- cable, another secretory signal sequence and/or terminator sequence than in its natural environment.
  • homologous is intended to include a cDNA sequence encoding a polypeptide native to the host organism in question.
  • heterologous is intended to include a DNA sequence not expressed by the host cell in nature.
  • the DNA sequence may be from another organism, or it may be a synthetic sequence.
  • the host cell into which the DNA construct or the recombinant vector of the invention is introduced may be any cell which is capable of producing the present peptide and includes bacteria, yeast, fungi and higher eukaryotic cells.
  • Examples of bacterial host cells which, on cultivation, are capable of produc ⁇ ing the GLP-2 peptide are grampositive bacteria such as strains of Bacillus, such as strains of B. subtilis, B. licheniformis, B. lentus, B. brevis, B. stearo- thermophilus, B. alkalophilus, B. amyloliquefaciens, B. coagulans, B. circulans, B. lautus, B. megatherium or B. thuringiensis, or strains of Streptomyces, such as S. lividans or S. murinus, or gramnegative bacteria such as Echerichia coli.
  • the transformation of the bacteria may be effected by protoplast transformation or by using competent cells in a manner known per se (cf . Sambrook et al., supra).
  • the peptide When expressing the peptide in bacteria such as E. coli, the peptide may be retained in the cytoplasm, typically as insoluble granules (known as inclusion bodies), or may be directed to the periplasmic space by a bacterial secretion sequence. In the former case, the cells are lysed and the granules are recovered and denatured after which the peptide is refolded by diluting the denaturing agent. In the latter case, the peptide may be recovered from the periplasmic space by disrupting the cells, e.g. by sonicatio ⁇ or osmotic shock, to release the contents of the periplasmic space and recovering the peptide.
  • the cytoplasm typically as insoluble granules (known as inclusion bodies)
  • the cells are lysed and the granules are recovered and denatured after which the peptide is refolded by diluting the denaturing agent.
  • the peptide may be recovered from the peri
  • suitable mammalian cell lines are the COS (ATCC CRL 1650), BHK (ATCC CRL 1632, ATCC CCL 10), CHL (ATCC CCL39) or CHO (ATCC CCL 61 ) cell lines.
  • Methods of transfecting mammalian cells and expressing DNA sequences introduced in the cells are described in e.g. Kaufman and Sharp, J. Mol. Biol. 159 (1982), 601 - 621 ; Southern and Berg, J. Mol. APPI. Genet. 1 (1982), 327 - 341 ; Loyter et al., Proc. Natl. Acad. Sci.
  • yeasts cells include cells of Saccharomyces spp. or Schizosaccharomyces spp., in particular strains of Saccharomyces cerevisiae or Saccharomyces kluyveri. Methods for transforming yeast cells with heterologous DNA and producing heterologous polypeptides therefrom are described, e.g. in US 4,599,31 1 , US 4,931 ,373, US 4,870,008, 5,037,743, and US 4,845,075, all of which are hereby incorporated by reference. Trans- formed cells are selected by a phenotype determined by a selectable marker, commonly drug resistance or the ability to grow in the absence of a particular nutrient, e.g. leucine.
  • a selectable marker commonly drug resistance or the ability to grow in the absence of a particular nutrient, e.g. leucine.
  • a preferred vector for use in yeast is the POT1 vector disclosed in US 4,931 ,373.
  • the DNA sequence encoding the GLP-2 peptide may be preceded by a signal sequence and optionally a leader sequence, e.g. as described above.
  • suitable yeast cells are strains of Kluyveromyces, such as K. lactis, Hansenula, e.g. H. polymorpha, or Pichia, e.g. P. pastoris (cf. Gleeson et al., J. Gen. Microbiol. 132. 1986, pp. 3459- 3465; US 4,882,279).
  • Examples of other fungal cells are cells of filamentous fungi, e.g. Aspergillus spp., Neurospora spp., Fusarium spp. or Trichoderma spp., in particular strains of A. oryzae, A. nidulans or A. niger.
  • Aspergillus spp. for the expression of proteins is described in, e.g., EP 272 277 and EP 230 023.
  • the transformation of F. oxysporum may, for instance, be carried out as described by Malardier et al., 1989, Gene 78: 147-156.
  • a filamentous fungus When a filamentous fungus is used as the host cell, it may be transformed with the DNA construct encoding the GLP-2 peptide, conveniently by inte ⁇ grating the DNA construct in the host chromosome to obtain a recombinant host cell.
  • This integration is generally considered to be an advantage as the DNA sequence is more likely to be stably maintained in the cell. Integration of the DNA constructs into the host chromosome may be performed according to conventional methods, e.g. by homologous or heterologous recombination.
  • Transformation of insect cells and production of heterologous polypeptides therein may be performed as described in US 4,745,051 ; US 4,879,236; US 5,155,037; 5,162,222; EP 397,485) all of which are incorporated herein by reference.
  • the insect cell line used as the host may suitably be a Lepidoptera cell line, such as Spodoptera frugiperda cells or Trichoplusia ni cells (cf . US 5,077,214).
  • Culture conditions may suitably be as described in, for instance, WO 89/01029 or WO 89/01028, or any of the aforementioned references.
  • the transformed or transfected host cell described above is then cultured in a suitable nutrient medium under conditions permitting the expression of the GLP-2 peptide, after which the resulting GLP-2 peptide is recovered from the culture.
  • the medium used to culture the cells may be any conventional medium suitable for growing the host cells, such as minimal or complex media contain ⁇ ing appropriate supplements. Suitable media are available from commercial suppliers or may be prepared according to published recipes (e.g. in catalogues of the American Type Culture Collection).
  • the GLP-2 peptide produced by the cells may then be recovered from the culture medium by conventional procedures including separating the host cells from the medium by centrifugation or filtration, precipitating the proteinaceous components of the supernatant or filtrate by means of a salt, e.g. ammonium sulphate, purification by a variety of chromatographic procedures, e.g. ion exchange chromatography, gelfiltration chromatography, affinity chromatography, or the like.
  • the GLP-2 peptide may be formulated by any of the established methods of formulating pharmaceutical compositions, e.g. as described in Remington's Pharmaceutical Sciences. 1985.
  • the composition may be in a form suited for systemic injection or infusion and may, as such, be formulated with a suitable liquid vehicle such as sterile water or an isotonic saline or glucose solution.
  • a suitable liquid vehicle such as sterile water or an isotonic saline or glucose solution.
  • the compositions may be sterilized by conventional sterilization techniques which are well known in the art.
  • the resulting aqueous solutions may be packaged for use or filtered under aseptic conditions and lyophilized, the lyophilized preparation being combined with the sterile aqueous solution prior to administration.
  • the composition may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as buffering agents, tonicity adjusting agents and the like, for instance sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, etc
  • the pharmaceutical composition of the present invention may also be adapted for nasal, transdermal, pulmonal or rectal administration.
  • the pharmaceutically acceptable carrier or diluent employed in the composition may be any conven ⁇ tional solid carrier. Examples of solid carriers are lactose, terra alba, sucrose, talc, gelatin, agar, pectin, acacia, magnesium stearate and stearic acid.
  • the carrier or diluent may include any sustained release material known in the art, such as glyceryl monostearate or glyceryl distearate, alone or mixed with a wax. It may be of particular advantage to provide the composition of the invention in the form of a sustained release formulation.
  • composition may be formulated as microcapsules or microparticles containing the GLP-2 peptide encapsulated by or dispersed in a suitable pharmaceutically acceptable biode ⁇ gradable polymer such as polylactic acid, polyglycolic acid or a lactic acid/glycolic acid copolymer.
  • a suitable pharmaceutically acceptable biode ⁇ gradable polymer such as polylactic acid, polyglycolic acid or a lactic acid/glycolic acid copolymer.
  • the preparation may contain GLP-2 peptide dissolved or suspended in a liquid carrier, in particular an aqueous carrier, for aerosol application.
  • a liquid carrier in particular an aqueous carrier
  • the carrier may contain additives such as solubilizing agents, e.g. propylene glycol, surfactants, absorption enhancers such as lecithin (phospha- tidylcholine) or cyclodextrin, or preservatives such as parabenes.
  • the compounds of the present invention are dispensed in unit dosage form comprising 0.5-500 mg of the peptide together with a pharma ⁇ ceutically acceptable carrier per unit dosage.
  • the GLP-2 peptide is contemplated to be advantageous to use in appetite suppression or satiety induction, such as for the prophylaxis or treatment of diseases or disorders associated with impaired appetite regulation. Examples of such diseases or disorders are obesity and type II diabetes.
  • the dosage of the GLP-2 peptide administered to a patient will vary with the type and severity of the condition to be treated, but is generally in the range of from about 10 ⁇ g/kg to about 5 mg/kg body weight.
  • the GLP-2 peptide may be combined with another appetite-suppressing or satiety-inducing agent.
  • GLP-1 which has been shown to have some effect on appetite suppression (cf. M.D. Turton et al., Nature 379, 4 January 1996, pp. 69-72).
  • GLP-2 peptide in suitably labelled form e.g. radiolabelled GLP-2, may be used to identify a receptor for GLP-2 in binding studies using tissue(s) expected to express the GLP-2 receptor, e.g. hypothalamus tissue. Once localized by GLP-2 binding, the receptor may be cloned by expression cloning, i.e.
  • a cell line stably expressing the receptor may then be used in a screening assay for GLP-2 agonists (i.e. compounds acting on the receptor to induce satiety or suppress appetite) or GLP-2 antagonists (i.e. compounds which antagonize the action of GLP-2 on the receptor, e.g. for use in the treatment of cancer anorexia or anorexia nervosa).
  • GLP-2 agonists i.e. compounds acting on the receptor to induce satiety or suppress appetite
  • GLP-2 antagonists i.e. compounds which antagonize the action of GLP-2 on the receptor, e.g. for use in the treatment of cancer anorexia or anorexia nervosa.
  • Anorectic tumors were produced in rats as previously described (Madsen, O.D. et al. (1993) Endocrinology 133, 2022-2030).
  • Fifty anorectic 12C3AN (MSL-G-AN) tumours (at -80°C) corresponding to 50.07 g of wet tissue were homogenised at 4°C with 700 ml of acid ethanol (96% ethanol/0.7M HCI, 3/1 , vol/vol). The homogenisation was carried out for 5 min in a precooled (4°C) 2 liter Waring Commercial Blender at maximum speed. After homogenisation the mixture was stirred at 4°C for 16 hours. The mixture was centrifuged at 9000 RPM at 4°C for 1 hour.
  • the volume of the supernatant was reduced to 20% by vacuum rotation. During this process, in which the main part of the ethanol is removed, some precipitate is formed. This precipitate was removed by centrifugation at 4°C for one hour at 20.000 RPM.
  • the supernatant which still contained some lipid-like material, was filtered and applied to a LiChroprep RP-18 (Merck) column (2.5 x 10cm) equilibrated with 0.1 % TFA at a flow rate of 2 ml/min. The column was washed with 100 ml of 0.1 % of TFA at a flow rate of 4 ml/min.
  • Bound material was eluted with 400 ml of 0.1 % TFA containing 70% (vol/vol) of acetonitrile. The acetonitrile was removed by vacuum rotation and the resulting mixture was lyophilised. After lyophilization the material was dissolved in 50 ml of water and the pH was adjusted to 5.3 with 425 ⁇ l of 1N NaOH. Further titration of the mixture to pH 6.0 resulted in the formation of a precipitate. Upon back titration to pH 5.3 this precipitate was dissolved again. Therefore the pH was left at 5.3 and the mixture was lyophilised.
  • the total yield of lyophilised material from 50 tumours was 359 mg of dry powder.
  • Lyophilized material (278 mg) from the acid ethanol extract corresponding to 38 individual tumors was redissolved in 20 ml of 1 M HAc and applied to Sephadex G75 column (5 x 50 cm). The column was equilibrated and eluted with 1 M HAc at a flow rate of 55 ml/h, and fractions corresponding to 10 ml were collected. The absorption at 280 nm was recorded for each fraction.
  • the gel filtration chromatogram is shown in Fig. 1. Individual fractions were pooled in the following 5 main fractions: G1 (Fr. 30-39), G2 (Fr. 40-45), G3 (Fr. 46-66), G4 (Fr. 67-91 ) and G5 (Fr. 92-118) and subjected to bioassay after lyophilization.
  • Second purification step Preparative HPLC of the G4 pool
  • the material was eluted at 25°C at a flow rate of 4 ml/min with a linear gradient formed from MeCN/H 2 O/TFA (10:79.9:0.1, v/v/v) and MeCN/H 2 O/TFA (65.0:34.9:0.1 , v/v/v) over 110 min.
  • UV absorption was monitored at 214 nm and 280 nm.
  • the HPLC chromatogram (monitored at 280nm) is shown in Fig. 2. Fractions corresponding to 10 main pools were generated as indicated in Fig. 2. The volume was reduced to approx. 25% by vacuum rotation and the fractions were lyophilized and tested in the bioassay.
  • the appetite suppression activity was found in fraction G4H9 (Example 6) and the peptides of this fraction were analysed by amino acid sequence analysis and mass spectrometry analysis (Example 4) .
  • the dominating peptide in this fraction was found to have the following amino acid sequence: HADGSFSDEMNTILDNLATRDFI NWLIQTKITD
  • the molecular weight found by mass spectrometry was: 3796.
  • This peptide is identical to rat GLP-2 (1-33). Minor amounts of the following two peptides were also found:
  • HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR These peptides are identical to rat GLP-2 which is N-terminally extended with spacer peptide 2 and rat GLP-1 (1-36amide), respectively.
  • mice were deprived of their normal feed for two days and given free access to a
  • mice were injected intraperitoneally with 0.5ml of a solution containing the test substance.
  • mice were placed in one of eight 15 cm 2 test box with a stainless steel grid floor and a glass drinking tube which projected into the box.
  • the drinking tube was connected to a reservoir containing a 20% sucrose solution, and the interior of the drinking tube contained an electrode enabling the detection of drinking contacts with the solution by measuring the flow of a weak (unnoticeable) electric current through mice by means of an electronic apparatus connected to the drinking tube electrode and the stainless steel grid floor.
  • the degree of appetite suppression produced by a given test substance was determined by statistical comparison of the duration of sucrose consumption by control (vehicle treated) mice with that of mice treated with a test substance. The degree of appetite suppression in a treated group of mice was expressed as percent of the control groups response.
  • mice were tested for appetite suppression (see Example 5) after treatment with a test substance.
  • the test substance consisted of extracts of the anorectic glucagonoma tumor prepared according to Example 3 (Gelfiltration fraction G4) or according to Example 4 (HPLC fraction G4H9) dissolved in phosphate buffered saline.
  • the test solution containing lyophilized material from the Gelfiltration fraction G4 corresponding to 3.3 tumors suppressed sucrose consumption by 72%.
  • the GLP-2 containing fraction, G4H9 gave a statistically significant suppression of appetite, suppressing sucrose consumption by 49%, when lyophilized material corresponding to 5.3 tumors was given.
  • Porcine GLP-2 has the following amino acid sequence:
  • Test method for measuring appetite suppression in mice The method is as in Example 5, but instead of 20% sucrose, a solution of infant formula milk (Complan ® ) is used.
  • the test substance is dissolved in a vehicle consisting of phosphate buffered saline with 1% albumin.
  • Test substances dissolved in vehicle are injected either intravenously (IV) in a volume of 100 microliters, or intra-cerebroventricularly (ICV) in a volume of 10 microliters.
  • mice were tested for appetite suppression as described in Example 8 after treatment with a test substance consisting of synthetic human GLP-2.
  • GLP-2 has the following amino acid sequence:
  • GLP-2 suppressed milk consumption by 24%, while ICV injections of 3 micrograms and 10 micrograms of synthetic human GLP-2 suppressed milk consumption by 32% and 35%, respectively.

Landscapes

  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • General Health & Medical Sciences (AREA)
  • Diabetes (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Engineering & Computer Science (AREA)
  • Animal Behavior & Ethology (AREA)
  • Endocrinology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Zoology (AREA)
  • General Chemical & Material Sciences (AREA)
  • Obesity (AREA)
  • Hematology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Molecular Biology (AREA)
  • Toxicology (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Genetics & Genomics (AREA)
  • Child & Adolescent Psychology (AREA)
  • Emergency Medicine (AREA)
  • Immunology (AREA)
  • Epidemiology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
PCT/DK1997/000086 1996-03-01 1997-02-27 Use of a pharmaceutical composition comprising an appetite-suppressing peptide Ceased WO1997031943A1 (en)

Priority Applications (15)

Application Number Priority Date Filing Date Title
UA98084651A UA70283C2 (en) 1996-03-01 1997-02-27 Peptide (variants), a pharmaceutical composition cpeptide (variants), a pharmaceutical composition composed of peptide and a method for the preparatioomposed of peptide and a method for the preparation thereof (variants) n thereof (variants)
PL97328732A PL187095B1 (pl) 1996-03-01 1997-02-27 Peptyd, kompozycja farmaceutyczna zawierająca peptyd, zastosowanie peptydu oraz zastosowanie frakcji HPLC ekstraktu nowotworu glukagonoma
CA2246733A CA2246733C (en) 1996-03-01 1997-02-27 Use of a pharmaceutical composition comprising an appetite-suppressing peptide
AU18715/97A AU710818B2 (en) 1996-03-01 1997-02-27 Use of a pharmaceutical composition comprising an appetite-suppressing peptide
DK97905000T DK0891378T3 (da) 1996-03-01 1997-02-27 Anvendelse af farmaceutisk formulering omfattende et appetitundertrykkende peptid
JP53052497A JP4064460B2 (ja) 1996-03-01 1997-02-27 食欲抑制性ペプチドを含む医薬組成物の用途
DE69717092T DE69717092T2 (de) 1996-03-01 1997-02-27 Gebrauch einer pharmazeutischen Zusammensetzung, enthaltend ein appetitzügelndes Peptid
ES08103786T ES2364705T3 (es) 1996-03-01 1997-02-27 Péptido supresor del apetito, su composición y uso.
AT97905000T ATE227737T1 (de) 1996-03-01 1997-02-27 Gebrauch einer pharmazeutischen zusammensetzung, enthaltend ein appetitzügelndes peptid
HU9902670A HU229234B1 (en) 1996-03-01 1997-02-27 Use of a pharmaceutical composition comprising an appetite-suppressing peptide
IL12580597A IL125805A0 (en) 1996-03-01 1997-02-27 Use of a pharmaceutical composition comprising an appetite-suppressing peptide
BR9707807A BR9707807A (pt) 1996-03-01 1997-02-27 Uso de uma composição farmacêutica composição farmacêutica processo de tratar doenças ou distúrbios associados com a regulação do apetite prejudicado e uso de um peptideo
EP97905000A EP0891378B1 (en) 1996-03-01 1997-02-27 Use of a pharmaceutical composition comprising an appetite-suppressing peptide
NO19984005A NO323043B1 (no) 1996-03-01 1998-08-31 peptid, farmasoytisk preparat som omfatter et slikt, og anvendelse av et slikt peptid til fremstilling av et farmasoytisk preparat for appetittundertrykkelse eller metthetsinduksjon.
NO2013006C NO2013006I1 (no) 1996-03-01 2013-03-12 Teduglutide i alle dens former slik som de er beskyttet av de grunnleggende patentene

Applications Claiming Priority (4)

Application Number Priority Date Filing Date Title
DK23096 1996-03-01
DK0230/96 1996-03-01
DK0231/96 1996-03-01
DK23196 1996-03-01

Publications (1)

Publication Number Publication Date
WO1997031943A1 true WO1997031943A1 (en) 1997-09-04

Family

ID=26063575

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/DK1997/000086 Ceased WO1997031943A1 (en) 1996-03-01 1997-02-27 Use of a pharmaceutical composition comprising an appetite-suppressing peptide

Country Status (22)

Country Link
EP (4) EP2295453A3 (https=)
JP (1) JP4064460B2 (https=)
KR (1) KR100611130B1 (https=)
CN (1) CN1112367C (https=)
AT (3) ATE227737T1 (https=)
AU (1) AU710818B2 (https=)
BR (1) BR9707807A (https=)
CA (1) CA2246733C (https=)
CY (2) CY2619B2 (https=)
CZ (1) CZ297338B6 (https=)
DE (3) DE69740176D1 (https=)
DK (2) DK1975177T3 (https=)
ES (3) ES2306685T3 (https=)
FR (1) FR13C0009I2 (https=)
HU (1) HU229234B1 (https=)
IL (1) IL125805A0 (https=)
NO (2) NO323043B1 (https=)
PL (1) PL187095B1 (https=)
PT (1) PT1975177E (https=)
RU (1) RU2197261C2 (https=)
UA (1) UA70283C2 (https=)
WO (1) WO1997031943A1 (https=)

Cited By (56)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP0830377A1 (en) 1995-04-14 1998-03-25 1149336 Ontario Inc. Glucagon-like peptide-2 and its therapeutic use
WO1998020895A1 (en) * 1996-11-12 1998-05-22 Novo Nordisk A/S Use of glp-1 peptides
WO1999014239A1 (de) * 1997-09-12 1999-03-25 Wolf Georg Forssmann Zusammensetzung zur therapie von diabetes mellitus und fettsucht
WO1999029336A1 (en) * 1997-12-05 1999-06-17 Eli Lilly And Company Glp-1 formulations
WO1999043361A1 (en) * 1998-02-27 1999-09-02 Novo Nordisk A/S Glp-2 derivatives with helix-content exceeding 25 %, forming partially structured micellar-like aggregates
WO1999043707A1 (en) * 1998-02-27 1999-09-02 Novo Nordisk A/S N-terminally modified glp-1 derivatives
WO1999043705A1 (en) * 1998-02-27 1999-09-02 Novo Nordisk A/S N-terminally truncated glp-1 derivatives
WO1999047161A1 (en) * 1998-03-19 1999-09-23 Bionebraska, Inc. Human appetite control by glucagon-like peptide receptor binding compounds
US6051557A (en) * 1997-05-16 2000-04-18 1149336 Ontario Inc. Methods of enhancing functioning of the upper gastrointestinal tract
US6191102B1 (en) 1996-11-05 2001-02-20 Eli Lilly And Company Use of GLP-1 analogs and derivatives administered peripherally in regulation of obesity
EP1231219A1 (en) 1996-04-12 2002-08-14 1149336 Ontario Inc. GLucagon-like peptide-2 analogs
US6458924B2 (en) 1996-08-30 2002-10-01 Novo Nordisk A/S Derivatives of GLP-1 analogs
WO2002022151A3 (en) * 2000-09-18 2003-03-13 Osteometer Bio Tech As Use of glp-1 and flp-2 peptides for treatment of bone disorders
WO2004069314A1 (en) 2003-02-04 2004-08-19 Novo Nordisk A/S Injection device with rotatable dose setting
US6852690B1 (en) 1995-08-22 2005-02-08 Amylin Pharmaceuticals, Inc. Method and composition for enhanced parenteral nutrition
US6998387B1 (en) 1998-03-19 2006-02-14 Amylin Pharmaceuticals, Inc. Human appetite control by glucagon-like peptide receptor binding compounds
US7056701B2 (en) 1992-01-31 2006-06-06 Aventis Behring L.L.C. Hormone and albumin fusion protein
US7141547B2 (en) 2001-12-21 2006-11-28 Human Genome Sciences, Inc. Albumin fusion proteins comprising GLP-1 polypeptides
US7186683B2 (en) 2000-09-18 2007-03-06 Sanos Bioscience A/S Use of GLP for the treatment, prevention, diagnosis, and prognosis of bone-related and nutrition-related disorders
US7235627B2 (en) 1996-08-30 2007-06-26 Novo Nordisk A/S Derivatives of GLP-1 analogs
US7371721B2 (en) 2000-09-18 2008-05-13 Sanos Bioscience A/S Use of GLP-2 and related compounds for the treatment, prevention, diagnosis, and prognosis of bone-related disorders and calcium homeostasis related syndromes
US7411039B2 (en) 2002-10-14 2008-08-12 Novo Nordisk A/S GLP-2 compounds, formulations, and uses thereof
EP2033662A1 (en) 2004-01-21 2009-03-11 Novo Nordisk Health Care AG Transglutaminase mediated conjugation of peptides
US7507414B2 (en) 2000-04-12 2009-03-24 Human Genome Sciences, Inc. Albumin fusion proteins
US7521424B2 (en) 2003-01-22 2009-04-21 Human Genome Sciences, Inc. Albumin fusion proteins
EP2062593A2 (en) 2000-12-01 2009-05-27 Takeda Pharmaceutical Company Limited Method for producing preparation containing bioactive peptide
US7569384B2 (en) 2004-02-09 2009-08-04 Human Genome Sciences, Inc. Albumin fusion proteins
EP1734971A4 (en) * 2004-04-15 2009-12-23 Alkermes Inc POLYMER-BASED DEVICE WITH DELAYED RELEASE
US7781401B2 (en) 1995-04-14 2010-08-24 Nps Pharmaceuticals, Inc. Glucagon-like peptide-2 analogs
US7888317B2 (en) 1995-04-14 2011-02-15 Nps Pharmaceuticals, Inc. Glucagon-like peptide-2 and its therapeutic use
US7977306B2 (en) 2001-12-21 2011-07-12 Human Genome Sciences, Inc. Albumin fusion proteins
EP2343082A1 (en) * 2001-09-07 2011-07-13 Imperial Innovations Limited Oxyntomodulin for preventing or treating excess weight
US8293871B2 (en) 2004-04-15 2012-10-23 Alkernnes Pharma Ireland Limited Poly(lactide-co-glycolide) based sustained release microcapsules comprising a polypeptide and a sugar
US8410047B2 (en) 2004-06-11 2013-04-02 Novo Nordisk A/S Counteracting drug-induced obesity using GLP-1 agonists
US8431533B2 (en) 2005-09-22 2013-04-30 Biocompatibles Uk Ltd. GLP-1 fusion peptides, their production and use
WO2014010586A1 (ja) 2012-07-10 2014-01-16 武田薬品工業株式会社 注射用製剤
US8790705B2 (en) 2006-05-10 2014-07-29 Biocompatibles Uk Ltd. Spherical microcapsules comprising GLP-1 peptides, their production and use
US9453064B2 (en) 2012-05-03 2016-09-27 Zealand Pharma A/S Glucagon-like-peptide-2 (GLP-2) analogues
US9486504B2 (en) 2003-12-09 2016-11-08 Novo Nordisk A/S Regulation of food preference using GLP-1 agonists
US9580487B2 (en) 2005-05-04 2017-02-28 Zealand Pharma A/S Method of treating stomach or bowel-related disorders by administering glucagon-like-peptide-2 (GLP-2) analogues
US9889085B1 (en) 2014-09-30 2018-02-13 Intarcia Therapeutics, Inc. Therapeutic methods for the treatment of diabetes and related conditions for patients with high baseline HbA1c
US10092648B2 (en) 2006-11-08 2018-10-09 Zealand Pharma A/S Selective glucagon-like-peptide-2 (GLP-2) analogues
USD835783S1 (en) 2016-06-02 2018-12-11 Intarcia Therapeutics, Inc. Implant placement guide
US10159714B2 (en) 2011-02-16 2018-12-25 Intarcia Therapeutics, Inc. Compositions, devices and methods of use thereof for the treatment of cancers
US10231923B2 (en) 2009-09-28 2019-03-19 Intarcia Therapeutics, Inc. Rapid establishment and/or termination of substantial steady-state drug delivery
US10363287B2 (en) 2005-02-03 2019-07-30 Intarcia Therapeutics, Inc. Method of manufacturing an osmotic delivery device
USD860451S1 (en) 2016-06-02 2019-09-17 Intarcia Therapeutics, Inc. Implant removal tool
US10441528B2 (en) 2008-02-13 2019-10-15 Intarcia Therapeutics, Inc. Devices, formulations, and methods for delivery of multiple beneficial agents
US10501517B2 (en) 2016-05-16 2019-12-10 Intarcia Therapeutics, Inc. Glucagon-receptor selective polypeptides and methods of use thereof
US10527170B2 (en) 2006-08-09 2020-01-07 Intarcia Therapeutics, Inc. Osmotic delivery systems and piston assemblies for use therein
WO2020223761A1 (en) * 2019-05-06 2020-11-12 The University Of Sydney Methods for the fractionation of proteins
US10835580B2 (en) 2017-01-03 2020-11-17 Intarcia Therapeutics, Inc. Methods comprising continuous administration of a GLP-1 receptor agonist and co-administration of a drug
US10905745B2 (en) 2016-12-09 2021-02-02 Zealand Pharma A/S Acylated GLP-1/GLP-2 dual agonists
US10925639B2 (en) 2015-06-03 2021-02-23 Intarcia Therapeutics, Inc. Implant placement and removal systems
US11246913B2 (en) 2005-02-03 2022-02-15 Intarcia Therapeutics, Inc. Suspension formulation comprising an insulinotropic peptide
US12297251B1 (en) 2017-06-16 2025-05-13 Zealand Pharma A/S Injection pen for subcutaneous administration of a peptide

Families Citing this family (10)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
DE69740176D1 (de) * 1996-03-01 2011-05-26 Novo Nordisk As Appetithemmendes Peptid, Zusammensetzung und Verwendung
GB2355657B (en) 1999-10-27 2004-07-28 Phytopharm Plc Inhibitors Of Gastric Acid Secretion
GB2363985B (en) 2000-06-30 2004-09-29 Phytopharm Plc Extracts,compounds & pharmaceutical compositions having anti-diabetic activity and their use
RU2262945C1 (ru) * 2004-04-29 2005-10-27 Закрытое акционерное общество "Научно-производственное предприятие "Тринита" Способ снижения массы тела в эксперименте на животных
US20100278843A1 (en) * 2007-08-16 2010-11-04 St. Vincent's Hospital Sydney Limited Agents and methods for modulating macrophage inhibitory cytokine (mic-1) activity
ES2360782B1 (es) * 2009-07-28 2012-03-12 Grifols, S.A. Medios para cultivo de células de mamíferos que comprenden sobrenadante de etapas del fraccionamiento de Cohn y uso de los mismos.
KR101576126B1 (ko) 2014-12-29 2015-12-11 부경대학교 산학협력단 αAL14 펩타이드를 유효성분으로 함유하는 신규 비만 예방 및 치료용 약학적 조성물
KR101669140B1 (ko) * 2015-04-28 2016-10-26 (주)케어젠 항비만 및 항당뇨 효능을 갖는 펩타이드 및 이의 용도
US10188135B2 (en) * 2015-11-04 2019-01-29 Stokley-Van Camp, Inc. Method for inducing satiety
KR101887576B1 (ko) * 2016-04-15 2018-08-13 (주)케어젠 항비만 및 항당뇨 효능을 갖는 펩타이드 및 이의 용도

Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1993018786A1 (en) * 1992-03-19 1993-09-30 Novo Nordisk A/S Use of a peptide
WO1996032414A1 (en) * 1995-04-14 1996-10-17 1149336 Ontario Inc. Glucagon-like peptide-2 and its therapeutic use

Family Cites Families (31)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4203570A (en) 1978-08-23 1980-05-20 The Western States Machine Company Power-operated loading gate for centrifugal machines incorporating an auxiliary drive device
US4546082A (en) 1982-06-17 1985-10-08 Regents Of The Univ. Of California E. coli/Saccharomyces cerevisiae plasmid cloning vector containing the alpha-factor gene for secretion and processing of hybrid proteins
US4599311A (en) 1982-08-13 1986-07-08 Kawasaki Glenn H Glycolytic promotersfor regulated protein expression: protease inhibitor
EP0116201B1 (en) 1983-01-12 1992-04-22 Chiron Corporation Secretory expression in eukaryotes
JPS60501140A (ja) 1983-04-22 1985-07-25 アムジエン 酵母による外因性ポリペプチドの分泌
NZ207926A (en) 1983-04-25 1988-04-29 Genentech Inc Use of yeast #a#-factor to assist in expression of proteins heterologus to yeast
US4745051A (en) 1983-05-27 1988-05-17 The Texas A&M University System Method for producing a recombinant baculovirus expression vector
US4870008A (en) 1983-08-12 1989-09-26 Chiron Corporation Secretory expression in eukaryotes
US4879236A (en) 1984-05-16 1989-11-07 The Texas A&M University System Method for producing a recombinant baculovirus expression vector
US4931373A (en) 1984-05-25 1990-06-05 Zymogenetics, Inc. Stable DNA constructs for expression of α-1 antitrypsin
DK58285D0 (da) 1984-05-30 1985-02-08 Novo Industri As Peptider samt fremstilling og anvendelse deraf
US4766073A (en) 1985-02-25 1988-08-23 Zymogenetics Inc. Expression of biologically active PDGF analogs in eucaryotic cells
US4683202A (en) 1985-03-28 1987-07-28 Cetus Corporation Process for amplifying nucleic acid sequences
US4632925A (en) * 1985-10-07 1986-12-30 Hoffmann-La Roche Inc. N-substituted diphenylpiperidines and antiobesity use thereof
UA41863C2 (uk) 1985-10-25 2001-10-15 Займодженетікс Інк. Спосіб одержання гетерологічного поліпептиду в еукаріотичних мікроорганізмах
US4882279A (en) 1985-10-25 1989-11-21 Phillips Petroleum Company Site selective genomic modification of yeast of the genus pichia
AU607690B2 (en) 1985-12-24 1991-03-14 Marion Laboratories, Inc. Use of synthetic sulfated saccharides to enhance wound healing
US4935349A (en) 1986-01-17 1990-06-19 Zymogenetics, Inc. Expression of higher eucaryotic genes in aspergillus
CA1309680C (en) 1987-07-24 1992-11-03 David Harano Airlift insect cell culture
US5024947A (en) 1987-07-24 1991-06-18 Cetus Corporation Serum free media for the growth on insect cells and expression of products thereby
DK463887D0 (da) 1987-09-07 1987-09-07 Novo Industri As Gaerleader
SU1697823A1 (ru) * 1988-08-01 1991-12-15 Киевский государственный институт усовершенствования врачей Способ лечени алиментарно-конституционального ожирени
US5037743A (en) 1988-08-05 1991-08-06 Zymogenetics, Inc. BAR1 secretion signal
AU4647889A (en) 1988-11-18 1990-06-12 Cetus Corporation Insect signal peptide mediated secretion of recombinant proteins
GB8910962D0 (en) 1989-05-12 1989-06-28 Natural Environment Res Novel baculovirus expression vectors and use thereof in the expression of foreign proteins in insects or insect cells
US5162222A (en) 1989-07-07 1992-11-10 Guarino Linda A Use of baculovirus early promoters for expression of foreign genes in stably transformed insect cells or recombinant baculoviruses
US5077214A (en) 1989-07-07 1991-12-31 The Texas A&M University System Use of baculovirus early promoters for expression of foreign genes in stably transformed insect cells
US5023328A (en) 1989-08-04 1991-06-11 The Texas A&M University System Lepidopteran AKH signal sequence
US5155037A (en) 1989-08-04 1992-10-13 The Texas A&M University System Insect signal sequences useful to improve the efficiency of processing and secretion of foreign genes in insect systems
DK300090D0 (da) 1990-12-19 1990-12-19 Novo Nordisk As Fremgangsmaade til fremstilling af leadersekvenser
DE69740176D1 (de) * 1996-03-01 2011-05-26 Novo Nordisk As Appetithemmendes Peptid, Zusammensetzung und Verwendung

Patent Citations (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1993018786A1 (en) * 1992-03-19 1993-09-30 Novo Nordisk A/S Use of a peptide
WO1996032414A1 (en) * 1995-04-14 1996-10-17 1149336 Ontario Inc. Glucagon-like peptide-2 and its therapeutic use

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
DIABETIC MEDICINE, Volume 12, 1995, J. RACHMAN et al., "Drugs on the Horizon for Treatment of Type 2 Diabetes", pages 467-478. *
NATURE, Volume 379, January 1996, M.D. TURTON et al., "A Role for Glucagon-Like Peptide-1 in the Central Regulation of Feeding", page 69. *

Cited By (104)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7410779B2 (en) 1992-01-31 2008-08-12 Novozymes Biopharma Uk Limited Fusion polypeptides of human serum albumin and a therapeutically active polypeptide
US7056701B2 (en) 1992-01-31 2006-06-06 Aventis Behring L.L.C. Hormone and albumin fusion protein
US8846625B2 (en) 1995-04-14 2014-09-30 1149336 Ontario Inc. Glucagon-like peptide-2 analogs
EP2277909A1 (en) * 1995-04-14 2011-01-26 1149336 Ontario Inc. Glucagon-like peptide-2 derivatives and their therapeutic use
EP2277530A1 (en) * 1995-04-14 2011-01-26 1149336 Ontario Inc. Glucagon-like peptide-2 and its therapeutic use
US7888317B2 (en) 1995-04-14 2011-02-15 Nps Pharmaceuticals, Inc. Glucagon-like peptide-2 and its therapeutic use
EP0830377A1 (en) 1995-04-14 1998-03-25 1149336 Ontario Inc. Glucagon-like peptide-2 and its therapeutic use
US8933039B2 (en) 1995-04-14 2015-01-13 Nps Pharmaceuticals, Inc. Glucagon-like peptide-2 analogs
US7781401B2 (en) 1995-04-14 2010-08-24 Nps Pharmaceuticals, Inc. Glucagon-like peptide-2 analogs
US6852690B1 (en) 1995-08-22 2005-02-08 Amylin Pharmaceuticals, Inc. Method and composition for enhanced parenteral nutrition
US7569540B2 (en) 1995-08-22 2009-08-04 Amylin Pharmaceuticals, Inc. Method for enhanced parenteral nutrition
EP1231219A1 (en) 1996-04-12 2002-08-14 1149336 Ontario Inc. GLucagon-like peptide-2 analogs
US6458924B2 (en) 1996-08-30 2002-10-01 Novo Nordisk A/S Derivatives of GLP-1 analogs
US8097698B2 (en) 1996-08-30 2012-01-17 Novo Nordisk A/S Derivatives of GLP-1 analogs
US7235627B2 (en) 1996-08-30 2007-06-26 Novo Nordisk A/S Derivatives of GLP-1 analogs
US7211557B2 (en) 1996-11-05 2007-05-01 Eli Lilly And Company Use of GLP-1 analogs and derivatives administered peripherally in regulation of obesity
US6191102B1 (en) 1996-11-05 2001-02-20 Eli Lilly And Company Use of GLP-1 analogs and derivatives administered peripherally in regulation of obesity
US6583111B1 (en) 1996-11-05 2003-06-24 Eli Lilly And Company Use of GLP-1 analogs and derivative adminstered peripherally in regulation of obesity
EP1529534A3 (en) * 1996-11-12 2005-06-08 Novo Nordisk A/S Use of GLP-1 peptides
WO1998020895A1 (en) * 1996-11-12 1998-05-22 Novo Nordisk A/S Use of glp-1 peptides
US6051557A (en) * 1997-05-16 2000-04-18 1149336 Ontario Inc. Methods of enhancing functioning of the upper gastrointestinal tract
WO1999014239A1 (de) * 1997-09-12 1999-03-25 Wolf Georg Forssmann Zusammensetzung zur therapie von diabetes mellitus und fettsucht
US6358924B1 (en) 1997-12-05 2002-03-19 Eli Lilly And Company GLP-1 formulations
WO1999029336A1 (en) * 1997-12-05 1999-06-17 Eli Lilly And Company Glp-1 formulations
WO1999043361A1 (en) * 1998-02-27 1999-09-02 Novo Nordisk A/S Glp-2 derivatives with helix-content exceeding 25 %, forming partially structured micellar-like aggregates
WO1999043705A1 (en) * 1998-02-27 1999-09-02 Novo Nordisk A/S N-terminally truncated glp-1 derivatives
WO1999043707A1 (en) * 1998-02-27 1999-09-02 Novo Nordisk A/S N-terminally modified glp-1 derivatives
WO1999047161A1 (en) * 1998-03-19 1999-09-23 Bionebraska, Inc. Human appetite control by glucagon-like peptide receptor binding compounds
US6998387B1 (en) 1998-03-19 2006-02-14 Amylin Pharmaceuticals, Inc. Human appetite control by glucagon-like peptide receptor binding compounds
US7507414B2 (en) 2000-04-12 2009-03-24 Human Genome Sciences, Inc. Albumin fusion proteins
US7186683B2 (en) 2000-09-18 2007-03-06 Sanos Bioscience A/S Use of GLP for the treatment, prevention, diagnosis, and prognosis of bone-related and nutrition-related disorders
EP1970072A1 (en) * 2000-09-18 2008-09-17 Sanos Bioscience A/S Use of GLP-2 peptides for the treatment of hyperparathyroidism
US7371721B2 (en) 2000-09-18 2008-05-13 Sanos Bioscience A/S Use of GLP-2 and related compounds for the treatment, prevention, diagnosis, and prognosis of bone-related disorders and calcium homeostasis related syndromes
US6943151B2 (en) 2000-09-18 2005-09-13 Sanos Bioscience A/S Method of inhibiting bone resorption and/or promoting bone formation using GLP-2 and related compounds
US6770620B2 (en) 2000-09-18 2004-08-03 Sanos Bioscience A/S Use of GLP for the treatment, prevention, diagnosis, and prognosis of bone-related and nutrition-related disorders
WO2002024214A3 (en) * 2000-09-18 2004-02-19 Osteometer Biotech As Use of glp -2 in combination with another therapeutic agent in bone-related and nutrition-related disorders
WO2002022151A3 (en) * 2000-09-18 2003-03-13 Osteometer Bio Tech As Use of glp-1 and flp-2 peptides for treatment of bone disorders
EP2062593A2 (en) 2000-12-01 2009-05-27 Takeda Pharmaceutical Company Limited Method for producing preparation containing bioactive peptide
EP2343082A1 (en) * 2001-09-07 2011-07-13 Imperial Innovations Limited Oxyntomodulin for preventing or treating excess weight
US7238667B2 (en) 2001-12-21 2007-07-03 Human Genome Sciences, Inc. Albumin fusion proteins
US9221896B2 (en) 2001-12-21 2015-12-29 Human Genome Sciences, Inc. Albumin fusion proteins
US7141547B2 (en) 2001-12-21 2006-11-28 Human Genome Sciences, Inc. Albumin fusion proteins comprising GLP-1 polypeptides
US7799759B2 (en) 2001-12-21 2010-09-21 Human Genome Sciences, Inc. Albumin fusion proteins
US7847079B2 (en) 2001-12-21 2010-12-07 Human Genome Sciences, Inc. Albumin fusion proteins
US7592010B2 (en) 2001-12-21 2009-09-22 Human Genome Sciences, Inc. Albumin fusion proteins
US8993517B2 (en) 2001-12-21 2015-03-31 Human Genome Sciences, Inc. Albumin fusion proteins
US8252739B2 (en) 2001-12-21 2012-08-28 Human Genome Sciences, Inc. Albumin fusion proteins
US7977306B2 (en) 2001-12-21 2011-07-12 Human Genome Sciences, Inc. Albumin fusion proteins
US8513189B2 (en) 2001-12-21 2013-08-20 Human Genome Sciences, Inc. Albumin fusion proteins
US9296809B2 (en) 2001-12-21 2016-03-29 Human Genome Sciences, Inc. Albumin fusion proteins
US8071539B2 (en) 2001-12-21 2011-12-06 Human Genome Sciences, Inc. Albumin fusion proteins
US7411039B2 (en) 2002-10-14 2008-08-12 Novo Nordisk A/S GLP-2 compounds, formulations, and uses thereof
US7521424B2 (en) 2003-01-22 2009-04-21 Human Genome Sciences, Inc. Albumin fusion proteins
US7785297B2 (en) 2003-02-04 2010-08-31 Novo Nordisk A/S Injection device with rotatable dose setting
US8419692B2 (en) 2003-02-04 2013-04-16 Novo Nordisk A/S Injection device with rotatable dose setting
WO2004069314A1 (en) 2003-02-04 2004-08-19 Novo Nordisk A/S Injection device with rotatable dose setting
US9486504B2 (en) 2003-12-09 2016-11-08 Novo Nordisk A/S Regulation of food preference using GLP-1 agonists
EP2368579A1 (en) 2004-01-21 2011-09-28 Novo Nordisk Health Care AG Transglutaminase mediated conjugation of peptides
EP2033662A1 (en) 2004-01-21 2009-03-11 Novo Nordisk Health Care AG Transglutaminase mediated conjugation of peptides
US8143026B2 (en) 2004-02-09 2012-03-27 Human Genome Sciences, Inc. Albumin fusion proteins
US7569384B2 (en) 2004-02-09 2009-08-04 Human Genome Sciences, Inc. Albumin fusion proteins
EP1734971A4 (en) * 2004-04-15 2009-12-23 Alkermes Inc POLYMER-BASED DEVICE WITH DELAYED RELEASE
US8431685B2 (en) 2004-04-15 2013-04-30 Alkermes Pharma Ireland Limited Polymer-based sustained release device
US8461105B2 (en) 2004-04-15 2013-06-11 Alkermes Pharma Ireland Limited Polymer-based sustained release device
US8877252B2 (en) 2004-04-15 2014-11-04 Alkermes Pharma Ireland Limited Polymer-based sustained release device
US8293871B2 (en) 2004-04-15 2012-10-23 Alkernnes Pharma Ireland Limited Poly(lactide-co-glycolide) based sustained release microcapsules comprising a polypeptide and a sugar
EP2409707A1 (en) * 2004-04-15 2012-01-25 Alkermes Pharma Ireland Limited Polymer-based sustained release device
US9238076B2 (en) 2004-04-15 2016-01-19 Alkermes Pharma Ireland Limited Polymer-based sustained release device
US8410047B2 (en) 2004-06-11 2013-04-02 Novo Nordisk A/S Counteracting drug-induced obesity using GLP-1 agonists
US10363287B2 (en) 2005-02-03 2019-07-30 Intarcia Therapeutics, Inc. Method of manufacturing an osmotic delivery device
US11246913B2 (en) 2005-02-03 2022-02-15 Intarcia Therapeutics, Inc. Suspension formulation comprising an insulinotropic peptide
EP1877435B2 (en) 2005-05-04 2021-03-17 Zealand Pharma A/S Glucagon-like-peptide-2 (glp-2) analogues
US9580487B2 (en) 2005-05-04 2017-02-28 Zealand Pharma A/S Method of treating stomach or bowel-related disorders by administering glucagon-like-peptide-2 (GLP-2) analogues
US8853159B2 (en) 2005-09-22 2014-10-07 Biocompatibles Uk Ltd GLP-1 Fusion Peptides
US8431533B2 (en) 2005-09-22 2013-04-30 Biocompatibles Uk Ltd. GLP-1 fusion peptides, their production and use
US8790705B2 (en) 2006-05-10 2014-07-29 Biocompatibles Uk Ltd. Spherical microcapsules comprising GLP-1 peptides, their production and use
US10527170B2 (en) 2006-08-09 2020-01-07 Intarcia Therapeutics, Inc. Osmotic delivery systems and piston assemblies for use therein
US10092648B2 (en) 2006-11-08 2018-10-09 Zealand Pharma A/S Selective glucagon-like-peptide-2 (GLP-2) analogues
US10441528B2 (en) 2008-02-13 2019-10-15 Intarcia Therapeutics, Inc. Devices, formulations, and methods for delivery of multiple beneficial agents
US10869830B2 (en) 2009-09-28 2020-12-22 Intarcia Therapeutics, Inc. Rapid establishment and/or termination of substantial steady-state drug delivery
US10231923B2 (en) 2009-09-28 2019-03-19 Intarcia Therapeutics, Inc. Rapid establishment and/or termination of substantial steady-state drug delivery
US12042557B2 (en) 2009-09-28 2024-07-23 I2O Therapeutics, Inc. Rapid establishment and/or termination of substantial steady-state drug delivery
US10159714B2 (en) 2011-02-16 2018-12-25 Intarcia Therapeutics, Inc. Compositions, devices and methods of use thereof for the treatment of cancers
US10253080B2 (en) 2012-05-03 2019-04-09 Zealand Pharma A/S Glucagon-like-peptide-2 (GLP-2) analogues
US9453064B2 (en) 2012-05-03 2016-09-27 Zealand Pharma A/S Glucagon-like-peptide-2 (GLP-2) analogues
US9969787B2 (en) 2012-05-03 2018-05-15 Zealand Pharma A/S Glucagon-like-peptide-2 (GLP-2) analogues
WO2014010586A1 (ja) 2012-07-10 2014-01-16 武田薬品工業株式会社 注射用製剤
US10583080B2 (en) 2014-09-30 2020-03-10 Intarcia Therapeutics, Inc. Therapeutic methods for the treatment of diabetes and related conditions for patients with high baseline HbA1c
US9889085B1 (en) 2014-09-30 2018-02-13 Intarcia Therapeutics, Inc. Therapeutic methods for the treatment of diabetes and related conditions for patients with high baseline HbA1c
US10925639B2 (en) 2015-06-03 2021-02-23 Intarcia Therapeutics, Inc. Implant placement and removal systems
US10501517B2 (en) 2016-05-16 2019-12-10 Intarcia Therapeutics, Inc. Glucagon-receptor selective polypeptides and methods of use thereof
US11840559B2 (en) 2016-05-16 2023-12-12 I2O Therapeutics, Inc. Glucagon-receptor selective polypeptides and methods of use thereof
US11214607B2 (en) 2016-05-16 2022-01-04 Intarcia Therapeutics Inc. Glucagon-receptor selective polypeptides and methods of use thereof
USD962433S1 (en) 2016-06-02 2022-08-30 Intarcia Therapeutics, Inc. Implant placement guide
USD912249S1 (en) 2016-06-02 2021-03-02 Intarcia Therapeutics, Inc. Implant removal tool
USD860451S1 (en) 2016-06-02 2019-09-17 Intarcia Therapeutics, Inc. Implant removal tool
USD835783S1 (en) 2016-06-02 2018-12-11 Intarcia Therapeutics, Inc. Implant placement guide
USD840030S1 (en) 2016-06-02 2019-02-05 Intarcia Therapeutics, Inc. Implant placement guide
US10905745B2 (en) 2016-12-09 2021-02-02 Zealand Pharma A/S Acylated GLP-1/GLP-2 dual agonists
US11395847B2 (en) 2016-12-09 2022-07-26 Zealand Pharma A/S Acylated GLP-1/GLP-2 dual agonists
US10835580B2 (en) 2017-01-03 2020-11-17 Intarcia Therapeutics, Inc. Methods comprising continuous administration of a GLP-1 receptor agonist and co-administration of a drug
US11654183B2 (en) 2017-01-03 2023-05-23 Intarcia Therapeutics, Inc. Methods comprising continuous administration of exenatide and co-administration of a drug
US12297251B1 (en) 2017-06-16 2025-05-13 Zealand Pharma A/S Injection pen for subcutaneous administration of a peptide
WO2020223761A1 (en) * 2019-05-06 2020-11-12 The University Of Sydney Methods for the fractionation of proteins

Also Published As

Publication number Publication date
CN1112367C (zh) 2003-06-25
DK1975177T3 (da) 2011-07-25
PL187095B1 (pl) 2004-05-31
EP1231218B1 (en) 2008-05-14
ATE395359T1 (de) 2008-05-15
AU710818B2 (en) 1999-09-30
DE69740176D1 (de) 2011-05-26
UA70283C2 (en) 2004-10-15
CA2246733C (en) 2010-07-20
NO323043B1 (no) 2006-12-27
EP2295453A3 (en) 2011-03-30
ES2306685T3 (es) 2008-11-16
FR13C0009I2 (fr) 2013-08-16
CZ273698A3 (cs) 1998-12-16
CN1215405A (zh) 1999-04-28
KR100611130B1 (ko) 2006-11-30
EP0891378B1 (en) 2002-11-13
NO984005D0 (no) 1998-08-31
ES2187756T3 (es) 2003-06-16
JP4064460B2 (ja) 2008-03-19
BR9707807A (pt) 1999-07-27
EP1975177B1 (en) 2011-04-13
DE69717092D1 (de) 2002-12-19
ATE505485T1 (de) 2011-04-15
IL125805A0 (en) 1999-04-11
EP1975177A1 (en) 2008-10-01
EP1231218A2 (en) 2002-08-14
CY2013008I1 (el) 2015-08-05
CZ297338B6 (cs) 2006-11-15
HUP9902670A3 (en) 2000-02-28
RU2197261C2 (ru) 2003-01-27
HU229234B1 (en) 2013-09-30
CY2013008I2 (el) 2015-08-05
FR13C0009I1 (https=) 2013-03-22
NO2013006I2 (https=) 2013-03-12
JP2000505460A (ja) 2000-05-09
DE69717092T2 (de) 2003-07-24
PT1975177E (pt) 2011-07-26
PL328732A1 (en) 1999-02-15
EP1231218A3 (en) 2002-10-30
NO2013006I1 (no) 2013-04-02
DE69738695D1 (de) 2008-06-26
ES2364705T3 (es) 2011-09-12
ATE227737T1 (de) 2002-11-15
CA2246733A1 (en) 1997-09-04
NO984005L (no) 1998-08-31
KR19990087439A (ko) 1999-12-27
EP0891378A1 (en) 1999-01-20
EP2295453A2 (en) 2011-03-16
CY2619B2 (https=) 2013-03-13
DK0891378T3 (da) 2003-01-06
AU1871597A (en) 1997-09-16

Similar Documents

Publication Publication Date Title
EP1975177B1 (en) An appetite-suppressing peptide, its compositions and use
US5912229A (en) Use of a pharmaceutical composition comprising an appetite-suppressing peptide
US12071456B2 (en) Extended recombinant polypeptides and compositions comprising same
US8703717B2 (en) Growth hormone polypeptides and methods of making and using same
EP2440241B1 (en) Growth hormone polypeptides and methods of making and using same
US20170158748A1 (en) Glucose-regulating polypeptides and methods of making and using same
US20110172146A1 (en) Growth hormone polypeptides and methods of making and using same
US9849188B2 (en) Growth hormone polypeptides and methods of making and using same
CZ289864B6 (cs) Trojlístkový peptid, způsob přípravy, farmaceutický prostředek a pouľití trojlístkového peptidu
HK1238255B (en) Extended recombinant polypeptides and compositions comprising same
HK1238255A1 (en) Extended recombinant polypeptides and compositions comprising same

Legal Events

Date Code Title Description
WWE Wipo information: entry into national phase

Ref document number: 97193525.4

Country of ref document: CN

AK Designated states

Kind code of ref document: A1

Designated state(s): AL AM AT AU AZ BA BB BG BR BY CA CH CN CU CZ DE DK EE ES FI GB GE HU IL IS JP KE KG KP KR KZ LC LK LR LS LT LU LV MD MG MK MN MW MX NO NZ PL PT RO RU SD SE SG SI SK TJ TM TR TT UA UG UZ VN AM AZ BY KG KZ MD RU TJ TM

AL Designated countries for regional patents

Kind code of ref document: A1

Designated state(s): GH KE LS MW SD SZ UG AT BE CH DE DK ES FI FR GB GR IE IT LU MC NL PT SE BF BJ CF CG

121 Ep: the epo has been informed by wipo that ep was designated in this application
DFPE Request for preliminary examination filed prior to expiration of 19th month from priority date (pct application filed before 20040101)
WWE Wipo information: entry into national phase

Ref document number: 1997905000

Country of ref document: EP

ENP Entry into the national phase

Ref document number: 2246733

Country of ref document: CA

Ref document number: 2246733

Country of ref document: CA

Kind code of ref document: A

WWE Wipo information: entry into national phase

Ref document number: PV1998-2736

Country of ref document: CZ

WWE Wipo information: entry into national phase

Ref document number: PA/A/1998/007086

Country of ref document: MX

WWE Wipo information: entry into national phase

Ref document number: 1019980706861

Country of ref document: KR

WWP Wipo information: published in national office

Ref document number: PV1998-2736

Country of ref document: CZ

REG Reference to national code

Ref country code: DE

Ref legal event code: 8642

WWP Wipo information: published in national office

Ref document number: 1997905000

Country of ref document: EP

WWP Wipo information: published in national office

Ref document number: 1019980706861

Country of ref document: KR

WWG Wipo information: grant in national office

Ref document number: 1997905000

Country of ref document: EP

WWG Wipo information: grant in national office

Ref document number: 1019980706861

Country of ref document: KR

WWG Wipo information: grant in national office

Ref document number: PV1998-2736

Country of ref document: CZ