US9624276B2 - Peptidic chimeric antigen receptor T cell switches and uses thereof - Google Patents
Peptidic chimeric antigen receptor T cell switches and uses thereof Download PDFInfo
- Publication number
- US9624276B2 US9624276B2 US14/688,894 US201514688894A US9624276B2 US 9624276 B2 US9624276 B2 US 9624276B2 US 201514688894 A US201514688894 A US 201514688894A US 9624276 B2 US9624276 B2 US 9624276B2
- Authority
- US
- United States
- Prior art keywords
- antibody
- car
- seq
- cell
- targeting
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 title claims abstract description 153
- 210000001744 T-lymphocyte Anatomy 0.000 title abstract description 78
- 210000004027 cell Anatomy 0.000 claims abstract description 418
- 239000000427 antigen Substances 0.000 claims abstract description 304
- 108091007433 antigens Proteins 0.000 claims abstract description 304
- 102000036639 antigens Human genes 0.000 claims abstract description 304
- 239000012636 effector Substances 0.000 claims abstract description 148
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 314
- 230000008685 targeting Effects 0.000 claims description 293
- 206010028980 Neoplasm Diseases 0.000 claims description 123
- 239000012634 fragment Substances 0.000 claims description 85
- 201000011510 cancer Diseases 0.000 claims description 81
- 101100107610 Arabidopsis thaliana ABCF4 gene Proteins 0.000 claims description 76
- 101100068078 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GCN4 gene Proteins 0.000 claims description 76
- 230000027455 binding Effects 0.000 claims description 63
- 108090000623 proteins and genes Proteins 0.000 claims description 51
- 150000001413 amino acids Chemical class 0.000 claims description 45
- 240000004808 Saccharomyces cerevisiae Species 0.000 claims description 40
- 102000004169 proteins and genes Human genes 0.000 claims description 32
- 102000005962 receptors Human genes 0.000 claims description 32
- 108020003175 receptors Proteins 0.000 claims description 32
- 102000040945 Transcription factor Human genes 0.000 claims description 30
- 108091023040 Transcription factor Proteins 0.000 claims description 30
- 150000007523 nucleic acids Chemical group 0.000 claims description 18
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 16
- 108060003951 Immunoglobulin Proteins 0.000 claims description 14
- 102000018358 immunoglobulin Human genes 0.000 claims description 14
- 230000002494 anti-cea effect Effects 0.000 claims description 9
- 230000001472 cytotoxic effect Effects 0.000 claims description 9
- 230000028993 immune response Effects 0.000 claims description 9
- 231100000433 cytotoxic Toxicity 0.000 claims description 6
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 5
- 102000003886 Glycoproteins Human genes 0.000 claims description 3
- 108090000288 Glycoproteins Proteins 0.000 claims description 3
- 102000018697 Membrane Proteins Human genes 0.000 claims description 3
- 108010052285 Membrane Proteins Proteins 0.000 claims description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 3
- 230000004069 differentiation Effects 0.000 claims description 3
- 238000011282 treatment Methods 0.000 abstract description 14
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 145
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 145
- 102000004196 processed proteins & peptides Human genes 0.000 description 137
- 229920001184 polypeptide Polymers 0.000 description 129
- 238000000034 method Methods 0.000 description 92
- 125000005647 linker group Chemical group 0.000 description 82
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 71
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 71
- -1 poly(NANP) Polymers 0.000 description 67
- 239000013604 expression vector Substances 0.000 description 56
- 102000040430 polynucleotide Human genes 0.000 description 56
- 108091033319 polynucleotide Proteins 0.000 description 56
- 239000002157 polynucleotide Substances 0.000 description 56
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 45
- 239000000203 mixture Substances 0.000 description 44
- 239000013598 vector Substances 0.000 description 44
- 235000001014 amino acid Nutrition 0.000 description 42
- 229940024606 amino acid Drugs 0.000 description 42
- 201000010099 disease Diseases 0.000 description 36
- 235000018102 proteins Nutrition 0.000 description 31
- 230000014509 gene expression Effects 0.000 description 30
- 230000000694 effects Effects 0.000 description 26
- 230000003834 intracellular effect Effects 0.000 description 26
- 206010006187 Breast cancer Diseases 0.000 description 24
- 208000026310 Breast neoplasm Diseases 0.000 description 24
- 239000013612 plasmid Substances 0.000 description 24
- 241000700605 Viruses Species 0.000 description 22
- 238000010367 cloning Methods 0.000 description 21
- 230000000670 limiting effect Effects 0.000 description 21
- 210000003719 b-lymphocyte Anatomy 0.000 description 20
- 230000001225 therapeutic effect Effects 0.000 description 19
- 239000003814 drug Substances 0.000 description 17
- 239000000499 gel Substances 0.000 description 17
- 229920000642 polymer Polymers 0.000 description 17
- 238000000746 purification Methods 0.000 description 17
- 101150029707 ERBB2 gene Proteins 0.000 description 16
- 239000012124 Opti-MEM Substances 0.000 description 16
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 16
- 230000011664 signaling Effects 0.000 description 16
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 15
- 230000003013 cytotoxicity Effects 0.000 description 15
- 231100000135 cytotoxicity Toxicity 0.000 description 15
- 208000032839 leukemia Diseases 0.000 description 15
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 14
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 13
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 12
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 12
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 12
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 12
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 12
- 238000004587 chromatography analysis Methods 0.000 description 12
- 230000035772 mutation Effects 0.000 description 12
- 102000039446 nucleic acids Human genes 0.000 description 12
- 108020004707 nucleic acids Proteins 0.000 description 12
- 150000003384 small molecules Chemical class 0.000 description 12
- 206010025323 Lymphomas Diseases 0.000 description 11
- 108091034117 Oligonucleotide Proteins 0.000 description 11
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 11
- 238000009472 formulation Methods 0.000 description 11
- 239000000047 product Substances 0.000 description 11
- FJHBVJOVLFPMQE-QFIPXVFZSA-N 7-Ethyl-10-Hydroxy-Camptothecin Chemical compound C1=C(O)C=C2C(CC)=C(CN3C(C4=C([C@@](C(=O)OC4)(O)CC)C=C33)=O)C3=NC2=C1 FJHBVJOVLFPMQE-QFIPXVFZSA-N 0.000 description 10
- 241000894006 Bacteria Species 0.000 description 10
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 10
- 241000699670 Mus sp. Species 0.000 description 10
- 239000008194 pharmaceutical composition Substances 0.000 description 10
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 10
- 210000001519 tissue Anatomy 0.000 description 10
- 239000003053 toxin Substances 0.000 description 10
- 231100000765 toxin Toxicity 0.000 description 10
- 108700012359 toxins Proteins 0.000 description 10
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 9
- DBMJMQXJHONAFJ-UHFFFAOYSA-M Sodium laurylsulphate Chemical compound [Na+].CCCCCCCCCCCCOS([O-])(=O)=O DBMJMQXJHONAFJ-UHFFFAOYSA-M 0.000 description 9
- 208000035475 disorder Diseases 0.000 description 9
- 229940079593 drug Drugs 0.000 description 9
- 108020001507 fusion proteins Proteins 0.000 description 9
- 102000037865 fusion proteins Human genes 0.000 description 9
- 239000003446 ligand Substances 0.000 description 9
- 239000002609 medium Substances 0.000 description 9
- 239000002773 nucleotide Substances 0.000 description 9
- 230000001717 pathogenic effect Effects 0.000 description 9
- 238000001712 DNA sequencing Methods 0.000 description 8
- 241000699666 Mus <mouse, genus> Species 0.000 description 8
- 206010039491 Sarcoma Diseases 0.000 description 8
- 101710120037 Toxin CcdB Proteins 0.000 description 8
- 239000006285 cell suspension Substances 0.000 description 8
- 239000003795 chemical substances by application Substances 0.000 description 8
- 239000001963 growth medium Substances 0.000 description 8
- 238000001727 in vivo Methods 0.000 description 8
- 239000002479 lipoplex Substances 0.000 description 8
- 208000020816 lung neoplasm Diseases 0.000 description 8
- 210000004698 lymphocyte Anatomy 0.000 description 8
- 239000000546 pharmaceutical excipient Substances 0.000 description 8
- 230000002062 proliferating effect Effects 0.000 description 8
- 229960004641 rituximab Drugs 0.000 description 8
- 238000002560 therapeutic procedure Methods 0.000 description 8
- 238000001890 transfection Methods 0.000 description 8
- 238000003146 transient transfection Methods 0.000 description 8
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 7
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 7
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 7
- 108091005682 Receptor kinases Proteins 0.000 description 7
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 7
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 7
- 239000007795 chemical reaction product Substances 0.000 description 7
- 150000002632 lipids Chemical group 0.000 description 7
- 201000005202 lung cancer Diseases 0.000 description 7
- 238000004519 manufacturing process Methods 0.000 description 7
- 239000000463 material Substances 0.000 description 7
- 244000052769 pathogen Species 0.000 description 7
- 210000000130 stem cell Anatomy 0.000 description 7
- 239000003981 vehicle Substances 0.000 description 7
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 description 6
- 206010003571 Astrocytoma Diseases 0.000 description 6
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 description 6
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 description 6
- 206010009944 Colon cancer Diseases 0.000 description 6
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 6
- 206010018338 Glioma Diseases 0.000 description 6
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 6
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 6
- 241001465754 Metazoa Species 0.000 description 6
- 206010035226 Plasma cell myeloma Diseases 0.000 description 6
- 208000000453 Skin Neoplasms Diseases 0.000 description 6
- 102100034922 T-cell surface glycoprotein CD8 alpha chain Human genes 0.000 description 6
- 230000001086 cytosolic effect Effects 0.000 description 6
- 238000000338 in vitro Methods 0.000 description 6
- 210000004072 lung Anatomy 0.000 description 6
- 239000002245 particle Substances 0.000 description 6
- 229920001223 polyethylene glycol Polymers 0.000 description 6
- 201000000849 skin cancer Diseases 0.000 description 6
- 150000003431 steroids Chemical class 0.000 description 6
- 229940124597 therapeutic agent Drugs 0.000 description 6
- 210000004881 tumor cell Anatomy 0.000 description 6
- 206010002961 Aplasia Diseases 0.000 description 5
- 208000023275 Autoimmune disease Diseases 0.000 description 5
- 208000003174 Brain Neoplasms Diseases 0.000 description 5
- 208000007465 Giant cell arteritis Diseases 0.000 description 5
- 208000017604 Hodgkin disease Diseases 0.000 description 5
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 5
- 241000124008 Mammalia Species 0.000 description 5
- 241001529936 Murinae Species 0.000 description 5
- 206010033128 Ovarian cancer Diseases 0.000 description 5
- 206010061535 Ovarian neoplasm Diseases 0.000 description 5
- 108010067390 Viral Proteins Proteins 0.000 description 5
- 125000005262 alkoxyamine group Chemical group 0.000 description 5
- 230000001580 bacterial effect Effects 0.000 description 5
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 5
- 239000011230 binding agent Substances 0.000 description 5
- 239000002458 cell surface marker Substances 0.000 description 5
- 229920002678 cellulose Polymers 0.000 description 5
- 238000006352 cycloaddition reaction Methods 0.000 description 5
- 210000003372 endocrine gland Anatomy 0.000 description 5
- 108010087914 epidermal growth factor receptor VIII Proteins 0.000 description 5
- 102000015694 estrogen receptors Human genes 0.000 description 5
- 108010038795 estrogen receptors Proteins 0.000 description 5
- 208000005017 glioblastoma Diseases 0.000 description 5
- 238000009169 immunotherapy Methods 0.000 description 5
- 208000015181 infectious disease Diseases 0.000 description 5
- 239000002502 liposome Substances 0.000 description 5
- 230000036210 malignancy Effects 0.000 description 5
- 230000001404 mediated effect Effects 0.000 description 5
- 210000003071 memory t lymphocyte Anatomy 0.000 description 5
- 125000003729 nucleotide group Chemical group 0.000 description 5
- 230000009437 off-target effect Effects 0.000 description 5
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 5
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 5
- 239000003755 preservative agent Substances 0.000 description 5
- 102000003998 progesterone receptors Human genes 0.000 description 5
- 108090000468 progesterone receptors Proteins 0.000 description 5
- 239000011780 sodium chloride Substances 0.000 description 5
- 239000004094 surface-active agent Substances 0.000 description 5
- 238000013268 sustained release Methods 0.000 description 5
- 239000012730 sustained-release form Substances 0.000 description 5
- 206010043207 temporal arteritis Diseases 0.000 description 5
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 4
- 208000003950 B-cell lymphoma Diseases 0.000 description 4
- 241000283690 Bos taurus Species 0.000 description 4
- 241000283707 Capra Species 0.000 description 4
- 201000009030 Carcinoma Diseases 0.000 description 4
- 102000004127 Cytokines Human genes 0.000 description 4
- 108090000695 Cytokines Proteins 0.000 description 4
- 241000233866 Fungi Species 0.000 description 4
- 108010070675 Glutathione transferase Proteins 0.000 description 4
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Polymers OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 4
- 102000009465 Growth Factor Receptors Human genes 0.000 description 4
- 108010009202 Growth Factor Receptors Proteins 0.000 description 4
- 102100029100 Hematopoietic prostaglandin D synthase Human genes 0.000 description 4
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 4
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 4
- 208000034578 Multiple myelomas Diseases 0.000 description 4
- 201000010133 Oligodendroglioma Diseases 0.000 description 4
- 241000283973 Oryctolagus cuniculus Species 0.000 description 4
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 4
- 108091005804 Peptidases Proteins 0.000 description 4
- 239000002202 Polyethylene glycol Substances 0.000 description 4
- 239000004365 Protease Substances 0.000 description 4
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 4
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 4
- 208000024770 Thyroid neoplasm Diseases 0.000 description 4
- 238000011374 additional therapy Methods 0.000 description 4
- 239000000654 additive Substances 0.000 description 4
- 206010003246 arthritis Diseases 0.000 description 4
- 210000000988 bone and bone Anatomy 0.000 description 4
- 210000004556 brain Anatomy 0.000 description 4
- 235000010980 cellulose Nutrition 0.000 description 4
- 239000001913 cellulose Substances 0.000 description 4
- 210000003169 central nervous system Anatomy 0.000 description 4
- 238000002512 chemotherapy Methods 0.000 description 4
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 4
- 208000029742 colonic neoplasm Diseases 0.000 description 4
- 238000013270 controlled release Methods 0.000 description 4
- 229920001577 copolymer Polymers 0.000 description 4
- 239000013078 crystal Substances 0.000 description 4
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 4
- 206010012601 diabetes mellitus Diseases 0.000 description 4
- 238000001962 electrophoresis Methods 0.000 description 4
- 238000011156 evaluation Methods 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- 229920002674 hyaluronan Polymers 0.000 description 4
- 239000000017 hydrogel Substances 0.000 description 4
- 210000000987 immune system Anatomy 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 230000007774 longterm Effects 0.000 description 4
- 210000002540 macrophage Anatomy 0.000 description 4
- 230000003211 malignant effect Effects 0.000 description 4
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 4
- 239000011159 matrix material Substances 0.000 description 4
- 201000001441 melanoma Diseases 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 210000004379 membrane Anatomy 0.000 description 4
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 4
- 210000000822 natural killer cell Anatomy 0.000 description 4
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 4
- 238000005457 optimization Methods 0.000 description 4
- 201000002528 pancreatic cancer Diseases 0.000 description 4
- 208000008443 pancreatic carcinoma Diseases 0.000 description 4
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 4
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 239000003826 tablet Substances 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- HVCOBJNICQPDBP-UHFFFAOYSA-N 3-[3-[3,5-dihydroxy-6-methyl-4-(3,4,5-trihydroxy-6-methyloxan-2-yl)oxyoxan-2-yl]oxydecanoyloxy]decanoic acid;hydrate Chemical compound O.OC1C(OC(CC(=O)OC(CCCCCCC)CC(O)=O)CCCCCCC)OC(C)C(O)C1OC1C(O)C(O)C(O)C(C)O1 HVCOBJNICQPDBP-UHFFFAOYSA-N 0.000 description 3
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 3
- 201000003076 Angiosarcoma Diseases 0.000 description 3
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 3
- 208000023328 Basedow disease Diseases 0.000 description 3
- 208000011691 Burkitt lymphomas Diseases 0.000 description 3
- 241000700199 Cavia porcellus Species 0.000 description 3
- 206010057248 Cell death Diseases 0.000 description 3
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 3
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 3
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 3
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 3
- 206010014759 Endometrial neoplasm Diseases 0.000 description 3
- 241000283073 Equus caballus Species 0.000 description 3
- 108010087819 Fc receptors Proteins 0.000 description 3
- 102000009109 Fc receptors Human genes 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- 239000004471 Glycine Substances 0.000 description 3
- 229930186217 Glycolipid Natural products 0.000 description 3
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 3
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 3
- 108010074328 Interferon-gamma Proteins 0.000 description 3
- 102000008070 Interferon-gamma Human genes 0.000 description 3
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 description 3
- 208000008839 Kidney Neoplasms Diseases 0.000 description 3
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 3
- 201000003791 MALT lymphoma Diseases 0.000 description 3
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 3
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 3
- 229930195725 Mannitol Natural products 0.000 description 3
- 208000003250 Mixed connective tissue disease Diseases 0.000 description 3
- 229920000954 Polyglycolide Polymers 0.000 description 3
- 206010060862 Prostate cancer Diseases 0.000 description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 3
- 206010038389 Renal cancer Diseases 0.000 description 3
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 3
- 102100029198 SLAM family member 7 Human genes 0.000 description 3
- 241000700584 Simplexvirus Species 0.000 description 3
- 229930182558 Sterol Natural products 0.000 description 3
- 241000194017 Streptococcus Species 0.000 description 3
- 229930006000 Sucrose Natural products 0.000 description 3
- 229960004150 aciclovir Drugs 0.000 description 3
- MKUXAQIIEYXACX-UHFFFAOYSA-N aciclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCO)C=N2 MKUXAQIIEYXACX-UHFFFAOYSA-N 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 3
- 239000003963 antioxidant agent Substances 0.000 description 3
- 235000006708 antioxidants Nutrition 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 239000000227 bioadhesive Substances 0.000 description 3
- 210000000601 blood cell Anatomy 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 239000004067 bulking agent Substances 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 239000002775 capsule Substances 0.000 description 3
- 150000001720 carbohydrates Chemical class 0.000 description 3
- 235000014633 carbohydrates Nutrition 0.000 description 3
- 239000000969 carrier Substances 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 238000012512 characterization method Methods 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 229940044683 chemotherapy drug Drugs 0.000 description 3
- 230000001684 chronic effect Effects 0.000 description 3
- 230000000295 complement effect Effects 0.000 description 3
- 238000010276 construction Methods 0.000 description 3
- 125000000151 cysteine group Chemical class N[C@@H](CS)C(=O)* 0.000 description 3
- 230000009089 cytolysis Effects 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 239000008121 dextrose Substances 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 230000006862 enzymatic digestion Effects 0.000 description 3
- 239000003925 fat Substances 0.000 description 3
- 210000001035 gastrointestinal tract Anatomy 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 229920000159 gelatin Polymers 0.000 description 3
- 235000019322 gelatine Nutrition 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- 210000002443 helper t lymphocyte Anatomy 0.000 description 3
- 208000029824 high grade glioma Diseases 0.000 description 3
- 229940088597 hormone Drugs 0.000 description 3
- 239000005556 hormone Substances 0.000 description 3
- 229960003160 hyaluronic acid Drugs 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 208000027866 inflammatory disease Diseases 0.000 description 3
- 239000003112 inhibitor Substances 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 3
- 125000000468 ketone group Chemical group 0.000 description 3
- 201000010982 kidney cancer Diseases 0.000 description 3
- 239000008101 lactose Substances 0.000 description 3
- 235000018977 lysine Nutrition 0.000 description 3
- 201000011614 malignant glioma Diseases 0.000 description 3
- 239000000594 mannitol Substances 0.000 description 3
- 235000010355 mannitol Nutrition 0.000 description 3
- 239000004005 microsphere Substances 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 238000010172 mouse model Methods 0.000 description 3
- 208000025113 myeloid leukemia Diseases 0.000 description 3
- 210000000581 natural killer T-cell Anatomy 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- 150000002923 oximes Chemical class 0.000 description 3
- 210000005259 peripheral blood Anatomy 0.000 description 3
- 239000011886 peripheral blood Substances 0.000 description 3
- 210000003635 pituitary gland Anatomy 0.000 description 3
- 229920001983 poloxamer Polymers 0.000 description 3
- 229920000747 poly(lactic acid) Polymers 0.000 description 3
- 229920000136 polysorbate Polymers 0.000 description 3
- 229920002451 polyvinyl alcohol Polymers 0.000 description 3
- 230000002685 pulmonary effect Effects 0.000 description 3
- 230000000306 recurrent effect Effects 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- 229910052708 sodium Inorganic materials 0.000 description 3
- 239000000600 sorbitol Substances 0.000 description 3
- 235000003702 sterols Nutrition 0.000 description 3
- 150000003432 sterols Chemical class 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 238000006467 substitution reaction Methods 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 239000005720 sucrose Substances 0.000 description 3
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 3
- 208000011580 syndromic disease Diseases 0.000 description 3
- 201000002510 thyroid cancer Diseases 0.000 description 3
- 210000001685 thyroid gland Anatomy 0.000 description 3
- 238000010361 transduction Methods 0.000 description 3
- 230000026683 transduction Effects 0.000 description 3
- 229960000575 trastuzumab Drugs 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 description 2
- VEEGZPWAAPPXRB-BJMVGYQFSA-N (3e)-3-(1h-imidazol-5-ylmethylidene)-1h-indol-2-one Chemical compound O=C1NC2=CC=CC=C2\C1=C/C1=CN=CN1 VEEGZPWAAPPXRB-BJMVGYQFSA-N 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- WRMNZCZEMHIOCP-UHFFFAOYSA-N 2-phenylethanol Chemical compound OCCC1=CC=CC=C1 WRMNZCZEMHIOCP-UHFFFAOYSA-N 0.000 description 2
- 241000251468 Actinopterygii Species 0.000 description 2
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 2
- 208000008190 Agammaglobulinemia Diseases 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- 102000009027 Albumins Human genes 0.000 description 2
- 206010002556 Ankylosing Spondylitis Diseases 0.000 description 2
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 description 2
- BFYIZQONLCFLEV-DAELLWKTSA-N Aromasine Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC(=C)C2=C1 BFYIZQONLCFLEV-DAELLWKTSA-N 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 2
- 231100000699 Bacterial toxin Toxicity 0.000 description 2
- 206010005003 Bladder cancer Diseases 0.000 description 2
- VTYYLEPIZMXCLO-UHFFFAOYSA-L Calcium carbonate Chemical compound [Ca+2].[O-]C([O-])=O VTYYLEPIZMXCLO-UHFFFAOYSA-L 0.000 description 2
- 241000589876 Campylobacter Species 0.000 description 2
- 102000000844 Cell Surface Receptors Human genes 0.000 description 2
- 108010001857 Cell Surface Receptors Proteins 0.000 description 2
- 206010007953 Central nervous system lymphoma Diseases 0.000 description 2
- 241000282693 Cercopithecidae Species 0.000 description 2
- 102000019034 Chemokines Human genes 0.000 description 2
- 108010012236 Chemokines Proteins 0.000 description 2
- 241000606161 Chlamydia Species 0.000 description 2
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 2
- 208000015943 Coeliac disease Diseases 0.000 description 2
- 206010009900 Colitis ulcerative Diseases 0.000 description 2
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 2
- 208000011231 Crohn disease Diseases 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 241000702421 Dependoparvovirus Species 0.000 description 2
- 229920002307 Dextran Polymers 0.000 description 2
- 229920001353 Dextrin Polymers 0.000 description 2
- 239000004375 Dextrin Substances 0.000 description 2
- 238000005698 Diels-Alder reaction Methods 0.000 description 2
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- XQSPYNMVSIKCOC-NTSWFWBYSA-N Emtricitabine Chemical compound C1=C(F)C(N)=NC(=O)N1[C@H]1O[C@@H](CO)SC1 XQSPYNMVSIKCOC-NTSWFWBYSA-N 0.000 description 2
- 206010014733 Endometrial cancer Diseases 0.000 description 2
- 239000001856 Ethyl cellulose Substances 0.000 description 2
- ZZSNKZQZMQGXPY-UHFFFAOYSA-N Ethyl cellulose Chemical compound CCOCC1OC(OC)C(OCC)C(OCC)C1OC1C(O)C(O)C(OC)C(CO)O1 ZZSNKZQZMQGXPY-UHFFFAOYSA-N 0.000 description 2
- 208000006168 Ewing Sarcoma Diseases 0.000 description 2
- 241000282326 Felis catus Species 0.000 description 2
- 208000001640 Fibromyalgia Diseases 0.000 description 2
- 201000008808 Fibrosarcoma Diseases 0.000 description 2
- VWUXBMIQPBEWFH-WCCTWKNTSA-N Fulvestrant Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3[C@H](CCCCCCCCCS(=O)CCCC(F)(F)C(F)(F)F)CC2=C1 VWUXBMIQPBEWFH-WCCTWKNTSA-N 0.000 description 2
- 241000287828 Gallus gallus Species 0.000 description 2
- 208000032612 Glial tumor Diseases 0.000 description 2
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 2
- 239000000579 Gonadotropin-Releasing Hormone Substances 0.000 description 2
- BLCLNMBMMGCOAS-URPVMXJPSA-N Goserelin Chemical compound C([C@@H](C(=O)N[C@H](COC(C)(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(=O)NNC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 BLCLNMBMMGCOAS-URPVMXJPSA-N 0.000 description 2
- 108010069236 Goserelin Proteins 0.000 description 2
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 2
- 208000015023 Graves' disease Diseases 0.000 description 2
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 2
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 2
- 208000017891 HER2 positive breast carcinoma Diseases 0.000 description 2
- 206010066476 Haematological malignancy Diseases 0.000 description 2
- 208000001258 Hemangiosarcoma Diseases 0.000 description 2
- 208000002250 Hematologic Neoplasms Diseases 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 2
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 2
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 2
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 238000006736 Huisgen cycloaddition reaction Methods 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- 229920002153 Hydroxypropyl cellulose Polymers 0.000 description 2
- 206010020983 Hypogammaglobulinaemia Diseases 0.000 description 2
- XQFRJNBWHJMXHO-RRKCRQDMSA-N IDUR Chemical class C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(I)=C1 XQFRJNBWHJMXHO-RRKCRQDMSA-N 0.000 description 2
- 206010021245 Idiopathic thrombocytopenic purpura Diseases 0.000 description 2
- 208000026350 Inborn Genetic disease Diseases 0.000 description 2
- 102000013462 Interleukin-12 Human genes 0.000 description 2
- 108010065805 Interleukin-12 Proteins 0.000 description 2
- 208000003456 Juvenile Arthritis Diseases 0.000 description 2
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 2
- 108010011942 LH Receptors Proteins 0.000 description 2
- 102000023108 LH Receptors Human genes 0.000 description 2
- 241000270322 Lepidosauria Species 0.000 description 2
- 235000010643 Leucaena leucocephala Nutrition 0.000 description 2
- 240000007472 Leucaena leucocephala Species 0.000 description 2
- 108010000817 Leuprolide Proteins 0.000 description 2
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 2
- 208000016604 Lyme disease Diseases 0.000 description 2
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 208000025205 Mantle-Cell Lymphoma Diseases 0.000 description 2
- 206010027406 Mesothelioma Diseases 0.000 description 2
- FQISKWAFAHGMGT-SGJOWKDISA-M Methylprednisolone sodium succinate Chemical compound [Na+].C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)COC(=O)CCC([O-])=O)CC[C@H]21 FQISKWAFAHGMGT-SGJOWKDISA-M 0.000 description 2
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 2
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 2
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 2
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 2
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 2
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- 206010029461 Nodal marginal zone B-cell lymphomas Diseases 0.000 description 2
- 241000282577 Pan troglodytes Species 0.000 description 2
- 241001494479 Pecora Species 0.000 description 2
- 108091093037 Peptide nucleic acid Proteins 0.000 description 2
- 108010004729 Phycoerythrin Proteins 0.000 description 2
- 208000007913 Pituitary Neoplasms Diseases 0.000 description 2
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 2
- 208000007048 Polymyalgia Rheumatica Diseases 0.000 description 2
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 2
- 102000003946 Prolactin Human genes 0.000 description 2
- 108010057464 Prolactin Proteins 0.000 description 2
- 108091008611 Protein Kinase B Proteins 0.000 description 2
- 102000009516 Protein Serine-Threonine Kinases Human genes 0.000 description 2
- 108010009341 Protein Serine-Threonine Kinases Proteins 0.000 description 2
- 241000589516 Pseudomonas Species 0.000 description 2
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 2
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 2
- 102100033810 RAC-alpha serine/threonine-protein kinase Human genes 0.000 description 2
- 208000012322 Raynaud phenomenon Diseases 0.000 description 2
- 208000015634 Rectal Neoplasms Diseases 0.000 description 2
- 208000033464 Reiter syndrome Diseases 0.000 description 2
- 241000607142 Salmonella Species 0.000 description 2
- 206010039710 Scleroderma Diseases 0.000 description 2
- 108010071390 Serum Albumin Proteins 0.000 description 2
- 102000007562 Serum Albumin Human genes 0.000 description 2
- 241000607768 Shigella Species 0.000 description 2
- 208000021386 Sjogren Syndrome Diseases 0.000 description 2
- CDBYLPFSWZWCQE-UHFFFAOYSA-L Sodium Carbonate Chemical compound [Na+].[Na+].[O-]C([O-])=O CDBYLPFSWZWCQE-UHFFFAOYSA-L 0.000 description 2
- 229920002125 Sokalan® Polymers 0.000 description 2
- 101000857870 Squalus acanthias Gonadoliberin Proteins 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 108091008874 T cell receptors Proteins 0.000 description 2
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- NAVMQTYZDKMPEU-UHFFFAOYSA-N Targretin Chemical compound CC1=CC(C(CCC2(C)C)(C)C)=C2C=C1C(=C)C1=CC=C(C(O)=O)C=C1 NAVMQTYZDKMPEU-UHFFFAOYSA-N 0.000 description 2
- 208000000491 Tendinopathy Diseases 0.000 description 2
- 206010043255 Tendonitis Diseases 0.000 description 2
- 206010043376 Tetanus Diseases 0.000 description 2
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 description 2
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 2
- 108010009583 Transforming Growth Factors Proteins 0.000 description 2
- 102000009618 Transforming Growth Factors Human genes 0.000 description 2
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 description 2
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 2
- 206010045170 Tumour lysis syndrome Diseases 0.000 description 2
- 201000006704 Ulcerative Colitis Diseases 0.000 description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 2
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 2
- 108091008605 VEGF receptors Proteins 0.000 description 2
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 2
- 229920002494 Zein Polymers 0.000 description 2
- IEDXPSOJFSVCKU-HOKPPMCLSA-N [4-[[(2S)-5-(carbamoylamino)-2-[[(2S)-2-[6-(2,5-dioxopyrrolidin-1-yl)hexanoylamino]-3-methylbutanoyl]amino]pentanoyl]amino]phenyl]methyl N-[(2S)-1-[[(2S)-1-[[(3R,4S,5S)-1-[(2S)-2-[(1R,2R)-3-[[(1S,2R)-1-hydroxy-1-phenylpropan-2-yl]amino]-1-methoxy-2-methyl-3-oxopropyl]pyrrolidin-1-yl]-3-methoxy-5-methyl-1-oxoheptan-4-yl]-methylamino]-3-methyl-1-oxobutan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]-N-methylcarbamate Chemical compound CC[C@H](C)[C@@H]([C@@H](CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C)[C@@H](O)c1ccccc1)OC)N(C)C(=O)[C@@H](NC(=O)[C@H](C(C)C)N(C)C(=O)OCc1ccc(NC(=O)[C@H](CCCNC(N)=O)NC(=O)[C@@H](NC(=O)CCCCCN2C(=O)CCC2=O)C(C)C)cc1)C(C)C IEDXPSOJFSVCKU-HOKPPMCLSA-N 0.000 description 2
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 2
- 239000008186 active pharmaceutical agent Substances 0.000 description 2
- 208000009956 adenocarcinoma Diseases 0.000 description 2
- 235000010443 alginic acid Nutrition 0.000 description 2
- 229920000615 alginic acid Polymers 0.000 description 2
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 description 2
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 2
- 239000004037 angiogenesis inhibitor Substances 0.000 description 2
- 229940121369 angiogenesis inhibitor Drugs 0.000 description 2
- 239000004599 antimicrobial Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 230000001363 autoimmune Effects 0.000 description 2
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 description 2
- IVRMZWNICZWHMI-UHFFFAOYSA-N azide group Chemical group [N-]=[N+]=[N-] IVRMZWNICZWHMI-UHFFFAOYSA-N 0.000 description 2
- 210000002769 b effector cell Anatomy 0.000 description 2
- 239000000688 bacterial toxin Substances 0.000 description 2
- 210000003651 basophil Anatomy 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 229960000397 bevacizumab Drugs 0.000 description 2
- 230000001588 bifunctional effect Effects 0.000 description 2
- 229920002988 biodegradable polymer Polymers 0.000 description 2
- 239000004621 biodegradable polymer Substances 0.000 description 2
- 229920001222 biopolymer Polymers 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 210000001772 blood platelet Anatomy 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- RYYVLZVUVIJVGH-UHFFFAOYSA-N caffeine Chemical compound CN1C(=O)N(C)C(=O)C2=C1N=CN2C RYYVLZVUVIJVGH-UHFFFAOYSA-N 0.000 description 2
- OSGAYBCDTDRGGQ-UHFFFAOYSA-L calcium sulfate Chemical compound [Ca+2].[O-]S([O-])(=O)=O OSGAYBCDTDRGGQ-UHFFFAOYSA-L 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 210000004671 cell-free system Anatomy 0.000 description 2
- 239000002738 chelating agent Substances 0.000 description 2
- 102000021178 chitin binding proteins Human genes 0.000 description 2
- 108091011157 chitin binding proteins Proteins 0.000 description 2
- 235000012000 cholesterol Nutrition 0.000 description 2
- 229940107161 cholesterol Drugs 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 210000002314 coated vesicle Anatomy 0.000 description 2
- 210000001072 colon Anatomy 0.000 description 2
- 239000008139 complexing agent Substances 0.000 description 2
- 230000001268 conjugating effect Effects 0.000 description 2
- 239000003246 corticosteroid Substances 0.000 description 2
- 239000006184 cosolvent Substances 0.000 description 2
- 238000004132 cross linking Methods 0.000 description 2
- 238000012926 crystallographic analysis Methods 0.000 description 2
- ZPWOOKQUDFIEIX-UHFFFAOYSA-N cyclooctyne Chemical group C1CCCC#CCC1 ZPWOOKQUDFIEIX-UHFFFAOYSA-N 0.000 description 2
- 102000003675 cytokine receptors Human genes 0.000 description 2
- 108010057085 cytokine receptors Proteins 0.000 description 2
- 206010052015 cytokine release syndrome Diseases 0.000 description 2
- 239000007857 degradation product Substances 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- WHBIGIKBNXZKFE-UHFFFAOYSA-N delavirdine Chemical compound CC(C)NC1=CC=CN=C1N1CCN(C(=O)C=2NC3=CC=C(NS(C)(=O)=O)C=C3C=2)CC1 WHBIGIKBNXZKFE-UHFFFAOYSA-N 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 235000019425 dextrin Nutrition 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 206010012818 diffuse large B-cell lymphoma Diseases 0.000 description 2
- 206010013023 diphtheria Diseases 0.000 description 2
- BNIILDVGGAEEIG-UHFFFAOYSA-L disodium hydrogen phosphate Chemical compound [Na+].[Na+].OP([O-])([O-])=O BNIILDVGGAEEIG-UHFFFAOYSA-L 0.000 description 2
- NOPFSRXAKWQILS-UHFFFAOYSA-N docosan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCCCCCO NOPFSRXAKWQILS-UHFFFAOYSA-N 0.000 description 2
- 239000012645 endogenous antigen Substances 0.000 description 2
- 210000003979 eosinophil Anatomy 0.000 description 2
- 210000003238 esophagus Anatomy 0.000 description 2
- 235000019325 ethyl cellulose Nutrition 0.000 description 2
- 229920001249 ethyl cellulose Polymers 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 239000000945 filler Substances 0.000 description 2
- 238000000684 flow cytometry Methods 0.000 description 2
- MKXKFYHWDHIYRV-UHFFFAOYSA-N flutamide Chemical compound CC(C)C(=O)NC1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 MKXKFYHWDHIYRV-UHFFFAOYSA-N 0.000 description 2
- 201000003444 follicular lymphoma Diseases 0.000 description 2
- 238000004108 freeze drying Methods 0.000 description 2
- 125000000524 functional group Chemical group 0.000 description 2
- 229960002963 ganciclovir Drugs 0.000 description 2
- IRSCQMHQWWYFCW-UHFFFAOYSA-N ganciclovir Chemical compound O=C1NC(N)=NC2=C1N=CN2COC(CO)CO IRSCQMHQWWYFCW-UHFFFAOYSA-N 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- 208000016361 genetic disease Diseases 0.000 description 2
- 239000008103 glucose Substances 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 210000002149 gonad Anatomy 0.000 description 2
- XLXSAKCOAKORKW-AQJXLSMYSA-N gonadorelin Chemical compound C([C@@H](C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)NCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 XLXSAKCOAKORKW-AQJXLSMYSA-N 0.000 description 2
- 229940035638 gonadotropin-releasing hormone Drugs 0.000 description 2
- 239000005090 green fluorescent protein Substances 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 201000009277 hairy cell leukemia Diseases 0.000 description 2
- 201000005787 hematologic cancer Diseases 0.000 description 2
- 230000002489 hematologic effect Effects 0.000 description 2
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 2
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 2
- 208000006454 hepatitis Diseases 0.000 description 2
- 231100000283 hepatitis Toxicity 0.000 description 2
- 238000006077 hetero Diels-Alder cycloaddition reaction Methods 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 238000001794 hormone therapy Methods 0.000 description 2
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 2
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 2
- 235000010977 hydroxypropyl cellulose Nutrition 0.000 description 2
- 239000001863 hydroxypropyl cellulose Substances 0.000 description 2
- 235000010979 hydroxypropyl methyl cellulose Nutrition 0.000 description 2
- 229920003088 hydroxypropyl methyl cellulose Polymers 0.000 description 2
- 239000001866 hydroxypropyl methyl cellulose Substances 0.000 description 2
- UFVKGYZPFZQRLF-UHFFFAOYSA-N hydroxypropyl methyl cellulose Chemical compound OC1C(O)C(OC)OC(CO)C1OC1C(O)C(O)C(OC2C(C(O)C(OC3C(C(O)C(O)C(CO)O3)O)C(CO)O2)O)C(CO)O1 UFVKGYZPFZQRLF-UHFFFAOYSA-N 0.000 description 2
- 210000002865 immune cell Anatomy 0.000 description 2
- 102000027596 immune receptors Human genes 0.000 description 2
- 108091008915 immune receptors Proteins 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 238000002649 immunization Methods 0.000 description 2
- 238000002513 implantation Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 238000001802 infusion Methods 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 229960003130 interferon gamma Drugs 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 229960004768 irinotecan Drugs 0.000 description 2
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 description 2
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 2
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 206010024627 liposarcoma Diseases 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 239000000314 lubricant Substances 0.000 description 2
- 206010025135 lupus erythematosus Diseases 0.000 description 2
- 210000002751 lymph Anatomy 0.000 description 2
- 239000012931 lyophilized formulation Substances 0.000 description 2
- 125000003588 lysine group Chemical class [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 201000009020 malignant peripheral nerve sheath tumor Diseases 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- RQZAXGRLVPAYTJ-GQFGMJRRSA-N megestrol acetate Chemical compound C1=C(C)C2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)C)[C@@]1(C)CC2 RQZAXGRLVPAYTJ-GQFGMJRRSA-N 0.000 description 2
- 206010027191 meningioma Diseases 0.000 description 2
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 2
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 2
- 239000008108 microcrystalline cellulose Substances 0.000 description 2
- 229940016286 microcrystalline cellulose Drugs 0.000 description 2
- 210000001616 monocyte Anatomy 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 210000003205 muscle Anatomy 0.000 description 2
- 201000000050 myeloid neoplasm Diseases 0.000 description 2
- 229920005615 natural polymer Polymers 0.000 description 2
- 210000004498 neuroglial cell Anatomy 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 210000000440 neutrophil Anatomy 0.000 description 2
- NQDJXKOVJZTUJA-UHFFFAOYSA-N nevirapine Chemical compound C12=NC=CC=C2C(=O)NC=2C(C)=CC=NC=2N1C1CC1 NQDJXKOVJZTUJA-UHFFFAOYSA-N 0.000 description 2
- XWXYUMMDTVBTOU-UHFFFAOYSA-N nilutamide Chemical compound O=C1C(C)(C)NC(=O)N1C1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 XWXYUMMDTVBTOU-UHFFFAOYSA-N 0.000 description 2
- 239000002736 nonionic surfactant Substances 0.000 description 2
- 230000009871 nonspecific binding Effects 0.000 description 2
- 231100000252 nontoxic Toxicity 0.000 description 2
- 230000003000 nontoxic effect Effects 0.000 description 2
- 238000001543 one-way ANOVA Methods 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 210000000496 pancreas Anatomy 0.000 description 2
- 230000002688 persistence Effects 0.000 description 2
- 230000002085 persistent effect Effects 0.000 description 2
- ZJAOAACCNHFJAH-UHFFFAOYSA-N phosphonoformic acid Chemical compound OC(=O)P(O)(O)=O ZJAOAACCNHFJAH-UHFFFAOYSA-N 0.000 description 2
- 210000004560 pineal gland Anatomy 0.000 description 2
- 229920001281 polyalkylene Polymers 0.000 description 2
- 229920002704 polyhistidine Polymers 0.000 description 2
- 208000005987 polymyositis Diseases 0.000 description 2
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 2
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 2
- 229920001282 polysaccharide Polymers 0.000 description 2
- 239000005017 polysaccharide Substances 0.000 description 2
- 150000004804 polysaccharides Chemical class 0.000 description 2
- 229940068968 polysorbate 80 Drugs 0.000 description 2
- 229920000053 polysorbate 80 Polymers 0.000 description 2
- 229940068965 polysorbates Drugs 0.000 description 2
- 235000019422 polyvinyl alcohol Nutrition 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 208000016800 primary central nervous system lymphoma Diseases 0.000 description 2
- 230000009465 prokaryotic expression Effects 0.000 description 2
- 229940097325 prolactin Drugs 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 230000001902 propagating effect Effects 0.000 description 2
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 2
- 210000002307 prostate Anatomy 0.000 description 2
- 230000002797 proteolythic effect Effects 0.000 description 2
- 208000002574 reactive arthritis Diseases 0.000 description 2
- 206010038038 rectal cancer Diseases 0.000 description 2
- 201000001275 rectum cancer Diseases 0.000 description 2
- 108010054624 red fluorescent protein Proteins 0.000 description 2
- 230000001177 retroviral effect Effects 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 201000000306 sarcoidosis Diseases 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 208000002491 severe combined immunodeficiency Diseases 0.000 description 2
- 210000003491 skin Anatomy 0.000 description 2
- 206010040872 skin infection Diseases 0.000 description 2
- 208000000587 small cell lung carcinoma Diseases 0.000 description 2
- 206010062113 splenic marginal zone lymphoma Diseases 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 230000004936 stimulating effect Effects 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- 235000000346 sugar Nutrition 0.000 description 2
- 239000000375 suspending agent Substances 0.000 description 2
- 230000002459 sustained effect Effects 0.000 description 2
- 229920001059 synthetic polymer Polymers 0.000 description 2
- 201000004415 tendinitis Diseases 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 210000001550 testis Anatomy 0.000 description 2
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 201000008827 tuberculosis Diseases 0.000 description 2
- 208000010380 tumor lysis syndrome Diseases 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 210000003932 urinary bladder Anatomy 0.000 description 2
- 201000005112 urinary bladder cancer Diseases 0.000 description 2
- 210000004291 uterus Anatomy 0.000 description 2
- 229960005486 vaccine Drugs 0.000 description 2
- 235000015112 vegetable and seed oil Nutrition 0.000 description 2
- 239000008158 vegetable oil Substances 0.000 description 2
- 229960003048 vinblastine Drugs 0.000 description 2
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 2
- 239000011782 vitamin Substances 0.000 description 2
- 235000013343 vitamin Nutrition 0.000 description 2
- 229940088594 vitamin Drugs 0.000 description 2
- 229930003231 vitamin Natural products 0.000 description 2
- 150000003722 vitamin derivatives Chemical class 0.000 description 2
- 239000001993 wax Substances 0.000 description 2
- 239000000080 wetting agent Substances 0.000 description 2
- 238000012447 xenograft mouse model Methods 0.000 description 2
- 239000005019 zein Substances 0.000 description 2
- 229940093612 zein Drugs 0.000 description 2
- HBOMLICNUCNMMY-XLPZGREQSA-N zidovudine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](N=[N+]=[N-])C1 HBOMLICNUCNMMY-XLPZGREQSA-N 0.000 description 2
- JNYAEWCLZODPBN-JGWLITMVSA-N (2r,3r,4s)-2-[(1r)-1,2-dihydroxyethyl]oxolane-3,4-diol Chemical class OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O JNYAEWCLZODPBN-JGWLITMVSA-N 0.000 description 1
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- MFRNYXJJRJQHNW-DEMKXPNLSA-N (2s)-2-[[(2r,3r)-3-methoxy-3-[(2s)-1-[(3r,4s,5s)-3-methoxy-5-methyl-4-[methyl-[(2s)-3-methyl-2-[[(2s)-3-methyl-2-(methylamino)butanoyl]amino]butanoyl]amino]heptanoyl]pyrrolidin-2-yl]-2-methylpropanoyl]amino]-3-phenylpropanoic acid Chemical compound CN[C@@H](C(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 MFRNYXJJRJQHNW-DEMKXPNLSA-N 0.000 description 1
- XMQUEQJCYRFIQS-YFKPBYRVSA-N (2s)-2-amino-5-ethoxy-5-oxopentanoic acid Chemical compound CCOC(=O)CC[C@H](N)C(O)=O XMQUEQJCYRFIQS-YFKPBYRVSA-N 0.000 description 1
- ZXSBHXZKWRIEIA-JTQLQIEISA-N (2s)-3-(4-acetylphenyl)-2-azaniumylpropanoate Chemical compound CC(=O)C1=CC=C(C[C@H](N)C(O)=O)C=C1 ZXSBHXZKWRIEIA-JTQLQIEISA-N 0.000 description 1
- CNPVJJQCETWNEU-CYFREDJKSA-N (4,6-dimethyl-5-pyrimidinyl)-[4-[(3S)-4-[(1R)-2-methoxy-1-[4-(trifluoromethyl)phenyl]ethyl]-3-methyl-1-piperazinyl]-4-methyl-1-piperidinyl]methanone Chemical compound N([C@@H](COC)C=1C=CC(=CC=1)C(F)(F)F)([C@H](C1)C)CCN1C(CC1)(C)CCN1C(=O)C1=C(C)N=CN=C1C CNPVJJQCETWNEU-CYFREDJKSA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- WHBMMWSBFZVSSR-GSVOUGTGSA-N (R)-3-hydroxybutyric acid Chemical compound C[C@@H](O)CC(O)=O WHBMMWSBFZVSSR-GSVOUGTGSA-N 0.000 description 1
- LKJPYSCBVHEWIU-KRWDZBQOSA-N (R)-bicalutamide Chemical compound C([C@@](O)(C)C(=O)NC=1C=C(C(C#N)=CC=1)C(F)(F)F)S(=O)(=O)C1=CC=C(F)C=C1 LKJPYSCBVHEWIU-KRWDZBQOSA-N 0.000 description 1
- RKDVKSZUMVYZHH-UHFFFAOYSA-N 1,4-dioxane-2,5-dione Chemical compound O=C1COC(=O)CO1 RKDVKSZUMVYZHH-UHFFFAOYSA-N 0.000 description 1
- HJTAZXHBEBIQQX-UHFFFAOYSA-N 1,5-bis(chloromethyl)naphthalene Chemical compound C1=CC=C2C(CCl)=CC=CC2=C1CCl HJTAZXHBEBIQQX-UHFFFAOYSA-N 0.000 description 1
- UBCHPRBFMUDMNC-UHFFFAOYSA-N 1-(1-adamantyl)ethanamine Chemical compound C1C(C2)CC3CC2CC1(C(N)C)C3 UBCHPRBFMUDMNC-UHFFFAOYSA-N 0.000 description 1
- 102100025573 1-alkyl-2-acetylglycerophosphocholine esterase Human genes 0.000 description 1
- IXPNQXFRVYWDDI-UHFFFAOYSA-N 1-methyl-2,4-dioxo-1,3-diazinane-5-carboximidamide Chemical compound CN1CC(C(N)=N)C(=O)NC1=O IXPNQXFRVYWDDI-UHFFFAOYSA-N 0.000 description 1
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- IIZPXYDJLKNOIY-JXPKJXOSSA-N 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCC\C=C/C\C=C/C\C=C/C\C=C/CCCCC IIZPXYDJLKNOIY-JXPKJXOSSA-N 0.000 description 1
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 1
- RPZANUYHRMRTTE-UHFFFAOYSA-N 2,3,4-trimethoxy-6-(methoxymethyl)-5-[3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxyoxane;1-[[3,4,5-tris(2-hydroxybutoxy)-6-[4,5,6-tris(2-hydroxybutoxy)-2-(2-hydroxybutoxymethyl)oxan-3-yl]oxyoxan-2-yl]methoxy]butan-2-ol Chemical compound COC1C(OC)C(OC)C(COC)OC1OC1C(OC)C(OC)C(OC)OC1COC.CCC(O)COC1C(OCC(O)CC)C(OCC(O)CC)C(COCC(O)CC)OC1OC1C(OCC(O)CC)C(OCC(O)CC)C(OCC(O)CC)OC1COCC(O)CC RPZANUYHRMRTTE-UHFFFAOYSA-N 0.000 description 1
- ZIIUUSVHCHPIQD-UHFFFAOYSA-N 2,4,6-trimethyl-N-[3-(trifluoromethyl)phenyl]benzenesulfonamide Chemical compound CC1=CC(C)=CC(C)=C1S(=O)(=O)NC1=CC=CC(C(F)(F)F)=C1 ZIIUUSVHCHPIQD-UHFFFAOYSA-N 0.000 description 1
- SOAPXKSPJAZNGO-UHFFFAOYSA-N 2-(1,3-dicarboxypropylcarbamoylamino)pentanedioic acid Chemical compound OC(=O)CCC(C(O)=O)NC(=O)NC(C(O)=O)CCC(O)=O SOAPXKSPJAZNGO-UHFFFAOYSA-N 0.000 description 1
- UEJJHQNACJXSKW-UHFFFAOYSA-N 2-(2,6-dioxopiperidin-3-yl)-1H-isoindole-1,3(2H)-dione Chemical compound O=C1C2=CC=CC=C2C(=O)N1C1CCC(=O)NC1=O UEJJHQNACJXSKW-UHFFFAOYSA-N 0.000 description 1
- VHVPQPYKVGDNFY-DFMJLFEVSA-N 2-[(2r)-butan-2-yl]-4-[4-[4-[4-[[(2r,4s)-2-(2,4-dichlorophenyl)-2-(1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy]phenyl]piperazin-1-yl]phenyl]-1,2,4-triazol-3-one Chemical compound O=C1N([C@H](C)CC)N=CN1C1=CC=C(N2CCN(CC2)C=2C=CC(OC[C@@H]3O[C@](CN4N=CN=C4)(OC3)C=3C(=CC(Cl)=CC=3)Cl)=CC=2)C=C1 VHVPQPYKVGDNFY-DFMJLFEVSA-N 0.000 description 1
- DIHXSRXTECMMJY-MURFETPASA-N 2-[dimethyl-[(9z,12z)-octadeca-9,12-dienyl]azaniumyl]acetate Chemical group CCCCC\C=C/C\C=C/CCCCCCCC[N+](C)(C)CC([O-])=O DIHXSRXTECMMJY-MURFETPASA-N 0.000 description 1
- LMVGXBRDRZOPHA-UHFFFAOYSA-N 2-[dimethyl-[3-(16-methylheptadecanoylamino)propyl]azaniumyl]acetate Chemical compound CC(C)CCCCCCCCCCCCCCC(=O)NCCC[N+](C)(C)CC([O-])=O LMVGXBRDRZOPHA-UHFFFAOYSA-N 0.000 description 1
- TYIOVYZMKITKRO-UHFFFAOYSA-N 2-[hexadecyl(dimethyl)azaniumyl]acetate Chemical compound CCCCCCCCCCCCCCCC[N+](C)(C)CC([O-])=O TYIOVYZMKITKRO-UHFFFAOYSA-N 0.000 description 1
- SNQVCAOGQHOSEN-UHFFFAOYSA-N 2-[methyl(octadecyl)amino]acetic acid Chemical compound CCCCCCCCCCCCCCCCCCN(C)CC(O)=O SNQVCAOGQHOSEN-UHFFFAOYSA-N 0.000 description 1
- CQOQDQWUFQDJMK-SSTWWWIQSA-N 2-methoxy-17beta-estradiol Chemical compound C([C@@H]12)C[C@]3(C)[C@@H](O)CC[C@H]3[C@@H]1CCC1=C2C=C(OC)C(O)=C1 CQOQDQWUFQDJMK-SSTWWWIQSA-N 0.000 description 1
- DIROHOMJLWMERM-UHFFFAOYSA-N 3-[dimethyl(octadecyl)azaniumyl]propane-1-sulfonate Chemical compound CCCCCCCCCCCCCCCCCC[N+](C)(C)CCCS([O-])(=O)=O DIROHOMJLWMERM-UHFFFAOYSA-N 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- YLDCUKJMEKGGFI-QCSRICIXSA-N 4-acetamidobenzoic acid;9-[(2r,3r,4s,5r)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]-3h-purin-6-one;1-(dimethylamino)propan-2-ol Chemical compound CC(O)CN(C)C.CC(O)CN(C)C.CC(O)CN(C)C.CC(=O)NC1=CC=C(C(O)=O)C=C1.CC(=O)NC1=CC=C(C(O)=O)C=C1.CC(=O)NC1=CC=C(C(O)=O)C=C1.O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(NC=NC2=O)=C2N=C1 YLDCUKJMEKGGFI-QCSRICIXSA-N 0.000 description 1
- SGOOQMRIPALTEL-UHFFFAOYSA-N 4-hydroxy-N,1-dimethyl-2-oxo-N-phenyl-3-quinolinecarboxamide Chemical compound OC=1C2=CC=CC=C2N(C)C(=O)C=1C(=O)N(C)C1=CC=CC=C1 SGOOQMRIPALTEL-UHFFFAOYSA-N 0.000 description 1
- 102100036009 5'-AMP-activated protein kinase catalytic subunit alpha-2 Human genes 0.000 description 1
- WYWHKKSPHMUBEB-UHFFFAOYSA-N 6-Mercaptoguanine Natural products N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- ZKRFOXLVOKTUTA-KQYNXXCUSA-N 9-(5-phosphoribofuranosyl)-6-mercaptopurine Chemical compound O[C@@H]1[C@H](O)[C@@H](COP(O)(O)=O)O[C@H]1N1C(NC=NC2=S)=C2N=C1 ZKRFOXLVOKTUTA-KQYNXXCUSA-N 0.000 description 1
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 241000224422 Acanthamoeba Species 0.000 description 1
- 241000922028 Acanthamoeba astronyxis Species 0.000 description 1
- 241000224423 Acanthamoeba castellanii Species 0.000 description 1
- 241000167877 Acanthamoeba culbertsoni Species 0.000 description 1
- 241001165303 Acanthamoeba divionensis Species 0.000 description 1
- 241000921991 Acanthamoeba hatchetti Species 0.000 description 1
- 241000921990 Acanthamoeba healyi Species 0.000 description 1
- 241000224430 Acanthamoeba polyphaga Species 0.000 description 1
- 241001455958 Acanthamoeba rhysodes Species 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 208000016557 Acute basophilic leukemia Diseases 0.000 description 1
- 208000026872 Addison Disease Diseases 0.000 description 1
- 108060003345 Adrenergic Receptor Proteins 0.000 description 1
- 102000017910 Adrenergic receptor Human genes 0.000 description 1
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 1
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 1
- 102100035248 Alpha-(1,3)-fucosyltransferase 4 Human genes 0.000 description 1
- 208000037540 Alveolar soft tissue sarcoma Diseases 0.000 description 1
- 206010001889 Alveolitis Diseases 0.000 description 1
- 102100022749 Aminopeptidase N Human genes 0.000 description 1
- 229920000856 Amylose Polymers 0.000 description 1
- 206010002412 Angiocentric lymphomas Diseases 0.000 description 1
- 102100034608 Angiopoietin-2 Human genes 0.000 description 1
- 108010048036 Angiopoietin-2 Proteins 0.000 description 1
- 102400000068 Angiostatin Human genes 0.000 description 1
- 108010079709 Angiostatins Proteins 0.000 description 1
- 241000476964 Anncaliia algerae Species 0.000 description 1
- 108010032595 Antibody Binding Sites Proteins 0.000 description 1
- 102000004411 Antithrombin III Human genes 0.000 description 1
- 108090000935 Antithrombin III Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 229940122815 Aromatase inhibitor Drugs 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 241000228212 Aspergillus Species 0.000 description 1
- 241000416162 Astragalus gummifer Species 0.000 description 1
- 206010065869 Astrocytoma, low grade Diseases 0.000 description 1
- AXRYRYVKAWYZBR-UHFFFAOYSA-N Atazanavir Natural products C=1C=C(C=2N=CC=CC=2)C=CC=1CN(NC(=O)C(NC(=O)OC)C(C)(C)C)CC(O)C(NC(=O)C(NC(=O)OC)C(C)(C)C)CC1=CC=CC=C1 AXRYRYVKAWYZBR-UHFFFAOYSA-N 0.000 description 1
- 108010019625 Atazanavir Sulfate Proteins 0.000 description 1
- 206010071576 Autoimmune aplastic anaemia Diseases 0.000 description 1
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 1
- 206010064539 Autoimmune myocarditis Diseases 0.000 description 1
- 208000031212 Autoimmune polyendocrinopathy Diseases 0.000 description 1
- 208000030016 Avascular necrosis Diseases 0.000 description 1
- 108090001008 Avidin Proteins 0.000 description 1
- 108091008875 B cell receptors Proteins 0.000 description 1
- 208000012526 B-cell neoplasm Diseases 0.000 description 1
- 206010003908 B-cell small lymphocytic lymphoma Diseases 0.000 description 1
- MLDQJTXFUGDVEO-UHFFFAOYSA-N BAY-43-9006 Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 MLDQJTXFUGDVEO-UHFFFAOYSA-N 0.000 description 1
- 201000001178 Bacterial Pneumonia Diseases 0.000 description 1
- 208000004926 Bacterial Vaginosis Diseases 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 206010004146 Basal cell carcinoma Diseases 0.000 description 1
- 208000009137 Behcet syndrome Diseases 0.000 description 1
- 208000006373 Bell palsy Diseases 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- BTBUEUYNUDRHOZ-UHFFFAOYSA-N Borate Chemical compound [O-]B([O-])[O-] BTBUEUYNUDRHOZ-UHFFFAOYSA-N 0.000 description 1
- 241000588807 Bordetella Species 0.000 description 1
- 241000589968 Borrelia Species 0.000 description 1
- 241000614861 Brachiola Species 0.000 description 1
- 206010006143 Brain stem glioma Diseases 0.000 description 1
- 241000589562 Brucella Species 0.000 description 1
- 206010006811 Bursitis Diseases 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 102100028989 C-X-C chemokine receptor type 2 Human genes 0.000 description 1
- 102100025248 C-X-C motif chemokine 10 Human genes 0.000 description 1
- 101710188619 C-type lectin domain family 12 member A Proteins 0.000 description 1
- 102100026094 C-type lectin domain family 12 member A Human genes 0.000 description 1
- 102100027207 CD27 antigen Human genes 0.000 description 1
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 1
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 1
- 102100035793 CD83 antigen Human genes 0.000 description 1
- QAGYKUNXZHXKMR-UHFFFAOYSA-N CPD000469186 Natural products CC1=C(O)C=CC=C1C(=O)NC(C(O)CN1C(CC2CCCCC2C1)C(=O)NC(C)(C)C)CSC1=CC=CC=C1 QAGYKUNXZHXKMR-UHFFFAOYSA-N 0.000 description 1
- 108091033409 CRISPR Proteins 0.000 description 1
- 238000010354 CRISPR gene editing Methods 0.000 description 1
- 102100029968 Calreticulin Human genes 0.000 description 1
- 108090000549 Calreticulin Proteins 0.000 description 1
- 241000222120 Candida <Saccharomycetales> Species 0.000 description 1
- 102400000730 Canstatin Human genes 0.000 description 1
- 101800000626 Canstatin Proteins 0.000 description 1
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical compound NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 241001466804 Carnivora Species 0.000 description 1
- 108010067225 Cell Adhesion Molecules Proteins 0.000 description 1
- 102000016289 Cell Adhesion Molecules Human genes 0.000 description 1
- 206010007882 Cellulitis Diseases 0.000 description 1
- 229920000623 Cellulose acetate phthalate Polymers 0.000 description 1
- DQEFEBPAPFSJLV-UHFFFAOYSA-N Cellulose propionate Chemical compound CCC(=O)OCC1OC(OC(=O)CC)C(OC(=O)CC)C(OC(=O)CC)C1OC1C(OC(=O)CC)C(OC(=O)CC)C(OC(=O)CC)C(COC(=O)CC)O1 DQEFEBPAPFSJLV-UHFFFAOYSA-N 0.000 description 1
- 229920002284 Cellulose triacetate Polymers 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 241000283153 Cetacea Species 0.000 description 1
- 241000306001 Cetartiodactyla Species 0.000 description 1
- 201000006082 Chickenpox Diseases 0.000 description 1
- 108091007741 Chimeric antigen receptor T cells Proteins 0.000 description 1
- 241000288673 Chiroptera Species 0.000 description 1
- GHXZTYHSJHQHIJ-UHFFFAOYSA-N Chlorhexidine Chemical compound C=1C=C(Cl)C=CC=1NC(N)=NC(N)=NCCCCCCN=C(N)N=C(N)NC1=CC=C(Cl)C=C1 GHXZTYHSJHQHIJ-UHFFFAOYSA-N 0.000 description 1
- 206010008690 Chondrocalcinosis pyrophosphate Diseases 0.000 description 1
- 208000005243 Chondrosarcoma Diseases 0.000 description 1
- 102100031186 Chromogranin-A Human genes 0.000 description 1
- 206010008874 Chronic Fatigue Syndrome Diseases 0.000 description 1
- 206010008909 Chronic Hepatitis Diseases 0.000 description 1
- VWFCHDSQECPREK-LURJTMIESA-N Cidofovir Chemical compound NC=1C=CN(C[C@@H](CO)OCP(O)(O)=O)C(=O)N=1 VWFCHDSQECPREK-LURJTMIESA-N 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 1
- 241000193403 Clostridium Species 0.000 description 1
- 102100024484 Codanin-1 Human genes 0.000 description 1
- 208000010007 Cogan syndrome Diseases 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 108010003384 Colony-Stimulating Factor Receptors Proteins 0.000 description 1
- 102000004626 Colony-Stimulating Factor Receptors Human genes 0.000 description 1
- 208000009248 Congenital Hip Dislocation Diseases 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 206010011219 Costochondritis Diseases 0.000 description 1
- 241000709687 Coxsackievirus Species 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241001337994 Cryptococcus <scale insect> Species 0.000 description 1
- 241000223935 Cryptosporidium Species 0.000 description 1
- 241000223936 Cryptosporidium parvum Species 0.000 description 1
- 102000008130 Cyclic AMP-Dependent Protein Kinases Human genes 0.000 description 1
- 108010049894 Cyclic AMP-Dependent Protein Kinases Proteins 0.000 description 1
- 102000001189 Cyclic Peptides Human genes 0.000 description 1
- 108010069514 Cyclic Peptides Proteins 0.000 description 1
- 229920000858 Cyclodextrin Polymers 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- 241000179197 Cyclospora Species 0.000 description 1
- 241000016605 Cyclospora cayetanensis Species 0.000 description 1
- 201000003883 Cystic fibrosis Diseases 0.000 description 1
- 241000205707 Cystoisospora belli Species 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 108010092160 Dactinomycin Proteins 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 208000008334 Dermatofibrosarcoma Diseases 0.000 description 1
- 206010057070 Dermatofibrosarcoma protuberans Diseases 0.000 description 1
- 108700022150 Designed Ankyrin Repeat Proteins Proteins 0.000 description 1
- 206010059352 Desmoid tumour Diseases 0.000 description 1
- BXZVVICBKDXVGW-NKWVEPMBSA-N Didanosine Chemical compound O1[C@H](CO)CC[C@@H]1N1C(NC=NC2=O)=C2N=C1 BXZVVICBKDXVGW-NKWVEPMBSA-N 0.000 description 1
- 108010053187 Diphtheria Toxin Proteins 0.000 description 1
- 102000016607 Diphtheria Toxin Human genes 0.000 description 1
- OFDNQWIFNXBECV-UHFFFAOYSA-N Dolastatin 10 Natural products CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)CC)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 OFDNQWIFNXBECV-UHFFFAOYSA-N 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 102000001301 EGF receptor Human genes 0.000 description 1
- 108060006698 EGF receptor Proteins 0.000 description 1
- XPOQHMRABVBWPR-UHFFFAOYSA-N Efavirenz Natural products O1C(=O)NC2=CC=C(Cl)C=C2C1(C(F)(F)F)C#CC1CC1 XPOQHMRABVBWPR-UHFFFAOYSA-N 0.000 description 1
- 208000002197 Ehlers-Danlos syndrome Diseases 0.000 description 1
- 102000006490 Eicosanoid receptors Human genes 0.000 description 1
- 108010019316 Eicosanoid receptors Proteins 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 241000243234 Encephalitozoon Species 0.000 description 1
- 241001442404 Encephalitozoon bieneusi Species 0.000 description 1
- 241000243212 Encephalitozoon cuniculi Species 0.000 description 1
- 241001126846 Encephalitozoon hellem Species 0.000 description 1
- 241000596569 Encephalitozoon intestinalis Species 0.000 description 1
- 102400001047 Endostatin Human genes 0.000 description 1
- 108010079505 Endostatins Proteins 0.000 description 1
- 108010032976 Enfuvirtide Proteins 0.000 description 1
- 241000224431 Entamoeba Species 0.000 description 1
- 241000224432 Entamoeba histolytica Species 0.000 description 1
- 241000194033 Enterococcus Species 0.000 description 1
- 241001126836 Enterocytozoon Species 0.000 description 1
- 102100029727 Enteropeptidase Human genes 0.000 description 1
- 108010013369 Enteropeptidase Proteins 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 206010014954 Eosinophilic fasciitis Diseases 0.000 description 1
- 206010014958 Eosinophilic leukaemia Diseases 0.000 description 1
- 206010014967 Ependymoma Diseases 0.000 description 1
- 102000050554 Eph Family Receptors Human genes 0.000 description 1
- 108091008815 Eph receptors Proteins 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- 201000005231 Epithelioid sarcoma Diseases 0.000 description 1
- 241000283074 Equus asinus Species 0.000 description 1
- 241001331845 Equus asinus x caballus Species 0.000 description 1
- 201000000297 Erysipelas Diseases 0.000 description 1
- 206010015226 Erythema nodosum Diseases 0.000 description 1
- 208000031637 Erythroblastic Acute Leukemia Diseases 0.000 description 1
- 208000036566 Erythroleukaemia Diseases 0.000 description 1
- 108010075944 Erythropoietin Receptors Proteins 0.000 description 1
- 102100036509 Erythropoietin receptor Human genes 0.000 description 1
- 241000588722 Escherichia Species 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- VGGSQFUCUMXWEO-UHFFFAOYSA-N Ethene Chemical compound C=C VGGSQFUCUMXWEO-UHFFFAOYSA-N 0.000 description 1
- CTKXFMQHOOWWEB-UHFFFAOYSA-N Ethylene oxide/propylene oxide copolymer Chemical compound CCCOC(C)COCCO CTKXFMQHOOWWEB-UHFFFAOYSA-N 0.000 description 1
- HKVAMNSJSFKALM-GKUWKFKPSA-N Everolimus Chemical compound C1C[C@@H](OCCO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 HKVAMNSJSFKALM-GKUWKFKPSA-N 0.000 description 1
- 206010063599 Exposure to chemical pollution Diseases 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 206010015848 Extraskeletal osteosarcomas Diseases 0.000 description 1
- 239000001116 FEMA 4028 Substances 0.000 description 1
- 108091008794 FGF receptors Proteins 0.000 description 1
- XZWYTXMRWQJBGX-VXBMVYAYSA-N FLAG peptide Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=C(O)C=C1 XZWYTXMRWQJBGX-VXBMVYAYSA-N 0.000 description 1
- 108010060374 FSH Receptors Proteins 0.000 description 1
- 108010074860 Factor Xa Proteins 0.000 description 1
- 208000013452 Fallopian tube neoplasm Diseases 0.000 description 1
- 206010016207 Familial Mediterranean fever Diseases 0.000 description 1
- 206010016228 Fasciitis Diseases 0.000 description 1
- 102000044168 Fibroblast Growth Factor Receptor Human genes 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 102100027627 Follicle-stimulating hormone receptor Human genes 0.000 description 1
- 208000019331 Foodborne disease Diseases 0.000 description 1
- 241000589601 Francisella Species 0.000 description 1
- 206010017533 Fungal infection Diseases 0.000 description 1
- 108091006027 G proteins Proteins 0.000 description 1
- 102000030782 GTP binding Human genes 0.000 description 1
- 108091000058 GTP-Binding Proteins 0.000 description 1
- 208000003098 Ganglion Cysts Diseases 0.000 description 1
- 206010061166 Gastroenteritis bacterial Diseases 0.000 description 1
- 208000031852 Gastrointestinal stromal cancer Diseases 0.000 description 1
- 108700004714 Gelonium multiflorum GEL Proteins 0.000 description 1
- 241000224466 Giardia Species 0.000 description 1
- 241000224467 Giardia intestinalis Species 0.000 description 1
- 201000010915 Glioblastoma multiforme Diseases 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- 229920002683 Glycosaminoglycan Polymers 0.000 description 1
- 208000024869 Goodpasture syndrome Diseases 0.000 description 1
- 241000282575 Gorilla Species 0.000 description 1
- 201000005569 Gout Diseases 0.000 description 1
- 102100039622 Granulocyte colony-stimulating factor receptor Human genes 0.000 description 1
- 102100020948 Growth hormone receptor Human genes 0.000 description 1
- 229920002907 Guar gum Polymers 0.000 description 1
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 1
- 241000606790 Haemophilus Species 0.000 description 1
- 208000001204 Hashimoto Disease Diseases 0.000 description 1
- 208000030836 Hashimoto thyroiditis Diseases 0.000 description 1
- 241000589989 Helicobacter Species 0.000 description 1
- 208000006050 Hemangiopericytoma Diseases 0.000 description 1
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 1
- 208000035186 Hemolytic Autoimmune Anemia Diseases 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 208000005176 Hepatitis C Diseases 0.000 description 1
- 206010019755 Hepatitis chronic active Diseases 0.000 description 1
- 108010061414 Hepatocyte Nuclear Factor 1-beta Proteins 0.000 description 1
- 102100022123 Hepatocyte nuclear factor 1-beta Human genes 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- 102000008949 Histocompatibility Antigens Class I Human genes 0.000 description 1
- 108010088652 Histocompatibility Antigens Class I Proteins 0.000 description 1
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 1
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 description 1
- 108010033040 Histones Proteins 0.000 description 1
- 241000228402 Histoplasma Species 0.000 description 1
- 101000783681 Homo sapiens 5'-AMP-activated protein kinase catalytic subunit alpha-2 Proteins 0.000 description 1
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 1
- 101001022185 Homo sapiens Alpha-(1,3)-fucosyltransferase 4 Proteins 0.000 description 1
- 101000757160 Homo sapiens Aminopeptidase N Proteins 0.000 description 1
- 101000916059 Homo sapiens C-X-C chemokine receptor type 2 Proteins 0.000 description 1
- 101000858088 Homo sapiens C-X-C motif chemokine 10 Proteins 0.000 description 1
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 1
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 description 1
- 101000980888 Homo sapiens Codanin-1 Proteins 0.000 description 1
- 101000746364 Homo sapiens Granulocyte colony-stimulating factor receptor Proteins 0.000 description 1
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 1
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 1
- 101001015004 Homo sapiens Integrin beta-3 Proteins 0.000 description 1
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 1
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 1
- 101001008874 Homo sapiens Mast/stem cell growth factor receptor Kit Proteins 0.000 description 1
- 101000669513 Homo sapiens Metalloproteinase inhibitor 1 Proteins 0.000 description 1
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 1
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 1
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 1
- 101001043564 Homo sapiens Prolow-density lipoprotein receptor-related protein 1 Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000884271 Homo sapiens Signal transducer CD24 Proteins 0.000 description 1
- 101000946843 Homo sapiens T-cell surface glycoprotein CD8 alpha chain Proteins 0.000 description 1
- 101000788172 Homo sapiens Transcription initiation factor TFIID subunit 12 Proteins 0.000 description 1
- 101000830596 Homo sapiens Tumor necrosis factor ligand superfamily member 15 Proteins 0.000 description 1
- 102000002265 Human Growth Hormone Human genes 0.000 description 1
- 108010000521 Human Growth Hormone Proteins 0.000 description 1
- 239000000854 Human Growth Hormone Substances 0.000 description 1
- 241000701085 Human alphaherpesvirus 3 Species 0.000 description 1
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 1
- 229920000663 Hydroxyethyl cellulose Polymers 0.000 description 1
- 239000004354 Hydroxyethyl cellulose Substances 0.000 description 1
- 206010048643 Hypereosinophilic syndrome Diseases 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- 208000010159 IgA glomerulonephritis Diseases 0.000 description 1
- 206010021263 IgA nephropathy Diseases 0.000 description 1
- 208000015617 IgG4-related dacryoadenitis and sialadenitis Diseases 0.000 description 1
- 206010061598 Immunodeficiency Diseases 0.000 description 1
- 208000029462 Immunodeficiency disease Diseases 0.000 description 1
- 206010021531 Impetigo Diseases 0.000 description 1
- 208000004575 Infectious Arthritis Diseases 0.000 description 1
- 206010061218 Inflammation Diseases 0.000 description 1
- 229930010555 Inosine Natural products 0.000 description 1
- UGQMRVRMYYASKQ-KQYNXXCUSA-N Inosine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C2=NC=NC(O)=C2N=C1 UGQMRVRMYYASKQ-KQYNXXCUSA-N 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 108010001127 Insulin Receptor Proteins 0.000 description 1
- 102100036721 Insulin receptor Human genes 0.000 description 1
- 102100022338 Integrin alpha-M Human genes 0.000 description 1
- 102100032999 Integrin beta-3 Human genes 0.000 description 1
- 102000001617 Interferon Receptors Human genes 0.000 description 1
- 108010054267 Interferon Receptors Proteins 0.000 description 1
- 108010014726 Interferon Type I Proteins 0.000 description 1
- 102000002227 Interferon Type I Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 102000003996 Interferon-beta Human genes 0.000 description 1
- 108090000467 Interferon-beta Proteins 0.000 description 1
- 102100027268 Interferon-stimulated gene 20 kDa protein Human genes 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102000003810 Interleukin-18 Human genes 0.000 description 1
- 108090000171 Interleukin-18 Proteins 0.000 description 1
- 102000000588 Interleukin-2 Human genes 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 102000004388 Interleukin-4 Human genes 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 206010061252 Intraocular melanoma Diseases 0.000 description 1
- LPHGQDQBBGAPDZ-UHFFFAOYSA-N Isocaffeine Natural products CN1C(=O)N(C)C(=O)C2=C1N(C)C=N2 LPHGQDQBBGAPDZ-UHFFFAOYSA-N 0.000 description 1
- 102000004195 Isomerases Human genes 0.000 description 1
- 108090000769 Isomerases Proteins 0.000 description 1
- 241000567229 Isospora Species 0.000 description 1
- KJHKTHWMRKYKJE-SUGCFTRWSA-N Kaletra Chemical compound N1([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=2C=CC=CC=2)NC(=O)COC=2C(=CC=CC=2C)C)CC=2C=CC=CC=2)CCCNC1=O KJHKTHWMRKYKJE-SUGCFTRWSA-N 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 229940127176 Ki-4.dgA Drugs 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- 102000003855 L-lactate dehydrogenase Human genes 0.000 description 1
- 108700023483 L-lactate dehydrogenases Proteins 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 1
- 239000005511 L01XE05 - Sorafenib Substances 0.000 description 1
- 239000003798 L01XE11 - Pazopanib Substances 0.000 description 1
- 108010021290 LHRH Receptors Proteins 0.000 description 1
- 102000008238 LHRH Receptors Human genes 0.000 description 1
- 201000010743 Lambert-Eaton myasthenic syndrome Diseases 0.000 description 1
- 208000031671 Large B-Cell Diffuse Lymphoma Diseases 0.000 description 1
- 244000147568 Laurus nobilis Species 0.000 description 1
- 235000017858 Laurus nobilis Nutrition 0.000 description 1
- 241000589248 Legionella Species 0.000 description 1
- 208000007764 Legionnaires' Disease Diseases 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- 241000713666 Lentivirus Species 0.000 description 1
- 206010024229 Leprosy Diseases 0.000 description 1
- 241000589902 Leptospira Species 0.000 description 1
- 206010024305 Leukaemia monocytic Diseases 0.000 description 1
- 241000186781 Listeria Species 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 206010050219 Lumbar radiculopathy Diseases 0.000 description 1
- 229940082819 Luteinizing hormone releasing hormone (LHRH) agonist Drugs 0.000 description 1
- 206010025327 Lymphopenia Diseases 0.000 description 1
- 102000043136 MAP kinase family Human genes 0.000 description 1
- 108091054455 MAP kinase family Proteins 0.000 description 1
- 241000282567 Macaca fascicularis Species 0.000 description 1
- 208000006644 Malignant Fibrous Histiocytoma Diseases 0.000 description 1
- 208000032271 Malignant tumor of penis Diseases 0.000 description 1
- 229920002774 Maltodextrin Polymers 0.000 description 1
- 239000005913 Maltodextrin Substances 0.000 description 1
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 1
- 208000001826 Marfan syndrome Diseases 0.000 description 1
- 102100027754 Mast/stem cell growth factor receptor Kit Human genes 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- 241000712079 Measles morbillivirus Species 0.000 description 1
- 208000009018 Medullary thyroid cancer Diseases 0.000 description 1
- 208000000172 Medulloblastoma Diseases 0.000 description 1
- 206010027202 Meningitis bacterial Diseases 0.000 description 1
- 102100039364 Metalloproteinase inhibitor 1 Human genes 0.000 description 1
- 241000289419 Metatheria Species 0.000 description 1
- 238000006957 Michael reaction Methods 0.000 description 1
- 241001295810 Microsporidium Species 0.000 description 1
- 208000019611 Mikulicz disease Diseases 0.000 description 1
- 208000002462 Mikulicz' Disease Diseases 0.000 description 1
- 102100024193 Mitogen-activated protein kinase 1 Human genes 0.000 description 1
- 229940121849 Mitotic inhibitor Drugs 0.000 description 1
- 229920000881 Modified starch Polymers 0.000 description 1
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 1
- 101000686985 Mouse mammary tumor virus (strain C3H) Protein PR73 Proteins 0.000 description 1
- 208000003445 Mouth Neoplasms Diseases 0.000 description 1
- 208000005647 Mumps Diseases 0.000 description 1
- 241000711386 Mumps virus Species 0.000 description 1
- 101000686934 Mus musculus Prolactin-7D1 Proteins 0.000 description 1
- 241000186359 Mycobacterium Species 0.000 description 1
- 241001467553 Mycobacterium africanum Species 0.000 description 1
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 1
- 241000204031 Mycoplasma Species 0.000 description 1
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 1
- 208000033833 Myelomonocytic Chronic Leukemia Diseases 0.000 description 1
- 208000037538 Myelomonocytic Juvenile Leukemia Diseases 0.000 description 1
- 208000030858 Myofascial Pain Syndromes Diseases 0.000 description 1
- 241000289692 Myrmecophagidae Species 0.000 description 1
- KJHOZAZQWVKILO-UHFFFAOYSA-N N-(diaminomethylidene)-4-morpholinecarboximidamide Chemical compound NC(N)=NC(=N)N1CCOCC1 KJHOZAZQWVKILO-UHFFFAOYSA-N 0.000 description 1
- WHNWPMSKXPGLAX-UHFFFAOYSA-N N-Vinyl-2-pyrrolidone Chemical compound C=CN1CCCC1=O WHNWPMSKXPGLAX-UHFFFAOYSA-N 0.000 description 1
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 1
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 1
- 102000012064 NLR Proteins Human genes 0.000 description 1
- 108091005686 NOD-like receptors Proteins 0.000 description 1
- 241000224436 Naegleria Species 0.000 description 1
- 241000224438 Naegleria fowleri Species 0.000 description 1
- 241000588653 Neisseria Species 0.000 description 1
- 108010032605 Nerve Growth Factor Receptors Proteins 0.000 description 1
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 1
- 241001126829 Nosema Species 0.000 description 1
- MSHZHSPISPJWHW-UHFFFAOYSA-N O-(chloroacetylcarbamoyl)fumagillol Chemical compound O1C(CC=C(C)C)C1(C)C1C(OC)C(OC(=O)NC(=O)CCl)CCC21CO2 MSHZHSPISPJWHW-UHFFFAOYSA-N 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 208000010191 Osteitis Deformans Diseases 0.000 description 1
- 206010031264 Osteonecrosis Diseases 0.000 description 1
- 102000004264 Osteopontin Human genes 0.000 description 1
- 108010081689 Osteopontin Proteins 0.000 description 1
- 208000001132 Osteoporosis Diseases 0.000 description 1
- 240000007019 Oxalis corniculata Species 0.000 description 1
- 108091008606 PDGF receptors Proteins 0.000 description 1
- 102000038030 PI3Ks Human genes 0.000 description 1
- 108091007960 PI3Ks Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 208000027868 Paget disease Diseases 0.000 description 1
- 241001631646 Papillomaviridae Species 0.000 description 1
- 208000002606 Paramyxoviridae Infections Diseases 0.000 description 1
- 208000000821 Parathyroid Neoplasms Diseases 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- 241000721454 Pemphigus Species 0.000 description 1
- JNTOCHDNEULJHD-UHFFFAOYSA-N Penciclovir Chemical compound N1C(N)=NC(=O)C2=C1N(CCC(CO)CO)C=N2 JNTOCHDNEULJHD-UHFFFAOYSA-N 0.000 description 1
- 208000002471 Penile Neoplasms Diseases 0.000 description 1
- 206010034299 Penile cancer Diseases 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- 108010043958 Peptoids Proteins 0.000 description 1
- 206010034464 Periarthritis Diseases 0.000 description 1
- 241000283089 Perissodactyla Species 0.000 description 1
- 241000009328 Perro Species 0.000 description 1
- 241000283216 Phocidae Species 0.000 description 1
- 108010064785 Phospholipases Proteins 0.000 description 1
- 102000015439 Phospholipases Human genes 0.000 description 1
- 208000002163 Phyllodes Tumor Diseases 0.000 description 1
- 206010071776 Phyllodes tumour Diseases 0.000 description 1
- 201000007286 Pilocytic astrocytoma Diseases 0.000 description 1
- 231100000742 Plant toxin Toxicity 0.000 description 1
- 102100024616 Platelet endothelial cell adhesion molecule Human genes 0.000 description 1
- 102000004211 Platelet factor 4 Human genes 0.000 description 1
- 108090000778 Platelet factor 4 Proteins 0.000 description 1
- 102000011653 Platelet-Derived Growth Factor Receptors Human genes 0.000 description 1
- 241001492488 Pleistophora Species 0.000 description 1
- 201000007288 Pleomorphic xanthoastrocytoma Diseases 0.000 description 1
- 208000021738 Plummer disease Diseases 0.000 description 1
- 241000233870 Pneumocystis Species 0.000 description 1
- 206010035664 Pneumonia Diseases 0.000 description 1
- 208000000474 Poliomyelitis Diseases 0.000 description 1
- 229920001305 Poly(isodecyl(meth)acrylate) Polymers 0.000 description 1
- 229920002319 Poly(methyl acrylate) Polymers 0.000 description 1
- 239000004952 Polyamide Substances 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 229920000148 Polycarbophil calcium Polymers 0.000 description 1
- 206010065159 Polychondritis Diseases 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 229920001710 Polyorthoester Polymers 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 239000004372 Polyvinyl alcohol Substances 0.000 description 1
- 206010065857 Primary Effusion Lymphoma Diseases 0.000 description 1
- 206010036711 Primary mediastinal large B-cell lymphomas Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 241000283080 Proboscidea <mammal> Species 0.000 description 1
- RJKFOVLPORLFTN-LEKSSAKUSA-N Progesterone Chemical class C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 RJKFOVLPORLFTN-LEKSSAKUSA-N 0.000 description 1
- 102100021923 Prolow-density lipoprotein receptor-related protein 1 Human genes 0.000 description 1
- 102000015433 Prostaglandin Receptors Human genes 0.000 description 1
- 108010050183 Prostaglandin Receptors Proteins 0.000 description 1
- 102000003923 Protein Kinase C Human genes 0.000 description 1
- 108090000315 Protein Kinase C Proteins 0.000 description 1
- 108010026552 Proteome Proteins 0.000 description 1
- 102100027378 Prothrombin Human genes 0.000 description 1
- 108010094028 Prothrombin Proteins 0.000 description 1
- 108010014608 Proto-Oncogene Proteins c-kit Proteins 0.000 description 1
- 102000016971 Proto-Oncogene Proteins c-kit Human genes 0.000 description 1
- 102000008022 Proto-Oncogene Proteins c-met Human genes 0.000 description 1
- 108010089836 Proto-Oncogene Proteins c-met Proteins 0.000 description 1
- 101900161471 Pseudomonas aeruginosa Exotoxin A Proteins 0.000 description 1
- 201000004681 Psoriasis Diseases 0.000 description 1
- CZPWVGJYEJSRLH-UHFFFAOYSA-N Pyrimidine Chemical compound C1=CN=CN=C1 CZPWVGJYEJSRLH-UHFFFAOYSA-N 0.000 description 1
- 208000003782 Raynaud disease Diseases 0.000 description 1
- 102000004278 Receptor Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000873 Receptor Protein-Tyrosine Kinases Proteins 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 206010038111 Recurrent cancer Diseases 0.000 description 1
- 206010070308 Refractory cancer Diseases 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 102400001051 Restin Human genes 0.000 description 1
- 208000025747 Rheumatic disease Diseases 0.000 description 1
- IWUCXVSUMQZMFG-AFCXAGJDSA-N Ribavirin Chemical compound N1=C(C(=O)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 IWUCXVSUMQZMFG-AFCXAGJDSA-N 0.000 description 1
- 108010039491 Ricin Proteins 0.000 description 1
- 241000606701 Rickettsia Species 0.000 description 1
- NCDNCNXCDXHOMX-UHFFFAOYSA-N Ritonavir Natural products C=1C=CC=CC=1CC(NC(=O)OCC=1SC=NC=1)C(O)CC(CC=1C=CC=CC=1)NC(=O)C(C(C)C)NC(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-UHFFFAOYSA-N 0.000 description 1
- 241000283984 Rodentia Species 0.000 description 1
- 241000710799 Rubella virus Species 0.000 description 1
- 108010005173 SERPIN-B5 Proteins 0.000 description 1
- 108010084592 Saporins Proteins 0.000 description 1
- 208000008765 Sciatica Diseases 0.000 description 1
- 102100030333 Serpin B5 Human genes 0.000 description 1
- 102100038081 Signal transducer CD24 Human genes 0.000 description 1
- 241000580858 Simian-Human immunodeficiency virus Species 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 1
- UIIMBOGNXHQVGW-DEQYMQKBSA-M Sodium bicarbonate-14C Chemical compound [Na+].O[14C]([O-])=O UIIMBOGNXHQVGW-DEQYMQKBSA-M 0.000 description 1
- 102000004584 Somatomedin Receptors Human genes 0.000 description 1
- 108010017622 Somatomedin Receptors Proteins 0.000 description 1
- 108010068542 Somatotropin Receptors Proteins 0.000 description 1
- 241001279361 Stachybotrys Species 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- XNKLLVCARDGLGL-JGVFFNPUSA-N Stavudine Chemical compound O=C1NC(=O)C(C)=CN1[C@H]1C=C[C@@H](CO)O1 XNKLLVCARDGLGL-JGVFFNPUSA-N 0.000 description 1
- 235000021355 Stearic acid Nutrition 0.000 description 1
- 206010072148 Stiff-Person syndrome Diseases 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 241000193996 Streptococcus pyogenes Species 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 238000010459 TALEN Methods 0.000 description 1
- 108010076818 TEV protease Proteins 0.000 description 1
- 208000001106 Takayasu Arteritis Diseases 0.000 description 1
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 1
- 208000002240 Tennis Elbow Diseases 0.000 description 1
- 235000005212 Terminalia tomentosa Nutrition 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010071574 Testicular autoimmunity Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 102100036407 Thioredoxin Human genes 0.000 description 1
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 102000002938 Thrombospondin Human genes 0.000 description 1
- 108060008245 Thrombospondin Proteins 0.000 description 1
- 208000026317 Tietze syndrome Diseases 0.000 description 1
- 208000002474 Tinea Diseases 0.000 description 1
- 201000010618 Tinea cruris Diseases 0.000 description 1
- SUJUHGSWHZTSEU-UHFFFAOYSA-N Tipranavir Natural products C1C(O)=C(C(CC)C=2C=C(NS(=O)(=O)C=3N=CC(=CC=3)C(F)(F)F)C=CC=2)C(=O)OC1(CCC)CCC1=CC=CC=C1 SUJUHGSWHZTSEU-UHFFFAOYSA-N 0.000 description 1
- 108020000411 Toll-like receptor Proteins 0.000 description 1
- 102000002689 Toll-like receptor Human genes 0.000 description 1
- IWEQQRMGNVVKQW-OQKDUQJOSA-N Toremifene citrate Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O.C1=CC(OCCN(C)C)=CC=C1C(\C=1C=CC=CC=1)=C(\CCCl)C1=CC=CC=C1 IWEQQRMGNVVKQW-OQKDUQJOSA-N 0.000 description 1
- 206010044242 Toxic nodular goitre Diseases 0.000 description 1
- 241001249162 Trachipleistophora Species 0.000 description 1
- 241001249135 Trachipleistophora hominis Species 0.000 description 1
- 229920001615 Tragacanth Polymers 0.000 description 1
- 108010043645 Transcription Activator-Like Effector Nucleases Proteins 0.000 description 1
- 108010048999 Transcription Factor 3 Proteins 0.000 description 1
- 108010048992 Transcription Factor 4 Proteins 0.000 description 1
- 102100023489 Transcription factor 4 Human genes 0.000 description 1
- 102100038313 Transcription factor E2-alpha Human genes 0.000 description 1
- 102100025171 Transcription initiation factor TFIID subunit 12 Human genes 0.000 description 1
- 108060008539 Transglutaminase Proteins 0.000 description 1
- 241000589886 Treponema Species 0.000 description 1
- 241000893966 Trichophyton verrucosum Species 0.000 description 1
- 206010044654 Trigger finger Diseases 0.000 description 1
- 208000003721 Triple Negative Breast Neoplasms Diseases 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 1
- 102100024587 Tumor necrosis factor ligand superfamily member 15 Human genes 0.000 description 1
- 102100033725 Tumor necrosis factor receptor superfamily member 16 Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 1
- 208000037386 Typhoid Diseases 0.000 description 1
- 208000015778 Undifferentiated pleomorphic sarcoma Diseases 0.000 description 1
- 208000023915 Ureteral Neoplasms Diseases 0.000 description 1
- 206010046458 Urethral neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 201000005969 Uveal melanoma Diseases 0.000 description 1
- 206010046851 Uveitis Diseases 0.000 description 1
- 208000036826 VIIth nerve paralysis Diseases 0.000 description 1
- 208000037009 Vaginitis bacterial Diseases 0.000 description 1
- HDOVUKNUBWVHOX-QMMMGPOBSA-N Valacyclovir Chemical compound N1C(N)=NC(=O)C2=C1N(COCCOC(=O)[C@@H](N)C(C)C)C=N2 HDOVUKNUBWVHOX-QMMMGPOBSA-N 0.000 description 1
- 206010046980 Varicella Diseases 0.000 description 1
- 108010053096 Vascular Endothelial Growth Factor Receptor-1 Proteins 0.000 description 1
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 1
- 102100033178 Vascular endothelial growth factor receptor 1 Human genes 0.000 description 1
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 1
- 206010047115 Vasculitis Diseases 0.000 description 1
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 1
- 208000014070 Vestibular schwannoma Diseases 0.000 description 1
- 241000607598 Vibrio Species 0.000 description 1
- OIRDTQYFTABQOQ-UHTZMRCNSA-N Vidarabine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1O OIRDTQYFTABQOQ-UHTZMRCNSA-N 0.000 description 1
- 206010047623 Vitamin C deficiency Diseases 0.000 description 1
- 206010047642 Vitiligo Diseases 0.000 description 1
- 241000144556 Vittaforma Species 0.000 description 1
- 241000144554 Vittaforma corneae Species 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- 208000004354 Vulvar Neoplasms Diseases 0.000 description 1
- 208000033559 Waldenström macroglobulinemia Diseases 0.000 description 1
- 208000000260 Warts Diseases 0.000 description 1
- 208000027207 Whipple disease Diseases 0.000 description 1
- 241000607734 Yersinia <bacteria> Species 0.000 description 1
- 108010017070 Zinc Finger Nucleases Proteins 0.000 description 1
- UYRDHEJRPVSJFM-VSWVFQEASA-N [(1s,3r)-3-hydroxy-4-[(3e,5e,7e,9e,11z)-11-[4-[(e)-2-[(1r,3s,6s)-3-hydroxy-1,5,5-trimethyl-7-oxabicyclo[4.1.0]heptan-6-yl]ethenyl]-5-oxofuran-2-ylidene]-3,10-dimethylundeca-1,3,5,7,9-pentaenylidene]-3,5,5-trimethylcyclohexyl] acetate Chemical compound C[C@@]1(O)C[C@@H](OC(=O)C)CC(C)(C)C1=C=C\C(C)=C\C=C\C=C\C=C(/C)\C=C/1C=C(\C=C\[C@]23[C@@](O2)(C)C[C@@H](O)CC3(C)C)C(=O)O\1 UYRDHEJRPVSJFM-VSWVFQEASA-N 0.000 description 1
- NNLVGZFZQQXQNW-ADJNRHBOSA-N [(2r,3r,4s,5r,6s)-4,5-diacetyloxy-3-[(2s,3r,4s,5r,6r)-3,4,5-triacetyloxy-6-(acetyloxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6s)-4,5,6-triacetyloxy-2-(acetyloxymethyl)oxan-3-yl]oxyoxan-2-yl]methyl acetate Chemical compound O([C@@H]1O[C@@H]([C@H]([C@H](OC(C)=O)[C@H]1OC(C)=O)O[C@H]1[C@@H]([C@@H](OC(C)=O)[C@H](OC(C)=O)[C@@H](COC(C)=O)O1)OC(C)=O)COC(=O)C)[C@@H]1[C@@H](COC(C)=O)O[C@@H](OC(C)=O)[C@H](OC(C)=O)[C@H]1OC(C)=O NNLVGZFZQQXQNW-ADJNRHBOSA-N 0.000 description 1
- DLGSOJOOYHWROO-WQLSENKSSA-N [(z)-(1-methyl-2-oxoindol-3-ylidene)amino]thiourea Chemical compound C1=CC=C2N(C)C(=O)\C(=N/NC(N)=S)C2=C1 DLGSOJOOYHWROO-WQLSENKSSA-N 0.000 description 1
- GLWHPRRGGYLLRV-XLPZGREQSA-N [[(2s,3s,5r)-3-azido-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)[C@@H](N=[N+]=[N-])C1 GLWHPRRGGYLLRV-XLPZGREQSA-N 0.000 description 1
- 229960004748 abacavir Drugs 0.000 description 1
- MCGSCOLBFJQGHM-SCZZXKLOSA-N abacavir Chemical compound C=12N=CN([C@H]3C=C[C@@H](CO)C3)C2=NC(N)=NC=1NC1CC1 MCGSCOLBFJQGHM-SCZZXKLOSA-N 0.000 description 1
- 210000001015 abdomen Anatomy 0.000 description 1
- 238000002679 ablation Methods 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 239000008351 acetate buffer Substances 0.000 description 1
- DPXJVFZANSGRMM-UHFFFAOYSA-N acetic acid;2,3,4,5,6-pentahydroxyhexanal;sodium Chemical compound [Na].CC(O)=O.OCC(O)C(O)C(O)C(O)C=O DPXJVFZANSGRMM-UHFFFAOYSA-N 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 208000004064 acoustic neuroma Diseases 0.000 description 1
- NIXOWILDQLNWCW-UHFFFAOYSA-N acrylic acid group Chemical group C(C=C)(=O)O NIXOWILDQLNWCW-UHFFFAOYSA-N 0.000 description 1
- 208000009621 actinic keratosis Diseases 0.000 description 1
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 1
- 230000003213 activating effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000013543 active substance Substances 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 208000021841 acute erythroid leukemia Diseases 0.000 description 1
- 230000033289 adaptive immune response Effects 0.000 description 1
- 238000007792 addition Methods 0.000 description 1
- 229960001997 adefovir Drugs 0.000 description 1
- WOZSCQDILHKSGG-UHFFFAOYSA-N adefovir depivoxil Chemical compound N1=CN=C2N(CCOCP(=O)(OCOC(=O)C(C)(C)C)OCOC(=O)C(C)(C)C)C=NC2=C1N WOZSCQDILHKSGG-UHFFFAOYSA-N 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 208000024447 adrenal gland neoplasm Diseases 0.000 description 1
- 239000000443 aerosol Substances 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 210000004712 air sac Anatomy 0.000 description 1
- 230000001476 alcoholic effect Effects 0.000 description 1
- 229960000548 alemtuzumab Drugs 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 239000000783 alginic acid Substances 0.000 description 1
- 229960001126 alginic acid Drugs 0.000 description 1
- 150000004781 alginic acids Chemical class 0.000 description 1
- 229910001508 alkali metal halide Inorganic materials 0.000 description 1
- 150000008045 alkali metal halides Chemical class 0.000 description 1
- 229920013820 alkyl cellulose Polymers 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 125000002947 alkylene group Chemical group 0.000 description 1
- 208000004631 alopecia areata Diseases 0.000 description 1
- 210000002203 alpha-beta t lymphocyte Anatomy 0.000 description 1
- 229960000473 altretamine Drugs 0.000 description 1
- SNAAJJQQZSMGQD-UHFFFAOYSA-N aluminum magnesium Chemical compound [Mg].[Al] SNAAJJQQZSMGQD-UHFFFAOYSA-N 0.000 description 1
- 208000008524 alveolar soft part sarcoma Diseases 0.000 description 1
- 229960003805 amantadine Drugs 0.000 description 1
- DKNWSYNQZKUICI-UHFFFAOYSA-N amantadine Chemical compound C1C(C2)CC3CC2CC1(N)C3 DKNWSYNQZKUICI-UHFFFAOYSA-N 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 125000002344 aminooxy group Chemical group [H]N([H])O[*] 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 229960001830 amprenavir Drugs 0.000 description 1
- YMARZQAQMVYCKC-OEMFJLHTSA-N amprenavir Chemical compound C([C@@H]([C@H](O)CN(CC(C)C)S(=O)(=O)C=1C=CC(N)=CC=1)NC(=O)O[C@@H]1COCC1)C1=CC=CC=C1 YMARZQAQMVYCKC-OEMFJLHTSA-N 0.000 description 1
- 206010002022 amyloidosis Diseases 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 229960002932 anastrozole Drugs 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 230000000964 angiostatic effect Effects 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 231100000659 animal toxin Toxicity 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 230000002280 anti-androgenic effect Effects 0.000 description 1
- 229940046836 anti-estrogen Drugs 0.000 description 1
- 230000001833 anti-estrogenic effect Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 230000002788 anti-peptide Effects 0.000 description 1
- 230000000798 anti-retroviral effect Effects 0.000 description 1
- 230000000656 anti-yeast Effects 0.000 description 1
- 239000000051 antiandrogen Substances 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 229960005348 antithrombin iii Drugs 0.000 description 1
- 239000008365 aqueous carrier Substances 0.000 description 1
- 210000001742 aqueous humor Anatomy 0.000 description 1
- 239000003125 aqueous solvent Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 235000009697 arginine Nutrition 0.000 description 1
- 229940078010 arimidex Drugs 0.000 description 1
- 229940087620 aromasin Drugs 0.000 description 1
- 239000003886 aromatase inhibitor Substances 0.000 description 1
- 238000007080 aromatic substitution reaction Methods 0.000 description 1
- GOLCXWYRSKYTSP-UHFFFAOYSA-N arsenic trioxide Inorganic materials O1[As]2O[As]1O2 GOLCXWYRSKYTSP-UHFFFAOYSA-N 0.000 description 1
- QTLQKAJBUDWPIB-UHFFFAOYSA-N arsenic(3+);oxygen(2-) Chemical compound [O-2].[O-2].[O-2].[As+3].[As+3] QTLQKAJBUDWPIB-UHFFFAOYSA-N 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 description 1
- 229960003277 atazanavir Drugs 0.000 description 1
- AXRYRYVKAWYZBR-GASGPIRDSA-N atazanavir Chemical compound C([C@H](NC(=O)[C@@H](NC(=O)OC)C(C)(C)C)[C@@H](O)CN(CC=1C=CC(=CC=1)C=1N=CC=CC=1)NC(=O)[C@@H](NC(=O)OC)C(C)(C)C)C1=CC=CC=C1 AXRYRYVKAWYZBR-GASGPIRDSA-N 0.000 description 1
- 229940030457 atralin Drugs 0.000 description 1
- 229940068561 atripla Drugs 0.000 description 1
- 108010044540 auristatin Proteins 0.000 description 1
- 201000000448 autoimmune hemolytic anemia Diseases 0.000 description 1
- 208000037979 autoimmune inflammatory disease Diseases 0.000 description 1
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 201000009904 bacterial meningitis Diseases 0.000 description 1
- 239000000440 bentonite Substances 0.000 description 1
- 229910000278 bentonite Inorganic materials 0.000 description 1
- SVPXDRXYRYOSEX-UHFFFAOYSA-N bentoquatam Chemical compound O.O=[Si]=O.O=[Al]O[Al]=O SVPXDRXYRYOSEX-UHFFFAOYSA-N 0.000 description 1
- 229960000686 benzalkonium chloride Drugs 0.000 description 1
- CADWTSSKOVRVJC-UHFFFAOYSA-N benzyl(dimethyl)azanium;chloride Chemical compound [Cl-].C[NH+](C)CC1=CC=CC=C1 CADWTSSKOVRVJC-UHFFFAOYSA-N 0.000 description 1
- WHGYBXFWUBPSRW-FOUAGVGXSA-N beta-cyclodextrin Chemical compound OC[C@H]([C@H]([C@@H]([C@H]1O)O)O[C@H]2O[C@@H]([C@@H](O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](CO)[C@H]([C@@H]([C@H]3O)O)O3)[C@H](O)[C@H]2O)CO)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H]3O[C@@H]1CO WHGYBXFWUBPSRW-FOUAGVGXSA-N 0.000 description 1
- 235000011175 beta-cyclodextrine Nutrition 0.000 description 1
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 1
- 229960004853 betadex Drugs 0.000 description 1
- 229960002938 bexarotene Drugs 0.000 description 1
- 229960000997 bicalutamide Drugs 0.000 description 1
- 230000002146 bilateral effect Effects 0.000 description 1
- 239000012867 bioactive agent Substances 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 239000012620 biological material Substances 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 229960001467 bortezomib Drugs 0.000 description 1
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 1
- 229960000455 brentuximab vedotin Drugs 0.000 description 1
- 210000000621 bronchi Anatomy 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 239000006172 buffering agent Substances 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- DQXBYHZEEUGOBF-UHFFFAOYSA-N but-3-enoic acid;ethene Chemical compound C=C.OC(=O)CC=C DQXBYHZEEUGOBF-UHFFFAOYSA-N 0.000 description 1
- 229960001948 caffeine Drugs 0.000 description 1
- VJEONQKOZGKCAK-UHFFFAOYSA-N caffeine Natural products CN1C(=O)N(C)C(=O)C2=C1C=CN2C VJEONQKOZGKCAK-UHFFFAOYSA-N 0.000 description 1
- 229910000019 calcium carbonate Inorganic materials 0.000 description 1
- FUFJGUQYACFECW-UHFFFAOYSA-L calcium hydrogenphosphate Chemical compound [Ca+2].OP([O-])([O-])=O FUFJGUQYACFECW-UHFFFAOYSA-L 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- BPKIGYQJPYCAOW-FFJTTWKXSA-I calcium;potassium;disodium;(2s)-2-hydroxypropanoate;dichloride;dihydroxide;hydrate Chemical compound O.[OH-].[OH-].[Na+].[Na+].[Cl-].[Cl-].[K+].[Ca+2].C[C@H](O)C([O-])=O BPKIGYQJPYCAOW-FFJTTWKXSA-I 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 1
- 229930195731 calicheamicin Natural products 0.000 description 1
- 102000028861 calmodulin binding Human genes 0.000 description 1
- 108091000084 calmodulin binding Proteins 0.000 description 1
- 229940088954 camptosar Drugs 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- 229960004562 carboplatin Drugs 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- WNRZHQBJSXRYJK-UHFFFAOYSA-N carboxyamidotriazole Chemical compound NC1=C(C(=O)N)N=NN1CC(C=C1Cl)=CC(Cl)=C1C(=O)C1=CC=C(Cl)C=C1 WNRZHQBJSXRYJK-UHFFFAOYSA-N 0.000 description 1
- 229920003123 carboxymethyl cellulose sodium Polymers 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 229940105329 carboxymethylcellulose Drugs 0.000 description 1
- 229940063834 carboxymethylcellulose sodium Drugs 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 208000003295 carpal tunnel syndrome Diseases 0.000 description 1
- 210000000845 cartilage Anatomy 0.000 description 1
- 208000015100 cartilage disease Diseases 0.000 description 1
- 230000005859 cell recognition Effects 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 230000019522 cellular metabolic process Effects 0.000 description 1
- 229920002301 cellulose acetate Polymers 0.000 description 1
- 229920006217 cellulose acetate butyrate Polymers 0.000 description 1
- 229940081734 cellulose acetate phthalate Drugs 0.000 description 1
- 229920003086 cellulose ether Polymers 0.000 description 1
- 229920006218 cellulose propionate Polymers 0.000 description 1
- 208000025997 central nervous system neoplasm Diseases 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 229960005395 cetuximab Drugs 0.000 description 1
- 125000003636 chemical group Chemical group 0.000 description 1
- 108700010039 chimeric receptor Proteins 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 229960003260 chlorhexidine Drugs 0.000 description 1
- 229930002875 chlorophyll Natural products 0.000 description 1
- 235000019804 chlorophyll Nutrition 0.000 description 1
- ATNHDLDRLWWWCB-AENOIHSZSA-M chlorophyll a Chemical compound C1([C@@H](C(=O)OC)C(=O)C2=C3C)=C2N2C3=CC(C(CC)=C3C)=[N+]4C3=CC3=C(C=C)C(C)=C5N3[Mg-2]42[N+]2=C1[C@@H](CCC(=O)OC\C=C(/C)CCC[C@H](C)CCC[C@H](C)CCCC(C)C)[C@H](C)C2=C5 ATNHDLDRLWWWCB-AENOIHSZSA-M 0.000 description 1
- 208000003167 cholangitis Diseases 0.000 description 1
- 150000001840 cholesterol esters Chemical class 0.000 description 1
- 208000002849 chondrocalcinosis Diseases 0.000 description 1
- 201000005043 chondromalacia Diseases 0.000 description 1
- 208000019069 chronic childhood arthritis Diseases 0.000 description 1
- 208000021668 chronic eosinophilic leukemia Diseases 0.000 description 1
- 201000010902 chronic myelomonocytic leukemia Diseases 0.000 description 1
- 201000010903 chronic neutrophilic leukemia Diseases 0.000 description 1
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 description 1
- 229960000724 cidofovir Drugs 0.000 description 1
- 210000003040 circulating cell Anatomy 0.000 description 1
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 1
- 229960004316 cisplatin Drugs 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- 238000012650 click reaction Methods 0.000 description 1
- 229960000928 clofarabine Drugs 0.000 description 1
- WDDPHFBMKLOVOX-AYQXTPAHSA-N clofarabine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@@H]1F WDDPHFBMKLOVOX-AYQXTPAHSA-N 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 239000000084 colloidal system Substances 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 238000004040 coloring Methods 0.000 description 1
- 229940000425 combination drug Drugs 0.000 description 1
- 229940014461 combivir Drugs 0.000 description 1
- 108010047295 complement receptors Proteins 0.000 description 1
- 102000006834 complement receptors Human genes 0.000 description 1
- 238000010668 complexation reaction Methods 0.000 description 1
- 238000013329 compounding Methods 0.000 description 1
- 239000007891 compressed tablet Substances 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 208000021863 corticosteroid-induced osteoporosis Diseases 0.000 description 1
- 238000006880 cross-coupling reaction Methods 0.000 description 1
- 238000009109 curative therapy Methods 0.000 description 1
- 208000030381 cutaneous melanoma Diseases 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 108010038764 cytoplasmic linker protein 170 Proteins 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 229960000640 dactinomycin Drugs 0.000 description 1
- 229960005107 darunavir Drugs 0.000 description 1
- CJBJHOAVZSMMDJ-HEXNFIEUSA-N darunavir Chemical compound C([C@@H]([C@H](O)CN(CC(C)C)S(=O)(=O)C=1C=CC(N)=CC=1)NC(=O)O[C@@H]1[C@@H]2CCO[C@@H]2OC1)C1=CC=CC=C1 CJBJHOAVZSMMDJ-HEXNFIEUSA-N 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 229960005319 delavirdine Drugs 0.000 description 1
- 201000001981 dermatomyositis Diseases 0.000 description 1
- 201000006827 desmoid tumor Diseases 0.000 description 1
- 208000014906 developmental dysplasia of the hip Diseases 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 229940096516 dextrates Drugs 0.000 description 1
- 229960002656 didanosine Drugs 0.000 description 1
- 201000001727 diffuse idiopathic skeletal hyperostosis Diseases 0.000 description 1
- 208000028919 diffuse intrinsic pontine glioma Diseases 0.000 description 1
- 208000026144 diffuse midline glioma, H3 K27M-mutant Diseases 0.000 description 1
- USIUVYZYUHIAEV-UHFFFAOYSA-N diphenyl ether Chemical class C=1C=CC=CC=1OC1=CC=CC=C1 USIUVYZYUHIAEV-UHFFFAOYSA-N 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 230000008034 disappearance Effects 0.000 description 1
- 208000016097 disease of metabolism Diseases 0.000 description 1
- 229910000397 disodium phosphate Inorganic materials 0.000 description 1
- 235000019800 disodium phosphate Nutrition 0.000 description 1
- 238000010494 dissociation reaction Methods 0.000 description 1
- 230000005593 dissociations Effects 0.000 description 1
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- 229960000735 docosanol Drugs 0.000 description 1
- OFDNQWIFNXBECV-VFSYNPLYSA-N dolastatin 10 Chemical compound CC(C)[C@H](N(C)C)C(=O)N[C@@H](C(C)C)C(=O)N(C)[C@@H]([C@@H](C)CC)[C@H](OC)CC(=O)N1CCC[C@H]1[C@H](OC)[C@@H](C)C(=O)N[C@H](C=1SC=CN=1)CC1=CC=CC=C1 OFDNQWIFNXBECV-VFSYNPLYSA-N 0.000 description 1
- 108010045524 dolastatin 10 Proteins 0.000 description 1
- 231100000673 dose–response relationship Toxicity 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- VQNATVDKACXKTF-XELLLNAOSA-N duocarmycin Chemical compound COC1=C(OC)C(OC)=C2NC(C(=O)N3C4=CC(=O)C5=C([C@@]64C[C@@H]6C3)C=C(N5)C(=O)OC)=CC2=C1 VQNATVDKACXKTF-XELLLNAOSA-N 0.000 description 1
- 229960005501 duocarmycin Drugs 0.000 description 1
- 229930184221 duocarmycin Natural products 0.000 description 1
- 229960002030 edoxudine Drugs 0.000 description 1
- XACKNLSZYYIACO-DJLDLDEBSA-N edoxudine Chemical compound O=C1NC(=O)C(CC)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 XACKNLSZYYIACO-DJLDLDEBSA-N 0.000 description 1
- XPOQHMRABVBWPR-ZDUSSCGKSA-N efavirenz Chemical compound C([C@]1(C2=CC(Cl)=CC=C2NC(=O)O1)C(F)(F)F)#CC1CC1 XPOQHMRABVBWPR-ZDUSSCGKSA-N 0.000 description 1
- 229960003804 efavirenz Drugs 0.000 description 1
- 210000003162 effector t lymphocyte Anatomy 0.000 description 1
- 239000003792 electrolyte Substances 0.000 description 1
- 229960000366 emtricitabine Drugs 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 210000000750 endocrine system Anatomy 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- PEASPLKKXBYDKL-FXEVSJAOSA-N enfuvirtide Chemical compound C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C=CC=CC=1)C(N)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(C)=O)[C@@H](C)O)[C@@H](C)CC)C1=CN=CN1 PEASPLKKXBYDKL-FXEVSJAOSA-N 0.000 description 1
- 229960002062 enfuvirtide Drugs 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 229960000980 entecavir Drugs 0.000 description 1
- YXPVEXCTPGULBZ-WQYNNSOESA-N entecavir hydrate Chemical compound O.C1=NC=2C(=O)NC(N)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)C1=C YXPVEXCTPGULBZ-WQYNNSOESA-N 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000007071 enzymatic hydrolysis Effects 0.000 description 1
- 238000006047 enzymatic hydrolysis reaction Methods 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 102000027412 enzyme-linked receptors Human genes 0.000 description 1
- 108091008592 enzyme-linked receptors Proteins 0.000 description 1
- 210000002615 epidermis Anatomy 0.000 description 1
- YJGVMLPVUAXIQN-UHFFFAOYSA-N epipodophyllotoxin Natural products COC1=C(OC)C(OC)=CC(C2C3=CC=4OCOC=4C=C3C(O)C3C2C(OC3)=O)=C1 YJGVMLPVUAXIQN-UHFFFAOYSA-N 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 230000008029 eradication Effects 0.000 description 1
- 229940082789 erbitux Drugs 0.000 description 1
- 230000003628 erosive effect Effects 0.000 description 1
- 230000000925 erythroid effect Effects 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- 229960001842 estramustine Drugs 0.000 description 1
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 1
- 229940011871 estrogen Drugs 0.000 description 1
- 239000000262 estrogen Substances 0.000 description 1
- 239000000328 estrogen antagonist Substances 0.000 description 1
- BEFDCLMNVWHSGT-UHFFFAOYSA-N ethenylcyclopentane Chemical compound C=CC1CCCC1 BEFDCLMNVWHSGT-UHFFFAOYSA-N 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 239000005038 ethylene vinyl acetate Substances 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 229960005167 everolimus Drugs 0.000 description 1
- 229960000255 exemestane Drugs 0.000 description 1
- 210000002744 extracellular matrix Anatomy 0.000 description 1
- 201000008815 extraosseous osteosarcoma Diseases 0.000 description 1
- 201000001155 extrinsic allergic alveolitis Diseases 0.000 description 1
- 201000001343 fallopian tube carcinoma Diseases 0.000 description 1
- 229960004396 famciclovir Drugs 0.000 description 1
- GGXKWVWZWMLJEH-UHFFFAOYSA-N famcyclovir Chemical compound N1=C(N)N=C2N(CCC(COC(=O)C)COC(C)=O)C=NC2=C1 GGXKWVWZWMLJEH-UHFFFAOYSA-N 0.000 description 1
- 229940043168 fareston Drugs 0.000 description 1
- 229940087861 faslodex Drugs 0.000 description 1
- 229940087476 femara Drugs 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 210000003495 flagella Anatomy 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- 229960002074 flutamide Drugs 0.000 description 1
- 229940014144 folate Drugs 0.000 description 1
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 229960001447 fomivirsen Drugs 0.000 description 1
- XCWFZHPEARLXJI-UHFFFAOYSA-N fomivirsen Chemical compound C1C(N2C3=C(C(NC(N)=N3)=O)N=C2)OC(CO)C1OP(O)(=S)OCC1OC(N(C)C(=O)\N=C(\N)C=C)CC1OP(O)(=S)OCC1OC(N2C3=C(C(NC(N)=N3)=O)N=C2)CC1OP(O)(=S)OCC1OC(N2C(NC(=O)C(C)=C2)=O)CC1OP(O)(=S)OCC1OC(N2C(NC(=O)C(C)=C2)=O)CC1OP(O)(=S)OCC1OC(N2C(NC(=O)C(C)=C2)=O)CC1OP(O)(=S)OCC1OC(N2C3=C(C(NC(N)=N3)=O)N=C2)CC1OP(O)(=S)OCC1OC(N2C(N=C(N)C=C2)=O)CC1OP(O)(=S)OCC(C(C1)OP(S)(=O)OCC2C(CC(O2)N2C(N=C(N)C=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C(NC(=O)C(C)=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)OP(O)(=S)OCC2C(CC(O2)N2C(N=C(N)C=C2)=O)OP(O)(=S)OCC2C(CC(O2)N2C3=C(C(NC(N)=N3)=O)N=C2)O)OC1N1C=C(C)C(=O)NC1=O XCWFZHPEARLXJI-UHFFFAOYSA-N 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 229960003142 fosamprenavir Drugs 0.000 description 1
- MLBVMOWEQCZNCC-OEMFJLHTSA-N fosamprenavir Chemical compound C([C@@H]([C@H](OP(O)(O)=O)CN(CC(C)C)S(=O)(=O)C=1C=CC(N)=CC=1)NC(=O)O[C@@H]1COCC1)C1=CC=CC=C1 MLBVMOWEQCZNCC-OEMFJLHTSA-N 0.000 description 1
- 229960005102 foscarnet Drugs 0.000 description 1
- 229940112424 fosfonet Drugs 0.000 description 1
- 201000010603 frozen shoulder Diseases 0.000 description 1
- 229960002258 fulvestrant Drugs 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- ZZUFCTLCJUWOSV-UHFFFAOYSA-N furosemide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C(O)=O)=C1NCC1=CC=CO1 ZZUFCTLCJUWOSV-UHFFFAOYSA-N 0.000 description 1
- 230000004927 fusion Effects 0.000 description 1
- 229940125777 fusion inhibitor Drugs 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 229960000578 gemtuzumab Drugs 0.000 description 1
- 229940020967 gemzar Drugs 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 210000004907 gland Anatomy 0.000 description 1
- 235000001727 glucose Nutrition 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- 229960002989 glutamic acid Drugs 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 235000004554 glutamine Nutrition 0.000 description 1
- 235000011187 glycerol Nutrition 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 229960002913 goserelin Drugs 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 239000000665 guar gum Substances 0.000 description 1
- 235000010417 guar gum Nutrition 0.000 description 1
- 229960002154 guar gum Drugs 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 208000005252 hepatitis A Diseases 0.000 description 1
- 208000002672 hepatitis B Diseases 0.000 description 1
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 1
- 230000003054 hormonal effect Effects 0.000 description 1
- 108091008039 hormone receptors Proteins 0.000 description 1
- 229940099552 hyaluronan Drugs 0.000 description 1
- KIUKXJAPPMFGSW-MNSSHETKSA-N hyaluronan Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)C1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H](C(O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-MNSSHETKSA-N 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- 229940088013 hycamtin Drugs 0.000 description 1
- 229960000890 hydrocortisone Drugs 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 229920013821 hydroxy alkyl cellulose Polymers 0.000 description 1
- 235000019447 hydroxyethyl cellulose Nutrition 0.000 description 1
- 229940071826 hydroxyethyl cellulose Drugs 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 229940071676 hydroxypropylcellulose Drugs 0.000 description 1
- 208000022098 hypersensitivity pneumonitis Diseases 0.000 description 1
- WEVJJMPVVFNAHZ-RRKCRQDMSA-N ibacitabine Chemical compound C1=C(I)C(N)=NC(=O)N1[C@@H]1O[C@H](CO)[C@@H](O)C1 WEVJJMPVVFNAHZ-RRKCRQDMSA-N 0.000 description 1
- 229960000374 ibacitabine Drugs 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- 229960004716 idoxuridine Drugs 0.000 description 1
- 229960001101 ifosfamide Drugs 0.000 description 1
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 1
- 229960002751 imiquimod Drugs 0.000 description 1
- DOUYETYNHWVLEO-UHFFFAOYSA-N imiquimod Chemical compound C1=CC=CC2=C3N(CC(C)C)C=NC3=C(N)N=C21 DOUYETYNHWVLEO-UHFFFAOYSA-N 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 230000007813 immunodeficiency Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000011503 in vivo imaging Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- 229960001936 indinavir Drugs 0.000 description 1
- CBVCZFGXHXORBI-PXQQMZJSSA-N indinavir Chemical compound C([C@H](N(CC1)C[C@@H](O)C[C@@H](CC=2C=CC=CC=2)C(=O)N[C@H]2C3=CC=CC=C3C[C@H]2O)C(=O)NC(C)(C)C)N1CC1=CC=CN=C1 CBVCZFGXHXORBI-PXQQMZJSSA-N 0.000 description 1
- 239000003701 inert diluent Substances 0.000 description 1
- 239000011261 inert gas Substances 0.000 description 1
- 230000008595 infiltration Effects 0.000 description 1
- 238000001764 infiltration Methods 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000004054 inflammatory process Effects 0.000 description 1
- 206010022000 influenza Diseases 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 229960003786 inosine Drugs 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 229940124524 integrase inhibitor Drugs 0.000 description 1
- 239000002850 integrase inhibitor Substances 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 108010018844 interferon type III Proteins 0.000 description 1
- 229940028894 interferon type ii Drugs 0.000 description 1
- 229960001388 interferon-beta Drugs 0.000 description 1
- 108010093036 interleukin receptors Proteins 0.000 description 1
- 102000002467 interleukin receptors Human genes 0.000 description 1
- 238000001361 intraarterial administration Methods 0.000 description 1
- 238000000185 intracerebroventricular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 208000026876 intravascular large B-cell lymphoma Diseases 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 239000002563 ionic surfactant Substances 0.000 description 1
- 150000002500 ions Chemical class 0.000 description 1
- 229960005386 ipilimumab Drugs 0.000 description 1
- 208000002551 irritable bowel syndrome Diseases 0.000 description 1
- 229960004130 itraconazole Drugs 0.000 description 1
- FABUFPQFXZVHFB-CFWQTKTJSA-N ixabepilone Chemical compound C/C([C@@H]1C[C@@H]2O[C@]2(C)CCC[C@@H]([C@@H]([C@H](C)C(=O)C(C)(C)[C@H](O)CC(=O)N1)O)C)=C\C1=CSC(C)=N1 FABUFPQFXZVHFB-CFWQTKTJSA-N 0.000 description 1
- 229960002014 ixabepilone Drugs 0.000 description 1
- 238000005304 joining Methods 0.000 description 1
- 230000000366 juvenile effect Effects 0.000 description 1
- 201000005992 juvenile myelomonocytic leukemia Diseases 0.000 description 1
- 210000000244 kidney pelvis Anatomy 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000004310 lactic acid Substances 0.000 description 1
- 235000014655 lactic acid Nutrition 0.000 description 1
- JJTUDXZGHPGLLC-UHFFFAOYSA-N lactide Chemical compound CC1OC(=O)C(C)OC1=O JJTUDXZGHPGLLC-UHFFFAOYSA-N 0.000 description 1
- 229960001627 lamivudine Drugs 0.000 description 1
- JTEGQNOMFQHVDC-NKWVEPMBSA-N lamivudine Chemical compound O=C1N=C(N)C=CN1[C@H]1O[C@@H](CO)SC1 JTEGQNOMFQHVDC-NKWVEPMBSA-N 0.000 description 1
- 208000003849 large cell carcinoma Diseases 0.000 description 1
- 238000002647 laser therapy Methods 0.000 description 1
- 235000010445 lecithin Nutrition 0.000 description 1
- 239000000787 lecithin Substances 0.000 description 1
- 229940067606 lecithin Drugs 0.000 description 1
- 229960003881 letrozole Drugs 0.000 description 1
- GFIJNRVAKGFPGQ-LIJARHBVSA-N leuprolide Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 GFIJNRVAKGFPGQ-LIJARHBVSA-N 0.000 description 1
- RGLRXNKKBLIBQS-XNHQSDQCSA-N leuprolide acetate Chemical compound CC(O)=O.CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 RGLRXNKKBLIBQS-XNHQSDQCSA-N 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- 125000005645 linoleyl group Chemical group 0.000 description 1
- 208000012987 lip and oral cavity carcinoma Diseases 0.000 description 1
- 125000003473 lipid group Chemical group 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 229960004525 lopinavir Drugs 0.000 description 1
- CJPLEFFCVDQQFZ-UHFFFAOYSA-N loviride Chemical compound CC(=O)C1=CC=C(C)C=C1NC(C(N)=O)C1=C(Cl)C=CC=C1Cl CJPLEFFCVDQQFZ-UHFFFAOYSA-N 0.000 description 1
- 229950006243 loviride Drugs 0.000 description 1
- 208000022080 low-grade astrocytoma Diseases 0.000 description 1
- 229940087857 lupron Drugs 0.000 description 1
- 208000012804 lymphangiosarcoma Diseases 0.000 description 1
- 230000001926 lymphatic effect Effects 0.000 description 1
- 208000003747 lymphoid leukemia Diseases 0.000 description 1
- 208000006116 lymphomatoid granulomatosis Diseases 0.000 description 1
- 231100001023 lymphopenia Toxicity 0.000 description 1
- 208000025036 lymphosarcoma Diseases 0.000 description 1
- 201000000564 macroglobulinemia Diseases 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000007257 malfunction Effects 0.000 description 1
- 229940035034 maltodextrin Drugs 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 208000027202 mammary Paget disease Diseases 0.000 description 1
- 229960004710 maraviroc Drugs 0.000 description 1
- GSNHKUDZZFZSJB-QYOOZWMWSA-N maraviroc Chemical compound CC(C)C1=NN=C(C)N1[C@@H]1C[C@H](N2CC[C@H](NC(=O)C3CCC(F)(F)CC3)C=3C=CC=CC=3)CC[C@H]2C1 GSNHKUDZZFZSJB-QYOOZWMWSA-N 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 1
- 229940090004 megace Drugs 0.000 description 1
- 229960004296 megestrol acetate Drugs 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 210000002418 meninge Anatomy 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 229960005558 mertansine Drugs 0.000 description 1
- 208000030159 metabolic disease Diseases 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 239000003475 metalloproteinase inhibitor Substances 0.000 description 1
- 238000005649 metathesis reaction Methods 0.000 description 1
- 125000005395 methacrylic acid group Chemical group 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- YLGXILFCIXHCMC-JHGZEJCSSA-N methyl cellulose Chemical compound COC1C(OC)C(OC)C(COC)O[C@H]1O[C@H]1C(OC)C(OC)C(OC)OC1COC YLGXILFCIXHCMC-JHGZEJCSSA-N 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- 229960004584 methylprednisolone Drugs 0.000 description 1
- 229960003152 metisazone Drugs 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 239000003094 microcapsule Substances 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 102000035118 modified proteins Human genes 0.000 description 1
- 108091005573 modified proteins Proteins 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 201000006894 monocytic leukemia Diseases 0.000 description 1
- 108010093470 monomethyl auristatin E Proteins 0.000 description 1
- 108010059074 monomethylauristatin F Proteins 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 229960005389 moroxydine Drugs 0.000 description 1
- 230000000921 morphogenic effect Effects 0.000 description 1
- 208000010805 mumps infectious disease Diseases 0.000 description 1
- 208000029766 myalgic encephalomeyelitis/chronic fatigue syndrome Diseases 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- NZXVYLJKFYSEPO-UHFFFAOYSA-N n-[3-(dimethylamino)propyl]-16-methylheptadecanamide Chemical compound CC(C)CCCCCCCCCCCCCCC(=O)NCCCN(C)C NZXVYLJKFYSEPO-UHFFFAOYSA-N 0.000 description 1
- 229950006780 n-acetylglucosamine Drugs 0.000 description 1
- 229960000884 nelfinavir Drugs 0.000 description 1
- QAGYKUNXZHXKMR-HKWSIXNMSA-N nelfinavir Chemical compound CC1=C(O)C=CC=C1C(=O)N[C@H]([C@H](O)CN1[C@@H](C[C@@H]2CCCC[C@@H]2C1)C(=O)NC(C)(C)C)CSC1=CC=CC=C1 QAGYKUNXZHXKMR-HKWSIXNMSA-N 0.000 description 1
- 210000005170 neoplastic cell Anatomy 0.000 description 1
- 201000002120 neuroendocrine carcinoma Diseases 0.000 description 1
- 208000029974 neurofibrosarcoma Diseases 0.000 description 1
- 239000002858 neurotransmitter agent Substances 0.000 description 1
- 229960000689 nevirapine Drugs 0.000 description 1
- 229940101771 nexavir Drugs 0.000 description 1
- 229940099637 nilandron Drugs 0.000 description 1
- 229960002653 nilutamide Drugs 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 230000009635 nitrosylation Effects 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 230000037311 normal skin Effects 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 238000010534 nucleophilic substitution reaction Methods 0.000 description 1
- 229940127073 nucleoside analogue Drugs 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 description 1
- 201000002575 ocular melanoma Diseases 0.000 description 1
- 206010073131 oligoastrocytoma Diseases 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 150000002895 organic esters Chemical class 0.000 description 1
- 229960003752 oseltamivir Drugs 0.000 description 1
- VSZGPKBBMSAYNT-RRFJBIMHSA-N oseltamivir Chemical compound CCOC(=O)C1=C[C@@H](OC(CC)CC)[C@H](NC(C)=O)[C@@H](N)C1 VSZGPKBBMSAYNT-RRFJBIMHSA-N 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- 208000005368 osteomalacia Diseases 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 238000005691 oxidative coupling reaction Methods 0.000 description 1
- 229950007318 ozogamicin Drugs 0.000 description 1
- 201000005580 palindromic rheumatism Diseases 0.000 description 1
- 230000026792 palmitoylation Effects 0.000 description 1
- 229960001972 panitumumab Drugs 0.000 description 1
- 238000004091 panning Methods 0.000 description 1
- 230000003071 parasitic effect Effects 0.000 description 1
- 210000002990 parathyroid gland Anatomy 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 210000004417 patella Anatomy 0.000 description 1
- 108010089193 pattern recognition receptors Proteins 0.000 description 1
- 102000007863 pattern recognition receptors Human genes 0.000 description 1
- CUIHSIWYWATEQL-UHFFFAOYSA-N pazopanib Chemical compound C1=CC2=C(C)N(C)N=C2C=C1N(C)C(N=1)=CC=NC=1NC1=CC=C(C)C(S(N)(=O)=O)=C1 CUIHSIWYWATEQL-UHFFFAOYSA-N 0.000 description 1
- 229960000639 pazopanib Drugs 0.000 description 1
- 229960003930 peginterferon alfa-2a Drugs 0.000 description 1
- 108010092853 peginterferon alfa-2a Proteins 0.000 description 1
- 229960005079 pemetrexed Drugs 0.000 description 1
- QOFFJEBXNKRSPX-ZDUSSCGKSA-N pemetrexed Chemical compound C1=N[C]2NC(N)=NC(=O)C2=C1CCC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 QOFFJEBXNKRSPX-ZDUSSCGKSA-N 0.000 description 1
- 229960001179 penciclovir Drugs 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- 229960001084 peramivir Drugs 0.000 description 1
- XRQDFNLINLXZLB-CKIKVBCHSA-N peramivir Chemical compound CCC(CC)[C@H](NC(C)=O)[C@@H]1[C@H](O)[C@@H](C(O)=O)C[C@H]1NC(N)=N XRQDFNLINLXZLB-CKIKVBCHSA-N 0.000 description 1
- UTIQDNPUHSAVDN-UHFFFAOYSA-N peridinin Natural products CC(=O)OC1CC(C)(C)C(=C=CC(=CC=CC=CC=C2/OC(=O)C(=C2)C=CC34OC3(C)CC(O)CC4(C)C)C)C(C)(O)C1 UTIQDNPUHSAVDN-UHFFFAOYSA-N 0.000 description 1
- 210000004303 peritoneum Anatomy 0.000 description 1
- 239000012466 permeate Substances 0.000 description 1
- 210000001539 phagocyte Anatomy 0.000 description 1
- 239000008177 pharmaceutical agent Substances 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- XUYJLQHKOGNDPB-UHFFFAOYSA-N phosphonoacetic acid Chemical compound OC(=O)CP(O)(O)=O XUYJLQHKOGNDPB-UHFFFAOYSA-N 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000003123 plant toxin Substances 0.000 description 1
- 229960000471 pleconaril Drugs 0.000 description 1
- KQOXLKOJHVFTRN-UHFFFAOYSA-N pleconaril Chemical compound O1N=C(C)C=C1CCCOC1=C(C)C=C(C=2N=C(ON=2)C(F)(F)F)C=C1C KQOXLKOJHVFTRN-UHFFFAOYSA-N 0.000 description 1
- 210000004224 pleura Anatomy 0.000 description 1
- 201000000317 pneumocystosis Diseases 0.000 description 1
- 229960001237 podophyllotoxin Drugs 0.000 description 1
- YJGVMLPVUAXIQN-XVVDYKMHSA-N podophyllotoxin Chemical compound COC1=C(OC)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@H](O)[C@@H]3[C@@H]2C(OC3)=O)=C1 YJGVMLPVUAXIQN-XVVDYKMHSA-N 0.000 description 1
- YVCVYCSAAZQOJI-UHFFFAOYSA-N podophyllotoxin Natural products COC1=C(O)C(OC)=CC(C2C3=CC=4OCOC=4C=C3C(O)C3C2C(OC3)=O)=C1 YVCVYCSAAZQOJI-UHFFFAOYSA-N 0.000 description 1
- 231100000614 poison Toxicity 0.000 description 1
- 239000002574 poison Substances 0.000 description 1
- 108700028325 pokeweed antiviral Proteins 0.000 description 1
- 229920001993 poloxamer 188 Polymers 0.000 description 1
- 229940044519 poloxamer 188 Drugs 0.000 description 1
- 229920000233 poly(alkylene oxides) Polymers 0.000 description 1
- 229920001490 poly(butyl methacrylate) polymer Polymers 0.000 description 1
- 229920001483 poly(ethyl methacrylate) polymer Polymers 0.000 description 1
- 229920001200 poly(ethylene-vinyl acetate) Polymers 0.000 description 1
- 229920000212 poly(isobutyl acrylate) Polymers 0.000 description 1
- 229920000205 poly(isobutyl methacrylate) Polymers 0.000 description 1
- 229920000196 poly(lauryl methacrylate) Polymers 0.000 description 1
- 229920003229 poly(methyl methacrylate) Polymers 0.000 description 1
- 229920000184 poly(octadecyl acrylate) Polymers 0.000 description 1
- 229920001515 polyalkylene glycol Polymers 0.000 description 1
- 229920002647 polyamide Polymers 0.000 description 1
- 201000006292 polyarteritis nodosa Diseases 0.000 description 1
- 229920000515 polycarbonate Polymers 0.000 description 1
- 239000004417 polycarbonate Substances 0.000 description 1
- 229950005134 polycarbophil Drugs 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229920000139 polyethylene terephthalate Polymers 0.000 description 1
- 239000005020 polyethylene terephthalate Substances 0.000 description 1
- 239000004633 polyglycolic acid Substances 0.000 description 1
- 229920000129 polyhexylmethacrylate Polymers 0.000 description 1
- 229920002338 polyhydroxyethylmethacrylate Polymers 0.000 description 1
- 229920000197 polyisopropyl acrylate Polymers 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 229920000193 polymethacrylate Polymers 0.000 description 1
- 239000004926 polymethyl methacrylate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 229920000182 polyphenyl methacrylate Polymers 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920001296 polysiloxane Polymers 0.000 description 1
- 229940068977 polysorbate 20 Drugs 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 229920002635 polyurethane Polymers 0.000 description 1
- 239000004814 polyurethane Substances 0.000 description 1
- 229920002689 polyvinyl acetate Polymers 0.000 description 1
- 239000011118 polyvinyl acetate Substances 0.000 description 1
- 229920000915 polyvinyl chloride Polymers 0.000 description 1
- 239000004800 polyvinyl chloride Substances 0.000 description 1
- 229920001290 polyvinyl ester Polymers 0.000 description 1
- 229920001289 polyvinyl ether Polymers 0.000 description 1
- 238000009258 post-therapy Methods 0.000 description 1
- 239000001103 potassium chloride Substances 0.000 description 1
- 235000011164 potassium chloride Nutrition 0.000 description 1
- 229940069328 povidone Drugs 0.000 description 1
- 239000000843 powder Substances 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 239000000583 progesterone congener Substances 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 125000001500 prolyl group Chemical group [H]N1C([H])(C(=O)[*])C([H])([H])C([H])([H])C1([H])[H] 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- 235000010232 propyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004405 propyl p-hydroxybenzoate Substances 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000012846 protein folding Effects 0.000 description 1
- 229940039716 prothrombin Drugs 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 238000010526 radical polymerization reaction Methods 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 229960004742 raltegravir Drugs 0.000 description 1
- CZFFBEXEKNGXKS-UHFFFAOYSA-N raltegravir Chemical compound O1C(C)=NN=C1C(=O)NC(C)(C)C1=NC(C(=O)NCC=2C=CC(F)=CC=2)=C(O)C(=O)N1C CZFFBEXEKNGXKS-UHFFFAOYSA-N 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 210000003370 receptor cell Anatomy 0.000 description 1
- 210000001350 reed-sternberg cell Anatomy 0.000 description 1
- 208000037922 refractory disease Diseases 0.000 description 1
- 208000016691 refractory malignant neoplasm Diseases 0.000 description 1
- 208000009169 relapsing polychondritis Diseases 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000008261 resistance mechanism Effects 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 201000006845 reticulosarcoma Diseases 0.000 description 1
- 208000029922 reticulum cell sarcoma Diseases 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 1
- 201000003068 rheumatic fever Diseases 0.000 description 1
- 229960000329 ribavirin Drugs 0.000 description 1
- HZCAHMRRMINHDJ-DBRKOABJSA-N ribavirin Natural products O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1N=CN=C1 HZCAHMRRMINHDJ-DBRKOABJSA-N 0.000 description 1
- 229960000888 rimantadine Drugs 0.000 description 1
- 229960000311 ritonavir Drugs 0.000 description 1
- NCDNCNXCDXHOMX-XGKFQTDJSA-N ritonavir Chemical compound N([C@@H](C(C)C)C(=O)N[C@H](C[C@H](O)[C@H](CC=1C=CC=CC=1)NC(=O)OCC=1SC=NC=1)CC=1C=CC=CC=1)C(=O)N(C)CC1=CSC(C(C)C)=N1 NCDNCNXCDXHOMX-XGKFQTDJSA-N 0.000 description 1
- 239000003419 rna directed dna polymerase inhibitor Substances 0.000 description 1
- 229960003522 roquinimex Drugs 0.000 description 1
- 201000005404 rubella Diseases 0.000 description 1
- HNMATTJJEPZZMM-BPKVFSPJSA-N s-[(2r,3s,4s,6s)-6-[[(2r,3s,4s,5r,6r)-5-[(2s,4s,5s)-5-[acetyl(ethyl)amino]-4-methoxyoxan-2-yl]oxy-6-[[(2s,5z,9r,13e)-13-[2-[[4-[(2e)-2-[1-[4-(4-amino-4-oxobutoxy)phenyl]ethylidene]hydrazinyl]-2-methyl-4-oxobutan-2-yl]disulfanyl]ethylidene]-9-hydroxy-12-(m Chemical compound C1[C@H](OC)[C@@H](N(CC)C(C)=O)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@@](C/3=C/CSSC(C)(C)CC(=O)N\N=C(/C)C=3C=CC(OCCCC(N)=O)=CC=3)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HNMATTJJEPZZMM-BPKVFSPJSA-N 0.000 description 1
- 229960001852 saquinavir Drugs 0.000 description 1
- QWAXKHKRTORLEM-UGJKXSETSA-N saquinavir Chemical compound C([C@@H]([C@H](O)CN1C[C@H]2CCCC[C@H]2C[C@H]1C(=O)NC(C)(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)C=1N=C2C=CC=CC2=CC=1)C1=CC=CC=C1 QWAXKHKRTORLEM-UGJKXSETSA-N 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 208000010233 scurvy Diseases 0.000 description 1
- 201000001223 septic arthritis Diseases 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 108091006024 signal transducing proteins Proteins 0.000 description 1
- 102000034285 signal transducing proteins Human genes 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 229920000260 silastic Polymers 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- 201000003708 skin melanoma Diseases 0.000 description 1
- 244000005714 skin microbiome Species 0.000 description 1
- 201000010153 skin papilloma Diseases 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- 239000003998 snake venom Substances 0.000 description 1
- 235000010413 sodium alginate Nutrition 0.000 description 1
- 239000000661 sodium alginate Substances 0.000 description 1
- 229940005550 sodium alginate Drugs 0.000 description 1
- 229910000029 sodium carbonate Inorganic materials 0.000 description 1
- HRZFUMHJMZEROT-UHFFFAOYSA-L sodium disulfite Chemical compound [Na+].[Na+].[O-]S(=O)S([O-])(=O)=O HRZFUMHJMZEROT-UHFFFAOYSA-L 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- HSFQBFMEWSTNOW-UHFFFAOYSA-N sodium;carbanide Chemical group [CH3-].[Na+] HSFQBFMEWSTNOW-UHFFFAOYSA-N 0.000 description 1
- 229960002063 sofosbuvir Drugs 0.000 description 1
- TTZHDVOVKQGIBA-IQWMDFIBSA-N sofosbuvir Chemical compound N1([C@@H]2O[C@@H]([C@H]([C@]2(F)C)O)CO[P@@](=O)(N[C@@H](C)C(=O)OC(C)C)OC=2C=CC=CC=2)C=CC(=O)NC1=O TTZHDVOVKQGIBA-IQWMDFIBSA-N 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 229940087854 solu-medrol Drugs 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 229960003787 sorafenib Drugs 0.000 description 1
- 235000010199 sorbic acid Nutrition 0.000 description 1
- 239000004334 sorbic acid Substances 0.000 description 1
- 229940075582 sorbic acid Drugs 0.000 description 1
- 210000000278 spinal cord Anatomy 0.000 description 1
- 208000005198 spinal stenosis Diseases 0.000 description 1
- 210000004988 splenocyte Anatomy 0.000 description 1
- 206010041823 squamous cell carcinoma Diseases 0.000 description 1
- 229940032147 starch Drugs 0.000 description 1
- 229960001203 stavudine Drugs 0.000 description 1
- 239000008117 stearic acid Substances 0.000 description 1
- 239000008223 sterile water Substances 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 201000004059 subependymal giant cell astrocytoma Diseases 0.000 description 1
- 150000005846 sugar alcohols Chemical class 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 1
- 229960001796 sunitinib Drugs 0.000 description 1
- 231100000617 superantigen Toxicity 0.000 description 1
- 230000003319 supportive effect Effects 0.000 description 1
- FIAFUQMPZJWCLV-UHFFFAOYSA-N suramin Chemical compound OS(=O)(=O)C1=CC(S(O)(=O)=O)=C2C(NC(=O)C3=CC=C(C(=C3)NC(=O)C=3C=C(NC(=O)NC=4C=C(C=CC=4)C(=O)NC=4C(=CC=C(C=4)C(=O)NC=4C5=C(C=C(C=C5C(=CC=4)S(O)(=O)=O)S(O)(=O)=O)S(O)(=O)=O)C)C=CC=3)C)=CC=C(S(O)(=O)=O)C2=C1 FIAFUQMPZJWCLV-UHFFFAOYSA-N 0.000 description 1
- 229960005314 suramin Drugs 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 210000001179 synovial fluid Anatomy 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 208000006379 syphilis Diseases 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 229940099419 targretin Drugs 0.000 description 1
- 229950006081 taribavirin Drugs 0.000 description 1
- NHKZSTHOYNWEEZ-AFCXAGJDSA-N taribavirin Chemical compound N1=C(C(=N)N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NHKZSTHOYNWEEZ-AFCXAGJDSA-N 0.000 description 1
- 229950001899 tasquinimod Drugs 0.000 description 1
- ONDYALNGTUAJDX-UHFFFAOYSA-N tasquinimod Chemical compound OC=1C=2C(OC)=CC=CC=2N(C)C(=O)C=1C(=O)N(C)C1=CC=C(C(F)(F)F)C=C1 ONDYALNGTUAJDX-UHFFFAOYSA-N 0.000 description 1
- 229940104261 taurate Drugs 0.000 description 1
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 1
- 229940111630 tea tree oil Drugs 0.000 description 1
- 239000010677 tea tree oil Substances 0.000 description 1
- 229960002935 telaprevir Drugs 0.000 description 1
- 108010017101 telaprevir Proteins 0.000 description 1
- BBAWEDCPNXPBQM-GDEBMMAJSA-N telaprevir Chemical compound N([C@H](C(=O)N[C@H](C(=O)N1C[C@@H]2CCC[C@@H]2[C@H]1C(=O)N[C@@H](CCC)C(=O)C(=O)NC1CC1)C(C)(C)C)C1CCCCC1)C(=O)C1=CN=CC=N1 BBAWEDCPNXPBQM-GDEBMMAJSA-N 0.000 description 1
- 229960004964 temozolomide Drugs 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 229960004556 tenofovir Drugs 0.000 description 1
- SGOIRFVFHAKUTI-ZCFIWIBFSA-N tenofovir (anhydrous) Chemical compound N1=CN=C2N(C[C@@H](C)OCP(O)(O)=O)C=NC2=C1N SGOIRFVFHAKUTI-ZCFIWIBFSA-N 0.000 description 1
- 229960001355 tenofovir disoproxil Drugs 0.000 description 1
- JFVZFKDSXNQEJW-CQSZACIVSA-N tenofovir disoproxil Chemical compound N1=CN=C2N(C[C@@H](C)OCP(=O)(OCOC(=O)OC(C)C)OCOC(=O)OC(C)C)C=NC2=C1N JFVZFKDSXNQEJW-CQSZACIVSA-N 0.000 description 1
- VCMJCVGFSROFHV-WZGZYPNHSA-N tenofovir disoproxil fumarate Chemical compound OC(=O)\C=C\C(O)=O.N1=CN=C2N(C[C@@H](C)OCP(=O)(OCOC(=O)OC(C)C)OCOC(=O)OC(C)C)C=NC2=C1N VCMJCVGFSROFHV-WZGZYPNHSA-N 0.000 description 1
- BWMISRWJRUSYEX-SZKNIZGXSA-N terbinafine hydrochloride Chemical compound Cl.C1=CC=C2C(CN(C\C=C\C#CC(C)(C)C)C)=CC=CC2=C1 BWMISRWJRUSYEX-SZKNIZGXSA-N 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- CXVCSRUYMINUSF-UHFFFAOYSA-N tetrathiomolybdate(2-) Chemical compound [S-][Mo]([S-])(=S)=S CXVCSRUYMINUSF-UHFFFAOYSA-N 0.000 description 1
- 150000003536 tetrazoles Chemical class 0.000 description 1
- 229960003433 thalidomide Drugs 0.000 description 1
- RTKIYNMVFMVABJ-UHFFFAOYSA-L thimerosal Chemical compound [Na+].CC[Hg]SC1=CC=CC=C1C([O-])=O RTKIYNMVFMVABJ-UHFFFAOYSA-L 0.000 description 1
- 229940033663 thimerosal Drugs 0.000 description 1
- 150000003568 thioethers Chemical class 0.000 description 1
- 108060008226 thioredoxin Proteins 0.000 description 1
- 229940094937 thioredoxin Drugs 0.000 description 1
- 229960001196 thiotepa Drugs 0.000 description 1
- 210000000115 thoracic cavity Anatomy 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 201000004647 tinea pedis Diseases 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- MNRILEROXIRVNJ-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=NC=N[C]21 MNRILEROXIRVNJ-UHFFFAOYSA-N 0.000 description 1
- 229960000838 tipranavir Drugs 0.000 description 1
- SUJUHGSWHZTSEU-FYBSXPHGSA-N tipranavir Chemical compound C([C@@]1(CCC)OC(=O)C([C@H](CC)C=2C=C(NS(=O)(=O)C=3N=CC(=CC=3)C(F)(F)F)C=CC=2)=C(O)C1)CC1=CC=CC=C1 SUJUHGSWHZTSEU-FYBSXPHGSA-N 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 239000012443 tonicity enhancing agent Substances 0.000 description 1
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- 229960005026 toremifene Drugs 0.000 description 1
- XFCLJVABOIYOMF-QPLCGJKRSA-N toremifene Chemical compound C1=CC(OCCN(C)C)=CC=C1C(\C=1C=CC=CC=1)=C(\CCCl)C1=CC=CC=C1 XFCLJVABOIYOMF-QPLCGJKRSA-N 0.000 description 1
- 210000003437 trachea Anatomy 0.000 description 1
- 235000010487 tragacanth Nutrition 0.000 description 1
- 239000000196 tragacanth Substances 0.000 description 1
- 229940116362 tragacanth Drugs 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 238000006276 transfer reaction Methods 0.000 description 1
- 102000003601 transglutaminase Human genes 0.000 description 1
- 102000027257 transmembrane receptors Human genes 0.000 description 1
- 108091008578 transmembrane receptors Proteins 0.000 description 1
- ODLHGICHYURWBS-LKONHMLTSA-N trappsol cyclo Chemical compound CC(O)COC[C@H]([C@H]([C@@H]([C@H]1O)O)O[C@H]2O[C@@H]([C@@H](O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O[C@H]3O[C@H](COCC(C)O)[C@H]([C@@H]([C@H]3O)O)O3)[C@H](O)[C@H]2O)COCC(O)C)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H]3O[C@@H]1COCC(C)O ODLHGICHYURWBS-LKONHMLTSA-N 0.000 description 1
- 229960001612 trastuzumab emtansine Drugs 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 229960003962 trifluridine Drugs 0.000 description 1
- VSQQQLOSPVPRAZ-RRKCRQDMSA-N trifluridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(C(F)(F)F)=C1 VSQQQLOSPVPRAZ-RRKCRQDMSA-N 0.000 description 1
- 208000022679 triple-negative breast carcinoma Diseases 0.000 description 1
- 208000036907 triple-positive breast carcinoma Diseases 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 229940111527 trizivir Drugs 0.000 description 1
- 229960000832 tromantadine Drugs 0.000 description 1
- UXQDWARBDDDTKG-UHFFFAOYSA-N tromantadine Chemical compound C1C(C2)CC3CC2CC1(NC(=O)COCCN(C)C)C3 UXQDWARBDDDTKG-UHFFFAOYSA-N 0.000 description 1
- 229960000281 trometamol Drugs 0.000 description 1
- 229940008349 truvada Drugs 0.000 description 1
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 201000008297 typhoid fever Diseases 0.000 description 1
- 238000005199 ultracentrifugation Methods 0.000 description 1
- 229960004626 umifenovir Drugs 0.000 description 1
- KCFYEAOKVJSACF-UHFFFAOYSA-N umifenovir Chemical compound CN1C2=CC(Br)=C(O)C(CN(C)C)=C2C(C(=O)OCC)=C1CSC1=CC=CC=C1 KCFYEAOKVJSACF-UHFFFAOYSA-N 0.000 description 1
- 241001529453 unidentified herpesvirus Species 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 208000019206 urinary tract infection Diseases 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 210000001215 vagina Anatomy 0.000 description 1
- 206010046885 vaginal cancer Diseases 0.000 description 1
- 208000013139 vaginal neoplasm Diseases 0.000 description 1
- 229940093257 valacyclovir Drugs 0.000 description 1
- 229940124676 vascular endothelial growth factor receptor Drugs 0.000 description 1
- 108010060757 vasostatin Proteins 0.000 description 1
- 229950009860 vicriviroc Drugs 0.000 description 1
- 229960003636 vidarabine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- 210000004127 vitreous body Anatomy 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 238000011816 wild-type C57Bl6 mouse Methods 0.000 description 1
- ARAIBEBZBOPLMB-UFGQHTETSA-N zanamivir Chemical compound CC(=O)N[C@@H]1[C@@H](N=C(N)N)C=C(C(O)=O)O[C@H]1[C@H](O)[C@H](O)CO ARAIBEBZBOPLMB-UFGQHTETSA-N 0.000 description 1
- 229960001028 zanamivir Drugs 0.000 description 1
- 229960002555 zidovudine Drugs 0.000 description 1
- 229940033942 zoladex Drugs 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0002—Fungal antigens, e.g. Trichophyton, Aspergillus, Candida
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/395—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum
- A61K39/39533—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals
- A61K39/3955—Antibodies; Immunoglobulins; Immune serum, e.g. antilymphocytic serum against materials from animals against proteinaceous materials, e.g. enzymes, hormones, lymphokines
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4631—Chimeric Antigen Receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464402—Receptors, cell surface antigens or cell surface determinants
- A61K39/464411—Immunoglobulin superfamily
- A61K39/464412—CD19 or B4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464402—Receptors, cell surface antigens or cell surface determinants
- A61K39/464416—Receptors for cytokines
- A61K39/464417—Receptors for tumor necrosis factors [TNF], e.g. lymphotoxin receptor [LTR], CD30
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464402—Receptors, cell surface antigens or cell surface determinants
- A61K39/464424—CD20
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464452—Transcription factors, e.g. SOX or c-MYC
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6811—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a protein or peptide, e.g. transferrin or bleomycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/37—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi
- C07K14/39—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi from yeasts
- C07K14/395—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from fungi from yeasts from Saccharomyces
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2887—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/515—Animal cells
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/572—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/70—Multivalent vaccine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/23—On/off switch
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/27—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by targeting or presenting multiple antigens
- A61K2239/28—Expressing multiple CARs, TCRs or antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
- A61K2239/48—Blood cells, e.g. leukemia or lymphoma
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/30—Non-immunoglobulin-derived peptide or protein having an immunoglobulin constant or Fc region, or a fragment thereof, attached thereto
Definitions
- Immunotherapies are becoming attractive alternatives to chemotherapies, including immunotherapies that use adoptive transfer of genetically modified T cells to “reteach” the immune system to recognize and eliminate malignant tumor cells.
- Genetically modified T cells express chimeric antigen receptors, which generally consist of a signaling endodomain, a CD3-zeta transmembrane domain and an extracellular single-chain variable fragment (scFv) derived from a monoclonal antibody which gives the receptor specificity for a tumor-associated antigen on a target malignant cell.
- scFv extracellular single-chain variable fragment
- the chimeric antigen receptor expressing T cell mounts an immune response that is cytotoxic to the malignant cell.
- Such therapies can circumvent chemotherapy resistance and have been shown to be active against relapsed/refractory disease, resulting in sustained remissions for some chronic lymphocytic leukemia (CLL) and acute lymphoblastic leukemia (ALL) patients.
- CLL chronic lymphocytic leukemia
- ALL acute lymphoblastic leukemia
- these therapies require further investigation and optimization, as they caused undesirable effects such as toxic lymphophenia, chronic hypogammaglobulinemia for hematological targets, fatal off-target cytolysis for solid tumor targets, persistent B cell aplasia with the use of anti-CD19 antibody expressing CAR T-cells, and, in some cases, death.
- CAR T-cell activity and associated immune responses would allow CAR T-cell activity and associated immune responses to be turned off after neoplastic cells are eliminated and would allow B cells to reproliferate.
- CAR T-cell systems can be controlled through an antibody-based switch, wherein the antibody binds the target cell (e.g. cancer cell), blocking the CAR T-cell from binding the target cell and “switching off” CAR-T activity. While these systems conceptually allow for switchable targeting of tumors using CAR T-cells, they may suffer from a series of limitations. Non-specific labeling of antibodies using cysteines or lysines produces heterogeneous products which includes variants that may be non-functional, have unpredictable pharmacokinetics and/or immunogenicity, and that may be difficult to optimize.
- chimeric antigen receptor-effector cell switches comprising: a peptidic antigen that binds a chimeric antigen receptor on an effector cell; and a targeting moiety that binds a cell surface molecule on a target cell.
- the peptidic antigen may be based on or derived from a naturally occurring peptide.
- the peptidic antigen may be based on or derived from a non-human peptide.
- the peptidic antigen may be based on or derived from a eukaryotic peptide.
- the peptidic antigen may be based on or derived from a peptide, wherein the peptide is expressed by a yeast.
- the peptidic antigen may be based on or derived from a yeast transcription factor GCN4.
- the peptidic antigen may comprise a non-naturally occurring peptide.
- the peptidic antigen may comprise a synthetic peptide tag.
- the peptidic antigen may be based on or derived from a sequence selected from SEQ ID NOs: 2-7.
- the peptidic antigen may comprise a sequence that is at least about 50% homologous to a peptide sequence selected from SEQ ID NOs: 2-7.
- the targeting moiety may comprise a targeting peptide.
- the targeting moiety may comprise a targeting antibody or antibody fragment.
- the targeting antibody or antibody fragment may be selected from the group consisting of: an immunoglobulin, an Fc null immunoglobulin, and a Fab, and fragments thereof.
- the targeting moiety may be selected from the group consisting of: an anti-EGFR antibody, an anti-Her2 antibody, anti-EGFRvIII antibody, an anti-CD33 antibody, an anti-CLL-1 antibody, an anti-CEA antibody, an anti-CD19 antibody, an anti-CD22 antibody, an anti-BCMA antibody, and an anti-CS1 antibody, and fragments thereof.
- the targeting antibody or antibody fragment may comprise a light chain and a heavy chain pair, wherein the light chain and heavy chain are encoded by nucleic acid sequences based on or derived from nucleic acid sequence pairs selected from the group consisting of: SEQ ID NOs: 8 and 9; SEQ ID NOs: 8 and 10; SEQ ID NOs: 11 and 12; SEQ ID NOs. 13 and 14; SEQ ID NOs: 15 and 16; SEQ ID NOs: 17 and 18; and SEQ ID NOs: 19 and 20.
- the targeting antibody or antibody fragment may comprise a light chain and a heavy chain pair, wherein the light chain and heavy chain are encoded by amino acid sequences based on or derived from amino acid sequence pairs selected from the group consisting of: SEQ ID NOs: 21 and 22; SEQ ID NOs: 23 and 24; SEQ ID NOs. 25 and 26; SEQ ID NOs: 27 and 28; and SEQ ID NOs: 27 and 29.
- the chimeric antigen receptor-effector cell switch may comprise a light chain and a heavy chain pair, wherein the light chain and heavy chain are encoded by amino acid sequences based on or derived from amino acid sequence pairs selected from the group consisting of: SEQ ID NOs: 30 and 29; SEQ ID NOs: 36 and 29; SEQ ID NOs: 31 and 28; SEQ ID NOs: 27 and 32; SEQ ID NOs: 27 and 33; SEQ ID NOs: 27 and 34; and SEQ ID NOs: 27 and 35.
- the peptidic antigen may be fused to a terminus of the targeting antibody or antibody fragment.
- the peptidic antigen may be fused to a region of the targeting antibody or antibody fragment selected from the group consisting of: an N terminus of a light chain, a C terminus of a light chain, an N terminus of a heavy chain, a C terminus of a Fab heavy chain and a C terminus of a constant region heavy chain.
- the peptidic antigen may be grafted into the targeting moiety.
- the targeting moiety may comprise a targeting antibody or antibody fragment.
- the peptidic antigen may be grafted into a region of the targeting antibody or antibody fragment selected from a CH 1 domain, a CH 2 domain, a CH 3 domain, a CL domain, a VH domain, a VL domain and a hinge region.
- the peptidic antigen may be grafted between two regions of the targeting antibody or antibody fragment selected from a CH 1 domain, a CH 2 domain, a CH 3 domain, a CL domain, a VH domain, a VL domain, a heavy chain, a light chain and a hinge region, wherein the two regions are adjacent.
- the peptidic antigen may be grafted into a loop of the targeting antibody or antibody fragment.
- the peptidic antigen may be grafted into a loop of a constant domain of the targeting antibody or antibody fragment.
- the peptidic antigen may be grafted between the hinge region and a heavy chain constant domain of the targeting antibody or antibody fragment.
- the peptidic antigen may replace one or more amino acids of the targeting antibody or antibody fragment.
- the peptidic antigen may be grafted into the targeting antibody or antibody fragment without replacing an amino acid.
- the chimeric antigen receptor-effector cell may further comprise a linker that links the peptidic antigen and the targeting moiety.
- the linker may be a peptide that links the peptidic antigen and the targeting moiety, wherein the targeting moiety comprises a targeting polypeptide.
- the linker may comprise about 1 to about 20 amino acids.
- the linker may comprise a sequence based on or derived from a sequence selected from SEQ ID NOs: 38-42.
- the peptidic antigen may comprise a yeast transcription factor GCN4 or homolog thereof and the targeting moiety is selected from the group consisting of: an anti-Her2 antibody, an anti-BCMA antibody, an anti-CD19 antibody, an anti-CEA antibody and fragments thereof.
- the target cell may be a cancer cell.
- the cell surface molecule may be a tumor associated antigen.
- the cell surface molecule may be selected from the group consisting of: a cluster of differentiation protein, a receptor, an integral membrane protein and a glycoprotein.
- the homogeneity of the chimeric antigen receptor-effector cell switch may be at least about 90%.
- compositions comprising: a chimeric antigen receptor-effector cell switch comprising: a peptidic antigen that binds a chimeric antigen receptor on an effector cell; and a targeting moiety that binds a cell surface molecule on a target; and a pharmaceutically acceptable salt, excipient and/or vehicle.
- kits comprising: a chimeric antigen receptor-effector cell switch comprising: a peptidic antigen that binds a chimeric antigen receptor on an effector cell; and a targeting moiety that binds a cell surface molecule on a target cell; and a chimeric antigen receptor-effector cell comprising a chimeric antigen receptor that binds to the peptidic antigen of the chimeric antigen receptor-effector cell switch.
- the targeting moiety may comprise a targeting peptide.
- the targeting moiety comprises a targeting antibody or antibody fragment.
- the peptidic antigen is grafted within the targeting moiety.
- the kit may comprise a first chimeric antigen receptor-effector cell switch and a second chimeric antigen receptor-effector cell switch, wherein the first chimeric antigen receptor-effector cell switch comprises a first peptidic antigen and a first targeting moiety and the second chimeric antigen receptor-effector cell switch comprises a second peptidic antigen and a second targeting moiety.
- the first peptidic antigen and the second peptidic antigen may be the same.
- the first targeting moiety may bind a first cell surface molecule on a first target cell and the second targeting moiety may bind a second cell surface molecule on a second target cell, wherein the first cell surface molecule and the second cell surface molecule are different.
- the effector cell may be selected from a T cell, an effector B cell, a natural killer cell, a macrophage and a progenitor thereof.
- the effector cell may be selected from a naive T cell, a memory stem cell T cell, a central memory T cell, an effector memory T cell, a helper T cell, a CD4+ T cell, a CD8+ T cell, a CD8/CD4+ T cell, an ⁇ T cell, a ⁇ T cell, a cytotoxic T cell, a natural killer T cell, a natural killer cell, a macrophage.
- the chimeric antigen receptor may comprise an antibody or antibody fragment that binds the peptidic antigen of a chimeric antigen receptor-effector cell switch.
- the antibody fragment or antibody fragment may bind a eukaryotic antigen.
- the antibody or antibody fragment may bind a non-naturally occurring peptide.
- the antibody fragment may be an scFv.
- the antibody or antibody fragment may be selected from an anti-yeast transcription factor GCN4 antibody, an anti-FLAG® antibody, an anti-HTP antibody and fragments thereof.
- the chimeric antigen receptor may be encoded by a polynucleotide based on or derived from SEQ ID NO: 1.
- effector cells comprising a chimeric antigen receptor, wherein the chimeric antigen receptor that binds a peptidic antigen of a chimeric antigen receptor-effector cell switch.
- the effector cells may be T cells.
- the effector cells may comprise one or more polynucleotides based on or derived from SEQ ID NO: 1.
- vectors comprising a polynucleotide having a sequence that encodes a chimeric antigen receptor-effector cell switch, wherein the chimeric antigen receptor-effector cell switch comprises peptidic antigen and a targeting moiety, wherein the targeting moiety comprises a peptide and binds a cell surface molecule on a target cell.
- vectors comprising a first polynucleotide having a first sequence that encodes a heavy chain of a targeting antibody or antibody fragment; a second polynucleotide having a second sequence that encodes a light chain of a targeting antibody or antibody fragment; and a third polynucleotide having a third sequence that encodes a peptidic antigen, wherein expression of the vector produces a chimeric antigen receptor-effector cell switch.
- the third sequence may be adjacent to a sequence selected from the first sequence and the second sequence.
- the third sequence may be located within a sequence selected from the first sequence and the second sequence.
- a chimeric antigen receptor-effector cell switch comprising expressing from one or more polynucleotide vectors: a first sequence that encodes a heavy chain of a targeting antibody or antibody fragment; a second sequence that encodes a light chain of a targeting antibody or antibody fragment; and a third sequence that encodes a peptidic antigen, wherein expression of the vector produces a chimeric antigen receptor-effector cell switch.
- FIG. 1A illustrates a general overview of chimeric antigen receptor-T cell (CAR T-cell) and CAR T-cell switch therapy with switches disclosed herein.
- Lymphocytes are isolated from a subject and an expression vector encoding a chimeric antigen receptor is subsequently introduced to the lymphocytes to produce chimeric antigen receptor expressing cells. Resulting engineered lymphocytes are administered to the subject, along with a CAR T-cell switch.
- FIG. 1B illustrates a CAR T-cell switch, comprising a peptide that is bound by the chimeric antigen receptor of the CAR T-cell and a targeting antibody that is selective for a target cell. Binding of the CAR T-cell switch to the CAR T-cell induces an immune response that would be cytotoxic to the malignant cell also bound to the CAR T-cell switch.
- FIG. 2 depicts a PDB 1P4B crystal structure of an affinity matured scFv (light and medium gray represent light chain and heavy chain) bound to a peptide derived from the yeast transcription factor GCN4 (7P-14P) (dark grey represents the GCN4 peptide).
- FIG. 3 shows mass spectrometry of an anti-CD19-Fab-GCN4 CL1 CAR-EC switch. Calculated: 49533, found: 49537.09.
- FIG. 4 shows cytotoxicity of an anti-GCN4 CAR T-cell with various anti-CD19 antibodies or antibody fragments with a GCN4 peptide grafted or fused to various regions or domains of the anti-CD19 antibodies or antibody fragments.
- FIG. 5A shows a non-reducing SDS-PAGE gel of anti-CD19 antibodies or antibody fragments with a GCN4 peptide grafted or fused to various regions or domains of the antibodies or antibody fragments.
- FIG. 5B shows a reducing SDS-PAGE gel of anti-CD19 antibodies or antibody fragments with a GCN4 peptide grafted or fused to various regions or domains of the antibodies or antibody fragments.
- FIG. 6 depicts a yeast GCN4 peptide grafting positions in an anti-CD19 Fab (FMC63).
- FIG. 7A-B shows in vivo efficacy of an anti-CD19 Fab-GCN4 peptide CAR T-cell switch and an anti-GCN4 CAR T-cell in a xenograft tumor mouse model.
- FIG. 7A shows quantification of tumors in untreated versus treated mice.
- FIG. 7B depicts in vivo treatment regimen and visualization of tumor cells in untreated versus treated mice.
- FIG. 8 shows cytotoxicity of an anti-GCN4 CAR T-cell and CAR T-cell switch (anti-BCMA antibody -GCN4 peptide grafted into the light chain constant domain) against BCMA-positive cells (OPM2).
- compositions and methods for selectively activating and deactivating chimeric antigen receptor T cells which may provide for safer and more versatile immunotherapies than those currently being tested and administered.
- CAR-ECs switchable chimeric antigen receptor effector cells
- CAR-EC chimeric antigen receptor effector cell
- the CAR-EC switches have a first region that is bound by a chimeric antigen receptor on the CAR-EC and a second region that binds a cell surface molecule on target cell, thereby stimulating an immune response from the CAR-EC that is cytotoxic to the bound target cell.
- the CAR-EC is a T cell.
- the CAR-EC switch may act as an “on-switch” for CAR-EC activity. Activity may be “turned off” by reducing or ceasing administration of the switch.
- CAR-EC switches may be used with CAR-ECs disclosed herein, as well as existing CAR T-cells, for the treatment of a disease or condition, such as cancer, wherein the target cell is a malignant cell.
- a disease or condition such as cancer
- Such treatment may be referred to herein as switchable immunotherapy, for which an exemplary schematic overview is depicted in FIG. 1 .
- the CAR-EC switches disclosed herein comprise a first region that binds a cell surface molecule on a target cell, and a second region that is bound by a chimeric antigen receptor.
- the first region is a targeting polypeptide.
- the targeting polypeptide may be a targeting antibody or antibody fragment that binds an antigen on the target cell.
- the first region may comprise a non-peptide small molecule (e.g. vitamin, metabolite).
- the second region referred to herein as a chimeric antigen binding peptidic antigen (CAR-BP), comprises a peptide.
- CAR-BP chimeric antigen binding peptidic antigen
- the term chimeric antigen binding peptidic antigen may simply be referred to herein as a peptidic antigen.
- the CAR-BP is fused to a terminus of the targeting polypeptide or grafted within the targeting polypeptide. Fusing or grafting the CAR-BP to the targeting polypeptide may be carried out by cloning one or more polynucleotides encoding the first region and the second region into a polynucleotide expression vector, in a desired order or combination.
- Methods of treating a disease or condition comprising administering the CAR-EC switches, disclosed herein may provide for a titratable response, improved safety and/or cessation of CAR-EC activity by reducing or ceasing administration of the CAR-EC switch.
- the CAR-EC switches disclosed herein generally function as CAR-EC activators or “on” switches.
- CAR-EC platforms including CAR-EC switches and effector cells comprising universal chimeric antigen receptors (CAR) that can bind multiple CAR-EC switches, providing for sequential targeting of one or more types of target cells (e.g. treatment of heterogeneous tumors).
- the CAR may comprise an ultra-high affinity antibody or antibody fragment (e.g. scFv) to the switch.
- Methods of producing the CAR-EC switches disclosed herein may advantageously provide for control of CAR-EC cell activity, titration of off-target reactivity, abrogation of tumor lysis syndrome (TLS), attenuation of cytokine release syndrome (CRS), and/or optimization of CAR-EC switch binding by affinity, valency, geometry, length and/or chemistry through site-specific grafting/fusing of CAR-EC switch peptides/antibodies.
- TLS tumor lysis syndrome
- CRS cytokine release syndrome
- the terms “switch” and “CAR-EC switch”, as used herein, are used interchangeably and may refer to a peptide switch.
- the antibody portion of the peptide antibody switch may comprise at least a portion of an antibody or an entire antibody.
- the antibody portion of the peptide antibody switch may comprise at least a portion of a heavy chain, a portion of a light chain, a portion of a variable region, a portion of a constant region, a portion of a complementarity determining region (CDR), or a combination thereof.
- the antibody portion of the peptide antibody switch and/or hapten antibody switch may comprise at least a portion of the Fc (fragment, crystallizable) region.
- the antibody portion of the peptide antibody switch may comprise at least a portion of the complementarity determining region (e.g., CDR1, CDR2, CDR3).
- the antibody portion of the peptide antibody switch may comprise at least a portion of the Fab (fragment, antigen-binding) region.
- the peptide switch may be a peptide-Fab switch.
- kits and compositions are provided for producing CAR-EC platforms and CAR-EC switches used to bring an effector cell together with a target in a subject. These methods, kits and compositions find therapeutic use in a number of diseases. For example, heterogeneous tumors and blood cell malignancies (e.g. acute lymphoblastic leukemia and chronic lymphocytic leukemia) may be more effectively treated with a CAR-EC platform when the length, valency and orientation of the CAR-EC switch linkage as well as the CAR-EC switch cell targeting moiety is optimized. Heterogeneous tumors may be more effectively treated with multiple CAR-EC switches that target more than one tumor antigens.
- Advantages, and features of the invention will become apparent to those persons skilled in the art upon reading the details of the compositions and methods as more fully described below.
- chimeric antigen receptor-effector cell switches comprising: a peptidic antigen that binds a chimeric antigen receptor on an effector cell; and a targeting moiety that binds a cell surface molecule on a target.
- the targeting moiety may be a targeting polypeptide, comprising a targeting peptide that binds the cell surface molecule.
- the targeting moiety may be a targeting antibody or antibody fragment comprising the targeting peptide, wherein the targeting peptide is an antigen binding site of the targeting antibody or antibody fragment.
- the targeting peptide may be at least a portion of an antibody fragment and the cell surface molecule may be an antigen.
- the targeting moiety may comprise one or more peptides that recognize and/or bind one or more antigens.
- the targeting moiety may comprise one or more peptides that recognize and/or bind only one antigen.
- the peptidic antigen may not comprise an antibody or antibody fragment that recognizes and/or binds an antigen.
- CAR-EC switches comprising: a peptidic antigen that binds a CAR (CAR-BP) on an effector cell, wherein the CAR-BP; and a targeting polypeptide that binds a cell surface molecule on a target cell.
- the peptidic antigen may be fused to a terminus of the targeting polypeptide.
- the peptidic antigen may be grafted into the targeting polypeptide (e.g. between chosen amino acids of the targeting polypeptide).
- the targeting polypeptide may be fused to a terminus of the peptidic antigen.
- the targeting polypeptide may be grafted into the peptidic antigen (e.g. between chosen amino acids of the peptidic antigen).
- CAR-EC switches comprising: a peptidic antigen that binds a CAR (CAR-BP) on an effector cell; and a targeting antibody or antibody fragment that binds an antigen on a target.
- the targeting antibody or antibody fragment may be selected from an immunoglobulin, a Fab, a Fab′, a F(ab′) 2 and an scFv.
- the targeting antibody or antibody fragment may comprise a light chain.
- the targeting antibody or antibody fragment may comprise a heavy chain.
- the peptidic antigen may be fused to an N terminus of the light chain of the targeting antibody or antibody fragment.
- the peptidic antigen may be fused to a C terminus of the light chain of the targeting antibody or antibody fragment.
- the peptidic antigen may be fused to an N terminus of the heavy chain of the targeting antibody or antibody fragment.
- the peptidic antigen may be fused to a C terminus of the heavy chain of the targeting antibody or antibody fragment.
- the peptidic antigen may be fused to an N terminus of a VL domain of the targeting antibody or antibody fragment.
- the peptidic antigen may be fused to an N terminus of a VH domain of the targeting antibody or antibody fragment.
- the peptidic antigen may be fused to a C terminus of a CL domain of the targeting antibody or antibody fragment.
- the peptidic antigen may be fused to a C terminus of an Fc domain of the targeting antibody or antibody fragment.
- the peptidic antigen may be fused to an N terminus of a VL domain of an IgG.
- the peptidic antigen may be fused to an N terminus of a VH domain of an IgG.
- the peptidic antigen may be fused to a C terminus of a CL domain of an IgG.
- the peptidic antigen may be fused to a C terminus of an Fc domain of an IgG.
- the peptidic antigen may be fused to an N terminus of a VL domain of a Fab.
- the peptidic antigen may be fused to an N terminus of a VH domain of a Fab.
- the peptidic antigen may be fused to a C terminus of a CL domain of a Fab.
- the peptidic antigen may be fused to a C terminus of a CH 1 domain of the Fab.
- the peptidic antigen may be grafted into an internal site of a targeting antibody or antibody fragment (e.g. between chosen amino acids of the targeting antibody or antibody fragment).
- the peptidic antigen may be grafted into a heavy chain of a targeting antibody or antibody fragment.
- the peptidic antigen may be grafted into a light chain of a targeting antibody or antibody fragment.
- the peptidic antigen may be grafted into a constant domain/region of a targeting antibody or antibody fragment.
- the peptidic antigen may be grafted into a variable domain/region of a targeting antibody or antibody fragment.
- the peptidic antigen may be grafted into an internal site of a Fab.
- the peptidic antigen may be grafted into an internal site of an immunoglobulin (e.g.
- the peptidic antigen may be grafted into a domain of the targeting antibody or fragment thereof selected from a CL domain, a CH 1 domain, a CH 2 domain, a CH 3 domain, a VL domain, a VH domain and a hinge domain.
- the peptidic antigen may be grafted between two domains of the antibody or fragment thereof selected from a CL domain, a CH 1 domain, a CH 2 domain, a CH 3 domain, a VL domain, a VH domain and a hinge domain, wherein the two domains are adjacent.
- the peptidic antigen may be grafted into a CL domain of the antibody or fragment thereof.
- the peptidic antigen may be grafted into a CH 1 domain of the antibody or fragment thereof.
- the peptidic antigen may be grafted into a hinge domain of the antibody or fragment thereof.
- the peptidic antigen may be grafted into a loop of the antibody or fragment thereof.
- the peptidic antigen may be grafted into a CL domain loop of the antibody or fragment thereof.
- the CAR-BP may be grafted into the C terminus of the antibody or antibody fragment and therefore the distance between the chimeric antigen receptor and the target may differ substantially depending on the size of CAR-EC switch (approximately 40 ⁇ for scFv, 70 ⁇ for Fab, and 120 ⁇ for IgG). While a larger distance may negatively impact efficacy in vitro, the increased residence time of the full length antibody may be superior in vivo.
- the CAR-BP may further comprise a linker.
- the linker may provide the CAR-EC switch flexibility, length or geometry optimal for facilitating an interaction or effect of the CAR-EC on the target cell.
- the CAR-BP may further comprise one or more linkers.
- the CAR-BP may comprise two linkers.
- the linker may comprise a peptide.
- the linker may be at least about 1, at least about 2, at least about 3, at least about 4, at least about 5, at least about 6, at least about 7, at least about 8, at least about 9 or at least about 10 amino acids in length.
- the one or more linkers may comprise about 5, about 10, about 15, about 20, about 25, about 30, about 35, about 40, about 45, about 50, about 55, about 60, about 70, about 80, about 90 or about 100 amino acids.
- the linker may be located at the N terminus or the C terminus of the CAR-BP to graft the CAR-BP to the targeting polypeptide.
- a first linker may be fused to the N terminus of the CAR-BP and a second linker may be fused to the C terminus of the CAR-BP.
- the linker may be comprised of the sequence (GGGGS) n , (SEQ ID NO: 45), wherein n may be 1, 2, 3, 4, 5 or more.
- the linker may be comprised of the sequence (GGS) n , (SEQ ID NO: 46), wherein n may be 1, 2, 3, 4, 5 or more.
- the CAR-BP may be grafted into an internal site of the targeting polypeptide with a linker on either end of the CAR-BP.
- the linker may comprise a sequence selected from SEQ ID NOS: 40-44.
- the peptidic antigen may be a peptide that is bound by a chimeric antigen receptor (CAR).
- the peptidic antigen may have high proteolytic stability and low immunogenicity in humans relative to peptides in general.
- the CAR-BP may be selected from a hormone, a cytokine, a chemokine, a growth factor, a cell adhesion molecule, a signaling peptide, a receptor, a cell surface peptide and fragments thereof.
- the CAR-BP may be a peptoid.
- the CAR-BP may be a peptide nucleic acid (PNA).
- the CAR-BP may be a ligand or a fragment thereof.
- the ligand may be a hormonal ligand.
- the ligand may be a peptide ligand.
- the CAR-BP may be a cyclic peptide.
- the CAR-BP may be a linear peptide.
- the CAR-BP may have a length of between about 2 and about 10, about 10 and about 20, about 20 and about 30, about 30 and about 40, about 40 and about 50, about 50 and about 60, about 60 and about 70, about 70 and about 80, and about 80 and about 90 amino acids.
- the CAR-BP may be an antigen.
- the CAR-BP may be an epitope.
- the CAR-BP may be a nonlinear epitope.
- the CAR-BP may further comprise a second peptide.
- the peptidic antigen may not comprise an antibody or antibody fragment.
- the peptidic antigen may comprise less than 10 amino acids of an antibody or antibody fragment.
- the peptidic antigen may comprise less than 12 amino acids of an antibody or antibody fragment.
- the peptidic antigen may comprise less than 15 amino acids of an antibody or antibody fragment.
- the peptidic antigen may comprise less than 20 amino acids of an antibody or antibody fragment.
- the peptidic antigen may comprise less than 22 amino acids of an antibody or antibody fragment.
- the peptidic antigen may comprise less than 30 amino acids of an antibody or antibody fragment.
- the peptidic antigen may not comprise a paratope of an antibody or antibody fragment.
- chimeric antigen receptor effector cell switches comprising a targeting moiety and a peptidic antigen, wherein the targeting moiety is a targeting polypeptide.
- the targeting polypeptide may comprise a targeting antibody or antibody fragment.
- the targeting antibody or antibody fragment may comprise a variable domain.
- the variable domain may be selected from a VH domain and a VL domain.
- the peptidic antigen may not be located at or near the N terminus of the VH domain.
- the peptidic antigen may not be located at or near the N terminus of the VL domain.
- the peptidic antigen may comprise a non-naturally occurring peptide.
- the peptidic antigen may comprise a synthetic peptide.
- the peptidic antigen may comprise a non-animal peptide (e.g. a peptide not expressed in an animal).
- the peptidic antigen may comprise a non-mammalian peptide.
- the peptidic antigen may comprise a non-human peptide.
- the peptide may comprise a peptide derived from a plant, a yeast, a bacteria, a reptile, a bird or an insect.
- the peptidic antigen may comprise a myc-tag.
- the peptidic antigen may comprise His-tag.
- the peptidic antigen may comprise an HA-tag.
- the peptidic antigen may comprise peridinin chlorophyll protein complex.
- the peptidic antigen may comprise green fluorescent protein (GFP).
- the peptidic antigen may comprise red fluorescent protein (RFP).
- the peptidic antigen may comprise phycoerythrin (PE).
- the peptidic antigen may comprise streptavidin.
- the peptidic antigen may comprise avidin.
- the peptidic antigen may comprise horse radish peroxidase (HRP).
- the peptidic antigen may comprise alkaline phosphatase.
- the peptidic antigen may comprise glucose oxidase.
- the peptidic antigen may comprise glutathione-S-transferase (GST).
- the peptidic antigen may comprise maltose binding protein.
- the peptidic antigen by non-limiting example, may be a c-myc tag, polyhistidine tag, V5, VSVG, softag 1, softag 3, express tag, S tag, palmitoylation, nitrosylation, SUMO tag, thioredoxin, poly(NANP), poly-Arg, calmodulin binding protein, PurF fragment, ketosteroid isomerase, PaP3.30, TAF12 histone fold domain, FKBP-tag, SNAP tag, Halo-tag, peptides from RNAse I.
- the peptidic antigen may comprise a protease cleavage site.
- the protease cleavage site may be recognized by thrombin, factor Xa, TEV protease or enterokinase.
- the peptidic antigen may be a small linear hydrophilic peptide.
- the small linear hydrophilic peptide may comprise a linker.
- the small linear hydrophilic peptide may be a hydrophilic target peptide (HTP).
- the small linear hydrophilic peptide may comprise the sequence GGGGSDYKDDDDK (SEQ ID NO: 5).
- the small linear hydrophilic peptide may comprise the sequence GGGGSDYKDDDDKP (SEQ ID NO: 6).
- the small linear hydrophilic peptide may consist essentially of the sequence GGGGSDYKDDDDK (SEQ ID NO: 5).
- the small linear hydrophilic peptide may consist essentially of the sequence GGGGSDYKDDDDKP (SEQ ID NO: 6).
- the small linear hydrophilic peptide may be at least about 50% homologous to SEQ ID NOs: 5 or 6.
- the small linear hydrophilic peptide may be at least about 60% homologous to SEQ ID NOs: 5 or 6.
- the small linear hydrophilic peptide may be at least about 70% homologous to SEQ ID NOs: 5 or 6.
- the small linear hydrophilic peptide may be at least about 80% homologous to SEQ ID NOs: 5 or 6.
- the small linear hydrophilic peptide may be at least about 85% homologous to SEQ ID NOs: 5 or 6.
- the small linear hydrophilic peptide may be at least about 90% homologous to SEQ ID NOs: 5 or 6.
- the small linear hydrophilic peptide may have reduced non-specific binding relative to other peptides known in the art.
- the small linear hydrophilic peptide may have reduced non-specific binding and reduced fusion protein instability relative to other peptides disclosed herein.
- the peptidic antigen may comprise a FLAG® tag (SEQ ID NO: 7) or a derivative or a homolog thereof.
- the peptide may be based on or derived from a naturally occurring peptide.
- the peptide may be based on or derived from a human peptide.
- the peptide may be based on or derived from an peptide expressed in animal selected from a chimpanzee, a monkey, a rat, a mouse, a bird, a fish, a pig, a horse, a cow, a goat, a chicken, a rabbit and a guinea pig.
- the peptide may be based on or derived from a mammalian peptide.
- the peptide may be based on or derived from a non-mammalian peptide.
- the peptide may be based on or derived from a peptide expressed in a plant.
- the peptide may be based on or derived from a peptide expressed in a bacterium.
- the peptide may be based on or derived from a prokaryotic peptide.
- the peptide may be based on or derived from a eukaryotic peptide.
- the peptide may be based on or derived from a peptide expressed by a yeast.
- the peptidic antigen may comprise a yeast transcription factor GCN4 peptide or a derivative or a homolog thereof.
- the yeast transcription factor GCN4 peptide may comprise the sequence RMKQLEPKVEELLPKNYHLENEVARLKKLVGER (SEQ ID NO: 2).
- the yeast transcription factor GCN4 peptide may comprise the sequence NYHLENEVARLKKL (SEQ ID NO: 3).
- the yeast transcription factor GCN4 peptide may consist essentially of the sequence RMKQLEPKVEELLPKNYHLENEVARLKKLVGER (SEQ ID NO: 2).
- the yeast transcription factor GCN4 peptide may consist essentially of the sequence NYHLENEVARLKKL (SEQ ID NO: 3).
- the yeast transcription factor GCN4 peptide may comprise a portion of SEQ ID NO. 2.
- the portion of SEQ ID NO. 2 may be at least 4 amino acids long.
- the portion of SEQ ID NO. 2 may be about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12 or about 13 amino acids long.
- the yeast transcription factor GCN4 peptide may be at least about 50% homologous to SEQ ID NOs: 2 or 3.
- the yeast transcription factor GCN4 peptide may be at least about 60% homologous to SEQ ID NOs: 2 or 3.
- the yeast transcription factor GCN4 peptide may be at least about 70% homologous to SEQ ID NOs: 2 or 3.
- the yeast transcription factor GCN4 peptide may be at least about 80% homologous to SEQ ID NOs: 2 or 3.
- the yeast transcription factor GCN4 peptide may be at least about 85% homologous to SEQ ID NOs: 2 or 3.
- the yeast transcription factor GCN4 peptide may be at least about 90% homologous to SEQ ID NOs: 2 or 3.
- the CAR-EC switch may comprise a yeast GCN4 peptide and one or more linkers.
- the CAR-EC switch may comprise SEQ ID NO. 4.
- the targeting moiety may bind to a cell surface molecule on a target.
- the cell surface molecule may comprise an antigen.
- the cell surface molecule may be selected from a protein, a lipid moiety, a glycoprotein, a glycolipid, a carbohydrate, a polysaccharide, a nucleic acid, an MHC-bound peptide, or a combination thereof.
- the cell surface molecule may comprise parts (e.g., coats, capsules, cell walls, flagella, fimbrae, and toxins) of bacteria, viruses, and other microorganisms.
- the cell surface molecule may be expressed by the target cell.
- the cell surface molecule may not be expressed by the target cell.
- the cell surface molecule may be a ligand expressed by a cell that is not the target cell and that is bound to the target cell or a cell surface molecule of the target cell.
- the cell surface molecule may be a toxin, exogenous molecule or viral protein that is bound to a cell surface or cell surface receptor of the target cell.
- the targeting polypeptide may be a targeting antibody or antibody fragment.
- the targeting antibody or antibody fragment may be an immunoglobulin (Ig).
- the immunoglobulin may selected from an IgG, an IgA, an IgD, an IgE, an IgM, a fragment thereof or a modification thereof.
- the immunoglobulin may be IgG.
- the IgG may be IgG1.
- the IgG may be IgG2.
- the IgG may have one or more Fc mutations for modulating endogenous T cell FcR binding to the CAR-EC switch.
- the IgG may have one or more Fc mutations for removing the Fc binding capacity to the FcR of FcR-positive cells.
- the one or more Fc mutations may remove a glycosylation site.
- the one or more Fc mutations may be selected from E233P, L234V, L235A, delG236, A327G, A330S, P331 S, N297Q and any combination thereof.
- the one or more Fc mutations may be in IgG1.
- the one or more Fc mutations in the IgG1 may be L234A, L235A, or both. Alternatively, or additionally, the one or more Fc mutations in the IgG1 may be L234A, L235E, or both. Alternatively, or additionally, the one or more Fc mutations in the IgG1 may be N297A. Alternatively, or additionally, the one or more mutations may be in IgG2.
- the one or more Fc mutations in the IgG2 may be V234A, V237A, or both.
- the targeting antibody or antibody fragment may be an Fc null immunoglobulin or a fragment thereof.
- antibody fragment refers to any form of an antibody other than the full-length form.
- Antibody fragments herein include antibodies that are smaller components that exist within full-length antibodies, and antibodies that have been engineered.
- Antibody fragments include, but are not limited to, Fv, Fc, Fab, and (Fab′)2, single chain Fv (scFv), diabodies, triabodies, tetrabodies, bifunctional hybrid antibodies, CDR1, CDR2, CDR3, combinations of CDRs, variable regions, framework regions, constant regions, heavy chains, light chains, alternative scaffold non-antibody molecules, and bispecific antibodies.
- Fab′ single chain Fv
- the targeting antibody fragment may be human, fully human, humanized, human engineered, non-human, and/or chimeric antibody.
- the non-human antibody may be humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody.
- Chimeric antibodies may refer to antibodies created through the joining of two or more antibody genes which originally encoded for separate antibodies.
- a chimeric antibody may comprise at least one amino acid from a first antibody and at least one amino acid from a second antibody, wherein the first and second antibodies are different. At least a portion of the antibody or antibody fragment may be from a bovine species, a human species, or a murine species.
- At least a portion of the antibody or antibody fragment may be from a rat, a goat, a guinea pig or a rabbit. At least a portion of the antibody or antibody fragment may be from a human. At least a portion of the antibody or antibody fragment antibody may be from cynomolgus monkey.
- the targeting antibody or antibody fragment may be based on or derived from an antibody or antibody fragment from a mammal, bird, fish, amphibian, reptile.
- Mammals include, but are not limited to, carnivores, rodents, elephants, marsupials, rabbits, bats, primates, seals, anteaters, cetaceans, odd-toed ungulates and even-toed ungulates.
- the mammal may be a human, non-human primate, mouse, sheep, cat, dog, cow, horse, goat, or pig.
- the targeting antibody or an antibody fragment may target an antigen selected from, by non-limiting example, CD19, Her2, CLL-1, CD33, EGFRvIII, CD20, CD22, BCMA or a fragment thereof.
- the antigen may comprise a wildtype antigen.
- the antigen may comprise one or more mutations.
- the targeting antibody or antibody fragment may be an anti-CD19 antibody or a fragment thereof.
- the targeting polypeptide may be an anti-CD22 antibody.
- the targeting polypeptide may be an anti-BCMA antibody or a fragment thereof.
- the targeting polypeptide may be an anti-CS1 antibody or a fragment thereof.
- the targeting polypeptide may be an anti-EGFRvIII antibody or a fragment thereof.
- the targeting polypeptide may be an anti-Her2 antibody or a fragment thereof.
- the targeting polypeptide may comprise an anti-CD20 antibody or antibody fragment.
- the targeting polypeptide may comprise rituximab.
- the targeting polypeptide may comprise an anti-EGFR antibody or antibody fragment.
- the targeting polypeptide may comprise an anti-CEA antibody or antibody fragment.
- the targeting polypeptide may comprise an anti-CLL-1 antibody or antibody fragment.
- the targeting polypeptide may comprise an anti-CD33 antibody or antibody fragment.
- the targeting polypeptide may not comprise an anti-EpCAM antibody or fragment
- the targeting antibody or antibody fragment may be selected any commercially available antibody.
- the targeting antibody or antibody fragment may be selected from ado-trastuzumab emtansine, alemtuzumab, bevacizumab, brentuximab, vedotin, gemtuzumab, ozogamicin, ipilimumab, ibritumomab, tiuxetan, panitumumab, cetuximab, erbitux, rituximab, trastuzumab and fragments thereof.
- the targeting antibody or antibody fragment may comprise an anti-CD19 antibody or fragment thereof.
- the targeting antibody or fragment thereof may comprise a light chain of the anti-CD19 antibody or fragment thereof.
- the light chain of the anti-CD19 antibody or fragment thereof may be encoded by a nucleotide sequence based on or derived from SEQ ID NO. 8.
- the nucleotide sequence may be about 99%, about 98%, about 97%, about 96%, about 95%, about 92%, about 90%, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, about 10%, about 5% or about 2% homologous to SEQ ID NO. 8.
- the targeting antibody or fragment thereof may comprise a heavy chain of the anti-CD19 antibody or fragment thereof.
- the heavy chain of the anti-CD19 antibody or fragment thereof may be encoded by a sequence based on or derived from SEQ ID NO. 9.
- the nucleotide sequence may be about 99%, about 98%, about 97%, about 96%, about 95%, about 92%, about 90%, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, about 10%, about 5% or about 2% homologous to SEQ ID NO. 9.
- the targeting antibody or antibody fragment may comprise an anti-CD19 antibody or fragment thereof.
- the targeting antibody or fragment thereof may comprise a light chain of the anti-CD19 antibody or fragment thereof.
- the light chain of the anti-CD19 antibody or fragment may comprise an amino acid sequence based on or derived from SEQ ID NO. 27.
- the amino acid sequence may be about 99%, about 98%, about 97%, about 96%, about 95%, about 92%, about 90%, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, about 10%, about 5% or about 2% homologous to SEQ ID NO. 27.
- the targeting antibody or fragment thereof may comprise a heavy chain of the anti-CD19 or fragment thereof.
- the targeting antibody or fragment thereof may comprise a heavy chain of an anti-CD19 IgG.
- the heavy chain of the anti-CD19 IgG may comprise a sequence based on or derived from SEQ ID NO. 28.
- the amino acid sequence may be about 99%, about 98%, about 97%, about 96%, about 95%, about 92%, about 90%, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, about 10%, about 5% or about 2% homologous to SEQ ID NO. 28.
- the targeting antibody or fragment thereof may comprise a heavy chain of an anti-CD19 Fab.
- the heavy chain of the anti-CD19 Fab may comprise a sequence based on or derived from SEQ ID NO. 29.
- the amino acid sequence may be about 99%, about 98%, about 97%, about 96%, about 95%, about 92%, about 90%, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, about 10%, about 5% or about 2% homologous to SEQ ID NO. 29.
- the targeting antibody or antibody fragment may comprise a nucleotide sequence selected from SEQ ID NOs: 8-20.
- the targeting polypeptide may be based on or derived from a nucleotide selected from SEQ ID NOs: 8-20.
- the targeting antibody or antibody fragment may comprise an amino acid sequence selected from SEQ ID NOs: 21-29.
- the targeting polypeptide may be based on or derived from an amino acid sequence selected from SEQ ID NOs: 21-29.
- CAR-EC chimeric antigen receptor effector cell
- T cell and the target cell are bound to the CAR-EC switch, the T cell may produce an immune response that has a cytotoxic effect on the target cell.
- the CAR-EC switches may interact with a plurality of target cells.
- the target cell may be an infected cell.
- the target cell may be a pathogenically infected cell.
- the target cell may be a diseased cell.
- the target cell may be a genetically-modified cell.
- the target cell may not be a host cell.
- the target cell may come from an invading organism (e.g. yeast, worm, bacteria, fungus).
- Further disclosed herein are CAR-EC switches that interact with a molecule on a non-cell target.
- the non-cell target may be a virus or a portion thereof.
- the non-cell target may be a fragment of a cell.
- the non-cell target may be an extracellular matrix component or protein.
- the target cell may be derived from a tissue.
- the tissue may be selected from brain, esophagus, breast, colon, lung, glia, ovary, uterus, testes, prostate, gastrointestinal tract, bladder, liver, thymus, bone and skin.
- the target cell may be derived from one or more endocrine glands.
- the target cell may be derived from one or more endocrine glands.
- the endocrine gland may be a lymph gland, pituitary gland, thyroid gland, parathyroid gland, pancreas, gonad or pineal gland.
- the target cell may be selected from a stem cell, a pluripotent cell, a hematopoietic stem cell or a progenitor cell.
- the target cell may a circulating cell.
- the target cell may be an immune cell.
- the target cell may be a cancer stem cell.
- the target cell may be a cancer cell.
- the cancer cell may be derived from a tissue.
- the tissue may be selected from, by way of non-limiting example, a brain, an esophagus, a breast, a colon, a lung, a glia, an ovary, a uterus, a testicle, a prostate, a gastrointestinal tract, a bladder, a liver, a thyroid and skin.
- the cancer cell may be derived from bone.
- the cancer cell may be derived from blood.
- the cancer cell may be derived from a B cell, a T cell, a monocyte, a thrombocyte, a leukocyte, a neutrophil, an eosinophil, a basophil, a lymphocyte, a hematopoietic stem cell or an endothelial cell progenitor.
- the cancer cell be derived from a CD19-positive B lymphocyte.
- the cancer cell may be derived from a stem cell.
- the cancer cell may be derived from a pluripotent cell.
- the cancer cell may be derived from one or more endocrine glands.
- the endocrine gland may be a lymph gland, pituitary gland, thyroid gland, parathyroid gland, pancreas, gonad or pineal gland.
- the cancer cell may be a CD19-positive cell.
- the cancer cell may be a CD19-positive B lymphocyte.
- the cancer cell may be a Her2-positive cell.
- the Her2-positive cell may be a Her2-positive breast cancer cell.
- the target cell may be a BCMA-positive cell.
- the cancer cell may be a BCMA-positive multiple myeloma cell.
- the cancer cell may be a CS1-positive cell.
- the CS1-positive cell may be a multiple myeloma cell.
- the cancer cell may be a EGFRvIII-positive cell.
- the cancer cell may be a EGFRvIII-positive glioblastoma cell.
- the cancer cell may be a CD20-positive cell.
- the cancer cell may be a CD22-positive cell.
- the cell surface molecule may be an antigen.
- the antigen may be at least a portion of a surface antigen or a cell surface marker on a cell.
- the antigen may be a receptor or a co-receptor on a cell.
- the antigen may refer to a molecule or molecular fragment that may be bound by a major histocompatibility complex (MHC) and presented to a T-cell receptor.
- MHC major histocompatibility complex
- the term “antigen” may also refer to an immunogen.
- the immunogen may provoke an adaptive immune response if injected on its own into a subject.
- the immunogen may induce an immune response by itself.
- the antigen may be a superantigen, T-dependent antigen or a T-independent antigen.
- the antigen may be an exogenous antigen.
- Exogenous antigens are typically antigens that have entered the body from the outside, for example by inhalation, ingestion, or injection. Some antigens may start out as exogenous antigens, and later become endogenous (for example, intracellular viruses).
- the antigen may be an endogenous antigen.
- the endogenous antigen may be an antigen that has been generated within cells as a result of normal cell metabolism, or because of pathogenic infections (e.g., viral, bacterial, fungal, parasitic).
- the antigen may be an autoantigen.
- the autoantigen may be a normal protein or complex of proteins (and sometimes DNA or RNA) that is recognized by the immune system of patients suffering from a specific autoimmune disease.
- the antigen should, under normal conditions, not be the target of the immune system, but, due to genetic and/or environmental factors, the normal immunological tolerance for such an antigen is not present in these patients.
- the antigen may be present or over-expressed due to a condition or disease.
- the condition or disease may be a cancer or a leukemia.
- the condition may be an inflammatory disease or condition.
- the condition or disease may be a metabolic disease.
- the condition may be a genetic disorder.
- the cell surface molecule may be an antigen that has been designated as a tumor antigen.
- Tumor antigens or neoantigens may be antigens that are presented by MHC I or MHC II molecules on the surface of tumor cells. These antigens may sometimes be presented by tumor cells and never by the normal ones. In this case, they are called tumor-specific antigens (TSAs) and, in general, result from a tumor-specific mutation. More common are antigens that are presented by tumor cells and normal cells, and they are called tumor-associated antigens (TAAs). Cytotoxic T lymphocytes that recognize these antigens may be able to destroy the tumor cells before they proliferate or metastasize.
- TSAs tumor-specific antigens
- TAAs tumor-associated antigens
- Tumor antigens may also be on the surface of the tumor in the form of, for example, a mutated receptor, in which case they may be recognized by B cells.
- tumor antigen Unless otherwise specified, the terms “tumor antigen,” “tumor specific antigen” and “tumor associated antigen,” are used interchangeably herein.
- the cell surface molecule may be a receptor.
- the receptor may be an extracellular receptor.
- the receptor may be a cell surface receptor.
- the receptor may bind a hormone, a neurotransmitter, a cytokine, a growth factor or a cell recognition molecule.
- the receptor may be a transmembrane receptor.
- the receptor may be an enzyme-linked receptor.
- the receptor may be a G-protein couple receptor (GPCR).
- GPCR G-protein couple receptor
- the receptor may be a growth factor receptor.
- the growth factor receptor may be selected from an epidermal growth factor receptor, a fibroblast growth factor receptor, a platelet derived growth factor receptor, a nerve growth factor receptor, a transforming growth factor receptor, a bone morphogenic protein growth factor receptor, a hepatocyte growth factor receptor, a vascular endothelial growth factor receptor, a stem cell factor receptor, an insulin growth factor receptor, a somatomedin receptor, an erythropoietin receptor and homologs and fragments thereof.
- the receptor may be a hormone receptor.
- the receptor may be an insulin receptor.
- the receptor may selected from an eicosanoid receptor, a prostaglandin receptor, an estrogen receptor, a follicle stimulating hormone receptor, a progesterone receptor, a growth hormone receptor, a gonadotropin-releasing hormone receptor, homologs thereof and fragments thereof.
- the receptor may be an adrenergic receptor.
- the receptor may be an integrin.
- the receptor may be an Eph receptor.
- the receptor may be a luteinizing hormone receptor.
- the cell surface molecule may be at least about 50% homologous to a luteinizing hormone receptor.
- the receptor may be an immune receptor.
- the immune receptor may be selected from a pattern recognition receptor, a toll-like receptor, a NOD like receptor, a killer activated receptor, a killer inhibitor receptor, an Fc receptor, a B cell receptor, a complement receptor, a chemokines receptor and a cytokine receptor.
- the cytokine receptor may be selected from an interleukin receptor, an interferon receptor, a transforming growth factor receptor, a tumor necrosis factor receptor, a colony stimulating factor receptor, homologs thereof and fragments thereof.
- the receptor may be a receptor kinase.
- the receptor kinase may be a tyrosine kinase receptor.
- the receptor kinase may be a serine kinase receptor.
- the receptor kinase may be a threonine kinase receptor.
- the receptor kinase may activate a signaling protein selected from a Ras, a Raf, a PI3K, a protein kinase A, a protein kinase B, a protein kinase C, an AKT, an AMPK, a phospholipase, homologs thereof and fragments thereof.
- the receptor kinase may activate a MAPK/ERK signaling pathway.
- the receptor kinase may activate Jak, Stat or Smad.
- the cell surface molecule may be a non-receptor cell surface protein.
- the cell surface molecule may be a cluster of differentiation proteins.
- the cell surface molecule may be selected from CD34, CD31, CD117, CD45, CD11b, CD15, CD24, CD114, CD182, CD14, CD11a, CD91, CD16, CD3, CD4, CD25, CD8, CD38, CD22, CD61, CD56, CD30, CD13, CD33, fragments thereof, and homologs thereof.
- the cell surface molecule may be a molecule that does not comprise a peptide.
- the cell surface molecule may comprise a lipid.
- the cell surface molecule may comprise a lipid moiety or a lipid group.
- the lipid moiety may comprise a sterol.
- the lipid moiety may comprise a fatty acid.
- the antigen may comprise a glycolipid.
- the cell surface molecule may comprise a carbohydrate.
- CAR-EC switches comprising (a) a chimeric antigen receptor binding peptidic antigen comprising a peptide from a yeast transcription factor peptide; and (b) a targeting polypeptide.
- the yeast transcription factor peptide may be a GCN4 peptide.
- the targeting polypeptide may comprise a targeting antibody or antibody fragment.
- the targeting antibody or antibody fragment may comprise a heavy chain of an antibody.
- the targeting antibody or antibody fragment may comprise a light chain of an antibody.
- the targeting antibody or antibody fragment may comprise a Fab of an antibody.
- the targeting antibody or antibody fragment may comprise an anti-CD19 antibody or a fragment thereof.
- the targeting antibody or antibody fragment may comprise an anti-Her2 antibody or a fragment thereof.
- the targeting antibody or antibody fragment may be selected from an anti-CS1 antibody, an anti-BCMA antibody, an anti-EGFRvIII antibody, an anti-CD20 antibody, an anti-EGFR antibody, an anti-CEA antibody, an anti-CLL-1 antibody, an anti-CD33 antibody and fragments thereof.
- CAR-EC switches comprising (a) a CAR binding region comprising a hydrophilic target peptide (HTP) tag; and (b) a targeting polypeptide.
- the targeting polypeptide may comprise a targeting antibody or antibody fragment.
- the targeting antibody or antibody fragment may comprise a heavy chain of an antibody.
- the targeting antibody or antibody fragment may comprise a light chain of an antibody.
- the targeting antibody or antibody fragment may comprise a Fab of an antibody.
- the targeting antibody or antibody fragment may comprise an anti-CD19 antibody or a fragment thereof.
- the targeting antibody or antibody fragment may comprise an anti-Her2 antibody or a fragment thereof.
- the targeting antibody or antibody fragment may be selected from an anti-CS1 antibody, an anti-BCMA antibody, an anti-EGFRvIII antibody, an anti-CD20 antibody, an anti-EGFR antibody, an anti-CEA antibody, an anti-CLL-1 antibody, an anti-CD33 antibody and fragments thereof.
- the chimeric antigen receptor-effector cell switch may comprise a heavy chain selected from SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO. 34, SEQ ID NO. 35 and SEQ ID NO. 38.
- the chimeric antigen receptor-effector cell switch may comprise a heavy chain that is at least 50% homologous to a sequence selected from SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO. 34, SEQ ID NO. 35 and SEQ ID NO. 38.
- the chimeric antigen receptor-effector cell switch may comprise a heavy chain that is at least 60% homologous to a sequence selected from SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO. 34, SEQ ID NO. 35 and SEQ ID NO. 38.
- the chimeric antigen receptor-effector cell switch may comprise a heavy chain that is at least 70% homologous to a sequence selected from SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO. 34, SEQ ID NO. 35 and SEQ ID NO. 38.
- the chimeric antigen receptor-effector cell switch may comprise a heavy chain that is at least 80% homologous to a sequence selected from SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO. 34, SEQ ID NO. 35 and SEQ ID NO. 38.
- the chimeric antigen receptor-effector cell switch may comprise a heavy chain that is at least 90% homologous to a sequence selected from SEQ ID NO. 32, SEQ ID NO. 33, SEQ ID NO. 34, SEQ ID NO. 35 and SEQ ID NO. 38.
- the chimeric antigen receptor-effector cell switch may comprise a light chain selected from SEQ ID NO. 30, SEQ ID NO. 31, SEQ ID NO. 36 and SEQ ID NO. 37.
- the chimeric antigen receptor-effector cell switch may comprise a light chain that is at least 50% homologous to a sequence selected from SEQ ID NO. 30, SEQ ID NO. 31, SEQ ID NO. 36 and SEQ ID NO. 37.
- the chimeric antigen receptor-effector cell switch may comprise a light chain that is at least 60% homologous to a sequence selected from SEQ ID NO. 30, SEQ ID NO. 31, SEQ ID NO. 36 and SEQ ID NO. 37.
- the chimeric antigen receptor-effector cell switch may comprise a light chain that is at least 70% homologous to a sequence selected from SEQ ID NO. 30, SEQ ID NO. 31, SEQ ID NO. 36 and SEQ ID NO. 37.
- the chimeric antigen receptor-effector cell switch may comprise a light chain that is at least 80% homologous to a sequence selected from SEQ ID NO. 30, SEQ ID NO. 31, SEQ ID NO. 36 and SEQ ID NO. 37.
- the chimeric antigen receptor-effector cell switch may comprise a light chain that is at least 90% homologous to a sequence selected from SEQ ID NO. 30, SEQ ID NO. 31, SEQ ID NO. 36 and SEQ ID NO. 37.
- the chimeric antigen receptor-effector cell switch may comprise a heavy chain of SEQ ID NO. 29 and a light chain of SEQ ID NO. 30.
- the chimeric antigen receptor-effector cell switch may comprise a heavy chain of SEQ ID NO. 29 and a light chain of SEQ ID NO. 36.
- the chimeric antigen receptor-effector cell switch may comprise a heavy chain of SEQ ID NO. 28 and a light chain of SEQ ID NO. 31.
- the chimeric antigen receptor-effector cell switch may comprise a heavy chain of SEQ ID NO. 32 and a light chain of SEQ ID NO. 27.
- the chimeric antigen receptor-effector cell switch may comprise a heavy chain of SEQ ID NO. 33 and a light chain of SEQ ID NO. 27.
- the chimeric antigen receptor-effector cell switch may comprise a heavy chain of SEQ ID NO. 34 and a light chain of SEQ ID NO. 27.
- the chimeric antigen receptor-effector cell switch may comprise a heavy chain of SEQ ID NO. 35 and a light chain of SEQ ID NO. 27.
- the chimeric antigen receptor-effector cell switch may comprise a heavy chain of SEQ ID NO. 38 and a light chain of SEQ ID NO. 37.
- CAR-EC switches comprising a chimeric antigen receptor binding peptidic antigen (CAR-BP) and a targeting polypeptide.
- CAR-BP chimeric antigen receptor binding peptidic antigen
- a targeting polypeptide a chimeric antigen receptor binding peptidic antigen
- these switches could further comprise additional targeting polypeptides and/or additional CAR-BPs.
- One or more CAR-BPs may be grafted into one or more grafting sites of the targeting polypeptide.
- One or more CAR-BPs may be fused to one or more termini of the targeting polypeptide. This may be advantageous, as several grafting/fusing sites may be predicted to provide optimal binding of the CAR-BP to the CAR.
- a first CAR-BP may be grafted into a first domain of the targeting polypeptide and a second CAR-BP may be grafted into a second domain of the targeting polypeptide.
- the first domain and the second domain may be the same.
- the first domain and the second domain may be different.
- the first CAR-BP may be grafted into a light chain of a targeting antibody or antibody fragment and a second CAR-BP may be grafted into heavy chain of the targeting antibody or antibody fragment.
- the first CAR-BP may be fused to a first terminus of the targeting polypeptide and a second CAR-BP may be fused to a second terminus of the targeting polypeptide.
- the first CAR-BP may be fused to a C terminus of a light chain of a targeting antibody or antibody fragment and a second CAR-BP may be fused to an N terminus of a heavy chain of the targeting antibody or antibody fragment.
- the first CAR-BP may be fused to a terminus of the targeting polypeptide and a second CAR-BP may be grafted within a domain of the targeting polypeptide.
- the first CAR-BP and the second CAR-BP may be the same or similar, such that the CAR-EC switch may be used with a CAR-EC cell that expresses one CAR.
- the first CAR-BP and the second CAR-BP may be different, such that the CAR-EC switch may be used with a CAR-EC cell that expresses one or more CARs or multiple CAR-EC cells that express different CARs.
- the peptide switches disclosed herein may comprise one or more CAR-BPs.
- the peptide switches disclosed herein may comprise two or more CAR-BPs.
- the peptide switches disclosed herein may comprise three or more CAR-BPs.
- the peptide switches disclosed herein may comprise 1, 2, 3, 4, 5, 6, 7 or more CAR-BPs.
- the one or more CAR-BPs may be fused or grafted to the targeting polypeptide via one or more linkers.
- the peptide switches disclosed herein may comprise one or more linkers (e.g., L1, L2).
- the peptide switches disclosed herein may comprise two or more linkers.
- the peptide switches disclosed herein may comprise three or more linkers.
- the peptide switches disclosed herein may comprise 1, 2, 3, 4, 5, 6, 7 or more linkers.
- CAR-EC switches comprising a CAR binding region and a targeting moiety, wherein the CAR binding region is a CAR-binding peptidic antigen and the targeting moiety is a non-peptidic small molecule.
- the non-peptidic small molecule may be a cell-targeting molecule, a chemical ligand, a nucleic acid, a vitamin, a substrate or a substrate analog.
- the non-peptidic small molecule may not comprise two amino acids, wherein the two amino acids are connected by an amide bond.
- the CAR-EC switch may further comprise a linker.
- the CAR-binding peptidic antigen (CAR-BP) and the small molecule may be site-specifically linked.
- the CAR-binding peptidic antigen may comprise an unnatural amino acid.
- the CAR-binding peptidic antigen and the small molecule may be site-specifically linked by the unnatural amino acid.
- the small molecule may bind a cell surface molecule on a target cell.
- the cell surface molecule may be selected from an antigen, a protein, a peptide, a lipid, a sterol, a glycolipid and a cell surface marker.
- the CAR-binding peptidic antigen may be selected from FLAG® tag, yeast transcription factor GCN4 and a hydrophilic target peptide (HTP).
- the small molecule may be 2-[3-(1,3-dicarboxypropyl)ureido]pentanedioic acid.
- the small molecule may be folate.
- the CAR-EC switch may further comprise a linker.
- CAR-EC switches comprising conjugating the CAR binding region to the targeting moiety, wherein the CAR-EC switches comprise a CAR binding region and a targeting moiety, wherein the CAR binding region is a CAR-binding peptidic antigen and the targeting moiety is a small molecule.
- the method may further comprise conjugating the small molecule to the linker to create a small molecule-linker intermediate.
- the small molecule or the small molecule-linker intermediate may comprise one or more reactive functional groups that may react with a complementary reactive functional group on the CAR-BP, previous to incorporation into the CAR-EC switch.
- the linker or the small molecule-linker intermediate may be bifunctional.
- the linker or the small molecule-linker intermediate may be heterobifunctional.
- the small molecule-linker intermediate or the CAR-EC switch may be the product of a bioorthogonal reaction, non-limiting examples of which are reviewed in Kim et al., Curr Opin Chem Bio 17:412-419 (2013).
- the small molecule-linker intermediate, linker or the CAR-EC switch may comprise an oxime, a tetrazole, a Diels Alder adduct, a hetero Diels Alder adduct, an aromatic substitution reaction product, a nucleophilic substitution reaction product, an ester, an amide, a carbamate, an ether, a thioether, or a Michael reaction product.
- the small molecule-linker intermediate, linker or the CAR-EC switch be a cycloaddition product, a metathesis reaction product, a metal-mediated cross-coupling reaction product, a radical polymerization product, an oxidative coupling product, an acyl-transfer reaction product, or a photo click reaction product.
- the cycloaddition may be a Huisgen-cycloaddition.
- the cycloaddition may be a copper-free [3+2] Huisgen-cycloaddition.
- the cycloaddition may be a Diels-Alder reaction.
- the cycloaddition may be a hetero Diels-Alder reaction.
- the small molecule-linker intermediate may be the product of an enzyme-mediated reaction.
- the small molecule-linker intermediate may be a product of a transglutaminase-mediated reaction, non-limiting examples of which are described in Lin et al., J. Am. Chem. Soc. 128:4542-4543 (2006) and WO 2013/093809.
- the small molecule-linker intermediate, linker or the CAR-EC switch may comprise a disulfide bridge that connects two cysteine residues, such as ThioBridgeTM technology by PolyTherics.
- the small molecule-linker intermediate, linker or the CAR-EC switch may comprise a maleimide bridge that connects two amino acid residues.
- the small molecule-linker intermediate, linker or the CAR-EC switch may comprise a maleimide bridge that connects two cysteine residues.
- the small molecule-linker intermediate or linker may comprise an alkoxy-amine (or aminooxy) group, azide group and/or cyclooctyne group at one or more termini.
- the small molecule-linker intermediate or linker may comprise an alkoxy-amine at one terminus and an azide group at the other terminus.
- the small molecule-linker intermediate or linker may comprise an alkoxy-amine at one terminus and a cyclooctyne group at the other terminus.
- the alkoxy-amine may form a stable oxime with a ketone group on an amino acid.
- the alkoxy-amine may form a stable oxime with a ketone group on an unnatural amino acid.
- the ketone group may be on a p-acetyl phenylalanine (pAcF).
- the chimeric antigen receptor may comprise an extracellular domain, transmembrane domain and intracellular domain.
- the extracellular domain may bind to the peptidic antigen (e.g. CAR-BP) of the CAR-EC switch.
- the extracellular domain may comprise an antibody or antibody fragment that binds to the CAR-BP of the CAR-EC switch (a CAR-antibody).
- the CAR-antibody may comprise at least a portion of an antibody. In some instances, the CAR-antibody is not a full-length antibody.
- the CAR-antibody may comprise at least a portion of an immunoglobulin or fragment thereof.
- the immunoglobulin or fragment thereof may be selected from the group consisting of an scFv, a di-scFv, a bi-scFv, a Fab, an Fc, an F(ab′) 2 , a pFc′, a nanobody, an affibody, a DARPin, a diabody, a camelid, an engineered T cell receptor and a monobody.
- the immunoglobulin may be selected from the group consisting of an IgA1, an IgA2, an IgD, an IgM, an IgE, an IgG1, an IgG2, an IgG3, and an IgG4.
- the CAR-antibody may comprise at least a portion of a single chain variable fragment (scFv).
- the CAR-antibody may be human, fully human, humanized, human engineered, non-human, and/or chimeric antibody.
- the CAR-antibody may have a binding affinity for the CAR-BP of less than about 0.01 pM, about 0.02 pM, about 0.03 pM, about 0.04 pM, 0.05 pM, about 0.06 pM, about 0.07 pM, about 0.08 pM, about 0.09 pM, about 0.1 pM, about 0.2 pM, 0.3 pM, about 0.4 pM, about 0.5 pM, about 0.6 pM, about 0.7 pM, about 0.8 pM, about 0.9 pM or about 1 pM, about 2 pM, about 3 pM, about 4 pM, about 5 pM, about 6 pM, about 7 pM, about 8 pM, about 9 pM, about 10 pM, about 0.01 nM, about 0.02 nM, about 0.03 nM, about 0.04 nM, about 0.05 nM, about 0.06 nM, about 0.07 nM,
- the CAR-antibody may recognize a synthetic (non-naturally-occurring) peptide.
- the CAR-antibody may comprise an antibody or antibody fragment that recognizes a FLAG® tag or a fragment thereof.
- the CAR-antibody may comprise an antibody or antibody fragment that recognizes a yeast transcription factor GCN4 or a fragment thereof.
- the CAR-antibody may comprise an anti-HTP antibody or a fragment thereof.
- the transmembrane domain and/or the intracellular domain of the CAR may comprise at least a portion of a cytoplasmic signaling domain.
- the intracellular domain may comprise at least a portion of a signaling molecule selected from the group comprising CD3zeta, CD28, and 4-1BB.
- the intracellular domain may comprise an Fc receptor or a portion thereof.
- the Fc receptor or portion thereof may be CD16 or a portion thereof.
- the signaling molecule may comprise CD3zeta.
- the signaling molecule may comprise CD28.
- the signaling molecule may comprise 4-1BB.
- the intracellular domain may comprise at least a portion of CD3zeta.
- the intracellular domain may comprise at least a portion of CD28, The intracellular domain may comprise at least a portion of 4-1BB, The intracellular domain may comprise at least a portion of OX-40, The intracellular domain may comprise at least a portion of CD30, The intracellular domain may comprise at least a portion of CD40, The intracellular domain may comprise at least a portion of CD2. The intracellular domain may comprise at least a portion of CD27. The intracellular domain may comprise at least a portion of PD-1. The intracellular domain may comprise at least a portion of ICOS. The intracellular domain may comprise at least a portion of lymphocyte function-associated antigen-1 (LFA-1). The intracellular domain may comprise at least a portion of CD7.
- LFA-1 lymphocyte function-associated antigen-1
- the intracellular domain may comprise at least a portion of LIGHT.
- the intracellular domain may comprise at least a portion of NKG2C.
- the intracellular domain may comprise at least a portion of B7-H3.
- the intracellular domain may comprise at least a portion of a cytoplasmic signaling domain from one or more signaling molecules.
- the intracellular domain may comprise at least a portion of two or more cytoplasmic signaling domains.
- the two or more cytoplasmic signaling domains may be from two or more different signaling molecules.
- the intracellular domain may comprise at least a portion of three or more cytoplasmic signaling domains.
- the intracellular domain may comprise at least a portion of four or more cytoplasmic signaling domains.
- the intracellular domain may comprise at least a portion of a ligand that binds to one or more signaling molecules.
- the intracellular domain may comprise at least a portion of a ligand that binds to CD83.
- CAR-EC Chimeric Antigen Receptor Effector Cells
- the methods, platforms and kits disclosed herein may comprise one or more chimeric antigen receptor effector cells (CAR-EC) or uses thereof.
- the chimeric antigen receptor effector cells disclosed herein express a chimeric antigen receptor.
- the chimeric antigen receptor (CAR) may be any CAR disclosed herein.
- the methods, platforms or kits comprise two or more effector cells, the two or more effector cells may be of the same cell type. The two or more effector cells may be of a different cell type. The two or more effector cells may be of the same cell lineage. The two or more effector cells may be of different cell lineages.
- the two or more effector cells may comprise two or more identical CARs.
- the two or more effector cells may comprise two or more different CARs.
- the two or more effector cells may comprise two or more similar CARs.
- the effector cell may be a T cell.
- the effector cell may be a cell of a T cell lineage.
- the effector cell may be a mature T cell.
- the effector cell may be a precursor T cell.
- the effector cell may be a cytotoxic T cell.
- the effector cell may be a naive T cell.
- the effector cell may be a memory stem cell T cell (T MSC ).
- the effector cell may be a central memory T cell (T CM ).
- the effector cell may be an effector T cell (TE).
- the effector cell may be a CD4+ T cell.
- the T cell may be a CD8+ T cell.
- the effector cell may be a CD4+ and CD8+ cell.
- the effector cell may be an alpha-beta T cell.
- the effector cell may be a gamma-beta T cell.
- the effector cell may be a natural killer T cell.
- the effector cell may be an effector cell that has an effect on a target or target cell when brought into proximity of the target or target cell.
- the effector cell may be a cell that has a cytotoxic effect on a target or target cell when brought into proximity of the target or target cell.
- the effector cell may be an immune cell.
- the effector cell may be selected from a B cell, a monocyte, a thrombocyte, a leukocyte, a neutrophil, an eosinophil, a basophil, or a lymphocyte.
- the effector cell may be a lymphocyte.
- the effector cell may be a macrophage.
- the effector cell may be a phagocytic cell.
- the effector cell may be an effector B cell.
- the effector cell may be a natural killer cell.
- the effector cell may isolated or derived from a subject suffering from a disease or condition.
- the effector cell may be a cell derived from a subject to be treated with a CAR-EC switch or CAR-EC platform disclosed herein.
- the T cell may express a chimeric antigen receptor encoded by one or more polynucleotides based on or derived from SEQ ID NO: 1.
- the polynucleotide may be at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 95% identical to one or more polynucleotides based on or derived from SEQ ID NO: 1.
- the polynucleotide may be at least about 70% identical to one or more polynucleotides based on or derived from SEQ ID NO: 1.
- the polypeptide encoded by one or more polynucleotides may be based on or derived from SEQ ID NO: 1.
- the polypeptide may be encoded by a polynucleotide that is at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 95% identical to one or more polynucleotides based on or derived from SEQ ID NO: 1.
- the polynucleotide may be constitutively expressed.
- the polynucleotide may be conditionally expressed.
- a chimeric antigen receptor effector cell comprising introducing one or more polynucleotides encoding a chimeric antigen receptor or a chimeric antigen receptor complex into an effector cell.
- the effector cell may be a T cell.
- Introducing one or more polynucleotides encoding a chimeric antigen receptor or a chimeric antigen receptor complex into an effector cell may comprise transfecting the effector cell with the one or more polynucleotides.
- Introducing one or more polynucleotides encoding a chimeric antigen receptor or a chimeric antigen receptor complex into an effector cell may comprise virally infecting the effector cell with one or more viruses comprising the one or more polynucleotides encoding a chimeric antigen receptor disclosed herein.
- the virus may be a lentivirus.
- the virus may be an adenovirus.
- the virus may be a retrovirus.
- the virus may be an adeno-associated virus.
- the virus may be a self-complementary adeno-associated virus (scAAV).
- the virus may be a modified human immunodeficiency (HIV) virus.
- the virus may be a modified herpes simplex virus (HSV) virus.
- Other methods of producing the CAR-EC may comprise a method of transferring one or more polynucleotides encoding a chimeric antigen receptor into a cell, wherein the methods comprise adding a transposon, a zinc finger nuclease, a TALEN or a CRISPR to the cell.
- the transposon may be a sleeping beauty transposon.
- the one or more polynucleotides may be based on or derived from SEQ ID NO: 1.
- CAR-EC chimeric antigen receptor effector cell
- the effector cell comprises a polynucleotide encoding a chimeric antigen receptor (CAR); and a chimeric antigen receptor effector cell (CAR-EC) switch, wherein the CAR-EC switch comprises a CAR binding peptidic antigen and a targeting polypeptide and wherein the CAR-EC switch binds a cell surface molecule on a target cell.
- the CAR-EC switch may be selected from any CAR-EC switches disclosed herein.
- the CAR-EC platforms may comprise two or more CAR-EC switches.
- the CAR-EC platforms may comprise 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more CAR-EC switches.
- the CAR-EC platforms may comprise may comprise more than 20, more than 25, more than 30, more than 35, more than 40, more than 45 or more than 50 CAR-EC switches.
- the two or more switches may be selected from one or more CAR-EC switches disclosed herein or a combination thereof.
- the CAR-EC platforms disclosed herein may further comprise a first CAR-EC switch and a second CAR-EC switch, wherein the first CAR-EC switch comprises a first CAR-BP and a first targeting polypeptide and the second CAR-EC switch comprises a second CAR-BP and a second targeting polypeptide.
- the first CAR-BP and the second CAR-BP may be the same.
- the first CAR-BP and the second CAR-BP may be different.
- the first CAR-BP and the second CAR-BP may be about 99%, about 98%, about 97%, about 96%, about 95%, about 92%, about 90%, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, about 10%, about 5% or about 2% homologous.
- the first targeting polypeptide and the second targeting polypeptide may be the same.
- the first targeting polypeptide and the second targeting polypeptide may be different.
- the first targeting polypeptide and the second targeting polypeptide may be about 99%, about 98%, about 97%, about 96%, about 95%, about 92%, about 90%, about 85%, about 80%, about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, about 45%, about 40%, about 35%, about 30%, about 25%, about 20%, about 15%, about 10%, about 5% or about 2% homologous.
- kits comprising one or more CAR-EC switches disclosed herein.
- the kit may further comprise two or more CAR-EC switches.
- the kit may comprise three CAR-EC switches.
- the kit may comprise about 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 24, 30, 35, 48, 50, 55, 60, 65, 70, 75, 80, 85, 90, 96, 100, 120, 150, 200, 300, 384, 400, 500, 600, 700, 800, 900 or 1000 CAR-EC switches.
- the kit may be employed for biological research.
- the kit may be used for diagnosing a disease or a condition.
- the kit may be used for treating a disease or condition.
- the CAR-EC switches of the kit may be used with CAR-EC cells disclosed herein or existing CAR T-cells clinically used or tested.
- the kit may further comprise one or more effector cells.
- the kit may further comprise one or more CAR-EC cells.
- the CAR-EC cell may be a T cell.
- the T cell may express one or more CARs.
- the kit may further comprise a polynucleotide encoding one or more CARs.
- the kit may further comprise a vector comprising a polynucleotide encoding one or more CARs.
- the CAR may be selected from any of the CARs disclosed herein.
- the kit may comprise one or more polynucleotide encoding a CAR-EC switch disclosed herein or a portion thereof (e.g. antibody, antibody fragment, peptide).
- the polynucleotides may be DNA.
- the polynucleotides may be RNA.
- the targeting polypeptide may be an antibody or antibody fragment.
- the vector may comprise a sequence encoding a heavy chain of the antibody or antibody fragment.
- the vectors may comprise a sequence encoding a light chain of the antibody or antibody fragment.
- the vectors may comprise the sequence encoding the light chain of the antibody or antibody fragment and the sequence encoding the heavy chain of the antibody or antibody fragment.
- the light chain and the heavy chain may be expressed from the same vector.
- the light chain and the heavy chain may be expressed from two separate vectors.
- chimeric antigen receptors comprising an extracellular domain that binds to a peptide of a chimeric antigen receptor effector cell switch.
- the extracellular domain may comprise an antibody or antibody fragment.
- the antibody or antibody fragment may bind a peptidic antigen of a chimeric antigen receptor effector cell switch.
- the peptidic antigen may be a yeast peptide.
- the yeast peptide may be GCN4. f a or portions thereof may be encoded by one or more polynucleotides based on or derived from SEQ ID NO: 1.
- CARs or portions thereof may be encoded by a polynucleotide at least about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90% or 95% identical to one or more polynucleotides based on or derived from SEQ ID NO: 1.
- CARs or portions thereof encoded by a polynucleotide may be at least about 70% identical to one or more polynucleotides based on or derived from SEQ ID NO: 1.
- vectors comprising one or more polynucleotides based on or derived from SEQ ID NO: 1.
- Vectors comprising sequences encoding chimeric antigen receptors and/or chimeric antigen receptor effector cell switches and portions thereof, disclosed herein, may be selected from any commercially available expression vector.
- the expression vector may be a prokaryotic expression vector.
- the expression vector may be a eukaryotic expression vector.
- the expression vector may be a mammalian expression vector.
- the expression vector may be a viral expression vector.
- the expression vector may have a constitutive promoter for constitutive expression of the CAR and/or CAR-EC switch encoding sequences.
- the expression vector may have an inducible promoter for conditional expression of the CAR and/or CAR-EC switch encoding sequences.
- CAR-EC chimeric antigen receptor effector cell
- the methods may comprise administering a CAR-EC cell and one or more CAR-EC switches.
- the methods may comprise administering about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 15, 20, 24, 30, 35, 48, 50, 55, 60, 65, 70, 75, 80, 85, 90, 96, 100, 120, 150, 200, 300, 384, 400, 500, 600, 700, 800, 900, 1000 or more CAR-EC switches.
- the methods may comprise administering two or more CAR-EC switches.
- the two or more CAR-EC switches may comprise the same CAR-binding peptidic antigen.
- the two more CAR-EC switches may comprise the same cell targeting polypeptide.
- the two or more CAR-EC switches may comprise one or more different CAR-binding peptidic antigens.
- the two more CAR-EC switches may comprise one or more different cell targeting polypeptides.
- the methods may comprising a plurality of CAR-EC cells and one or more CAR-EC switches.
- a chimeric antigen receptor effector cell comprising administering a chimeric antigen receptor effector cell (CAR-EC) switch to the subject, wherein the CAR-EC switch comprises: a chimeric antigen receptor binding peptidic antigen (CAR-BP); and a targeting moiety that binds an antigen on a target.
- CAR-BP chimeric antigen receptor binding peptidic antigen
- the CAR-BP may be selected from a FLAG® tag, a yeast transcription factor GCN4 and a hydrophilic target peptide (HTP).
- the targeting moiety by non-limiting example may be selected from an anti-CD19 antibody, an anti-CD20 antibody, an anti-CD22 antibody, an anti-EGFR antibody, an anti-EGFRvIII antibody, an anti-Her2 antibody, an anti-CS1 antibody, an anti-BCMA antibody, an anti-CEA antibody, an anti-CLL-1 antibody and an anti-CD33 antibody.
- the methods may comprise administering one or more chimeric antigen receptor effector cells.
- the methods may comprise administering one or more T cells.
- the one or more effector cells may be selected from T cell is selected from a naive T cell, a memory stem cell T cell, a central memory T cell, an effector memory T cell, a helper T cell, a CD4+ T cell, a CD8+ T cell, a CD8/CD4+ T cell, an ⁇ T cell, a ⁇ T cell, a cytotoxic T cell, a natural killer T cell, a natural killer cell, a macrophage.
- the CAR-EC switch may have a therapeutic effect that is at least partially dependent on bringing an effector cell in proximity of a target cell.
- the therapeutic effect on the intended indication of the CAR-EC switch may be at least partially due to the CAR-EC switch recruiting an effector cell to the target cell.
- the therapeutic effect on the intended indication of the CAR-EC switch may be predominantly due to the CAR-EC switch recruiting an effector cell to the target cell.
- the therapeutic effect of the CAR-EC switch may be at least partially dependent on stimulating an immune response in the CAR-EC cell.
- Administering the CAR-EC switch may not have any therapeutic effect without further administering an effector cell.
- the CAR-EC switch may not have a significant, desirable and/or intended therapeutic effect without further administering an effector cell.
- the CAR-EC switch may not have any therapeutic effect towards an intended indication of the CAR-EC platform without further administering an effector cell.
- a portion or component of the CAR-EC switch e.g. CAR-BP or targeting moiety
- the dose of a portion or component of the CAR-EC switch e.g.
- the CAR-BP or targeting moiety when administered as part of the CAR-EC platform to provide a therapeutic effect may not have a therapeutic effect when the portion or component of the CAR-EC switch is administered alone at that dose.
- the portion or component of the CAR-EC switch may not be intended to have any therapeutic effect besides recruiting the T cell to the target cell.
- Administering the portion or component of the CAR-EC switch alone may have a therapeutic effect on the target cell, wherein the therapeutic effect is negligible relative to the therapeutic effect of administering the CAR-EC switch and the CAR-EC cell.
- Administering the portion or component of the CAR-EC switch may have a therapeutic effect on the target cell, wherein the therapeutic effect is less than the therapeutic effect of administering the CAR-EC switch and the CAR-EC cell.
- CAR-EC switches disclosed herein to treat a disease or condition in a subject in need thereof. Further disclosed herein are uses of CAR-EC switches disclosed herein in the manufacture of a medicament for the treatment of a disease.
- a switch comprising a peptidic antigen that binds a CAR (CAR-BP) on an effector cell; and a targeting polypeptide that binds an antigen on a target to treat a disease or condition in a subject in need thereof.
- a switch comprising a peptidic antigen (CAR-BP) that binds a CAR on an effector cell, wherein the CAR-BP; and a targeting polypeptide that binds an antigen on a target in the manufacture of a medicament for the treatment of a disease.
- a CAR-EC switch comprising a CAR-BP, wherein the CAR-BP comprises a hydrophilic target peptide (HTP) or derivative thereof and a targeting polypeptide, wherein the targeting polypeptide comprises an anti-CD19 antibody or fragment thereof and an effector cell comprising a CAR, wherein the CAR comprises an anti-HTP antibody, wherein the anti-CD19 antibody or fragment thereof binds CD19 on a B cell to treat a multiple myeloma.
- HTP hydrophilic target peptide
- a CAR-EC switch comprising a CAR-BP, wherein the CAR-BP comprises a yeast transcription factor GCN4 or derivative thereof and a targeting polypeptide, wherein the targeting polypeptide comprises an anti-CD19 antibody or fragment thereof; and an effector cell comprising a CAR, wherein the CAR comprises an anti-GCN4 antibody, wherein the anti-CD19 antibody or fragment thereof binds CD19 on a lymphoblast, lymphocyte or B cell, to treat an acute lymphoblastic leukemia, a chronic lymphocytic leukemia or a B-cell lymphoma.
- the disease or condition may be a cell proliferative disorder.
- the cell proliferative disorder may be selected from a solid tumor, a lymphoma, a leukemia and a liposarcoma.
- the cell proliferative disorder may be acute, chronic, recurrent, refractory, accelerated, in remission, stage I, stage II, stage III, stage IV, juvenile or adult.
- the cell proliferative disorder may be selected from myelogenous leukemia, lymphoblastic leukemia, myeloid leukemia, an acute myeloid leukemia, myelomonocytic leukemia, neutrophilic leukemia, myelodysplastic syndrome, B-cell lymphoma, burkitt lymphoma, large cell lymphoma, mixed cell lymphoma, follicular lymphoma, mantle cell lymphoma, hodgkin lymphoma, recurrent small lymphocytic lymphoma, hairy cell leukemia, multiple myeloma, basophilic leukemia, eosinophilic leukemia, megakaryoblastic leukemia, monoblastic leukemia, monocytic leukemia, erythroleukemia, erythroid leukemia and hepatocellular carcinoma.
- the cell proliferative disorder may comprise a hematological malignancy.
- the hematological malignancy may comprise a B cell malignancy.
- the cell proliferative disorder may comprise a chronic lymphocytic leukemia.
- the cell proliferative disorder may comprise an acute lymphoblastic leukemia.
- the cell proliferative disorder may comprise a CD19-positive Burkitt's lymphoma.
- the disease or condition may be a cancer, a pathogenic infection, autoimmune disease, inflammatory disease, or genetic disorder.
- the one or more diseases comprises a cancer.
- the cancer may comprise a recurrent and/or refractory cancer.
- Examples of cancers include, but are not limited to, sarcomas, carcinomas, lymphomas or leukemias.
- the cancer may comprise a neuroendocrine cancer.
- the cancer may comprise a pancreatic cancer.
- the cancer may comprise an exocrine pancreatic cancer.
- the cancer may comprise a thyroid cancer.
- the thyroid cancer may comprise a medullary thyroid cancer.
- the cancer may comprise a prostate cancer.
- the cancer may comprise an epithelial cancer.
- the cancer may comprise a breast cancer.
- the cancer may comprise an endometrial cancer.
- the cancer may comprise an ovarian cancer.
- the ovarian cancer may comprise a stromal ovarian cancer.
- the cancer may comprise a cervical cancer.
- the cancer may comprise a skin cancer.
- the skin cancer may comprise a neo-angiogenic skin cancer.
- the skin cancer may comprise a melanoma.
- the cancer may comprise a kidney cancer.
- the cancer may comprise a lung cancer.
- the lung cancer may comprise a small cell lung cancer.
- the lung cancer may comprise a non-small cell lung cancer.
- the cancer may comprise a colorectal cancer.
- the cancer may comprise a gastric cancer.
- the cancer may comprise a colon cancer.
- the cancer may comprise a brain cancer.
- the brain cancer may comprise a brain tumor.
- the cancer may comprise a glioblastoma.
- the cancer may comprise an astrocytoma.
- the cancer may comprise a blood cancer.
- the blood cancer may comprise a leukemia.
- the leukemia may comprise a myeloid leukemia.
- the cancer may comprise a lymphoma.
- the lymphoma may comprise a non-Hodgkin's lymphoma.
- the cancer may comprise a sarcoma.
- the sarcoma may comprise an Ewing's sarcoma.
- Sarcomas are cancers of the bone, cartilage, fat, muscle, blood vessels, or other connective or supportive tissue.
- Sarcomas include, but are not limited to, bone cancer, fibrosarcoma, chondrosarcoma, Ewing's sarcoma, malignant hemangioendothelioma, malignant schwannoma, bilateral vestibular schwannoma, osteosarcoma, soft tissue sarcomas (e.g.
- alveolar soft part sarcoma alveolar soft part sarcoma, angiosarcoma, cystosarcoma phylloides, dermatofibrosarcoma, desmoid tumor, epithelioid sarcoma, extraskeletal osteosarcoma, fibrosarcoma, hemangiopericytoma, hemangiosarcoma, Kaposi's sarcoma, leiomyosarcoma, liposarcoma, lymphangiosarcoma, lymphosarcoma, malignant fibrous histiocytoma, neurofibrosarcoma, rhabdomyosarcoma, and synovial sarcoma).
- Carcinomas are cancers that begin in the epithelial cells, which are cells that cover the surface of the body, produce hormones, and make up glands.
- carcinomas include breast cancer, pancreatic cancer, lung cancer, colon cancer, colorectal cancer, rectal cancer, kidney cancer, bladder cancer, stomach cancer, prostate cancer, liver cancer, ovarian cancer, brain cancer, vaginal cancer, vulvar cancer, uterine cancer, oral cancer, penile cancer, testicular cancer, esophageal cancer, skin cancer, cancer of the fallopian tubes, head and neck cancer, gastrointestinal stromal cancer, adenocarcinoma, cutaneous or intraocular melanoma, cancer of the anal region, cancer of the small intestine, cancer of the endocrine system, cancer of the thyroid gland, cancer of the parathyroid gland, cancer of the adrenal gland, cancer of the urethra, cancer of the renal pelvis, cancer of the ureter, cancer of the endometrium, cancer of the cervi
- the cancer is a lung cancer.
- Lung cancer may start in the airways that branch off the trachea to supply the lungs (bronchi) or the small air sacs of the lung (the alveoli).
- Lung cancers include non-small cell lung carcinoma (NSCLC), small cell lung carcinoma, and mesotheliomia.
- NSCLC non-small cell lung carcinoma
- Examples of NSCLC include squamous cell carcinoma, adenocarcinoma, and large cell carcinoma.
- the mesothelioma may be a cancerous tumor of the lining of the lung and chest cavity (pleura) or lining of the abdomen (peritoneum). The mesothelioma may be due to asbestos exposure.
- the cancer may be a brain cancer, such as a glioblastoma.
- the cancer may be a central nervous system (CNS) tumor.
- CNS tumors may be classified as gliomas or nongliomas.
- the glioma may be malignant glioma, high grade glioma, diffuse intrinsic pontine glioma. Examples of gliomas include astrocytomas, oligodendrogliomas (or mixtures of oligodendroglioma and astocytoma elements), and ependymomas.
- Astrocytomas include, but are not limited to, low-grade astrocytomas, anaplastic astrocytomas, glioblastoma multiforme, pilocytic astrocytoma, pleomorphic xanthoastrocytoma, and subependymal giant cell astrocytoma.
- Oligodendrogliomas include low-grade oligodendrogliomas (or oligoastrocytomas) and anaplastic oligodendriogliomas.
- Nongliomas include meningiomas, pituitary adenomas, primary CNS lymphomas, and medulloblastomas. In some instances, the cancer is a meningioma.
- the leukemia may be an acute lymphocytic leukemia, acute myelocytic leukemia, chronic lymphocytic leukemia, or chronic myelocytic leukemia. Additional types of leukemias include hairy cell leukemia, chronic myelomonocytic leukemia, and juvenile myelomonocytic leukemia.
- Lymphomas are cancers of the lymphocytes and may develop from either B or T lymphocytes.
- the two major types of lymphoma are Hodgkin's lymphoma, previously known as Hodgkin's disease, and non-Hodgkin's lymphoma.
- Hodgkin's lymphoma is marked by the presence of the Reed-Sternberg cell.
- Non-Hodgkin's lymphomas are all lymphomas which are not Hodgkin's lymphoma.
- Non-Hodgkin lymphomas may be indolent lymphomas and aggressive lymphomas.
- Non-Hodgkin's lymphomas include, but are not limited to, diffuse large B cell lymphoma, follicular lymphoma, mucosa-associated lymphatic tissue lymphoma (MALT), small cell lymphocytic lymphoma, mantle cell lymphoma, Burkitt's lymphoma, mediastinal large B cell lymphoma, Waldenströ m macroglobulinemia, nodal marginal zone B cell lymphoma (NMZL), splenic marginal zone lymphoma (SMZL), extranodal marginal zone B cell lymphoma, intravascular large B cell lymphoma, primary effusion lymphoma, and lymphomatoid granulomatosis.
- MALT mucosa-associated lymphatic tissue lymphoma
- MALT mucosa-associated lymphatic tissue lymphoma
- small cell lymphocytic lymphoma mantle cell lymphoma
- Burkitt's lymphoma mediast
- the cancer may comprise a solid tumor.
- the cancer may comprise a sarcoma.
- the cancer may be selected from a group consisting of a bladder cancer, a breast cancer, a colon cancer, a rectal cancer, an endometrial cancer, a kidney cancer, a lung cancer, melanoma, a myeloma, a thyroid cancer, a pancreatic cancer, a glioma, a malignant glioma of the brain, a glioblastoma, an ovarian cancer, and a prostate cancer.
- the cancer may have non-uniform antigen expression.
- the cancer may have modulated antigen expression.
- the antigen may be a surface antigen.
- the cancer may not comprise a myeloma.
- the cancer may not comprise a melanoma.
- the cancer may not comprise a colon cancer.
- the cancer may be acute lymphoblastic leukemia (ALL).
- the cancer may be relapsed ALL.
- the cancer may be refractory ALL.
- the cancer may be relapsed, refractory ALL.
- the cancer may be chronic lymphocytic leukemia (CLL).
- the cancer may be relapsed CLL.
- the cancer may be refractory CLL.
- the cancer may be relapsed, refractory CLL.
- the cancer may comprise a breast cancer.
- the breast cancer may be triple positive breast cancer (estrogen receptor, progesterone receptor and Her2 positive).
- the breast cancer may be triple negative breast cancer (estrogen receptor, progesterone receptor and Her2 negative).
- the breast cancer may be estrogen receptor positive.
- the breast cancer may be estrogen receptor negative.
- the breast cancer may be progesterone receptor positive.
- the breast cancer may be progesterone receptor negative.
- the breast cancer may comprise a Her2 negative breast cancer.
- the breast cancer may comprise a low-expressing Her2 breast cancer.
- the breast cancer may comprise a Her2 positive breast cancer.
- the breast cancer may comprise a breast cancer classified as Her2 0.
- the breast cancer may comprise a breast cancer classified as Her2 1+.
- the breast cancer may comprise a breast cancer classified as Her2 2+.
- the breast cancer may comprise a breast cancer classified as a Her2 3+.
- the disease or condition may be a pathogenic infection.
- Pathogenic infections may be caused by one or more pathogens.
- the pathogen is a bacterium, fungi, virus, or protozoan.
- Exemplary pathogens include but are not limited to: Bordetella, Borrelia, Brucella, Campylobacter, Chlamydia, Chlamydophila, Clostridium, Corynebacterium, Enterococcus, Escherichia, Francisella, Haemophilus, Helicobacter, Legionella, Leptospira, Listeria, Mycobacterium, Mycoplasma, Neisseria, Pseudomonas, Rickettsia, Salmonella, Shigella, Staphylococcus, Streptococcus, Treponema, Vibrio , or Yersinia .
- the disease or condition caused by the pathogen is tuberculosis and the heterogeneous sample comprises foreign molecules derived from the bacterium Mycobacterium tuberculosis and molecules derived from the subject.
- the disease or condition is caused by a bacterium is tuberculosis, pneumonia, which may be caused by bacteria such as Streptococcus and Pseudomonas , a foodborne illness, which may be caused by bacteria such as Shigella, Campylobacter and Salmonella , and an infection such as tetanus, typhoid fever, diphtheria, syphilis and leprosy.
- the disease or condition may be bacterial vaginosis, a disease of the vagina caused by an imbalance of naturally occurring bacterial flora.
- the disease or condition is a bacterial meningitis, a bacterial inflammation of the meninges (e.g., the protective membranes covering the brain and spinal cord).
- Other diseases or conditions caused by bacteria include, but are not limited to, bacterial pneumonia, a urinary tract infection, bacterial gastroenteritis, and bacterial skin infection.
- bacterial skin infections include, but are not limited to, impetigo which may be caused by Staphylococcus aureus or Streptococcus pyogenes ; erysipelas which may be caused by a streptococcus bacterial infection of the deep epidermis with lymphatic spread; and cellulitis which may be caused by normal skin flora or by exogenous bacteria.
- the pathogen may be a fungus, such as, Candida, Aspergillus, Cryptococcus, Histoplasma, Pneumocystis , and Stachybotrys .
- diseases or conditions caused by a fungus include, but are not limited to, jock itch, yeast infection, ringworm, and athlete's foot.
- the pathogen may be a virus.
- viruses include, but are not limited to, adenovirus, coxsackievirus, Epstein-Barr virus, Hepatitis virus (e.g., Hepatitis A, B, and C), herpes simplex virus (type 1 and 2), cytomegalovirus, herpes virus, HIV, influenza virus, measles virus, mumps virus, papillomavirus, parainfluenza virus, poliovirus, respiratory syncytial virus, rubella virus, and varicella-zoster virus.
- diseases or conditions caused by viruses include, but are not limited to, cold, flu, hepatitis, AIDS, chicken pox, rubella, mumps, measles, warts, and poliomyelitis.
- the pathogen may be a protozoan, such as Acanthamoeba (e.g., A. astronyxis, A. castellanii, A. culbertsoni, A. hatchetti, A. polyphaga, A. rhysodes, A. healyi, A. divionensis ), Brachiola (e.g., B connori, B. vesicularum ), Cryptosporidium (e.g., C. parvum ), Cyclospora (e.g., C. cayetanensis ), Encephalitozoon (e.g., E. cuniculi, E. hellem, E.
- Acanthamoeba e.g., A. astronyxis, A. castellanii, A. culbertsoni, A. hatchetti, A. polyphaga, A. rhysodes, A. healyi, A. divionensis
- Brachiola e.
- Entamoeba e.g., E. histolytica
- Enterocytozoon e.g., E. bieneusi
- Giardia e.g., G. lamblia
- Isospora e.g, I. belli
- Microsporidium e.g., M. africanum, M. ceylonensis
- Naegleria e.g., N. fowleri
- Nosema e.g., N. algerae, N. ocularum
- Pleistophora e.g., Trachipleistophora (e.g., T. anthropophthera, T. hominis )
- Vittaforma e.g., V. corneae
- the disease or condition may be an autoimmune disease or autoimmune related disease.
- An autoimmune disorder may be a malfunction of the body's immune system that causes the body to attack its own tissues.
- autoimmune diseases and autoimmune related diseases include, but are not limited to, Addison's disease, alopecia areata, ankylosing spondylitis, antiphospholipid syndrome (APS), autoimmune aplastic anemia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune myocarditis, Behcet's disease, celiac sprue, Crohn's disease, dermatomyositis, eosinophilic fasciitis, erythema nodosum, giant cell arteritis (temporal arteritis), Goodpasture's syndrome, Graves' disease, Hashimoto's disease, idiopathic thrombocytopenic purpura (ITP), IgA nephropathy, juvenile arthritis, diabetes, juvenile diabetes, Kawasaki syndrome, Lambert-E
- the disease or condition may be an inflammatory disease.
- inflammatory diseases include, but are not limited to, alveolitis, amyloidosis, angiitis, ankylosing spondylitis, avascular necrosis, Basedow's disease, Bell's palsy, bursitis, carpal tunnel syndrome, celiac disease, cholangitis, chondromalacia patella, chronic active hepatitis, chronic fatigue syndrome, Cogan's syndrome, congenital hip dysplasia, costochondritis, Crohn's Disease, cystic fibrosis, De Quervain's tendinitis, diabetes associated arthritis, diffuse idiopathic skeletal hyperostosis, discoid lupus, Ehlers-Danlos syndrome, familial mediterranean fever, fascitis, fibrositis/fibromyalgia, frozen shoulder, ganglion cysts, giant cell arteritis, gout, Graves' Disease, HIV-
- Methods of treatment disclosed herein may comprise off-target activity as measured by cytokine levels.
- the method may reduce the off-target activity, as measured by cytokine levels, when compared to other CAR-EC therapies.
- the method may reduce the off-target activity as measured by interferon gamma levels.
- Other off-target activities that may be reduced include toxic lymphophenia, fatal cytolysis of solid tumor targets and chronic hypogammaglobulinemia for hematological targets.
- Methods of treatment and compositions disclosed herein may be used to treat a cancer comprising CD19-mediated B cell aplasia.
- the methods and compositions may minimize the CD19-mediated B cell aplasia.
- the method may avoid long-term B-cell aplasia.
- the CAR-EC platforms, methods and compositions disclosed herein may be used to treat a heterogeneous tumor or a heterogeneous blood cell malignancy in a subject in need thereof.
- the “pan-B cell” marker CD20 is the most prevalently targeted antigen for B cell neoplasms and the FDA-approved antibody rituximab is a vital component in the treatment of many leukemias and lymphomas.
- resistance mechanisms related to modulation of CD20 antigen expression occurs in a significant number of patients. It is clear that targeting with either CD19 or CD20 antigen alone is insufficient for a curative therapy.
- the methods disclosed herein provide for construction and administration of two or more switches with different specificities (e.g.
- an anti-CD19 antibody CAR-EC switch and an anti-CD20 antibody CAR-EC switch provide for construction and administration of two or more switches with different specificities (e.g. an anti-CD19 antibody CAR-EC switch and an anti-CD22 antibody CAR-EC switch).
- This methodology may offer a significant advantage against the propensity for relapse in the clinic while avoiding persistent loss of B cells.
- a heterogeneous tumor or heterogeneous blood cell malignancy may also be treated with an anti-CD19 antibody CAR-EC switch and an anti-CD22 antibody CAR-EC switch.
- One or more CAR-EC switches may be administered sequentially or simultaneously.
- the CAR-EC switch may be administered with one or more additional therapeutic agents.
- the one or more additional therapeutic agents may be selected from a group consisting of an immunotherapy, a chemotherapy and a steroid.
- the one or more additional therapeutic agents may be a chemotherapy drug.
- the chemotherapy drug may be an alkylating agent, an antimetabolite, an anthracycline, a topoisomerase inhibitor, a mitotic inhibitor, a corticosteroid or a differentiating agent.
- the chemotherapy drug may be selected from actinomycin-D, bleomycin, altretamine, bortezomib, busulfan, carboplatin, capecitabine, carmustine, chlorambucil, cisplatin, cladribine, clofarabine, cyclophosphamide, cytarabine, dacarbazine, daunorubicin, docetaxel, doxorubicin, epirubicin, etoposide, estramustine, floxuridine, fludarabine, fluorouracil, gemcitbine (Gemzar), hydroxyurea, idarubicin, ifosfamide, irinotecan (Camptosar), ixabepilone, L-asparaginase, lomustine, mechlorethamine, melphalan, 6-mercaptopurine, methotrexate, mitomycin-C, paclitaxel (Taxol),
- the one or more additional therapeutic agents may comprise an angiogenesis inhibitor.
- the angiogenesis inhibitor may be selected from bevacizumab, itraconazole, carboxyamidotriazole, TNP-470, CM101, IFN alpha, IL-12, platelet factor 4, suramin, SU5416, thrombospondin, a VEGFR antagonist, an angiostatic steroid with heparin, CAR-ECilage-derived angiogenesis inhibitory factor, matrix metalloprotease inhibitors, angiostatin, endostatin, sorafenib, sunitinib, pazopanib, everolimus, 2-methoxyestradiol, tecogalan, tetrathiomolybdate, thalidomide, prolactin, ⁇ v ⁇ 3 inhibitor, linomide, tasquinimod, soluble VEGFR-1, soluble NRP-1, angiopoietin 2, vasostatin, calreticul
- the one or more additional therapeutic agents may comprise a hormone therapy.
- the hormone therapy may be selected from an anti-estrogen (e.g. fulvestrant (Faslodex®), tamoxifen, toremifene (Fareston®)); an aromatase inhibitor (e.g. anastrozole (Arimidex®), exemestane (Aromasin®) letrozole (Femara®); a progestin (e.g. megestrol acetate (Megace®); an estrogen; an anti-androgen (e.g.
- bicalutamide (Casode®), flutamide (Eulexin®), nilutamide (Nilandron®)); a gonadotropin-releasing hormone (GnRH) or luteinizing hormone-releasing hormone (LHRH) agonist or analog (e.g. leuprolide (Lupron®), goserelin (Zoladex®)).
- the one or more additional therapeutic agents may comprise a steroid.
- the steroid may be a corticosteroid.
- the steroid may be cortisol or a derivative thereof.
- the steroid may be selected from prednisone, methylprednisolone (Solumedrol®) or dexamethasone.
- the CAR-EC switch may be administered with one or more additional therapies.
- the one or more additional therapies may comprise laser therapy.
- the one or more additional therapies may comprise radiation therapy.
- the one or more additional therapies may comprise surgery.
- the subject may be a healthy subject.
- the subject may be suffering from a disease or condition.
- the subject may be suffering from more than one disease or condition.
- the subject may be suffering from chronic lymphocytic leukemia.
- the subject may be suffering from acute lymphoblastic leukemia.
- the subject may be an animal.
- the subject may be a mammal.
- the mammal may be a human, a chimpanzee, a gorilla, a monkey, a bovine, a horse, a donkey, a mule, a dog, a cat, a pig, a rabbit, a goat, a sheep, a rat, a hamster, a guinea pig or a mouse.
- the subject may be a bird or a chicken.
- the subject may be a human.
- the subject may be a child.
- the child may be suffering from acute lymphoblastic leukemia.
- the subject may be less than 6 months old.
- the subject may be about 1 year old, about 2 years old, about 3 years old, about 4 years old, about 5 years old, about 6 years old, about 7 years old, about 8 years old, about 9 years old, about 10 years old, about 11 years old, about 12 years old, about 13 years old, about 14 years old, about 15 years old, about 18 years old, about 20 years old, about 25 years old, about 30 years old, about 35 years old, about 40 years old, about 45 years old, about 50 years old, about 55 years old, about 60 years old, about 65 years old, about 70 years old, about 75 years old, about 80 years old, about 85 years old, about 90 years old, about 95 years old, about 100 years old or about 105 years old.
- the CAR-EC off switch may comprise an antibody or antibody fragment that targets a cell surface marker on the effector cell.
- the CAR-EC off switch may comprise a peptide that is bound by the CAR of the CAR-EC.
- the CAR-EC off switch may comprise a CAR-BP that is bound by the CAR of the CAR-EC.
- the antibody, antibody fragment or peptide of the CAR-EC off switch may be conjugated to a drug or a toxin.
- the drug or toxin may be selected from maytasine (e.g. DM1, DM4), monomethylauristatin E, monomethylauristatin F, Ki-4.dgA, dolastatin 10, calicheamicin, SN-38, duocarmycin, irinotecan, ricin, saporin, gelonin, poke weed antiviral protein, pseudomonas aeruginosa exotoxin A or diphtheria toxin.
- the toxin may comprise a poison, a bacterial toxin (e.g.
- the toxin may be a snake venom.
- the toxin may comprise vinblastine.
- the toxin may comprise auristatin.
- the toxin may be contained in a liposome membrane-coated vesicle. Wherein the toxin is contained in a liposome membrane-coated vesicle, the antibody is attached to the vesicle.
- the cell surface marker may be a viral protein or fragment thereof.
- the effector cell expresses a viral protein or fragment thereof that is not a cell surface marker.
- the effector cell expressing a viral protein or fragment thereof may be targeted with a drug.
- the drug may be selected from a group comprising abacavir, acyclovir, acyclovir, adefovir, amantadine, amprenavir, ampligen, arbidol, atazanavir, atripla, balavir, boceprevirertet, cidofovir, combivir, darunavir, delavirdine, didanosine, docosanol, edoxudine, efavirenz, emtricitabine, enfuvirtide, entecavir, an entry inhibitor, famciclovir, a fixed dose combination antiretroviral drug, fomivirsen, fo
- compositions comprising one or more of the CAR-EC switches disclosed herein.
- the compositions may further comprise one or more pharmaceutically acceptable salts, excipients or vehicles.
- Pharmaceutically acceptable salts, excipients, or vehicles for use in the present pharmaceutical compositions include carriers, excipients, diluents, antioxidants, preservatives, coloring, flavoring and diluting agents, emulsifying agents, suspending agents, solvents, fillers, bulking agents, buffers, delivery vehicles, tonicity agents, cosolvents, wetting agents, complexing agents, buffering agents, antimicrobials, and surfactants.
- Neutral buffered saline or saline mixed with serum albumin are exemplary appropriate carriers.
- the pharmaceutical compositions may include antioxidants such as ascorbic acid; low molecular weight polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as Tween, pluronics, or polyethylene glycol (PEG).
- antioxidants such as ascorbic acid
- low molecular weight polypeptides such as serum albumin, gelatin, or immunoglobulins
- hydrophilic polymers such as polyviny
- suitable tonicity enhancing agents include alkali metal halides (preferably sodium or potassium chloride), mannitol, sorbitol, and the like.
- Suitable preservatives include benzalkonium chloride, thimerosal, phenethyl alcohol, methylparaben, propylparaben, chlorhexidine, sorbic acid and the like. Hydrogen peroxide also may be used as preservative.
- Suitable cosolvents include glycerin, propylene glycol, and PEG.
- Suitable complexing agents include caffeine, polyvinylpyrrolidone, beta-cyclodextrin or hydroxy-propyl-beta-cyclodextrin.
- Suitable surfactants or wetting agents include sorbitan esters, polysorbates such as polysorbate 80, tromethamine, lecithin, cholesterol, tyloxapal, and the like.
- the buffers may be conventional buffers such as acetate, borate, citrate, phosphate, bicarbonate, or Tris-HC1.
- Acetate buffer may be about pH 4-5.5, and Tris buffer may be about pH 7-8.5. Additional pharmaceutical agents are set forth in Remington's Pharmaceutical Sciences, 18th Edition, A. R. Gennaro, ed., Mack Publishing Company, 1990.
- the composition may be in liquid form or in a lyophilized or freeze-dried form and may include one or more lyoprotectants, excipients, surfactants, high molecular weight structural additives and/or bulking agents (see, for example, U.S. Pat. Nos. 6,685,940, 6,566,329, and 6,372,716).
- a lyoprotectant is included, which is a non-reducing sugar such as sucrose, lactose or trehalose.
- the amount of lyoprotectant generally included is such that, upon reconstitution, the resulting formulation will be isotonic, although hypertonic or slightly hypotonic formulations also may be suitable.
- lyoprotectant concentrations for sugars e.g., sucrose, lactose, trehalose
- sugars e.g., sucrose, lactose, trehalose
- concentrations for sugars in the pre-lyophilized formulation are from about 10 mM to about 400 mM.
- a surfactant is included, such as for example, nonionic surfactants and ionic surfactants such as polysorbates (e.g., polysorbate 20, polysorbate 80); poloxamers (e.g., poloxamer 188); poly(ethylene glycol) phenyl ethers (e.g., Triton); sodium dodecyl sulfate (SDS); sodium laurel sulfate; sodium octyl glycoside; lauryl-, myristyl-, linoleyl-, or stearyl-sulfobetaine; lauryl-, myristyl-, linoleyl- or stearyl-sarcosine; linoleyl, myristyl-, or cetyl-betaine; lauroamidopropyl-, cocamidopropyl-, linoleamidopropyl-, myristamidopropyl-, and surfact
- surfactant that may be present in the pre-lyophilized formulation are from about 0.001-0.5%.
- High molecular weight structural additives may include for example, acacia , albumin, alginic acid, calcium phosphate (dibasic), cellulose, carboxymethylcellulose, carboxymethylcellulose sodium, hydroxyethylcellulose, hydroxypropylcellulose, hydroxypropylmethylcellulose, microcrystalline cellulose, dextran, dextrin, dextrates, sucrose, tylose, pregelatinized starch, calcium sulfate, amylose, glycine, bentonite, maltose, sorbitol, ethylcellulose, disodium hydrogen phosphate, disodium phosphate, disodium pyrosulfite, polyvinyl alcohol, gelatin, glucose, guar gum, liquid glucose, compressible sugar, magnesium aluminum silicate, maltodextrin, polyethylene oxide, polymethacrylates, povidone, sodium alginate, tragacanth microcrystalline cellulose, starch, and
- compositions may be suitable for parenteral administration.
- Exemplary compositions are suitable for injection or infusion into an animal by any route available to the skilled worker, such as intraarticular, subcutaneous, intravenous, intramuscular, intraperitoneal, intracerebral (intraparenchymal), intracerebroventricular, intramuscular, intraocular, intraarterial, or intralesional routes.
- a parenteral formulation typically will be a sterile, pyrogen-free, isotonic aqueous solution, optionally containing pharmaceutically acceptable preservatives.
- non-aqueous solvents examples include propylene glycol, polyethylene glycol, vegetable oils such as olive oil, and injectable organic esters such as ethyl oleate.
- Aqueous carriers include water, alcoholic/aqueous solutions, emulsions or suspensions, including saline and buffered media.
- Parenteral vehicles include sodium chloride solution, Ringers' dextrose, dextrose and sodium chloride, lactated Ringer's, or fixed oils.
- Intravenous vehicles include fluid and nutrient replenishers, electrolyte replenishers, such as those based on Ringer's dextrose, and the like.
- Preservatives and other additives may also be present, such as, for example, anti-microbials, anti-oxidants, chelating agents, inert gases and the like. See generally, Remington's Pharmaceutical Science, 16th Ed., Mack Eds., 1980.
- compositions described herein may be formulated for controlled or sustained delivery in a manner that provides local concentration of the product (e.g., bolus, depot effect) and/or increased stability or half-life in a particular local environment.
- the compositions may comprise the formulation of CAR-EC switches, polypeptides, nucleic acids, or vectors disclosed herein with particulate preparations of polymeric compounds such as polylactic acid, polyglycolic acid, etc., as well as agents such as a biodegradable matrix, injectable microspheres, microcapsular particles, microcapsules, bioerodible particles beads, liposomes, and implantable delivery devices that provide for the controlled or sustained release of the active agent which then may be delivered as a depot injection.
- Such sustained- or controlled-delivery means are known and a variety of polymers have been developed and used for the controlled release and delivery of drugs.
- Such polymers are typically biodegradable and biocompatible.
- Polymer hydrogels including those formed by complexation of enantiomeric polymer or polypeptide segments, and hydrogels with temperature or pH sensitive properties, may be desirable for providing drug depot effect because of the mild and aqueous conditions involved in trapping bioactive protein agents (e.g., antibodies comprising an ultralong CDR3).
- bioactive protein agents e.g., antibodies comprising an ultralong CDR3
- Suitable materials for this purpose include polylactides (see, e.g., U.S. Pat. No.
- poly-(a-hydroxycarboxylic acids such as poly-D-( ⁇ )-3-hydroxybutyric acid (EP 133,988A)
- copolymers of L-glutamic acid and gamma ethyl-L-glutamate (Sidman et al.
- biodegradable polymers include poly(lactones), poly(acetals), poly(orthoesters), and poly(orthocarbonates).
- Sustained-release compositions also may include liposomes, which may be prepared by any of several methods known in the art (see, e.g., Eppstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688-92 (1985)).
- the carrier itself, or its degradation products, should be nontoxic in the target tissue and should not further aggravate the condition. This may be determined by routine screening in animal models of the target disorder or, if such models are unavailable, in normal animals.
- Microencapsulation of recombinant proteins for sustained release has been performed successfully with human growth hormone (rhGH), interferon-(rhIFN-), interleukin-2, and MN rgp120.
- rhGH human growth hormone
- interferon-(rhIFN-) interferon-(rhIFN-)
- interleukin-2 interleukin-2
- MN rgp120 MN rgp120.
- the sustained-release formulations of these proteins were developed using poly-lactic-coglycolic acid (PLGA) polymer due to its biocompatibility and wide range of biodegradable properties.
- PLGA poly-lactic-coglycolic acid
- the degradation products of PLGA, lactic and glycolic acids may be cleared quickly within the human body.
- the degradability of this polymer may be depending on its molecular weight and composition. Lewis, “Controlled release of bioactive agents from lactide/glycolide polymer,” in: M. Chasin and R.
- sustained release compositions include, for example, EP 58,481A, U.S. Pat. No. 3,887,699, EP 158,277A, Canadian Patent No. 1176565, U. Sidman et al., Biopolymers 22, 547 [1983], R. Langer et al., Chem. Tech. 12, 98 [1982], Sinha et al., J. Control. Release 90, 261 [2003], Zhu et al., Nat. Biotechnol. 18, 24 [2000], and Dai et al., Colloids Surf B Biointerfaces 41, 117 [2005].
- Bioadhesive polymers are also contemplated for use in or with compositions of the present disclosure.
- Bioadhesives are synthetic and naturally occurring materials able to adhere to biological substrates for extended time periods.
- Carbopol and polycarbophil are both synthetic cross-linked derivatives of poly(acrylic acid).
- Bioadhesive delivery systems based on naturally occurring substances include for example hyaluronic acid, also known as hyaluronan.
- Hyaluronic acid is a naturally occurring mucopolysaccharide consisting of residues of D-glucuronic and N-acetyl-D-glucosamine.
- Hyaluronic acid is found in the extracellular tissue matrix of vertebrates, including in connective tissues, as well as in synovial fluid and in the vitreous and aqueous humor of the eye. Esterified derivatives of hyaluronic acid have been used to produce microspheres for use in delivery that are biocompatible and biodegradable (see, for example, Cortivo et al., Biomaterials (1991) 12:727-730; EP 517,565; WO 96/29998; Illum et al., J. Controlled Rel. (1994) 29:133-141).
- Both biodegradable and non-biodegradable polymeric matrices may be used to deliver compositions of the present disclosure, and such polymeric matrices may comprise natural or synthetic polymers. Biodegradable matrices are preferred. The period of time over which release occurs is based on selection of the polymer. Typically, release over a period ranging from between a few hours and three to twelve months is most desirable.
- Exemplary synthetic polymers which may be used to form the biodegradable delivery system include: polymers of lactic acid and glycolic acid, polyamides, polycarbonates, polyalkylenes, polyalkylene glycols, polyalkylene oxides, polyalkylene terepthalates, polyvinyl alcohols, polyvinyl ethers, polyvinyl esters, poly-vinyl halides, polyvinylpyrrolidone, polyglycolides, polysiloxanes, polyanhydrides, polyurethanes and co-polymers thereof, poly(butic acid), poly(valeric acid), alkyl cellulose, hydroxyalkyl celluloses, cellulose ethers, cellulose esters, nitro celluloses, polymers of acrylic and methacrylic esters, methyl cellulose, ethyl cellulose, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, hydroxybutyl methyl cellulose, cellulose acetate, cellulose propionate, cellulose
- Exemplary natural polymers include alginate and other polysaccharides including dextran and cellulose, collagen, chemical derivatives thereof (substitutions, additions of chemical groups, for example, alkyl, alkylene, hydroxylations, oxidations, and other modifications routinely made by those skilled in the art), albumin and other hydrophilic proteins, zein and other prolamines and hydrophobic proteins, copolymers and mixtures thereof. In general, these materials degrade either by enzymatic hydrolysis or exposure to water in vivo, by surface or bulk erosion.
- the polymer optionally is in the form of a hydrogel (see, for example, WO 04/009664, WO 05/087201, Sawhney, et al., Macromolecules, 1993, 26, 581-587) that can absorb up to about 90% of its weight in water and further, optionally is cross-linked with multi-valent ions or other polymers.
- Delivery systems also include non-polymer systems that are lipids including sterols such as cholesterol, cholesterol esters and fatty acids or neutral fats such as mono-di- and tri-glycerides; hydrogel release systems; silastic systems; peptide based systems; wax coatings; compressed tablets using conventional binders and excipients; partially fused implants; and the like.
- lipids including sterols such as cholesterol, cholesterol esters and fatty acids or neutral fats such as mono-di- and tri-glycerides
- hydrogel release systems silastic systems; peptide based systems; wax coatings; compressed tablets using conventional binders and excipients; partially fused implants; and the like.
- Specific examples include, but are not limited to: (a) erosional systems in which the product is contained in a form within a matrix such as those described in U.S. Pat. Nos. 4,452,775, 4,675,189 and 5,736,152 and (b) diffusional systems in which a product permeates at a
- Liposomes containing the product may be prepared by methods known methods, such as for example (DE 3,218,121; Epstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688-3692 (1985); Hwang et al., Proc. Natl. Acad. Sci. USA, 77: 4030-4034 (1980); EP 52,322; EP 36,676; EP 88,046; EP 143,949; EP 142,641; JP 83-118008; U.S. Pat. Nos. 4,485,045 and 4,544,545; and EP 102,324).
- compositions may be administered locally via implantation into the affected area of a membrane, sponge, or other appropriate material on to which a CAR-EC switch disclosed herein has been absorbed or encapsulated.
- a CAR-EC switch, nucleic acid, or vector disclosed herein may be directly through the device via bolus, or via continuous administration, or via catheter using continuous infusion.
- a pharmaceutical composition comprising a CAR-EC switch disclosed herein may be formulated for inhalation, such as for example, as a dry powder Inhalation solutions also may be formulated in a liquefied propellant for aerosol delivery. In yet another formulation, solutions may be nebulized. Additional pharmaceutical composition for pulmonary administration include, those described, for example, in WO 94/20069, which discloses pulmonary delivery of chemically modified proteins.
- the particle size should be suitable for delivery to the distal lung. For example, the particle size may be from 1 ⁇ m to 5 ⁇ m; however, larger particles may be used, for example, if each particle is fairly porous.
- formulations containing CAR-EC switches disclosed herein may be administered orally.
- Formulations administered in this fashion may be formulated with or without those carriers customarily used in the compounding of solid dosage forms such as tablets and capsules.
- a capsule may be designed to release the active portion of the formulation at the point in the gastrointestinal tract when bioavailability is maximized and pre-systemic degradation is minimized.
- Additional agents may be included to facilitate absorption of a selective binding agent. Diluents, flavorings, low melting point waxes, vegetable oils, lubricants, suspending agents, tablet disintegrating agents, and binders also may be employed.
- Another preparation may involve an effective quantity of a CAR-EC switch disclosed herein in a mixture with non-toxic excipients which are suitable for the manufacture of tablets.
- excipients include, but are not limited to, inert diluents, such as calcium carbonate, sodium carbonate or bicarbonate, lactose, or calcium phosphate; or binding agents, such as starch, gelatin, or acacia ; or lubricating agents such as magnesium stearate, stearic acid, or talc.
- Suitable and/or preferred pharmaceutical formulations may be determined in view of the present disclosure and general knowledge of formulation technology, depending upon the intended route of administration, delivery format, and desired dosage. Regardless of the manner of administration, an effective dose may be calculated according to patient body weight, body surface area, or organ size. Further refinement of the calculations for determining the appropriate dosage for treatment involving each of the formulations described herein are routinely made in the art and is within the ambit of tasks routinely performed in the art. Appropriate dosages may be ascertained through use of appropriate dose-response data.
- CAR-EC switches comprising expressing one or more polypeptides from one or more vectors comprising one or more polynucleotide having one or more sequences that encode a chimeric antigen receptor-effector cell switch or a portion thereof, wherein the chimeric antigen receptor-effector cell switch comprises a peptidic antigen (CAR-BP) and a targeting polypeptide.
- the targeting moiety may comprise a targeting polypeptide.
- the methods comprise fusing or grafting a polynucleotide encoding the CAR-BP to a polynucleotide encoding the targeting polypeptide.
- Fusing or grafting may be carried out by any standard cloning method known to one skilled in the art. Fusing or grafting the polynucleotides encoding the CAR-BP and targeting polypeptide may comprise enzymatic digestion of the polynucleotides, ligation of the polynucleotides and/or amplification of the polynucleotides.
- the peptidic antigen may be fused to an N terminus of the targeting polypeptide.
- the peptidic antigen may be fused to a C terminus of the targeting polypeptide.
- the peptidic antigen may be grafted within the targeting polypeptide.
- the targeting polypeptide may comprise a targeting antibody or antibody fragment.
- the peptidic antigen may be fused to an N terminus of the targeting antibody or antibody fragment.
- the peptidic antigen may be fused to a C terminus of the targeting antibody or antibody fragment.
- the term “fused” may refer to adjoining a terminus of the CAR-BP with a terminus of the targeting polypeptide.
- the CAR-BP may be fused to the terminus of the targeting polypeptide without replacing or removing any amino acids of the targeting polypeptide.
- Fusing the CAR-BP to the terminus of the targeting polypeptide may comprise removing or replacing amino acids at the terminus of the targeting polypeptide.
- Removing or replacing amino acids at the terminus of the targeting polypeptide may comprise removing or replacing about 1 to about 20 amino acids at the terminus of the targeting polypeptide.
- the CAR-BP may be fused to the terminus of the targeting polypeptide via a linker.
- the linker may be fused to the CAR-BP to produce a CAR-BP-linker intermediate.
- the linker may be fused to a CAR-BP N terminus to produce the CAR-BP-linker intermediate.
- the linker may be fused to a CAR-BP C terminus to produce the CAR-BP-linker intermediate.
- the CAR-BP-linker intermediate may be fused to the targeting polypeptide.
- the CAR-BP-linker intermediate may be fused to the N terminus of the targeting polypeptide.
- the CAR-BP-linker intermediate may be fused to the C terminus of the targeting polypeptide.
- a first CAR-BP linker intermediate may be fused to the N terminus of the targeting polypeptide and a second CAR-BP linker intermediate may be fused to the C terminus of the targeting polypeptide.
- the CAR-BP of the first CAR-BP linker intermediate may be the same or similar to the CAR-BP of the second CAR-BP linker intermediate.
- the CAR-BP of the first CAR-BP linker intermediate may be different from the CAR-BP of the second CAR-BP linker intermediate.
- the term “grafted” may refer to inserting a CAR-BP within a targeting polypeptide (e.g. between two amino acids of the targeting polypeptide).
- the CAR-BP may be grafted within the targeting polypeptide without replacing or removing any amino acids of the targeting polypeptide. Grafting the CAR-BP within the targeting polypeptide may comprise removing or replacing amino acids within the targeting polypeptide. Removing or replacing amino acids within the targeting polypeptide may comprise removing or replacing about 1 to about 20 amino acids within the targeting polypeptide.
- the CAR-BP may be grafted within the targeting polypeptide via one linker.
- the CAR-BP may be grafted within the targeting polypeptide via two linkers.
- the linker may be fused to the CAR-BP N terminus to produce a CAR-BP-linker intermediate.
- the linker may be fused to the CAR-BP C terminus to produce a CAR-BP-linker intermediate.
- a first linker may be fused to the CAR-BP N terminus and a second linker may be fused to the CAR-BP C terminus to produce a CAR-BP-linker intermediate.
- the CAR-BP linker intermediate may be grafted with in the targeting polypeptide.
- a first CAR-BP linker intermediate may be grafted within the targeting polypeptide and a second CAR-BP linker intermediate may be grafted within the targeting polypeptide.
- the first CAR-BP linker intermediate may be grafted within a first domain of the targeting polypeptide and a second CAR-BP linker intermediate may be grafted within a second domain of the targeting polypeptide.
- the first domain of the targeting polypeptide may be the same as the second domain of the targeting polypeptide.
- the first domain of the targeting polypeptide may be different from the second domain of the targeting polypeptide.
- the CAR-BP of the first CAR-BP linker intermediate may be the same or similar to the CAR-BP of the second CAR-BP linker intermediate.
- the CAR-BP of the first CAR-BP linker intermediate may be different from the CAR-BP of the second CAR-BP linker intermediate.
- the terms “graft” and “insert”, as used herein, are used interchangeably.
- the targeting moiety may comprise an antibody or antibody fragment.
- the antibody or antibody fragment may comprise a heavy chain and a light chain or fragments thereof.
- the methods may comprise expressing a heavy chain wherein the peptidic antigen is fused to a terminus of the heavy chain.
- the methods may comprise expressing a heavy chain wherein the peptidic antigen is grafted within the heavy chain.
- the methods may comprise expressing a light chain wherein the peptidic antigen is fused to a terminus of the light chain.
- the methods may comprise expressing a light chain wherein the peptidic antigen is grafted within the light chain.
- the methods may further comprise cloning one or more polynucleotides encoding the targeting polypeptide and/or the peptidic antigen into an expression vector.
- the methods may further comprise ligation of the one or more polynucleotides encoding the targeting polypeptide and/or peptidic antigen into an expression vector.
- the expression vector may be a prokaryotic expression vector.
- the expression vector may be a eukaryotic expression vector.
- the expression vector may be a mammalian expression vector.
- the expression vector may be a viral expression vector.
- the methods may further comprise validating the cloning of the one or more polynucleotides encoding the targeting polypeptide and/or peptidic antigen into the expression vector comprising sequencing the expression vector, running gel electrophoresis of the vector and/or viewing the targeting polypeptide and/or peptidic antigen on an SDS page gel.
- the methods may further comprise amplifying a polynucleotide encoding the targeting polypeptide and/or peptidic antigen and cloning the targeting polypeptide and/or peptidic antigen into the expression vector.
- Amplifying the polynucleotide encoding the targeting polypeptide and/or the peptidic antigen may comprise synthesizing oligonucleotides at least partially complementary to the gene.
- the oligonucleotides may be sufficiently complementary to the gene to anneal to the polynucleotide.
- the oligonucleotides may comprise linker sequences. The linker sequences may be selected from SEQ ID NOs: 40-44.
- the methods may further comprise transfecting or infecting a cell with the expression vector.
- the methods may further comprise expressing the targeting polypeptide and/or peptidic antigen in the cell.
- the methods may further comprise expressing the targeting polypeptide and/or peptidic antigen in a cell free system.
- the methods may further comprise producing a virus comprising the expression vector.
- the methods may further comprise propagating the virus.
- the methods may further comprise infecting a cell with the virus comprising the expression vector.
- the methods may further comprise propagating the cell.
- the method may comprise grafting the CAR-BP to the antibody or antibody fragment.
- the method may comprise grafting the CAR-BP to an N terminus, C terminus or internal site of the antibody or antibody fragment.
- the CAR-BP may be grafted to a CL domain of the antibody or antibody fragment.
- the CAR-BP may be grafted to a loop of the CL domain of the antibody or antibody fragment.
- the method may comprise grafting the antibody or antibody fragment to the CAR-BP.
- the method may comprise grafting the antibody or antibody fragment to an N terminus, C terminus or internal site of the CAR-BP.
- the method may comprise grafting the CAR-BP to the targeting peptide.
- the method may comprise grafting the CAR-BP to an N terminus, C terminus or internal site of the targeting peptide.
- the method may comprise grafting the targeting peptide to the CAR-BP.
- the method may comprise grafting the targeting peptide to an N terminus, C terminus or internal site of the CAR-BP.
- the CAR-BP, targeting peptide, antibody or antibody fragment may comprise one or more linkers, wherein the linker is located at the N terminus and/or C terminus of the CAR-BP, targeting peptide, antibody or antibody fragment.
- the method may comprise grafting the antibody or antibody fragment, the CAR-BP or the targeting peptide through the linker.
- the linker may comprise (GSSSS) n (SEQ ID NO: 47).
- Grafting may comprise producing a CAR-EC switch encoding nucleic acid.
- Producing the CAR-EC switch encoding nucleic acid may comprise one or more polymerase chain reactions.
- Producing the CAR-EC switch encoding nucleic acid may comprise one or more nucleic acid enzymatic digestions. The enzymatic digestion may be site specific.
- Producing the CAR-EC switch encoding nucleic acid may comprise one or more ligations.
- the methods of producing the CAR-EC switch may comprise incorporating the CAR-EC switch encoding nucleic acid into a CAR-EC switch vector.
- the vector may be an expression vector.
- the expression vector may comprise a constitutive promoter, an inducible promoter and/or a conditional promoter.
- the CAR-EC switch encoding nucleic acid or CAR-EC switch vector may be expressed in a cell and the resulting CAR-EC switch isolated and purified.
- the cell may be a prokaryotic cell.
- the cell may be an E. coli .
- the cell may be a eukaryotic cell.
- the cell may be a mammalian cell.
- the CAR-EC switch encoding nucleic acid or CAR-EC switch vector may be expressed in a cell-free system. Alternatively or additionally the CAR-EC switch may be synthesized from free amino acids.
- separating the CAR-EC switches disclosed herein comprising separating the CAR-EC switches disclosed herein from components of a CAR-EC switch production system (e.g. cellular debris, free amino acids).
- Purifying the CAR-EC switch may comprise use of one or more concentrator columns, electrophoresis, filtration, centrifugation, chromatography or a combination thereof.
- Chromatography may comprise size-exclusion chromatography. Additional chromatography methods include, but are not limited to, hydrophobic interaction chromatography, ion exchange chromatography, affinity chromatography, metal binding, immunoaffinity chromatography, and high performance liquid chromatography or high pressure liquid chromatography.
- Electrophoresis may comprise denaturing electrophoresis or non-denaturing electrophoresis.
- the CAR-EC switches may comprise one or more peptide tags.
- the methods of purifying CAR-EC switches may comprise binding one or more peptide tags of the CAR-EC switches to a capturing agent.
- the capturing agent may be selected from an antibody, a column, a bead and a combination thereof.
- the one or more tags may be cleaved by one or more proteases. Examples of tags include, but are not limited to, polyhistidine, FLAG® tag, HA, c-myc, V5, chitin binding protein (CBP), maltose binding protein (MBP), and glutathione-S-transferase (GST).
- the peptide tag may be the CAR-BP.
- the peptide tag may be HTP.
- the peptide tag may be yeast transcription factor GCN4.
- the methods may further comprise lyophilization or ultracentrifugation of the CAR-BPs, targeting polypeptides and/or the CAR-EC switches.
- the purity of the CAR-BPs, targeting polypeptides and/or the CAR-EC switches may be equal to or greater than 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more.
- the purity of the CAR-BPs, targeting polypeptides and/or the CAR-EC switches may be equal to or greater than 85%.
- the purity of the CAR-BPs, targeting polypeptides and/or the CAR-EC switches may be equal to or greater than 90%.
- the purity of the CAR-BPs, targeting polypeptides and/or the CAR-EC switches may be equal to or greater than 95%.
- the purity of the CAR-BPs, targeting polypeptides and/or the CAR-EC switches may be equal to or greater than 97%.
- the methods of producing CAR-EC switches disclosed herein may comprise producing CAR-EC switches that are structurally homogeneous.
- the method of producing the CAR-EC switch from a polynucleotide may result in one or more CAR-EC switches that have the same or similar form, features, binding affinities (e.g. for the CAR or the target), geometry and/or size.
- the homogeneity of the CAR-EC switches may be equal to or greater than 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more.
- the homogeneity of the CAR-EC switches may be equal to or greater than 85%.
- the homogeneity CAR-EC switches may be equal to or greater than 90%.
- the homogeneity of the CAR-EC switches may be equal to or greater than 95%.
- the homogeneity of the CAR-EC switches may be equal to or greater than 97%.
- the homogeneity may be a structural homogeneity.
- the homogeneity may be a structural homogeneity prior to administering the cell to a subject.
- the homogeneity may be a structural homogeneity prior to modifications to the CAR-EC switch by cellular activities (methylation, acetylation, glycosylation, etc.). These high percentages of homogeneity may provide a more predictable effect of the CAR-EC switch.
- These high percentages of homogeneity may provide for less off-target effects of the CAR-EC switch, when combined with a CAR-EC to treat a condition in a subject.
- the solubility, stability, affinity, and potential for cross reactive epitopes in the human proteome of developed antibodies were considered in choosing a CAR-EC switch peptidic antigen. Based on these criteria, a linear amino acid epitope from the yeast transcription factor GCN4 (7P14P) was chosen. Single chain antibodies with affinities varying from 2.6 nM to 5.2 pM enable optimization of the CAR-EC through binding kinetics. Additionally, these antibodies are among the highest affinity anti-peptide single chain antibodies for linear epitopes.
- the dissociation constant (Kd) for the chosen GCN4 epitope (7P14P) having a sequence of NYHLENEVARLKKL (SEQ ID NO. 3) and GCN4 binding scFv (52SR4) is 5.2 pM.
- a small hydrophilic target peptide (HTP), based on the commonly used FLAG® tag, was developed.
- FLAG® has low antigenicity, is highly soluble, and has been fused to numerous proteins with little impact on protein folding or stability.
- a proline residue was incorporated after the terminal lysine in an effort to increase proteolytic stability.
- Antibodies to this epitope are developed by traditional mouse immunization and subsequent humanization or by phage panning of a human library. Binding kinetics of evolved scFv's are fully characterized and peptide-CAR-ECs are created and tested for off-target specificity as described.
- mice xenograft models are used to compare these switchable platforms to previously developed by CAR-T switch platforms.
- RS4; 11, NALM-6, Raji or other CD19 positive cell lines are used to establish tumor models in non-obese diabetic-severe combined immunodeficiency (NOD-SCID- ⁇ ⁇ / ⁇ , NSG) mice.
- CAR-Ts are delivered by intravenous administration. Dose-range finding is carried out for the peptide anti-CD19 switch, and is compared to a wild type CD19 Fab control. Efficacy is judged based on tumor burden and overall survival. Mice are monitored with weekly blood draws to monitor proliferation of CAR-ECs in peripheral blood.
- Detailed immunophenotypic characterization of CAR-ECs focus on effector, memory, senescent (terminally differentiated), or anergized phenotypes are defined according to standard phenotypic parameters using multi-channel flow cytometry.
- Switchable CAR-ECs are tested for the ability to reverse B cell aplasia in an immunocompetent B cell lymphoma mouse model.
- the engineered peptide-based chimeric receptor is cloned to a Moloney murine leukemia-based retroviral vector for transduction into murine splenocytes.
- the murine-derived signaling domains CD28 and CD3z are used.
- the anti-human CD19 antibody does not cross-react with mouse CD19; therefore, the rat anti-mouse CD19 hybridoma 1D3 is obtained (from ATCC) and variable regions sequenced. This sequence is cloned into an expression vector for peptide fusion to create the switch and is cloned into a chimeric antigen receptor to create a CAR-T-19 mouse surrogate.
- the Myc5-CD19 cell line is used to establish B cell lymphoma in wild type C57BL/6 mice.
- CAR-ECs and switches are administered with dosing schedules based on xenograft studies and in vitro assays with surrogate system. Of particular interest in this model is to compare Fab, and IgG based switches on the rate of Myc5-CD19 disappearance and B cell ablation.
- CAR-T proliferation is monitored and immunophenotypic characterization is carried out ex vivo. After eradication of lymphoma cells, switch administration is halted and the reproliferation of B cells in peripheral blood is monitored.
- Both the surrogate CAR-T-19 and the surrogate switchable CAR-T are expected to enable long-term remission, but only the switchable platform enables repopulation of B cells.
- CAR-T infiltration to major organs is monitored via histology on predefined cohorts and cellular analysis is carried out post-therapy. Long-term persistence of CAR-ECs in the absence of stimulation is followed.
- a first switch containing an anti-CD19 targeting antibody and a second switch containing the anti-CD20 targeting antibody rituximab are used sequentially or simultaneously to target different antigens in the same patient using a single adoptively transferred CAR-T in an effort to combat ALL relapse attributed to a CD19 escape variant during CAR-T-19 therapy.
- An anti-CD20 switch is created in analogous fashion to the anti-CD19 switch using the optimal characteristics determined in Example 3.
- a CAR-T-20 based on rituximab is constructed for comparison. Efficacy is tested in vitro against CD20-positive IM-9 and Daudi cells lines.
- To create a heterogeneous B-cell lymphoblast the chronic myelogenous leukemia-derived K562 cell line (which is negative for CD20 and CD19) is stably transduced with the CD19 antigen using a lentiviral vector. Single cell clones are obtained via flow-sorting to obtain a population with homogenous CD19 expression.
- This cell line is then be transduced with CD20 and sorted by high (CD20 hi ) or low (CD20 low ) level of antigen expression.
- the activation and cytotoxicity of the switchable CAR-T on mixtures of CD19 + CD20 ⁇ and CD19 +CD 20 hi or CD19 + CD20 low are assessed in vitro using the CD19 and CD20 switches (simultaneous or sequential administration).
- the method provides an opportunity to study the lowest percentage of CD20 hi or CD20 low cells in a population that are necessary to stimulate the CAR-T with the rituximab switch. This may be more physiologically relevant than a homogeneous population.
- This system is then tested in a xenograft mouse model.
- CD19 + CD20 ⁇ and CD19 + CD20 + are used to establish the xenograft.
- primary patient derived ALL samples are used for this experiment if found to be heterogeneous for CD19 or CD20 expression in our initial xenograft study.
- Switchable CAR-ECs with the anti-CD20 switch are administered to eliminate the CD19 + CD20 + population and allow outgrowth of CD19 + CD20 ⁇ cells.
- the anti-CD19 switch is subsequently dosed and growth of remaining xenograft monitored. Tumors are evaluated for antigen expression in cohorts of sacrificed mice or in primary blasts. Simultaneous targeting is also assessed. Treatment is compared with CAR-T-19, CAR-T-20, or both simultaneously.
- the CARs were constructed as follows:
- LV-EF1a-GCN4-BBZ was designed to target the 7P14P epitope of the yeast transcription factor GCN4 (sequence RMKQLEPKVEELLPKN YHLENEVARLKK LVGER (SEQ ID NO. 2) where the underlined amino acids have been shown to bind to the c11L32Ser scFv in the 1P4B crystal structure from PDB.
- the scFv was constructed from the 52SR4 (high affinity mutant with similar sequence to c11L32Ser) antibody scFv from reference: Zahnd, C., Spinelli, S., Luginbuhl, B., Amstutz, P., Cambillau, C., and Pluckthun, A. (2004) Directed in vitro evolution and crystallographic analysis of a peptide-binding single chain antibody fragment (scFv) with low picomolar affinity, The Journal of Biological Chemistry 279, 18870-18877.
- Mammalian expression vector of CD19 Fab heavy chain was generated by ligation of amplified CD19 Fab heavy chain (VH and CH1) to pFuse-hIgG1-Fc backbone vector (InvivoGen, CA) without Fc fragment.
- a gene encoding antibody CD19 light chain was amplified and cloned into the pFuse vector without hIgG1 Fc fragment.
- a gene encoding GCN4 (NYHLENEVARLKKL SEQ ID NO: 3) with was synthesized as oligonucleotides.
- anti-CD1-Fab-GCN4 HC1 fusion proteins were created by grafting GCN4 into the mature heavy chain of the CD19 Fab following S135 of the CD19 Fab heavy chain.
- the resulting mammalian expression vectors were confirmed by DNA sequencing.
- anti-CD19-Fab-GCN4 HC1 was expressed through transient transfection of FreeStyle HEK 293 cells with expression vectors of CD19-Fab light chain and GCN4-CD19-HC1, according to the manufacturer's protocol. Briefly, 28 mL FreeStyle HEK 293 cells containing 3 ⁇ 107 cells were seeded in a 125 mL shaking flask. 15 ⁇ g light chain plasmid and 15 ⁇ g heavy chain plasmid diluted in 1 mL Opti-MEM medium were added in 1 mL Opti-MEM containing 60 ⁇ L 293fectin (Invitrogen, Inc).
- FIGS. 5A and 5B show SDS gel images of anti-CD1-Fab-GCN4 HC1 (Lane 7) in non-reducing and reducing (with 50 mM DTT) conditions, respectively.
- Mammalian expression vector of CD19 IgG heavy chain was generated by in-frame ligation of amplified CD19 Fab heavy chain (VH and CH1) to pFuse-hIgG1-Fc backbone vector (InvivoGen, CA).
- a gene encoding antibody CD19 light chain was amplified and cloned into the pFuse vector without hIgG1 Fc fragment.
- anti-CD19-IgG-GCN4 HC1 fusion proteins were created by inserting GCN4 following S135 of the mature heavy chain of the CD19 IgG.
- the resulting mammalian expression vectors were confirmed by DNA sequencing.
- anti-CD19-IgG-GCN4 HC1 was expressed through transient transfection of FreeStyle HEK 293 cells with expression vectors of CD19-IgG light chain and GCN4-CD19 heavy chain, according to the manufacturer's protocol. Briefly, 28 mL FreeStyle HEK 293 cells containing 3 ⁇ 107 cells were seeded in a 125 mL shaking flask. 15 ⁇ g light chain plasmid and 15 ⁇ g heavy chain plasmid diluted in 1 mL Opti-MEM medium were added in 1 mL Opti-MEM containing 60 ⁇ L 293fectin (Invitrogen, Inc).
- FIGS. 5A & 5B show SDS gel images of anti-CD19-IgG-GCN4 HC1 (Lane 3) in non-reducing and reducing (with 50 mM DTT) conditions, respectively.
- Mammalian expression vector of CD19 Fab heavy chain was generated by ligation of amplified CD19 Fab heavy chain (VH and CH1) to pFuse-hIgG1-Fc backbone vector (InvivoGen, CA) without Fc fragment.
- a gene encoding antibody CD19 light chain was amplified and cloned into the pFuse vector without hIgG1 Fc fragment.
- anti-CD19-Fab-GCN4 C-term term fusion proteins were created by fusing the linker-GCN4 to the C terminus of the Fab heavy chain at C223.
- the resulting mammalian expression vectors were confirmed by DNA sequencing.
- anti-CD19-Fab-GCN4 C-term was expressed through transient transfection of FreeStyle HEK 293 cells with expression vectors of CD19-Fab light chain and anti-CD19-Fab-GCN4 C-term , according to the manufacturer's protocol. Briefly, 28 mL FreeStyle HEK 293 cells containing 3 ⁇ 107 cells were seeded in a 125 mL shaking flask. 15 ⁇ g light chain plasmid and 15 ⁇ g heavy chain plasmid diluted in 1 mL Opti-MEM medium were added in 1 mL Opti-MEM containing 60 ⁇ L 293fectin (Invitrogen, Inc).
- FIGS. 5A and 5B show SDS gel images of anti-CD19-Fab-GCN4 C-term (Lane 9) in non-reducing and reducing (with 50 mM DTT) conditions, respectively.
- Mammalian expression vector of CD19 IgG heavy chain was generated by in-frame ligation of amplified CD19 Fab heavy chain (VH and CH1) to pFuse-hIgG1-Fc backbone vector (InvivoGen, CA). A gene encoding antibody CD19 light chain was amplified and cloned into the pFuse vector without hIgG1 Fc fragment.
- anti-CD19-IgG-GCN4 hinge was expressed through transient transfection of FreeStyle HEK 293 cells with expression vectors of CD19-IgG light chain and GCN4-CD19 hinge heavy chain, according to the manufacturer's protocol. Briefly, 28 mL FreeStyle HEK 293 cells containing 3 ⁇ 107 cells were seeded in a 125 mL shaking flask. 15 ⁇ g light chain plasmid and 15 ⁇ g heavy chain plasmid diluted in 1 mL Opti-MEM medium were added in 1 mL Opti-MEM containing 60 ⁇ L 293fectin (Invitrogen, Inc).
- FIGS. 5A & 5B show SDS gel images of anti-CD19-IgG-GCN4 hinge (Lane 5) in non-reducing and reducing (with 50 mM DTT) conditions, respectively.
- Mammalian expression vector of CD19 IgG heavy chain was generated by in-frame ligation of amplified CD19 Fab heavy chain (VH and CH1) to pFuse-hIgG1-Fc backbone vector (InvivoGen, CA).
- a gene encoding antibody CD19 light chain was amplified and cloned into the pFuse vector without hIgG1 Fc fragment.
- anti-CD19-IgG-GCN4 CL1 fusion proteins were created by replacing the K169 in CL region of CD19 light chain with GCN4 with linker sequences at both ends.
- the resulting mammalian expression vectors were confirmed by DNA sequencing.
- anti-CD19-IgG-GCN4 CL1 was expressed through transient transfection of FreeStyle HEK 293 cells with expression vectors of CD19-IgG heavy chain and GCN4-CD19-CL1 light chain, according to the manufacturer's protocol. Briefly, 28 mL FreeStyle HEK 293 cells containing 3 ⁇ 10 7 cells were seeded in a 125 mL shaking flask. 15 ⁇ g light chain plasmid and 15 ⁇ g heavy chain plasmid diluted in 1 mL Opti-MEM medium were added in 1 mL Opti-MEM containing 60 ⁇ L 293fectin (Invitrogen, Inc).
- FIGS. 5A & 5B show SDS gel images of anti-CD19-IgG-GCN4 CL1 (Lane 4) in non-reducing and reducing (with 50 mM DTT) conditions, respectively.
- Mammalian expression vector of CD19 Fab heavy chain was generated by ligation of amplified CD19 Fab heavy chain (VH and CH1) to pFuse-hIgG1-Fc backbone vector (InvivoGen, CA) without Fc fragment.
- a gene encoding antibody CD19 light chain was amplified and cloned into the pFuse vector without hIgG1 Fc fragment.
- anti-CD19-Fab-GCN4 CL1 fusion proteins were created by replacing the K169 in CL region of CD19 light chain with GCN4 with linker sequences at both ends.
- the resulting mammalian expression vectors were confirmed by DNA sequencing.
- anti-CD19-Fab-GCN4 CL1 was expressed through transient transfection of FreeStyle HEK 293 cells with expression vectors of CD19-Fab heavy chain and GCN4-CD19-CL light chain, according to the manufacturer's protocol. Briefly, 28 mL FreeStyle HEK 293 cells containing 3 ⁇ 10 7 cells were seeded in a 125 mL shaking flask. 15 ⁇ g light chain plasmid and 15 ⁇ g heavy chain plasmid diluted in 1 mL Opti-MEM medium were added in 1 mL Opti-MEM containing 60 ⁇ L 293fectin (Invitrogen, Inc).
- FIGS. 5A & 5B show SDS gel images of anti-CD19-Fab-GCN4 CL1 (Lane 8) in non-reducing and reducing (with 50 mM DTT) conditions, respectively.
- Mammalian expression vector of CD19 Fab heavy chain was generated by ligation of amplified CD19 Fab heavy chain (VH and CH1) to pFuse-hIgG1-Fc backbone vector (InvivoGen, CA) without Fc fragment.
- a gene encoding antibody CD19 light chain was amplified and cloned into the pFuse vector without hIgG1 Fc fragment.
- a gene encoding GCN4 (NYHLENEVARLKKL SEQ ID NO: 3) with GGGGS (SEQ ID NO: 48) linker at C-terminal end of GCN4 with was synthesized as oligonucleotides.
- anti-CD19-Fab-GCN4 LC1-N-term fusion proteins were created by fusing the linker-GCN4 to the N terminus of the Fab light chain.
- the resulting mammalian expression vectors were confirmed by DNA sequencing.
- anti-CD19-Fab-GCN4 LC1-N-term was expressed through transient transfection of FreeStyle HEK 293 cells with expression vectors of CD19-Fab light chain and GCN4-CD19-C-term, according to the manufacturer's protocol. Briefly, 28 mL FreeStyle HEK 293 cells containing 3 ⁇ 107 cells were seeded in a 125 mL shaking flask. 15 ⁇ g light chain plasmid and 15 ⁇ g heavy chain plasmid diluted in 1 mL Opti-MEM medium were added in 1 mL Opti-MEM containing 60 ⁇ L 293fectin (Invitrogen, Inc).
- FIGS. 5A and 5B show SDS gel images of anti-CD19-Fab-GCN4 LC1-N-term (Lane 10) in non-reducing and reducing (with 50 mM DTT) conditions, respectively.
- Peptide CAR-EC switches were created by fusing 14 amino acids of the GCN4 yeast transcription factor peptide sequence 7P14P (defined in Zahnd et al. (2004) Directed in vitro evolution and crystallographic analysis of a peptide-binding single chain antibody fragment (scFv) with low picomolar affinity, The Journal of Biological Chemistry 279, 18870-18877).
- the 14 amino acids were chosen based on those defined in crystal structure 1P4B of GCN4 peptide 7P14P with scFv c11L32Ser.
- the switches were constructed by either fusing the GCN4 peptide sequence to the C-terminus of the heavy chain of the Fab antibody or by fusing the GCN4 peptide sequence in the CL loop of the light chain of the Fab or IgG antibody. All expressions were carried out in CHO or HEK cells.
- the peptide NYHLENEVARLKKL (SEQ ID NO: 3), suggested to be the minimal binding epitope according to the crystal structure (PDB: 1P4B) (see FIG. 2 ) from the yeast transcription factor GCN4 peptide (7P14P) RMKQLEPKVEELLPKNYHLENEVARLKKLVGER (SEQ ID NO: 2), was grafted to the mouse anti-human CD19 Fab clone FMC63.
- the graft was carried out by replacing K63 (as counted from the N terminus of the constant region, which would be K169 when counting from the N terminus of the mature protein) of the light chain with the sequence GGGGSNYHLENEVARLKKLGGGGS (SEQ ID NO. 4)—the GCN4 epitope flanked by GGGGS linkers (SEQ ID NO: 48).
- the mass spec of anti-CD19 Fab CL1 -GCN4 is provided below ( FIG. 3 ).
- the peptide is grafted to the heavy chain (SEQ ID NO: 29).
- the cytotoxic activity of the anti-CD19 Fab CL1 -GCN4 switch was assessed with the human PBMCs transduced with LV-EF1a-GCN4 (52SR4) to create CAR-T-GCN4 at E:T ratios of 10:1 and 24 hour incubation.
- Activity was assessed against NALM-6 (CD19 + ), RS4; 11 (CD19 + ), or RPMI-8226 (CD19 ⁇ ) (Table 1).
- the activity of the IgG (FcNull) switch was assessed against RS4; 11 (CD19 + ), or K562 (CD19 ⁇ ) (Table 2).
- the activity of the C-terminal switch was assessed against RS4; 11 (CD19 + ), or K562 (CD19 ⁇ ) (Table 3).
- cytotoxic activities of various anti-CD19-GCN4 CAR-EC switches grafted/fused to different regions of anti-CD19 FMC63 antibodies or antibody fragments were assessed with the human PBMCs transduced with LV-EF1a-GCN4 (52SR4) to create CAR-T-GCN4 at E:T ratios of 10:1 and 24 hour incubation.
- FIG. 6 depicts the grafting positions of switches described in this example.
- the CL1 and HC1 grafting positions were applied to both Fab and IgG formats.
- the N-terminus grafting is shown as grafted to the light chain, however N-terminal grafting is not restricted to the light chain or Fab and may also be grafted to the heavy chain as well as the IgG format.
- the C-term position on the Fab is isosteric with the hinge IgG. In this context all Fab constructs are monovalent and all IgG constructs are bivalent, but these are not a necessary requirements for CAR-EC switches in general.
- swiCAR-T cell in vivo activity To assess swiCAR-T cell in vivo activity, a pilot study with an orthotopic (liquid) xenograft tumor model based on luciferized NALM-6 cells was conducted. In this model swiCAR T-cells demonstrated regression after just 5 days of daily treatment with 0.5 mg/kg of anti-CD19 (GCN4) CL1 Fab. Treatment with the wild type anti-CD19 Fab with swiCAR T-cells were not capable of mediating tumor regression (not significant by one-way ANOVA). These results demonstrate the ability to redirect swiCAR T-cells in vivo. Experiment details: 10 6 luciferized NALM-6 cells were injected I.V.
- IVIS in vivo imaging system
- Mammalian expression vector of CD19 IgG heavy chain was generated by in-frame ligation of amplified anti-BCMA IgG heavy chain (VH and CH1) to pFuse-hIgG1-Fc backbone vector (InvivoGen, CA).
- a gene encoding antibody BCMA light chain was amplified and cloned into the pFuse vector without hIgG1 Fc fragment.
- anti-BCMA-IgG-GCN4 CL1 fusion proteins were created by grafting GCN4 with linker sequences at both ends into the CL region of the anti-BCMA light chain.
- the resulting mammalian expression vectors were confirmed by DNA sequencing.
- anti-BCMA-IgG-GCN4 CL1 was expressed through transient transfection of FreeStyle HEK 293 cells with expression vectors of BCMA-IgG heavy chain and GCN4-BCMA-CL1 light chain, according to the manufacturer's protocol. Briefly, 28 mL FreeStyle HEK 293 cells containing 3 ⁇ 10 7 cells were seeded in a 125 mL shaking flask. 15 ⁇ g light chain plasmid and 15 ⁇ g heavy chain plasmid diluted in 1 mL Opti-MEM medium were added in 1 mL Opti-MEM containing 60 ⁇ L 293fectin (Invitrogen, Inc).
- the lipoplex mixture was added to the cell suspension.
- Cells were then shaken at 125 rpm in a 5% CO 2 environment at 37° C.
- Culture medium containing secreted proteins was harvested at 48 and 96 hours after transfection.
- anti-BCMA-IgG-GCN4 CL1 was purified by Protein G chromatography (Thermo Fisher Scientific, IL).
- the cytotoxic activity of the anti-BCMA-IgG-GCN4 CL1 CAR-EC switch was assessed with the human PBMCs transduced with LV-EF1a-GCN4(52SR4) to create CAR-T-GCN4 at E:T ratios of 10:1 and 24 hour incubation. Transduction efficiency of PBMCs was approximately 50%. Activities were assessed against OPM2 (BCMA + ), by quantifying lactate dehydrogenase due to cytolysis of target cells ( FIG. 8 , Table 5).
Priority Applications (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US14/688,894 US9624276B2 (en) | 2013-10-15 | 2015-04-16 | Peptidic chimeric antigen receptor T cell switches and uses thereof |
US15/448,477 US10391155B2 (en) | 2013-10-15 | 2017-03-02 | Peptidic chimeric antigen receptor T cell switches and uses thereof |
US16/532,860 US20200197497A1 (en) | 2013-10-15 | 2019-08-06 | Peptidic chimeric antigen receptor t cell switches and uses thereof |
US18/056,554 US20230355728A1 (en) | 2013-10-15 | 2022-11-17 | Peptidic chimeric antigen receptor t cell switches and uses thereof |
Applications Claiming Priority (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201361891347P | 2013-10-15 | 2013-10-15 | |
US201361895704P | 2013-10-25 | 2013-10-25 | |
US201462009054P | 2014-06-06 | 2014-06-06 | |
US201462030514P | 2014-07-29 | 2014-07-29 | |
US201462030526P | 2014-07-29 | 2014-07-29 | |
PCT/US2014/060684 WO2015057834A1 (en) | 2013-10-15 | 2014-10-15 | Peptidic chimeric antigen receptor t cell switches and uses thereof |
US14/688,894 US9624276B2 (en) | 2013-10-15 | 2015-04-16 | Peptidic chimeric antigen receptor T cell switches and uses thereof |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2014/060684 Continuation WO2015057834A1 (en) | 2013-10-15 | 2014-10-15 | Peptidic chimeric antigen receptor t cell switches and uses thereof |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/448,477 Continuation US10391155B2 (en) | 2013-10-15 | 2017-03-02 | Peptidic chimeric antigen receptor T cell switches and uses thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
US20150307564A1 US20150307564A1 (en) | 2015-10-29 |
US9624276B2 true US9624276B2 (en) | 2017-04-18 |
Family
ID=52828649
Family Applications (4)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US14/688,894 Active US9624276B2 (en) | 2013-10-15 | 2015-04-16 | Peptidic chimeric antigen receptor T cell switches and uses thereof |
US15/448,477 Active US10391155B2 (en) | 2013-10-15 | 2017-03-02 | Peptidic chimeric antigen receptor T cell switches and uses thereof |
US16/532,860 Abandoned US20200197497A1 (en) | 2013-10-15 | 2019-08-06 | Peptidic chimeric antigen receptor t cell switches and uses thereof |
US18/056,554 Pending US20230355728A1 (en) | 2013-10-15 | 2022-11-17 | Peptidic chimeric antigen receptor t cell switches and uses thereof |
Family Applications After (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US15/448,477 Active US10391155B2 (en) | 2013-10-15 | 2017-03-02 | Peptidic chimeric antigen receptor T cell switches and uses thereof |
US16/532,860 Abandoned US20200197497A1 (en) | 2013-10-15 | 2019-08-06 | Peptidic chimeric antigen receptor t cell switches and uses thereof |
US18/056,554 Pending US20230355728A1 (en) | 2013-10-15 | 2022-11-17 | Peptidic chimeric antigen receptor t cell switches and uses thereof |
Country Status (9)
Country | Link |
---|---|
US (4) | US9624276B2 (es) |
EP (1) | EP3057994B1 (es) |
JP (2) | JP6734774B2 (es) |
KR (1) | KR102339240B1 (es) |
CN (1) | CN105829349B (es) |
AU (2) | AU2014337367B2 (es) |
CA (1) | CA2927543C (es) |
ES (1) | ES2845924T3 (es) |
WO (1) | WO2015057834A1 (es) |
Cited By (14)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2019060425A1 (en) | 2017-09-19 | 2019-03-28 | Massachusetts Institute Of Technology | COMPOSITIONS FOR CHIMERIC ANTIGENIC RECEPTOR T CELL THERAPY AND USES THEREOF |
US10391155B2 (en) | 2013-10-15 | 2019-08-27 | The Scripps Research Institute | Peptidic chimeric antigen receptor T cell switches and uses thereof |
WO2020068261A1 (en) | 2018-09-28 | 2020-04-02 | Massachusetts Institute Of Technology | Collagen-localized immunomodulatory molecules and methods thereof |
US10800828B2 (en) | 2015-03-26 | 2020-10-13 | The Scripps Research Institute | Switchable non-scFv chimeric receptors, switches, and methods of use thereof to treat cancer |
WO2020263399A1 (en) | 2019-06-26 | 2020-12-30 | Massachusetts Institute Of Technology | Immunomodulatory fusion protein-metal hydroxide complexes and methods thereof |
WO2021061648A1 (en) | 2019-09-23 | 2021-04-01 | Massachusetts Institute Of Technology | Methods and compositions for stimulation of endogenous t cell responses |
US11091546B2 (en) | 2015-04-15 | 2021-08-17 | The Scripps Research Institute | Optimized PNE-based chimeric receptor T cell switches and uses thereof |
US11117936B2 (en) | 2017-11-10 | 2021-09-14 | University of Pittsburg—Of the Commonwealth System of Higher Education | Affinity-enhanced monomeric streptavidin chimeric antigen receptor (CAR) |
US11174306B2 (en) * | 2016-10-19 | 2021-11-16 | The Scripps Research Institute | Chimeric antigen receptor effector cell switches with humanized targeting moieties and/or optimized chimeric antigen receptor interacting domains and uses thereof |
US11185570B2 (en) | 2017-02-08 | 2021-11-30 | Bristol-Myers Squibb Company | Method of treating cardiovascular disease and heart failure with modified relaxin polypeptides |
US11242530B2 (en) * | 2016-12-08 | 2022-02-08 | Shanghai Unicar-Therapy Bio-Medicine Technology Co., Ltd | siRNA knocking down human PD-1 and recombinant expression CAR-T vector and their construction methods and applications |
US11344578B2 (en) | 2017-04-19 | 2022-05-31 | Board Of Regents, The University Of Texas System | Immune cells expressing engineered antigen receptors |
US11649294B2 (en) | 2017-11-14 | 2023-05-16 | GC Cell Corporation | Anti-HER2 antibody or antigen-binding fragment thereof, and chimeric antigen receptor comprising same |
WO2023225569A1 (en) | 2022-05-17 | 2023-11-23 | Umoja Biopharma, Inc. | Manufacturing viral particles |
Families Citing this family (120)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10323236B2 (en) | 2011-07-22 | 2019-06-18 | President And Fellows Of Harvard College | Evaluation and improvement of nuclease cleavage specificity |
PL2992020T3 (pl) | 2013-05-03 | 2020-06-01 | Ohio State Innovation Foundation | Odpornościowe komórki efektorowe wyrażające inżynierowane chimeryczne receptory antygenu swoiste dla CS1 |
US9163284B2 (en) | 2013-08-09 | 2015-10-20 | President And Fellows Of Harvard College | Methods for identifying a target site of a Cas9 nuclease |
US9359599B2 (en) | 2013-08-22 | 2016-06-07 | President And Fellows Of Harvard College | Engineered transcription activator-like effector (TALE) domains and uses thereof |
US9737604B2 (en) | 2013-09-06 | 2017-08-22 | President And Fellows Of Harvard College | Use of cationic lipids to deliver CAS9 |
US9322037B2 (en) | 2013-09-06 | 2016-04-26 | President And Fellows Of Harvard College | Cas9-FokI fusion proteins and uses thereof |
US9340799B2 (en) | 2013-09-06 | 2016-05-17 | President And Fellows Of Harvard College | MRNA-sensing switchable gRNAs |
EP3057991B8 (en) * | 2013-10-15 | 2019-09-04 | The Scripps Research Institute | Chimeric antigen receptor t cell switches and uses thereof |
US20150165054A1 (en) | 2013-12-12 | 2015-06-18 | President And Fellows Of Harvard College | Methods for correcting caspase-9 point mutations |
GB201409558D0 (en) | 2014-05-29 | 2014-07-16 | Ucb Biopharma Sprl | Method |
GB201412659D0 (en) | 2014-07-16 | 2014-08-27 | Ucb Biopharma Sprl | Molecules |
GB201412658D0 (en) | 2014-07-16 | 2014-08-27 | Ucb Biopharma Sprl | Molecules |
US10077453B2 (en) | 2014-07-30 | 2018-09-18 | President And Fellows Of Harvard College | CAS9 proteins including ligand-dependent inteins |
ES2688035T3 (es) | 2014-08-29 | 2018-10-30 | Gemoab Monoclonals Gmbh | Receptor de antígeno universal que expresa células inmunes para direccionamiento de antígenos múltiples diversos, procedimiento para fabricación del mismo y utilización del mismo para tratamiento de cáncer, infecciones y enfermedades autoinmunes |
AU2016219785B2 (en) | 2015-02-20 | 2021-10-28 | Ohio State Innovation Foundation | Bivalent antibody directed against NKG2D and tumor associated antigens |
CN107708710A (zh) | 2015-03-17 | 2018-02-16 | 嵌合体生物工程公司 | Smart CAR装置,DE CAR多肽,Side CAR及其使用 |
KR20180012749A (ko) | 2015-04-06 | 2018-02-06 | 지안후아 유 | 교아세포종에 대한 egfr-지시된 car 요법 |
EP3466967A1 (en) | 2015-05-18 | 2019-04-10 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
GB201601073D0 (en) | 2016-01-20 | 2016-03-02 | Ucb Biopharma Sprl | Antibodies |
GB201601077D0 (en) | 2016-01-20 | 2016-03-02 | Ucb Biopharma Sprl | Antibody molecule |
GB201601075D0 (en) | 2016-01-20 | 2016-03-02 | Ucb Biopharma Sprl | Antibodies molecules |
PT3331902T (pt) * | 2015-08-07 | 2021-07-26 | Alx Oncology Inc | Construções com um domínio de sirp-alfa ou uma sua variante |
EP3352784A4 (en) | 2015-09-23 | 2019-06-26 | Cytoimmune Therapeutics, LLC | FLT3-FACED CAR CELLS FOR IMMUNOTHERAPY |
WO2017069958A2 (en) | 2015-10-09 | 2017-04-27 | The Brigham And Women's Hospital, Inc. | Modulation of novel immune checkpoint targets |
WO2017070633A2 (en) | 2015-10-23 | 2017-04-27 | President And Fellows Of Harvard College | Evolved cas9 proteins for gene editing |
WO2017075465A1 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting gata3 |
WO2017075451A1 (en) | 2015-10-28 | 2017-05-04 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses by detecting and targeting pou2af1 |
CA3003144A1 (en) * | 2015-10-30 | 2017-05-04 | Aleta Biotherapeutics Inc. | Compositions and methods for tumor transduction |
WO2017075537A1 (en) * | 2015-10-30 | 2017-05-04 | Aleta Biotherapeutics Inc. | Compositions and methods for treatment of cancer |
WO2017087708A1 (en) | 2015-11-19 | 2017-05-26 | The Brigham And Women's Hospital, Inc. | Lymphocyte antigen cd5-like (cd5l)-interleukin 12b (p40) heterodimers in immunity |
EP3377103B1 (en) * | 2015-11-19 | 2021-03-17 | Revitope Limited | Functional antibody fragment complementation for a two-components system for redirected killing of unwanted cells |
GB201521389D0 (en) * | 2015-12-03 | 2016-01-20 | Ucb Biopharma Sprl | Method |
GB201521382D0 (en) * | 2015-12-03 | 2016-01-20 | Ucb Biopharma Sprl | Antibodies |
GB201521393D0 (en) * | 2015-12-03 | 2016-01-20 | Ucb Biopharma Sprl | Antibodies |
GB201521391D0 (en) | 2015-12-03 | 2016-01-20 | Ucb Biopharma Sprl | Antibodies |
GB201521383D0 (en) * | 2015-12-03 | 2016-01-20 | Ucb Biopharma Sprl And Ucb Celltech | Method |
US11052111B2 (en) | 2015-12-08 | 2021-07-06 | Chimera Bioengineering, Inc. | Smart CAR devices and DE CAR polypeptides for treating disease and methods for enhancing immune responses |
GB201602974D0 (en) * | 2016-02-19 | 2016-04-06 | Clube Jasper R | Engineered cells & methods (1) |
EP3443001A4 (en) | 2016-04-11 | 2020-04-29 | Obsidian Therapeutics, Inc. | REGULATED BIOCIRCUIT SYSTEMS |
US10222369B2 (en) | 2016-05-17 | 2019-03-05 | Chimera Bioengineering, Inc. | Methods for making novel antigen binding domains |
ES2960835T3 (es) * | 2016-07-12 | 2024-03-06 | Kite Pharma Inc | Moléculas de unión a antígeno y métodos de uso de las mismas |
US11242376B2 (en) | 2016-08-02 | 2022-02-08 | TCR2 Therapeutics Inc. | Compositions and methods for TCR reprogramming using fusion proteins |
SG11201900907YA (en) | 2016-08-03 | 2019-02-27 | Harvard College | Adenosine nucleobase editors and uses thereof |
EP3497214B1 (en) | 2016-08-09 | 2023-06-28 | President and Fellows of Harvard College | Programmable cas9-recombinase fusion proteins and uses thereof |
WO2018039438A1 (en) | 2016-08-24 | 2018-03-01 | President And Fellows Of Harvard College | Incorporation of unnatural amino acids into proteins using base editing |
EP3858365B1 (en) | 2016-09-01 | 2024-01-31 | Chimera Bioengineering Inc. | Gold optimized car t-cells |
WO2018049025A2 (en) | 2016-09-07 | 2018-03-15 | The Broad Institute Inc. | Compositions and methods for evaluating and modulating immune responses |
IL265438B2 (en) * | 2016-09-23 | 2023-10-01 | Univ Southern California | Chimeric antigen receptors and jewelry and methods for using them |
WO2018067991A1 (en) | 2016-10-07 | 2018-04-12 | The Brigham And Women's Hospital, Inc. | Modulation of novel immune checkpoint targets |
ES2875959T3 (es) | 2016-10-07 | 2021-11-11 | Tcr2 Therapeutics Inc | Composiciones y métodos para reprogramación de receptores de linfocitos T mediante el uso de proteínas de fusión |
CA3039928A1 (en) | 2016-10-14 | 2018-04-19 | President And Fellows Of Harvard College | Aav delivery of nucleobase editors |
EP3315511A1 (en) | 2016-10-29 | 2018-05-02 | Miltenyi Biotec GmbH | Adapter chimeric antigen receptor expressing cells for targeting of multiple antigens |
CN108018299B (zh) * | 2016-11-01 | 2020-03-17 | 上海恒润达生生物科技有限公司 | 靶向bcma的嵌合抗原受体及其用途 |
WO2018083704A1 (en) | 2016-11-07 | 2018-05-11 | Vidac Pharma Ltd. | Use of hexokinase 2/mitochondria-detaching compounds for activating immune responses |
EP3565555A4 (en) * | 2016-11-07 | 2021-03-17 | VIDAC Pharma Ltd. | USE OF HEXKINASE-2 / MITOCHONDRIAL DISCONNECTORS FOR TREATMENT OF HEXKINASE-2 (HC2) EXPRESSING CANCER DISEASES |
CA3044593A1 (en) | 2016-11-22 | 2018-05-31 | TCR2 Therapeutics Inc. | Compositions and methods for tcr reprogramming using fusion proteins |
US11180535B1 (en) | 2016-12-07 | 2021-11-23 | David Gordon Bermudes | Saccharide binding, tumor penetration, and cytotoxic antitumor chimeric peptides from therapeutic bacteria |
WO2018119359A1 (en) | 2016-12-23 | 2018-06-28 | President And Fellows Of Harvard College | Editing of ccr5 receptor gene to protect against hiv infection |
US11242402B2 (en) | 2016-12-23 | 2022-02-08 | Macrogenics, Inc. | ADAM9-binding molecules, and methods of use thereof |
CN110612119A (zh) | 2017-02-07 | 2019-12-24 | 西雅图儿童医院(Dba西雅图儿童研究所) | 磷脂醚(ple)car t细胞肿瘤靶向(ctct)剂 |
KR20190115079A (ko) * | 2017-02-17 | 2019-10-10 | 유넘 테라퓨틱스 인크. | 암 요법 및 b 세포 장애에서의 항-bcma 항체 및 항체-커플링된 t 세포 수용체 (actr)의 공동-사용 |
EP3589295A4 (en) | 2017-02-28 | 2020-11-04 | Endocyte, Inc. | COMPOSITIONS AND METHODS OF T CAR LYMPHOCYTE THERAPY |
US11629340B2 (en) | 2017-03-03 | 2023-04-18 | Obsidian Therapeutics, Inc. | DHFR tunable protein regulation |
JP7341900B2 (ja) * | 2017-03-03 | 2023-09-11 | オブシディアン セラピューティクス, インコーポレイテッド | 免疫療法のためのcd19組成物及び方法 |
US11898179B2 (en) | 2017-03-09 | 2024-02-13 | President And Fellows Of Harvard College | Suppression of pain by gene editing |
US11542496B2 (en) | 2017-03-10 | 2023-01-03 | President And Fellows Of Harvard College | Cytosine to guanine base editor |
IL306092A (en) | 2017-03-23 | 2023-11-01 | Harvard College | Nucleic base editors that include nucleic acid programmable DNA binding proteins |
WO2018183908A1 (en) | 2017-03-31 | 2018-10-04 | Dana-Farber Cancer Institute, Inc. | Compositions and methods for treating ovarian tumors |
WO2018183921A1 (en) | 2017-04-01 | 2018-10-04 | The Broad Institute, Inc. | Methods and compositions for detecting and modulating an immunotherapy resistance gene signature in cancer |
WO2018191553A1 (en) | 2017-04-12 | 2018-10-18 | Massachusetts Eye And Ear Infirmary | Tumor signature for metastasis, compositions of matter methods of use thereof |
US11560566B2 (en) | 2017-05-12 | 2023-01-24 | President And Fellows Of Harvard College | Aptazyme-embedded guide RNAs for use with CRISPR-Cas9 in genome editing and transcriptional activation |
WO2018232195A1 (en) | 2017-06-14 | 2018-12-20 | The Broad Institute, Inc. | Compositions and methods targeting complement component 3 for inhibiting tumor growth |
US11732274B2 (en) | 2017-07-28 | 2023-08-22 | President And Fellows Of Harvard College | Methods and compositions for evolving base editors using phage-assisted continuous evolution (PACE) |
US11319532B2 (en) | 2017-08-30 | 2022-05-03 | President And Fellows Of Harvard College | High efficiency base editors comprising Gam |
WO2019079347A1 (en) | 2017-10-16 | 2019-04-25 | The Broad Institute, Inc. | USES OF BASIC EDITORS ADENOSINE |
WO2019084055A1 (en) | 2017-10-23 | 2019-05-02 | Massachusetts Institute Of Technology | CLASSIFICATION OF GENETIC VARIATION FROM UNICELLULAR TRANSCRIPTOMS |
EP3710039A4 (en) | 2017-11-13 | 2021-08-04 | The Broad Institute, Inc. | METHODS AND COMPOSITIONS FOR CANCER TREATMENT BY TARGETING THE CLEC2D-KLRB1 PATH |
JP6981234B2 (ja) * | 2017-12-22 | 2021-12-15 | 住友電装株式会社 | バッテリターミナルカバー |
WO2019144095A1 (en) | 2018-01-22 | 2019-07-25 | Seattle Children's Hospital (dba Seattle Children's Research Institute) | Methods of use for car t cells |
CN111989108A (zh) | 2018-02-13 | 2020-11-24 | 嵌合体生物工程公司 | 利用rna去稳定元件协调基因表达 |
JP2021517907A (ja) * | 2018-04-18 | 2021-07-29 | アブクロン・インコーポレイテッドAbclon Inc. | スイッチ分子及びスイッチャブルキメラ抗原受容体 |
US11957695B2 (en) | 2018-04-26 | 2024-04-16 | The Broad Institute, Inc. | Methods and compositions targeting glucocorticoid signaling for modulating immune responses |
EP3561053A1 (en) * | 2018-04-26 | 2019-10-30 | Baylor College of Medicine | Immune effector cells and molecular adaptors with an antigen cytokine complex for effective cancer immunotherapy |
US20210252058A1 (en) * | 2018-05-17 | 2021-08-19 | St. Jude Children's Research Hospital, Inc. | Chimeric antigen receptors with myd88 and cd40 costimulatory domains |
US20210371932A1 (en) | 2018-06-01 | 2021-12-02 | Massachusetts Institute Of Technology | Methods and compositions for detecting and modulating microenvironment gene signatures from the csf of metastasis patients |
KR20190141511A (ko) | 2018-06-14 | 2019-12-24 | 주식회사 녹십자랩셀 | 신규 펩티드, 이를 포함하는 키메라 항원 수용체 및 이를 발현하는 면역 세포 |
US20210308267A1 (en) * | 2018-08-07 | 2021-10-07 | Purdue Research Foundation | Rejuvenation of car t cell |
CN114805356A (zh) * | 2018-08-09 | 2022-07-29 | 中国医学科学院北京协和医院 | 用于控制嵌合抗原受体t细胞激活/抑制的连接臂及其应用 |
EP3620464A1 (en) | 2018-09-10 | 2020-03-11 | Miltenyi Biotec GmbH | Car cell having crosslinked disulfide bridge on antigen recognizing moiety |
US20210382068A1 (en) | 2018-10-02 | 2021-12-09 | Dana-Farber Cancer Institute, Inc. | Hla single allele lines |
WO2020081730A2 (en) | 2018-10-16 | 2020-04-23 | Massachusetts Institute Of Technology | Methods and compositions for modulating microenvironment |
US20220062394A1 (en) | 2018-12-17 | 2022-03-03 | The Broad Institute, Inc. | Methods for identifying neoantigens |
US11739156B2 (en) | 2019-01-06 | 2023-08-29 | The Broad Institute, Inc. Massachusetts Institute of Technology | Methods and compositions for overcoming immunosuppression |
MX2021009744A (es) | 2019-02-15 | 2021-11-12 | Univ Southern California | Composiciones de anticuerpos lym-1 y lym-2 y constructos car mejorados. |
US20220154282A1 (en) | 2019-03-12 | 2022-05-19 | The Broad Institute, Inc. | Detection means, compositions and methods for modulating synovial sarcoma cells |
US20220142948A1 (en) | 2019-03-18 | 2022-05-12 | The Broad Institute, Inc. | Compositions and methods for modulating metabolic regulators of t cell pathogenicity |
AU2020242032A1 (en) | 2019-03-19 | 2021-10-07 | Massachusetts Institute Of Technology | Methods and compositions for editing nucleotide sequences |
WO2020201527A1 (en) | 2019-04-04 | 2020-10-08 | Umc Utrecht Holding B.V. | Modified immune receptor constructs |
US20220235340A1 (en) | 2019-05-20 | 2022-07-28 | The Broad Institute, Inc. | Novel crispr-cas systems and uses thereof |
WO2020243371A1 (en) | 2019-05-28 | 2020-12-03 | Massachusetts Institute Of Technology | Methods and compositions for modulating immune responses |
AU2020282791A1 (en) | 2019-05-31 | 2021-12-09 | ALX Oncology Inc. | Methods of treating cancer with SIRP alpha Fc fusion in combination with an immune checkpoint inhibitor |
US20220282333A1 (en) | 2019-08-13 | 2022-09-08 | The General Hospital Corporation | Methods for predicting outcomes of checkpoint inhibition and treatment thereof |
US20210046117A1 (en) | 2019-08-18 | 2021-02-18 | Chimera Bioengineering, Inc. | Combination Therapy with Gold Controlled Transgenes |
WO2021041922A1 (en) | 2019-08-30 | 2021-03-04 | The Broad Institute, Inc. | Crispr-associated mu transposase systems |
EP4028413A1 (en) | 2019-09-10 | 2022-07-20 | Obsidian Therapeutics, Inc. | Ca2-il15 fusion proteins for tunable regulation |
US11793787B2 (en) | 2019-10-07 | 2023-10-24 | The Broad Institute, Inc. | Methods and compositions for enhancing anti-tumor immunity by targeting steroidogenesis |
US11844800B2 (en) | 2019-10-30 | 2023-12-19 | Massachusetts Institute Of Technology | Methods and compositions for predicting and preventing relapse of acute lymphoblastic leukemia |
EP3878464A1 (en) | 2020-03-09 | 2021-09-15 | Miltenyi Biotec B.V. & Co. KG | Use of a car cell having crosslinked disulfide bridge on antigen recognizing moiety for targeting cancer cells |
EP3881866A1 (en) * | 2020-03-16 | 2021-09-22 | GEMoaB GmbH | A targeting module comprising pd-l1 and/or pd-l2 for use in a method for stimulating a chimeric antigen receptor mediated response in a mammal |
CA3175392A1 (en) | 2020-04-17 | 2021-10-21 | Michael A. Caligiuri | Flt3-targeted chimeric antigen receptor modified cells for treatment of flt3-positive malignancies |
KR102502287B1 (ko) * | 2020-04-17 | 2023-02-22 | 앱클론(주) | 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 |
KR20230019843A (ko) | 2020-05-08 | 2023-02-09 | 더 브로드 인스티튜트, 인코퍼레이티드 | 표적 이중 가닥 뉴클레오티드 서열의 두 가닥의 동시 편집을 위한 방법 및 조성물 |
EP4157864A1 (en) * | 2020-05-27 | 2023-04-05 | Antion Biosciences SA | Adapter molecules to re-direct car t cells to an antigen of interest |
WO2021246283A1 (ja) | 2020-06-03 | 2021-12-09 | 京セラ株式会社 | 切削インサート、切削工具及び切削加工物の製造方法 |
WO2022111562A1 (zh) * | 2020-11-26 | 2022-06-02 | 上海医药集团生物治疗技术有限公司 | 一种经修饰的免疫细胞及其应用 |
JP2024500847A (ja) | 2020-12-18 | 2024-01-10 | センチュリー セラピューティクス,インコーポレイテッド | 適合可能な受容体特異性を有するキメラ抗原受容体システム |
EP4176895A1 (en) | 2021-11-08 | 2023-05-10 | AvenCell Europe GmbH | Targeting modules against il13ra2 or her2 for use in combination with a chimeric antigen receptor |
WO2023107940A2 (en) * | 2021-12-07 | 2023-06-15 | The Scripps Research Institute | Switchable car-t therapies for treating human cancers |
EP4342907A1 (en) * | 2022-09-21 | 2024-03-27 | AvenCell Europe GmbH | Switchable chimeric antigen receptors and their use |
WO2024077256A1 (en) | 2022-10-07 | 2024-04-11 | The General Hospital Corporation | Methods and compositions for high-throughput discovery ofpeptide-mhc targeting binding proteins |
Citations (44)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5372930A (en) | 1992-09-16 | 1994-12-13 | The United States Of America As Represented By The Secretary Of The Navy | Sensor for ultra-low concentration molecular recognition |
WO1997015669A1 (en) | 1995-10-24 | 1997-05-01 | The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services | Chimeric receptor genes and cells transformed therewith |
US5861156A (en) | 1993-01-08 | 1999-01-19 | Creative Biomolecules | Methods of delivering agents to target cells |
US5906936A (en) | 1988-05-04 | 1999-05-25 | Yeda Research And Development Co. Ltd. | Endowing lymphocytes with antibody specificity |
US6083751A (en) | 1994-11-01 | 2000-07-04 | Targeted Genetics Corporation | Chimeric receptors for the generation of selectively-activatable TH-independent cytotoxic T cells |
US20040044177A1 (en) | 2002-04-16 | 2004-03-04 | Macke Helmut Robert | Peptide compounds having improved binding affinity to somatostatin receptors |
US20040072299A1 (en) * | 1999-08-09 | 2004-04-15 | Gillies Stephen D. | Multiple cytokine protein complexes |
WO2004106380A2 (en) | 2003-05-31 | 2004-12-09 | Micromet Ag | Human-anti-human cd3 binding molecules |
US20050113564A1 (en) | 2003-11-05 | 2005-05-26 | St. Jude Children's Research Hospital | Chimeric receptors with 4-1BB stimulatory signaling domain |
US20050129671A1 (en) | 2003-03-11 | 2005-06-16 | City Of Hope | Mammalian antigen-presenting T cells and bi-specific T cells |
US20060083683A1 (en) * | 1999-01-21 | 2006-04-20 | Vanessa Hsei | Antibody fragment-polymer conjugates and uses of same |
WO2007059312A2 (en) | 2005-11-16 | 2007-05-24 | Ambrx, Inc. | Methods and compositions comprising non-natural amino acids |
WO2007070659A2 (en) | 2005-12-14 | 2007-06-21 | Ambrx, Inc. | Compositions containing, methods involving, and uses of non-natural amino acids and polypeptides |
WO2007079130A2 (en) | 2005-12-30 | 2007-07-12 | Ambrx, Inc. | Compositions containing, methods involving, and uses of non-natural amino acids and polypeptides |
US20070172504A1 (en) | 2005-12-08 | 2007-07-26 | University Of Lousville Research Foundation, Inc. | In vivo cell surface engineering |
US7258986B2 (en) | 1999-12-28 | 2007-08-21 | Esbatech Ag | Intrabodies with defined framework that is stable in a reducing environment and applications thereof |
WO2007094916A2 (en) | 2006-01-19 | 2007-08-23 | Ambrx, Inc. | Non-natural amino acid polypeptides having modulated immunogenicity |
WO2008025558A2 (en) * | 2006-09-01 | 2008-03-06 | Helmholtz Zentrum München Deutsches Forschungszentrum Für Gesundheit Und Umwelt (Gmbh) | Affinity marker comprising a first and a second tag and its use |
WO2008077079A1 (en) | 2006-12-18 | 2008-06-26 | Ambrx, Inc. | Compositions containing, methods involving, and uses of non-natural amino acids and polypeptides |
WO2008083346A1 (en) | 2006-12-28 | 2008-07-10 | Ambrx, Inc. | Phenazine and quinoxaline substituted amino acids and polypeptides |
US20080260731A1 (en) * | 2002-03-01 | 2008-10-23 | Bernett Matthew J | Optimized antibodies that target cd19 |
US7446190B2 (en) | 2002-05-28 | 2008-11-04 | Sloan-Kettering Institute For Cancer Research | Nucleic acids encoding chimeric T cell receptors |
US7514537B2 (en) | 2001-04-30 | 2009-04-07 | City Of Hope | Chimeric immunoreceptor useful in treating human gliomas |
US20090117108A1 (en) | 2004-04-01 | 2009-05-07 | Xiangbin Wang | Gene Engineering Recombinant Anti-CEA, Anti-CD3, And Anti-CD28 Single-Chain Tri-Specific Antibody |
WO2010037062A1 (en) | 2008-09-26 | 2010-04-01 | Ambrx, Inc. | Non-natural amino acid replication-dependent microorganisms and vaccines |
US20100178276A1 (en) * | 2007-03-30 | 2010-07-15 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred t lymphocytes |
US20100278830A1 (en) | 2007-02-20 | 2010-11-04 | Shoemaker Charles B | Methods and systems for multi-antibody therapies |
US20100297076A1 (en) * | 2007-09-21 | 2010-11-25 | The Regents Of The University Of California | Targeted interferon demonstrates potent apoptotic and anti-tumor activities |
US20100324008A1 (en) | 2007-08-17 | 2010-12-23 | Purdue Research Foundation | Psma binding ligand-linker conjugates and methods for using |
US20120034223A1 (en) | 2008-11-06 | 2012-02-09 | Hall Christopher J | Methods of improving the therapeutic efficacy and utility of antibody fragments |
WO2012031744A1 (en) | 2010-09-08 | 2012-03-15 | Chemotherapeutisches Forschungsinstitut | Chimeric antigen receptors with an optimized hinge region |
WO2012079000A1 (en) | 2010-12-09 | 2012-06-14 | The Trustees Of The University Of Pennsylvania | Use of chimeric antigen receptor-modified t cells to treat cancer |
WO2012082841A2 (en) | 2010-12-14 | 2012-06-21 | University Of Maryland, Baltimore | Universal anti-tag chimeric antigen receptor-expressing t cells and methods of treating cancer |
US20120213783A1 (en) | 2009-10-01 | 2012-08-23 | Rosenberg Steven A | Anti-vascular endothelial growth factor receptor-2 chimeric antigen receptors and use of same for the treatment of cancer |
WO2012166560A1 (en) | 2011-05-27 | 2012-12-06 | Ambrx, Inc. | Compositions containing, methods involving, and uses of non-natural amino acid linked dolastatin derivatives |
WO2012166559A1 (en) | 2011-05-27 | 2012-12-06 | Ambrx, Inc. | Compositions containing, methods involving, and uses of non-natural amino acid linked dolastatin derivatives |
WO2013019615A2 (en) | 2011-07-29 | 2013-02-07 | The Trustees Of The University Of Pennsylvania | Switch costimulatory receptors |
WO2013044225A1 (en) | 2011-09-22 | 2013-03-28 | The Trustees Of The University Of Pennsylvania | A universal immune receptor expressed by t cells for the targeting of diverse and multiple antigens |
WO2013093809A1 (en) | 2011-12-23 | 2013-06-27 | Pfizer Inc. | Engineered antibody constant regions for site-specific conjugation and methods and uses therefor |
WO2013123061A1 (en) | 2012-02-13 | 2013-08-22 | Seattle Children's Hospital D/B/A Seattle Children's Research Institute | Bispecific chimeric antigen receptors and therapeutic uses thereof |
US20140065171A1 (en) | 2012-06-04 | 2014-03-06 | Bernhard Hubert GEIERSTANGER | Site-Specific Labeling Methods and Molecules Produced Thereby |
WO2014100615A1 (en) | 2012-12-20 | 2014-06-26 | Purdue Research Foundation | Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics |
US8802374B2 (en) | 2009-11-03 | 2014-08-12 | City Of Hope | Truncated epiderimal growth factor receptor (EGFRt) for transduced T cell selection |
WO2014153002A1 (en) | 2013-03-14 | 2014-09-25 | The California Institute For Biomedical Research | Bispecific antibodies and uses thereof |
Family Cites Families (42)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US3887699A (en) | 1969-03-24 | 1975-06-03 | Seymour Yolles | Biodegradable polymeric article for dispensing drugs |
US3854480A (en) | 1969-04-01 | 1974-12-17 | Alza Corp | Drug-delivery system |
US3773919A (en) | 1969-10-23 | 1973-11-20 | Du Pont | Polylactide-drug mixtures |
US4263428A (en) | 1978-03-24 | 1981-04-21 | The Regents Of The University Of California | Bis-anthracycline nucleic acid function inhibitors and improved method for administering the same |
DE3169595D1 (en) | 1980-11-10 | 1985-05-02 | Gersonde Klaus | Method of preparing lipid vesicles by ultrasonic treatment, the use of this method and apparatus for its application |
PH19942A (en) | 1980-11-18 | 1986-08-14 | Sintex Inc | Microencapsulation of water soluble polypeptides |
US4675189A (en) | 1980-11-18 | 1987-06-23 | Syntex (U.S.A.) Inc. | Microencapsulation of water soluble active polypeptides |
IE52535B1 (en) | 1981-02-16 | 1987-12-09 | Ici Plc | Continuous release pharmaceutical compositions |
US4485045A (en) | 1981-07-06 | 1984-11-27 | Research Corporation | Synthetic phosphatidyl cholines useful in forming liposomes |
EP0088046B1 (de) | 1982-02-17 | 1987-12-09 | Ciba-Geigy Ag | Lipide in wässriger Phase |
DE3218121A1 (de) | 1982-05-14 | 1983-11-17 | Leskovar, Peter, Dr.-Ing., 8000 München | Arzneimittel zur tumorbehandlung |
EP0102324A3 (de) | 1982-07-29 | 1984-11-07 | Ciba-Geigy Ag | Lipide und Tenside in wässriger Phase |
US4452775A (en) | 1982-12-03 | 1984-06-05 | Syntex (U.S.A.) Inc. | Cholesterol matrix delivery system for sustained release of macromolecules |
US4544545A (en) | 1983-06-20 | 1985-10-01 | Trustees University Of Massachusetts | Liposomes containing modified cholesterol for organ targeting |
HUT35524A (en) | 1983-08-02 | 1985-07-29 | Hoechst Ag | Process for preparing pharmaceutical compositions containing regulatory /regulative/ peptides providing for the retarded release of the active substance |
ATE59966T1 (de) | 1983-09-26 | 1991-02-15 | Ehrenfeld Udo | Mittel und erzeugnis fuer die diagnose und therapie von tumoren sowie zur behandlung von schwaechen der zelligen und humoralen immunabwehr. |
EP0143949B1 (en) | 1983-11-01 | 1988-10-12 | TERUMO KABUSHIKI KAISHA trading as TERUMO CORPORATION | Pharmaceutical composition containing urokinase |
DE3413608A1 (de) | 1984-04-11 | 1985-10-24 | Hoechst Ag, 6230 Frankfurt | Implantierbare zubereitungen von regulatorischen peptiden mit gesteuerter freisetzung und verfahren zu ihrer herstellung |
US5133974A (en) | 1989-05-05 | 1992-07-28 | Kv Pharmaceutical Company | Extended release pharmaceutical formulations |
US6565841B1 (en) | 1991-03-15 | 2003-05-20 | Amgen, Inc. | Pulmonary administration of granulocyte colony stimulating factor |
IT1247472B (it) | 1991-05-31 | 1994-12-17 | Fidia Spa | Processo per la preparazione di microsfere contenenti componenti biologicamente attivi. |
US5407686A (en) | 1991-11-27 | 1995-04-18 | Sidmak Laboratories, Inc. | Sustained release composition for oral administration of active ingredient |
WO1993015722A1 (en) | 1992-02-07 | 1993-08-19 | Syntex (Usa) Inc. | Controlled delivery of pharmaceuticals from preformed porous microparticles |
US5686072A (en) | 1992-06-17 | 1997-11-11 | Board Of Regents, The University Of Texas | Epitope-specific monoclonal antibodies and immunotoxins and uses thereof |
DK0674506T3 (da) | 1992-12-02 | 2001-01-08 | Alkermes Inc | Væksthormonholdige mikrosfærer med styret frigivelse |
US6372716B1 (en) | 1994-04-26 | 2002-04-16 | Genetics Institute, Inc. | Formulations for factor IX |
BR9509201A (pt) | 1994-09-09 | 1997-12-30 | Takeda Chemical Industries Ltd | Preparação de liberação sustemtada uso de um sal de metal polivalente insolúvel em água ou ligeiramente solúvel em água e processo para produzir uma preparação de liberação sustentada |
DE69618938T2 (de) | 1995-03-28 | 2002-10-31 | Fidia Advanced Biopolymers Srl | Nanosphären mit einem biokompatiblen polysaccharid |
DE69614685T2 (de) | 1995-06-07 | 2002-06-27 | Alkermes Inc | Mittel zur verzögerten freisetzung von menschlichem wachstumshormon |
ZA965368B (en) | 1995-07-14 | 1997-01-14 | Novo Nordisk As | A pharmaceutical formulation |
US6685940B2 (en) | 1995-07-27 | 2004-02-03 | Genentech, Inc. | Protein formulation |
US5736152A (en) | 1995-10-27 | 1998-04-07 | Atrix Laboratories, Inc. | Non-polymeric sustained release delivery system |
US6566329B1 (en) | 1999-06-28 | 2003-05-20 | Novo Nordisk A/S | Freeze-dried preparation of human growth hormone |
US20030180714A1 (en) * | 1999-12-15 | 2003-09-25 | Genentech, Inc. | Shotgun scanning |
US6686940B2 (en) | 2000-11-16 | 2004-02-03 | Minolta Co., Ltd. | Reversible image display medium |
US7297348B2 (en) | 2002-07-19 | 2007-11-20 | Omeros Corporation | Biodegradable triblock copolymers, synthesis methods therefore, and hydrogels and biomaterials made there from |
EP1576952A1 (en) | 2004-03-18 | 2005-09-21 | OctoPlus Technologies B.V. | Hydrogel microspheres with improved release profile |
JP4616237B2 (ja) | 2006-11-07 | 2011-01-19 | 日本電信電話株式会社 | シリコン化合物薄膜の形成方法 |
CN103415534A (zh) | 2009-03-10 | 2013-11-27 | 贝勒研究院 | 靶向抗原呈递细胞的癌症疫苗 |
TR201808019T4 (tr) * | 2010-10-27 | 2018-06-21 | Amgen Res Munich Gmbh | Dlbcl tedavisi için araçlar ve yöntemler. |
AU2014337367B2 (en) | 2013-10-15 | 2020-04-30 | The Scripps Research Institute | Peptidic chimeric antigen receptor T cell switches and uses thereof |
EP3057991B8 (en) | 2013-10-15 | 2019-09-04 | The Scripps Research Institute | Chimeric antigen receptor t cell switches and uses thereof |
-
2014
- 2014-10-15 AU AU2014337367A patent/AU2014337367B2/en active Active
- 2014-10-15 KR KR1020167012414A patent/KR102339240B1/ko active IP Right Grant
- 2014-10-15 WO PCT/US2014/060684 patent/WO2015057834A1/en active Application Filing
- 2014-10-15 ES ES14854285T patent/ES2845924T3/es active Active
- 2014-10-15 CN CN201480066872.6A patent/CN105829349B/zh active Active
- 2014-10-15 EP EP14854285.5A patent/EP3057994B1/en active Active
- 2014-10-15 JP JP2016522782A patent/JP6734774B2/ja active Active
- 2014-10-15 CA CA2927543A patent/CA2927543C/en active Active
-
2015
- 2015-04-16 US US14/688,894 patent/US9624276B2/en active Active
-
2017
- 2017-03-02 US US15/448,477 patent/US10391155B2/en active Active
-
2019
- 2019-08-06 US US16/532,860 patent/US20200197497A1/en not_active Abandoned
-
2020
- 2020-03-05 JP JP2020037808A patent/JP2020096644A/ja active Pending
- 2020-07-21 AU AU2020207804A patent/AU2020207804A1/en not_active Abandoned
-
2022
- 2022-11-17 US US18/056,554 patent/US20230355728A1/en active Pending
Patent Citations (49)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5906936A (en) | 1988-05-04 | 1999-05-25 | Yeda Research And Development Co. Ltd. | Endowing lymphocytes with antibody specificity |
US5912172A (en) | 1988-05-04 | 1999-06-15 | Yeda Research And Development Co. Ltd. | Endowing lymphocytes with antibody specificity |
US5372930A (en) | 1992-09-16 | 1994-12-13 | The United States Of America As Represented By The Secretary Of The Navy | Sensor for ultra-low concentration molecular recognition |
US5861156A (en) | 1993-01-08 | 1999-01-19 | Creative Biomolecules | Methods of delivering agents to target cells |
US6083751A (en) | 1994-11-01 | 2000-07-04 | Targeted Genetics Corporation | Chimeric receptors for the generation of selectively-activatable TH-independent cytotoxic T cells |
WO1997015669A1 (en) | 1995-10-24 | 1997-05-01 | The Government Of The United States Of America, Represented By The Secretary, Department Of Health And Human Services | Chimeric receptor genes and cells transformed therewith |
US20060083683A1 (en) * | 1999-01-21 | 2006-04-20 | Vanessa Hsei | Antibody fragment-polymer conjugates and uses of same |
US20040072299A1 (en) * | 1999-08-09 | 2004-04-15 | Gillies Stephen D. | Multiple cytokine protein complexes |
US7258986B2 (en) | 1999-12-28 | 2007-08-21 | Esbatech Ag | Intrabodies with defined framework that is stable in a reducing environment and applications thereof |
US7514537B2 (en) | 2001-04-30 | 2009-04-07 | City Of Hope | Chimeric immunoreceptor useful in treating human gliomas |
US20080260731A1 (en) * | 2002-03-01 | 2008-10-23 | Bernett Matthew J | Optimized antibodies that target cd19 |
US20040044177A1 (en) | 2002-04-16 | 2004-03-04 | Macke Helmut Robert | Peptide compounds having improved binding affinity to somatostatin receptors |
US7446190B2 (en) | 2002-05-28 | 2008-11-04 | Sloan-Kettering Institute For Cancer Research | Nucleic acids encoding chimeric T cell receptors |
US20050129671A1 (en) | 2003-03-11 | 2005-06-16 | City Of Hope | Mammalian antigen-presenting T cells and bi-specific T cells |
WO2004106380A2 (en) | 2003-05-31 | 2004-12-09 | Micromet Ag | Human-anti-human cd3 binding molecules |
US20050113564A1 (en) | 2003-11-05 | 2005-05-26 | St. Jude Children's Research Hospital | Chimeric receptors with 4-1BB stimulatory signaling domain |
US20090117108A1 (en) | 2004-04-01 | 2009-05-07 | Xiangbin Wang | Gene Engineering Recombinant Anti-CEA, Anti-CD3, And Anti-CD28 Single-Chain Tri-Specific Antibody |
WO2007059312A2 (en) | 2005-11-16 | 2007-05-24 | Ambrx, Inc. | Methods and compositions comprising non-natural amino acids |
US20070172504A1 (en) | 2005-12-08 | 2007-07-26 | University Of Lousville Research Foundation, Inc. | In vivo cell surface engineering |
WO2007070659A2 (en) | 2005-12-14 | 2007-06-21 | Ambrx, Inc. | Compositions containing, methods involving, and uses of non-natural amino acids and polypeptides |
WO2007079130A2 (en) | 2005-12-30 | 2007-07-12 | Ambrx, Inc. | Compositions containing, methods involving, and uses of non-natural amino acids and polypeptides |
WO2007094916A2 (en) | 2006-01-19 | 2007-08-23 | Ambrx, Inc. | Non-natural amino acid polypeptides having modulated immunogenicity |
WO2008025558A2 (en) * | 2006-09-01 | 2008-03-06 | Helmholtz Zentrum München Deutsches Forschungszentrum Für Gesundheit Und Umwelt (Gmbh) | Affinity marker comprising a first and a second tag and its use |
WO2011028195A2 (en) | 2006-12-18 | 2011-03-10 | Ambrx, Inc. | Compositions containing, methods involving, and uses of non-natural amino acids and polypeptides |
WO2008077079A1 (en) | 2006-12-18 | 2008-06-26 | Ambrx, Inc. | Compositions containing, methods involving, and uses of non-natural amino acids and polypeptides |
WO2008083346A1 (en) | 2006-12-28 | 2008-07-10 | Ambrx, Inc. | Phenazine and quinoxaline substituted amino acids and polypeptides |
US20100278830A1 (en) | 2007-02-20 | 2010-11-04 | Shoemaker Charles B | Methods and systems for multi-antibody therapies |
US20100178276A1 (en) * | 2007-03-30 | 2010-07-15 | Memorial Sloan-Kettering Cancer Center | Constitutive expression of costimulatory ligands on adoptively transferred t lymphocytes |
US20100324008A1 (en) | 2007-08-17 | 2010-12-23 | Purdue Research Foundation | Psma binding ligand-linker conjugates and methods for using |
US20100297076A1 (en) * | 2007-09-21 | 2010-11-25 | The Regents Of The University Of California | Targeted interferon demonstrates potent apoptotic and anti-tumor activities |
WO2010037062A1 (en) | 2008-09-26 | 2010-04-01 | Ambrx, Inc. | Non-natural amino acid replication-dependent microorganisms and vaccines |
US20120034223A1 (en) | 2008-11-06 | 2012-02-09 | Hall Christopher J | Methods of improving the therapeutic efficacy and utility of antibody fragments |
US20120213783A1 (en) | 2009-10-01 | 2012-08-23 | Rosenberg Steven A | Anti-vascular endothelial growth factor receptor-2 chimeric antigen receptors and use of same for the treatment of cancer |
US8802374B2 (en) | 2009-11-03 | 2014-08-12 | City Of Hope | Truncated epiderimal growth factor receptor (EGFRt) for transduced T cell selection |
WO2012031744A1 (en) | 2010-09-08 | 2012-03-15 | Chemotherapeutisches Forschungsinstitut | Chimeric antigen receptors with an optimized hinge region |
WO2012079000A1 (en) | 2010-12-09 | 2012-06-14 | The Trustees Of The University Of Pennsylvania | Use of chimeric antigen receptor-modified t cells to treat cancer |
US8916381B1 (en) | 2010-12-09 | 2014-12-23 | The Trustees Of The University Of Pennyslvania | Methods for treatment of cancer |
WO2012082841A2 (en) | 2010-12-14 | 2012-06-21 | University Of Maryland, Baltimore | Universal anti-tag chimeric antigen receptor-expressing t cells and methods of treating cancer |
WO2012166560A1 (en) | 2011-05-27 | 2012-12-06 | Ambrx, Inc. | Compositions containing, methods involving, and uses of non-natural amino acid linked dolastatin derivatives |
WO2012166559A1 (en) | 2011-05-27 | 2012-12-06 | Ambrx, Inc. | Compositions containing, methods involving, and uses of non-natural amino acid linked dolastatin derivatives |
WO2013019615A2 (en) | 2011-07-29 | 2013-02-07 | The Trustees Of The University Of Pennsylvania | Switch costimulatory receptors |
US20140234348A1 (en) | 2011-09-22 | 2014-08-21 | The Trustees Of The University Of Pennsylvania | Universal Immune Receptor Expressed by T Cells for the Targeting of Diverse and Multiple Antigens |
WO2013044225A1 (en) | 2011-09-22 | 2013-03-28 | The Trustees Of The University Of Pennsylvania | A universal immune receptor expressed by t cells for the targeting of diverse and multiple antigens |
WO2013093809A1 (en) | 2011-12-23 | 2013-06-27 | Pfizer Inc. | Engineered antibody constant regions for site-specific conjugation and methods and uses therefor |
WO2013123061A1 (en) | 2012-02-13 | 2013-08-22 | Seattle Children's Hospital D/B/A Seattle Children's Research Institute | Bispecific chimeric antigen receptors and therapeutic uses thereof |
US20140065171A1 (en) | 2012-06-04 | 2014-03-06 | Bernhard Hubert GEIERSTANGER | Site-Specific Labeling Methods and Molecules Produced Thereby |
WO2014100615A1 (en) | 2012-12-20 | 2014-06-26 | Purdue Research Foundation | Chimeric antigen receptor-expressing t cells as anti-cancer therapeutics |
WO2014153002A1 (en) | 2013-03-14 | 2014-09-25 | The California Institute For Biomedical Research | Bispecific antibodies and uses thereof |
WO2014153164A1 (en) | 2013-03-14 | 2014-09-25 | The California Institute For Biomedical Research | Targeting agent antibody conjugates and uses thereof |
Non-Patent Citations (159)
Title |
---|
Ang et al., "Generating a Chimeric Antigen Receptor to Redirect T-cell Specificity after Infusion" Molecular Therapy 19( Suppl 1): No. 353, p. S137, May 2011. |
Arcondéguy et al., "Survey and Summary. VEGF-A mRNA processing, stability and translation: a paradigm for intricate regulation of gene expression at the post-transcriptional level," Nucleic Acids Research 41(17): 7997-8010, 2013. |
Axup, J. et al., Synthesis of site-specific antibody-drug conjugates using unnatural amino acids. PNAS. 2012, pp. 16101-16106, vol. 109, No. 40. |
Baeuerle, P.A., P. Kufer, and R. Bargou, BiTE: Teaching antibodies to engage T-cells for cancer therapy. Curr Opin Mol Ther, 2009. pp. 22-30, vol. 11, Issue No. 1. |
Beers, S.A., et al., Antigenic modulation limits the efficacy of anti-CD20 antibodies: implications for antibody selection. Blood, Jun. 24, 2010. pp. 5191-5201, vol. 115, Issue No. 25. |
Bibl, M., et al., Stability of amyloid-beta peptides in plasma and serum. Electrophoresis, 2012. pp. 445-450, vol. 33, Issue No. 3. |
Bluemel, C., et al., Epitope distance to the target cell membrane and antigen size determine the potency of T cell-mediated lysis by BiTE antibodies specific for a large melanoma surface antigen. Cancer Immunol Immunother, 2010. pp. 1197-1209, vol. 59, Issue No. 8. |
Boder, E.T., K.S. Midelfort, and K.D. Wittrup, Directed evolution of antibody fragments with monovalent femtomolar antigen-binding affinity. Proc Natl Acad Sci U S A, 2000, pp. 10701-10705, vol. 97, No. 20. |
Bonini, C., et al., The suicide gene therapy challenge: how to improve a successful gene therapy approach. Mol Ther, 2007. pp. 1248-1252, vol. 15, No. 7. |
Boulassel, M.R. and A. Galal, Immunotherapy for B-Cell Neoplasms using T Cells expressing Chimeric Antigen Receptors: From antigen choice to clinical implementation. Sultan Qaboos Univ Med J, 2012. p. 273-85, vol. 12, No. 3. |
Brentjens et al., "Eradication of systemic B-cell tumors by genetically targeted human T lymphocytes co-stimulated by CD80 and interleukin-15," Nature Medicine 9(3): 279-286, Mar. 2003. |
Brentjens et al., "Genetically Targeted T Cells Eradicate Systemic Acute Lymphoblastic Leukemia Xenografts," Clinical Cancer Research 13(18): 5426-5435, Sep. 15, 2007. |
Brentjens, R., et al., Treatment of chronic lymphocytic leukemia with genetically targeted autologous T cells: case report of an unforeseen adverse event in a phase I clinical trial. Mol Ther, 2010. pp. 666-668, vol. 18, No. 4. |
Bridgeman, J.S., et al., Structural and biophysical determinants of alphabeta T-cell antigen recognition. Immunology, 2011. pp. 9-18, vol. 135, No. 1. |
Cairo, M.S., et al., NCI first International Workshop on the biology, prevention, and treatment of relapse after allogeneic hematopoietic stem cell transplantation: report from the committee on the biological considerations of hematological relapse following allogeneic stem cell transplantation unrelated to graft-versus-tumor effects: state of the science. Biol Blood Marrow Transplant, 2010. pp. 709-728, vol. 16, No. 6. |
Cameron, B.J., et al., Identification of a Titin-Derived HLA-Al-Presented Peptide as a Cross-Reactive Target for Engineered MAGE A3-Directed T Cells. Sci Transl Med, 2013. pp. 197ra103, vol. 5, No. 197. |
Carpenito, C., et al., Control of large, established tumor xenografts with genetically retargeted human T cells containing CD28 and CD137 domains. Proc Natl Acad Sci U S A, 2009. pp. 3360-3365, vol. 106, No. 9. |
Carpenter et al., B-cell maturation antigen is a promising target for adoptive T-cell therapy of multiple myeloma, Clinical Cancer Research, 2013, pp. 2048-2060, vol. 19, No. 8, e-pub Jan. 23, 2013. |
Chatterjee et al. A Versatile Platform for Single- and Multiple-Unnatural Amino Acid Mutagenesis in Escherichia coli. Biochemistry. Mar. 12, 2013. vol. 52, No. 10, e-pub. Dec. 7, 2013. |
Chiarella, P., et al., Antigenic features of protein carriers commonly used in immunisation trials. Biotechnol Lett, 2010. pp. 1215-1221, vol. 32, No. 9. |
Chlewicki, L.K., et al., High-affinity, peptide-specific T cell receptors can be generated by mutations in CDR1, CDR2 or CDR3. J Mol Biol, 2005. pp. 223-239, vol. 346, vol. 1. |
Chung, E.Y., et al., CD19 is a major B cell receptor-independent activator of MYC-driven B-lymphomagenesis. J Clin Invest, 2012. pp. 2257-2266, vol. 122, No. 6. |
Cole, D.K., et al., The molecular determinants of CD8 co-receptor function. Immunology, Oct. 2012. pp. 139-148, vol. 137, No. 2. |
Cui et al. Chemically programmed bispecific antibodies that recruit and activate T cells. Journal of Biological Chemistry, 2012, pp. 28206-28214, vol. 287, No. 34. |
Davila, M.L., et al., CD19 CAR-targeted T cells induce long-term remission and B Cell Aplasia in an immunocompetent mouse model of B cell acute lymphoblastic leukemia. PLoS One, 2013. p. e61338, vol. 8 No. 4. |
Davis et al., "Therapy of B-Cell Lymphoma with Anti-CD20 Antibodies Can Result in the Loss of CD20 Antigen Expression," Clinical Cancer Research 5: 611-615, Mar. 1999. |
Davis, T.A., et al., Therapy of B-cell lymphoma with anti-CD20 antibodies can result in the loss of CD20 antigen expression. Clin Cancer Res, 1999. pp. 611-615, vol. 5, No. 3. |
Dengl et al., "Engineered hapten-binding antibody derivatives for modulation of pharmacokinetic properties of small molecules and targeted payload delivery," Immunological Reviews 270: 165-177, 2016. |
Dubrovska, A., et al., A chemically induced vaccine strategy for prostate cancer. ACS Chem Biol, 2011. pp. 1223-1231, vol. 6, No. 11. |
Ertl et al., "Considerations for the Clinical Application of Chimeric Antigen Receptor T Cells: Observations from a Recombinant DNA Advisory Committee Symposium Held Jun. 15, 2010," Cancer Research 71(9): 3175-3181, 2011. |
Eshhar et al., "Chimeric T cell receptor which incorporates the anti-tumour specificity of a monoclonal antibody with the cytolytic activity of T cells: a model system for immunotherapeutical approach" Br. J. Cancer 62: 27-29, 1990. |
Eshhar et al., Specific activation and targeting of cytotoxic lymphocytes through chimeric single chains consisting of antibody-binding domains and the y or subunits of the immunoglobulin and T-cell receptors, Proc. Natl. Acad. Sci. USA 90: 720-724, Jan. 1993. |
Eshhar, "The T-Body Approach: Redirecting T Cells with Antibody Specificity," Y. Chernajovsky, A. Nissim (eds.), Therapeutic Antibodies. Handbook of Experimental Pharmacology 181. Springer-Verlag Berlin Heidelberg 2008, pp. 329-342. |
Fernando et al., "Targeted Therapy of Colorectal Cancer: Clinical Experience with Bevacizumab," The Oncologist 9(suppl 1): 11-18, 2004. |
Fitzer-Attas et al., "Harnessing Syk Family Tyrosine Kinases as Signaling Domains for Chimeric Single Chain of the Variable Domain Receptors: Optimal Design for T Cell Activation," The Journal of Immunology 160: 145-154, 1998. |
Friedmann-Morvinski et al., "Redirected primary T cells harboring a chimeric receptor require costimulation for their antigen-specific activation," Blood 105: 3087-3093, 2005. |
Frost et al., "In Vitro Evaluation of Avidin Antibody Pretargeting Using 211At-Labeled and Biotinylated Poly-L-Lysine as Effector Molecule," Cancer 116(4 suppl): 1101-1110, 2010. |
Gamzatova et al., "Human leucocyte antigen (HLA) A2 as a negative clinical prognostic factor in patients with advanced ovarian cancer," Gynecologic Oncology 103: 145-150, 2006. |
Gavrilyuk, et al. β-Lactam-based Approach for the Chemical Programming of Aldolase Antibody 38C2. Bioorg Med Chem Lett. Mar. 1, 2009, pp. 1421-1424, vol. 19, No. 5, e-pub Jan. 15, 2009. |
GenBank Accession No. AB064051: Homo sapiens IGK mRNA for immunoglobulin kappa light chain VLJ region, partial cds, clone: K10. Jul. 2, 2002. |
Gilham et al., CAR-T cells and solid tumors: tuning T cells to challenge an inveterate foe, Trends in Molecular Medicine, 2012, pp. 377-384, vol. 18, No. 7. |
Gillies et al., "Targeting Human Cytotoxic T Lymphocytes to Kill Heterologous Epidermal Growth Factor Receptor-Bearing Tumor Cells. Tumor-Infiltrating Lymphocyte/Hormone Receptor/Recombinant Antibody," J. Immu. 146(3): 1067-1071, Feb. 1, 1991. |
Grada et al., TanCAR: a novel bispecific chimeric antigen receptor for cancer immunotherapy, Molecular Therapy-Nucleic Acids, 2013, pp. 1-11, vol. 2, No. 7. |
Griffioen, M., et al., Retroviral transfer of human CD20 as a suicide gene for adoptive T-cell therapy. Haematologica, 2009. pp. 1316-1320, vol. 94, No. 9. |
Gross and Eshhar, "Endowing T cells with antibody specificity using chimeric T cell receptors," FASEB J. 6: 3370-3378, 1992. |
Gross et al., "Expression of immunoglobulin-T-cell receptor chimeric molecules as functional receptors with antibody-type specificity," Proc. Natl. Acad. Sci. USA 86: 10024-10028, Dec. 1989. |
Gross, G., T. Waks, and Z. Eshhar, Expression of immunoglobulin-T-cell receptor chimeric molecules as functional receptors with antibody-type specificity. Proc Natl Acad Sci U S A, 1989. 86(24): p. 10024-8. |
Grupp, S.A., et al., Chimeric antigen receptor-modified T cells for acute lymphoid leukemia. N Engl J Med, 2013. pp. 1509-1518, vol. 68, No. 16. |
Guest et al., "The Role of Extracellular Spacer Regions in the Optimal Design of Chimeric Immune Receptors. Evaluation of Four Different scFvs and Antigens," J. Immunother 28(3): 203-211, May/Jun. 2005. |
Hanes, J., et al., Ribosome display efficiently selects and evolves high-affinity antibodies in vitro from immune libraries. Proc Natl Acad Sci U S A, 1998. pp. 14130-1435, vol. 95, No. 24. |
Herron, J.N., et al., High resolution structures of the 4-4-20 Fab-fluorescein complex in two solvent systems: effects of solvent on structure and antigen-binding affinity. Biophys J, 1994. pp. 2167-2183, vol. 67, No. 6. |
Heslop, H.E., Safer CARS. Mol Ther, Apr. 2010. pp. 661-662, vol. 18, No. 4. |
Hollatz, G., et al., T cells for suicide gene therapy: activation, functionality and clinical relevance. J Immunol Methods, 2008, pp. 69-81, vol. 331(1-2). |
Hombach et al., "T cell activation by recombinant FcεRl γ-chain immune receptors: an extracellular spacer domain impairs antigen-dependent T cell activation but not antigen recognition," Gene Therapy 7: 1067-1075, 2000. |
Hotfilder, M., et al., Leukemic stem cells in childhood high-risk ALL/t(9;22) and t(4;11) are present in primitive lymphoid-restricted CD34+CD19− cells. Cancer Res, 2005. pp. 1442-1449, vol. 65, No. 4. |
Hudecek, M., et al., Receptor affinity and extracellular domain modifications affect tumor recognition by ROR1-specific chimeric antigen receptor T cells. Clin Cancer Res, 2013.pp. 3153-3164, vol. 19, No. 12. |
Hutchins et al. Site-Specific Coupling and Sterically Controlled Formation of Multimeric Antibody Fab Fragments with Unnatural Amino Acids. Journal of Molecular Biology. Mar. 2011. pp. 595-603, vol. 406, No. 4. |
Hutchins et al., Selective formation of covalent protein heterodimers with an unnatural amino acid. Chemistry & Biology, 2011, pp. 299-303, vol. 18, No. 3. |
Hwu et al., "Lysis of Ovarian Cancer Cells by Human Lymphocytes Redirected with a Chimeric Gene Composed of an Antibody Variable Region and the Fc Receptor γ Chain," J. Exp. Med. 178: 361-366, Jul. 1993. |
Johnson et al. RF1 Knockout Allows Ribosomal Incorporation of Unnatural Amino Acids at Multiple Sites. Nat Chem Biol. May 1, 2012. pp. 779-786, vol. 7, No. 11. |
Johnson et al., "Gene therapy with human and mouse T-cell receptors mediates cancer regression and targets normal tissues expressing cognate antigen," Blood 114: 535-546, 2009. |
Jung, S. and A. Pluckthun. Improving in vivo folding and stability of a single-chain Fv antibody fragment by loop grafting. Protein Engineering, Aug. 1997, pp. 959-966, vol. 10, No. 8. |
Kalos, M., et al., T cells with chimeric antigen receptors have potent antitumor effects and can establish memory in patients with advanced leukemia. Science Translational Medicine, Aug. 10, 2011. p. 95ra73, vol. 3, No. 95. |
Kazane et al. Self-assembled antibody multimers through peptide nucleic acid conjugation. Journal Am Chem Soc, 135(1):340-6, 2013. |
Kershaw et al., "A Phase I Study on Adoptive Immunotherapy Using Gene-Modified T Cells for Ovarian Cancer," Clinical Cancer Research 12(20 Pt 1): 6106-6115, Oct. 15, 2006. |
Kershaw et al., "Gene-Engineered T Cells as a Superior Adjuvant Therapy for Metastatic Cancer," The Journal of Immunology 173(3): 2143-2150, Aug. 1, 2004. |
Kim et al. Synthesis of bispecific antibodies genetically encoded unnatural amino acids. Journal of the American Chemical Society, Jun. 20, 2012, pp. 9918-9921, vol. 134, No. 24, e-pub Jun. 6, 2012. |
Kim et al., Protein conjugation with genetically encoded unnatural amino acids. Current Opinion Chemical Biology, Jun. 2013, pp. 412-419, vol. 17, No. 3. |
Kochenderfer et al., Construction and pre-clinical evaluation of an anti-CD19 chimeric antigen receptor, Journal of Immunotherapy, 2009, pp. 689-702, vol. 32, No. 7. |
Kochenderfer, J.N., et al., Adoptive transfer of syngeneic T cells transduced with a chimeric antigen receptor that recognizes murine CD19 can eradicate lymphoma and normal B cells. Blood, 2010, pp. 3875-3886, vol. 116, No. 19. |
Kochenderfer, J.N., et al., B-cell depletion and remissions of malignancy along with cytokine-associated toxicity in a clinical trial of anti-CD19 chimeric-antigenreceptor-transduced T cells. Blood, 2012, pp. 2709-2720, vol. 119, No. 12. |
Kranz et al., "Conjugates of folate and anti-T-cell-receptor antibodies specifically target folate-receptor-positive tumor cells for lysis," Proc. Natl. Acad. Sci. USA 92: 9057-9061, Sep. 1995. |
Krause et al., "Antigen-dependent CD28 Signaling Selectively Enhances Survival and Proliferation in Genetically Modified Activated Human Primary T Lymphocytes," J. Exp. Med. 188(4): 619-626, Aug. 17, 1998. |
Kudo K., et al, T Lymphocytes expressing a CD16 signaling receptor exert antibody-dependent cancer cell killing. Cancer Research, Jan. 1, 2014, pp. 93-103, vol. 74, No. 1, e-pub Nov. 6, 2013. |
Kularatne, S.A., et al., Prostate-specific membrane antigen targeted imaging and therapy of prostate cancer using a PSMA inhibitor as a homing ligand. Molecular Pharmaceutics, May-Jun. 2009, pp. 780-789, vol. 6, No. 3, e-pub Apr. 12, 2009. |
Kuroki et al., "Strategies to Endow Cytotoxic T Lymphocytes or Natural Killer Cells with Antibody Activity against Carcinoembryonic Antigen," Tumor Biol. 25: 208-216, 2004. |
Lamers et al., "Treatment of Metastatic Renal Cell Carcinoma With Autologous T-Lymphocytes Genetically Retargeted Against Carbonic Anhydrase IX: First Clinical Experience," Journal of Clinical Oncology 24(13): e20-e22, May 1, 2006. |
Lamers, C.H., et al., Immune responses to transgene and retroviral vector in patients treated with ex vivo-engineered T cells. Blood, Jan. 6, 2011, pp. 72-82, vol. 117, No. 1, e-pub Oct. 1, 2010. |
Lang et al., Genetic encoding of bicyclononynes and trans-cyclooctenes for site-specific protein labeling in vitro and in live mammalian cells via rapid fluorgenic Diels-Alder reactions. Journal of the American Chemical Society, 2012, pp. 10317-1320, vol. 134, No. 25. |
le Viseur, C., et al., In childhood acute lymphoblastic leukemia, blasts at different stages of immunophenotypic maturation have stem cell properties. Cancer Cell, Jul. 8, 2008. p. 47-58, vol. 14, No. 1. |
Lee, J., M. Sadelain, and R. Brentjens. Retroviral transduction of murine primary T lymphocytes. Methods in Molecular Biology, 2009. pp. 83-96, vol. 506. |
Lin et al., Transglutaminase-Catalyzed Site-Specific Conjugation of Small-Molecules to Proteins in Vitro and on the Surface of Living Cells. Journal of American Chemical Society, 2006, pp. 4542-4543, vol. 128, No. 14, e-pub Mar. 16, 2006. |
Linette, G.P., et al., Cardiovascular toxicity and titin cross-reactivity of affinity-enhanced T cells in myeloma and melanoma. Blood, Aug. 8, 2013. pp. 863-871, vol. 122, No. 6, e-pub Jun. 14, 2013. |
Liu et al. Adding new chemistries to the genetic code. Annual Review of Biochemistry, Jul. 2010, pp. 413-444, vol. 79, e-pub Mar. 18, 2010. |
Lobbestael et al., "Immunohistochemical detection of transgene expression in the brain using small epitope tags," BMC Biotechnology 10, six pages, 2010. |
Lu, H., et al., Site-Specific Antibody-Polymer Conjugates for siRNA Delivery. Journal of American Chemical Society, 2013. p. 13885-13891, vol. 135, No. 37. |
Lu, Y., et al., Strategy to prevent drug-related hypersensitivity in folate-targeted hapten immunotherapy of cancer. AAPS J, 2009. p. 628-638, vol. 11, No. 3. |
Ma et al., "Carcinoembryonic antigen-immunoglobulin Fc fusion protein (CEA-Fc) for identification and activation of anti-CEA immunoglobulin-T-cell receptor-modified T cells, representative of a new class of Ig fusion proteins," C. Gene Therapy 11: 297-306, 2004. |
Ma, Q., R.M. Gonzalo-Daganzo, and R.P. Junghans, Genetically engineered T cells as adoptive immunotherapy of cancer. Cancer Chemother Biol Response Modif, 2002. pp. 315-341, vol. 20. |
Ma, Y., et al., Targeting of antigens to B lymphocytes via CD19 as a means for tumor vaccine development. Journal of Immunology, Jun. 1, 2013, pp. 5588-5599, vol. 190, No. 11. e-pub Apr. 29, 2013. |
Maher et al., "Human T-lymphocyte cytotoxicity and proliferation directed by a single chimeric TCRζ/CD28 receptor," Nature Biotechnology 20: 70-75, Jan. 2002. |
Maher, J., Immunotherapy of malignant disease using chimeric antigen receptor engrafted T cells. International Scholarly Research Notices Oncology, 2012, p. 278093, vol. 2012. |
Masir, N., et al., Loss of CD19 expression in B-cell neoplasms. Histopathology, 2006. p. 239-246, vol. 48, No. 3. |
Milone, M.C., et al., Chimeric receptors containing CD137 signal transduction domains mediate enhanced survival of T cells and increased antileukemic efficacy in vivo. Molecular Therapy, 2009, pp. 1453-1464, vol. 17, No. 8. |
Moore, P.A., et al., Application of dual affinity retargeting molecules to achieve optimal redirected T-cell killing of B-cell lymphoma. Blood, Apr. 28, 2011. pp. 4542-4551, vol. 117, No. 17. e-pub Feb. 7, 2011. |
Morgan, R.A., et al., Case report of a serious adverse event following the administration of T cells transduced with a chimeric antigen receptor recognizing ERBB2. Molecular Therapy, Apr. 18, 2010. pp. 843-851 vol. 18, No. 4. e-pub Feb. 23, 2010. |
Mossner, E., H. Koch, and A. Pluckthun, Fast selection of antibodies without antigen purification: adaptation of the protein fragment complementation assay to select antigen-antibody pairs. Journal of Molecular Biology, Apr. 27, 2001, pp. 115-122, vol. 308, No. 2. |
Murphy et al., Proc. Amer. Assoc. Cancer Res., 2005, 46, abstract No. 1495. * |
Nauerth, M., et al., TCR-ligand koff rate correlates with the protective capacity of antigen-specific CD8+ T cells for adoptive transfer. Science Translational Medicine, Jul. 3, 2013, pp. 192ra87, vol. 5, No. 192. |
Ogg et al., "Sensitization of tumour cells to lysis by virus-specific CTL using antibody-targeted MHC class I/peptide complexes," British Journal of Cancer 82(5): 1058-1062, 2000. |
Olejniczak, S.H., et al., A quantitative exploration of surface antigen expression in common B-cell malignancies using flow cytometry. Immunol Invest, 2006. pp. 93-114, vol. 35, No. 1. |
Oshimi et al., Increased Lysis of Patient CD10-Positive Leukemic Cells by T Cells Coated With Anti-CD3 Fab' Antibody Cross-Linked to Anti-CD10 Fab' Antibody, Blood 77(5): 1044-1049, Mar. 1, 1991. |
Park et al., "Adoptive Transfer of Chimeric Antigen Receptor Re-directed Cytolytic T Lymphocyte Clones in Patients with Neuroblastoma," Molecular Therapy 15(4): 825-833, Apr. 2007. |
PCT/US2014/060684 International Search Report Mailed Jan. 22, 2015. |
PCT/US2014/060713 International Search Reported Dated Jan. 15, 2015. |
Perez et al., "Specific targeting of cytotoxic T cells by anti-T3 linked to anti-target cell antibody," Nature 316: 354-356, Jul. 25, 1985. |
Popkov, et al. Instant immunity through chemically programmable vaccination and covalent self-assembly. Proceedings of the National Academy of Sciences of the United States of America. Early Edition. Jan. 7, 2009, pp. 1-6. |
Porter, D.L., et al., Chimeric antigen receptor-modified T cells in chronic lymphoid leukemia. New England Journal of Medicine, Aug. 25, 2011. pp. 725-733, vol. 365, No. 8. |
Pule et al., "Virus-specific T cells engineered to coexpress tumor-specific receptors: persistence and antitumor activity in individuals with neuroblastoma," Nature Medicine 14(11): 1264-1270, Nov. 2008. |
Rader, et al. A Humanized Aldolase Antibody for Selective Chemotherapy and Adaptor Immunotherapy. Journal of Molecular Biology, 2003, pp. 889-899, vol. 332. |
Rader, et al. Chemically programmed antibodies. Trends in Biotechnology, Apr. 2014, pp. 186-197, vol. 32, No. 4. |
Rader, et al., Chemically programmed monoclonal antibodies for cancer therapy: Adaptor immunotherapy based on a covalent antibody catalyst. PNAS Apr. 29, 2003, pp. 5396-5400, vol. 100, No. 9. |
Reichert, Biospecific antibodies: A global overview of development as innovative therapeutics. AAPS 2013 National Biotechnology Conference, May 21, 2013, 14 pages. |
Reid et al., "Extrinsic Cotton Effects in Hapten-Carrier and Hapten-Antibody Interactions," Proc. Nat. Acad. Sci. USA 68(6): 1184-1187, Jun. 1971. |
Restifo, N.P., M.E. Dudley, and S.A. Rosenberg, Adoptive immunotherapy for cancer: harnessing the T cell response. Nature Reviews Immunology, Apr. 2012, pp. 269-281, vol. 12, No. 4. |
Rezvani, A.R. and D.G. Maloney. Rituximab resistance. Best Pract Res Clin Haematol, Jun. 2011. pp. 203-216, vol. 24, No. 2. e-pub Apr. 13, 2011. |
Riddell and Protzer, "Carving the CAR," Gene Therapy 17: 1191-1192, 2010. |
Riviere, I., K. Brose, and R.C. Mulligan, Effects of retroviral vector design on expression of human adenosine deaminase in murine bone marrow transplant recipients engrafted with genetically modified cells. Proc Natl Acad Sci USA, Jul. 18, 1995, pp. 6733-6737, vol. 92, No. 15. |
Romer, P.S., et al., Preculture of PBMCs at high cell density increases sensitivity of T-cell responses, revealing cytokine release by CD28 superagonist TGN1412. Blood, Dec. 22, 2011. pp. 6772-6782, vol. 118, No. 26. |
Sadelain et al., "The promise and potential pitfalls of chimeric antigen receptors," Current Opinion in Immunology 21: 215-223, 2009. |
Savage et al., "Induction of viral and tumor specific CTL responses using antibody targeted HLA class I peptide complexes," British Journal of Cancer 86: 1336-1342, 2002. |
Schmitt-Verhulst et al., "H-2-Restricted Cytotoxic Effectors Generated In Vitro by the Addition of Trinitrophenyl-Conjugated Soluble Proteins," The Journal of Experimental Medicine 147: 352-368, 1978. |
Scholler, J., et al., Decade-long safety and function of retroviral-modified chimeric antigen receptor T cells. Science Translational Medicine, May 2, 2012, pp. 132ra53, vol. 4, No. 132. |
Scott, D., et al., Immunogenicity of biotinylated hapten-avidin complexes. Mol Immunol, Nov. 1984. p. 1055-60, vol. 21, No. 11. |
Shirasu et al., "Construction and Molecular Characterization of Human Chimeric T-Cell Antigen Receptors Specific for Carcinoembryonic Antigen," Anticancer Research 30: 2731-2738, 2010. |
Sigma-Aldrich Co. LLC, Product Information Monoclanal Anti-CD3, clone UCHT-1 produced in mouse, purified immunoglobulin. Catalog No. C7048, © 2012. |
Siliciano et al., "The Interaction of Nominal Antigen With T Cell Antigen Receptors. I. Specific Binding of Multivalent Nominal Antigen to Cytolytic T Cell Clone," The Journal of Immunology 135(2): 906-914, Aug. 1985. |
Sinha et al. Preparation of integrin α(v)β(3)-targeting Ab 38C2 constructs. Nature Protocols Mar. 8, 2007, pp. 449-456, vol. 2. |
Stone, J.D., et al., A sensitivity scale for targeting T cells with chimeric antigen receptors (CARs) and bispecific T-cell Engagers (BiTEs). Oncoimmunology, Sep. 1, 2012. pp. 863-873, vol. 1, No. 6. |
Straathof, K.C., et al., An inducible caspase 9 safety switch for T-cell therapy. Blood, Jun. 1, 2005. pp. 4247-4254, vol. 105, No. 11, e-pub Feb. 22, 2005. |
Suhoski, M.M., et al., Engineering artificial antigen-presenting cells to express a diverse array of co-stimulatory molecules. Molecular Therapy, May 2007. pp. 981-988, vol. 15, No. 5, e-pub Mar. 20, 2007. |
Tai, W. et al., Development of a Peptide-Drug Conjugate for Prostate Cancer Therapy. Molecular Pharmaceutics. 2011, pp. 901-912, vol. 8. |
Tamada et al., Redirecting gene-modified T cells toward various cancer types using tagged antibodies, Clinical Cancer Research, Dec. 1, 2012, pp. 6436-6445, vol. 18, No. 23, e-pub Oct. 2, 2012. |
Terakura, S., et al., Generation of CD19-chimeric antigen receptor modified CD8+ T cells derived from virus-specific central memory T cells. Blood, Jan. 5, 2012. pp. 72-82, vol. 119, No. 1, e-pub Oct. 26, 2011. |
Themeli, M., et al., Generation of tumor-targeted human T lymphocytes from induced pluripotent stem cells for cancer therapy. Nature Biotechnology, 2013, pp. 928-933, vol. 31, e-pub Aug. 11, 2013. |
Thomas et al., Application of strain-promoted azide-alkyne cycloaddition and tetrazine ligation to targeted Fc-drug conjugates. Bioconjugate Chemistry, 2012, pp. 2007-2013, vol. 23, No. 10. |
Till et al., "Adoptive immunotherapy for indolent non-Hodgkin lymphoma and mantle cell lymphoma using genetically modified autologous CD20-specific T cells," Blood 112(6): 2261-2271, Sep. 15, 2008. |
Traversari, C., et al., The potential immunogenicity of the TK suicide gene does not prevent full clinical benefit associated with the use of TK-transduced donor lymphocytes in HSCT for hematologic malignancies. Blood, Jun. 1, 2007. pp. 4708-4715, vol. 109, No. 11, e-pub Feb. 27, 2007. |
Turatti, F., et al., Redirected activity of human antitumor chimeric immune receptors is governed by antigen and receptor expression levels and affinity of interaction. Journal of Immunotherapy, Oct. 2007, pp. 684-693, vol. 30, No. 7. |
U.S. Appl. No. 14/432,065 Restriction Requirement Mailed Nov. 6, 2015. |
U.S. Appl. No. 14/432,065, Travis Young. |
Urbanska K, et al, Targeted cancer immunotherapy via combination of designer bispecific antibody and novel gene-engineered T cells. Journal of Translational Medicine, Dec. 2014, 347-359, vol. 12. |
Urbanska, K. and D.J. Powell, Development of a novel universal immune receptor for antigen targeting: To Infinity and beyond. Oncoimmunology, Aug. 1, 2012. pp. 777-779, vol. 1, No. 5. |
Urbanska, K., et al., A universal strategy for adoptive immunotherapy of cancer through use of a novel T-cell antigen receptor. Cancer Research, Apr. 1, 2012. pp. 1844-1852, vol. 72, No. 7, e-pub Feb. 7, 2012. |
Uttenthal, B.J., et al., Challenges in T cell receptor gene therapy. Journal of Gene Med, Jun. 2012. pp. 386-399, vol. 14, No. 6. |
van Dam, G.M., et al., Intraoperative tumor-specific fluorescence imaging in ovarian cancer by folate receptor-alpha targeting: first in-human results. Nature Medicine, 2011. pp. 1315-1319, vol. 17, No. 10, e-pub Sep. 18, 2011. |
Vaughan, T.J., et al., Human antibodies with sub-nanomolar affinities isolated from a large non-immunized phage display library. Nat Biotechnol, Mar. 1996. pp. 309-314, vol. 14, No. 3. |
Wang et al. Expanding the genetic code. Angew Chem Int Ed, 2005, pp. 34-66, vol. 44, No. 1, e-pub Dec. 17, 2004. |
Weiden and Breitz, "Pretargeted radioimmunotherapy (PRIT™) for treatment of non-Hodgkin's lymphoma (NHL)," Critical Reviews in Oncology/Hematology 40: 37-51, 2001. |
Xiang et al., "Production of hybrid bispecific antibody recognizing human colorectal carcinoma and CD3 antigen," Mol. Biother. 4: 15-23, Mar. 1992. |
Xu, X.J., H.Z. Zhao, and Y.M. Tang, Efficacy and safety of adoptive immunotherapy using anti-CD19 chimeric antigen receptor transduced T-cells: a systematic review of phase I clinical trials. Leuk Lymphoma, Feb. 2013. pp. 255-260, vol. 54, No. 2. |
Young, T.S. and P.G. Schultz, Beyond the canonical 20 amino acids: expanding the genetic lexicon. Journal of Biological Chemistry, Apr. 9, 2010. pp. 11039-11044, vol. 285, No. 15. |
Young, T.S., et al., An enhanced system for unnatural amino acid mutagenesis in E. coli. Journal Molecular Biology, Jan. 15, 2010. pp. 361-374, vol. 395, No. 2, e-pub Oct. 21, 2009. |
Yu, D. and A. Thomas-Tikhonenko, A non-transgenic mouse model for B-cell lymphoma: in vivo infection of p53-null bone marrow progenitors by a Myc retrovirus is sufficient for tumorigenesis. Oncogene, Mar. 14, 2002. pp. 1922-1927, vol. 21, No. 12. |
Yu, D., et al., Oscillation between B-lymphoid and myeloid lineages in Myc-induced hematopoietic tumors following spontaneous silencing/reactivation of the EBF/Pax5 pathway. Blood, Mar. 1, 2003. pp. 1950-1955, vol. 101, No. 5, e-pub Oct. 24, 2002. |
Zahnd, C., et al., Directed in vitro evolution and crystallographic analysis of a peptide-binding single chain antibody fragment (scFv) with low picomolar affinity. Journal of Biological Chemistry, Apr. 30, 2004. pp. 18870-18877, vol. 279, No. 18. |
Zeidler et al., "Simultaneous Activation of T Cells and Accessory Cells by a New Class of Intact Bispecific Antibody Results in Efficient Tumor Cell Killing," The Journal of Immunology 163: 1246-1252, 1999. |
Zhang, M.Y., et al., Identification and characterization of a new cross-reactive human immunodeficiency virus type 1-neutralizing human monoclonal antibody. Journal of Virology, Sep. 2004. pp. 9233-9242, vol. 78, No. 17. |
Zhang, M.Y., et al., Identification of a novel CD4i human monoclonal antibody Fab that neutralizes HIV-1 primary isolates from different clades. Antiviral Research, Mar. 2004. pp. 161-164, vol. 61, No. 3. |
Cited By (16)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10391155B2 (en) | 2013-10-15 | 2019-08-27 | The Scripps Research Institute | Peptidic chimeric antigen receptor T cell switches and uses thereof |
US10800828B2 (en) | 2015-03-26 | 2020-10-13 | The Scripps Research Institute | Switchable non-scFv chimeric receptors, switches, and methods of use thereof to treat cancer |
US11091546B2 (en) | 2015-04-15 | 2021-08-17 | The Scripps Research Institute | Optimized PNE-based chimeric receptor T cell switches and uses thereof |
US11174306B2 (en) * | 2016-10-19 | 2021-11-16 | The Scripps Research Institute | Chimeric antigen receptor effector cell switches with humanized targeting moieties and/or optimized chimeric antigen receptor interacting domains and uses thereof |
US11242530B2 (en) * | 2016-12-08 | 2022-02-08 | Shanghai Unicar-Therapy Bio-Medicine Technology Co., Ltd | siRNA knocking down human PD-1 and recombinant expression CAR-T vector and their construction methods and applications |
US11364281B2 (en) | 2017-02-08 | 2022-06-21 | Bristol-Myers Squibb Company | Modified relaxin polypeptides comprising a pharmacokinetic enhancer and pharmaceutical compositions thereof |
US11185570B2 (en) | 2017-02-08 | 2021-11-30 | Bristol-Myers Squibb Company | Method of treating cardiovascular disease and heart failure with modified relaxin polypeptides |
US11344578B2 (en) | 2017-04-19 | 2022-05-31 | Board Of Regents, The University Of Texas System | Immune cells expressing engineered antigen receptors |
WO2019060425A1 (en) | 2017-09-19 | 2019-03-28 | Massachusetts Institute Of Technology | COMPOSITIONS FOR CHIMERIC ANTIGENIC RECEPTOR T CELL THERAPY AND USES THEREOF |
US11117936B2 (en) | 2017-11-10 | 2021-09-14 | University of Pittsburg—Of the Commonwealth System of Higher Education | Affinity-enhanced monomeric streptavidin chimeric antigen receptor (CAR) |
US11649294B2 (en) | 2017-11-14 | 2023-05-16 | GC Cell Corporation | Anti-HER2 antibody or antigen-binding fragment thereof, and chimeric antigen receptor comprising same |
US11970547B2 (en) | 2017-11-14 | 2024-04-30 | GC Cell Corporation | Anti-HER2 antibody or antigen-binding fragment thereof, and chimeric antigen receptor comprising same |
WO2020068261A1 (en) | 2018-09-28 | 2020-04-02 | Massachusetts Institute Of Technology | Collagen-localized immunomodulatory molecules and methods thereof |
WO2020263399A1 (en) | 2019-06-26 | 2020-12-30 | Massachusetts Institute Of Technology | Immunomodulatory fusion protein-metal hydroxide complexes and methods thereof |
WO2021061648A1 (en) | 2019-09-23 | 2021-04-01 | Massachusetts Institute Of Technology | Methods and compositions for stimulation of endogenous t cell responses |
WO2023225569A1 (en) | 2022-05-17 | 2023-11-23 | Umoja Biopharma, Inc. | Manufacturing viral particles |
Also Published As
Publication number | Publication date |
---|---|
US20230355728A1 (en) | 2023-11-09 |
JP6734774B2 (ja) | 2020-08-05 |
US10391155B2 (en) | 2019-08-27 |
US20150307564A1 (en) | 2015-10-29 |
ES2845924T3 (es) | 2021-07-28 |
CA2927543A1 (en) | 2015-04-23 |
CA2927543C (en) | 2021-07-20 |
AU2014337367B2 (en) | 2020-04-30 |
JP2016533174A (ja) | 2016-10-27 |
KR102339240B1 (ko) | 2021-12-15 |
JP2020096644A (ja) | 2020-06-25 |
CN105829349B (zh) | 2023-02-03 |
EP3057994A4 (en) | 2017-10-25 |
AU2014337367A1 (en) | 2016-04-07 |
US20170246270A1 (en) | 2017-08-31 |
EP3057994B1 (en) | 2020-09-23 |
CN105829349A (zh) | 2016-08-03 |
KR20160062760A (ko) | 2016-06-02 |
US20200197497A1 (en) | 2020-06-25 |
AU2020207804A1 (en) | 2020-08-06 |
WO2015057834A1 (en) | 2015-04-23 |
EP3057994A1 (en) | 2016-08-24 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20230355728A1 (en) | Peptidic chimeric antigen receptor t cell switches and uses thereof | |
US10800828B2 (en) | Switchable non-scFv chimeric receptors, switches, and methods of use thereof to treat cancer | |
US11091546B2 (en) | Optimized PNE-based chimeric receptor T cell switches and uses thereof | |
US20220073597A1 (en) | Chimeric antigen receptor effector cell switches with humanized targeting moieties and/or optimized chimeric antigen receptor interacting domains and uses thereof | |
US20180100026A1 (en) | Optimized chimeric receptor t cell switches and uses thereof | |
CA2926698C (en) | Chimeric antigen receptor t cell switches and uses thereof | |
JP2020505438A (ja) | インテグリン結合性ポリペプチド−Fc融合タンパク質および免疫調節物質を用いる併用がん治療法 | |
CN115894703A (zh) | 具有经修饰重链恒定区的多特异性重链抗体 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
AS | Assignment |
Owner name: THE CALIFORNIA INSTITUTE FOR BIOMEDICAL RESEARCH, Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNORS:YOUNG, TRAVIS;KIM, CHANHYUK;SCHULTZ, PETER G.;REEL/FRAME:035511/0861 Effective date: 20150422 |
|
STCF | Information on status: patent grant |
Free format text: PATENTED CASE |
|
AS | Assignment |
Owner name: THE SCRIPPS RESEARCH INSTITUTE, CALIFORNIA Free format text: ASSIGNMENT OF ASSIGNORS INTEREST;ASSIGNOR:THE CALIFORNIA INSTITUTE FOR BIOMEDICAL RESEARCH;REEL/FRAME:048590/0059 Effective date: 20180927 |
|
MAFP | Maintenance fee payment |
Free format text: PAYMENT OF MAINTENANCE FEE, 4TH YEAR, LARGE ENTITY (ORIGINAL EVENT CODE: M1551); ENTITY STATUS OF PATENT OWNER: LARGE ENTITY Year of fee payment: 4 |