KR102502287B1 - 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 - Google Patents
항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 Download PDFInfo
- Publication number
- KR102502287B1 KR102502287B1 KR1020200047025A KR20200047025A KR102502287B1 KR 102502287 B1 KR102502287 B1 KR 102502287B1 KR 1020200047025 A KR1020200047025 A KR 1020200047025A KR 20200047025 A KR20200047025 A KR 20200047025A KR 102502287 B1 KR102502287 B1 KR 102502287B1
- Authority
- KR
- South Korea
- Prior art keywords
- cells
- her2
- cotinine
- present
- chimeric antigen
- Prior art date
Links
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 title claims description 75
- 210000004027 cell Anatomy 0.000 claims abstract description 158
- 229950006073 cotinine Drugs 0.000 claims abstract description 98
- UIKROCXWUNQSPJ-UHFFFAOYSA-N Cotinine Natural products C1CC(=O)N(C)C1C1=CC=CN=C1 UIKROCXWUNQSPJ-UHFFFAOYSA-N 0.000 claims abstract description 68
- UIKROCXWUNQSPJ-VIFPVBQESA-N (-)-cotinine Chemical group C1CC(=O)N(C)[C@@H]1C1=CC=CN=C1 UIKROCXWUNQSPJ-VIFPVBQESA-N 0.000 claims abstract description 66
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 claims abstract description 58
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 claims abstract description 58
- 230000027455 binding Effects 0.000 claims description 56
- 239000000427 antigen Substances 0.000 claims description 45
- 102000036639 antigens Human genes 0.000 claims description 45
- 108091007433 antigens Proteins 0.000 claims description 45
- 108090000623 proteins and genes Proteins 0.000 claims description 31
- 239000012636 effector Substances 0.000 claims description 30
- 238000000034 method Methods 0.000 claims description 29
- 206010028980 Neoplasm Diseases 0.000 claims description 27
- 102000004169 proteins and genes Human genes 0.000 claims description 25
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 24
- 239000012634 fragment Substances 0.000 claims description 23
- 239000008194 pharmaceutical composition Substances 0.000 claims description 22
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 20
- 201000011510 cancer Diseases 0.000 claims description 20
- 230000004068 intracellular signaling Effects 0.000 claims description 17
- 230000008685 targeting Effects 0.000 claims description 15
- -1 epsilon Proteins 0.000 claims description 12
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 9
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 9
- 108091008874 T cell receptors Proteins 0.000 claims description 7
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 claims description 7
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 claims description 7
- 230000004913 activation Effects 0.000 claims description 7
- 210000004443 dendritic cell Anatomy 0.000 claims description 7
- 210000000822 natural killer cell Anatomy 0.000 claims description 7
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 claims description 6
- 102100027207 CD27 antigen Human genes 0.000 claims description 5
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 claims description 5
- 102100025390 Integrin beta-2 Human genes 0.000 claims description 5
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 5
- 239000003937 drug carrier Substances 0.000 claims description 5
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 claims description 4
- 230000000139 costimulatory effect Effects 0.000 claims description 4
- 102000004127 Cytokines Human genes 0.000 claims description 3
- 108090000695 Cytokines Proteins 0.000 claims description 3
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 claims description 3
- 108010064593 Intercellular Adhesion Molecule-1 Proteins 0.000 claims description 3
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 claims description 3
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 claims description 3
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 claims description 3
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 claims description 3
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 claims description 3
- 230000003213 activating effect Effects 0.000 claims description 3
- 230000003013 cytotoxicity Effects 0.000 claims description 3
- 231100000135 cytotoxicity Toxicity 0.000 claims description 3
- 210000003630 histaminocyte Anatomy 0.000 claims description 3
- 210000002540 macrophage Anatomy 0.000 claims description 3
- 239000002243 precursor Substances 0.000 claims description 3
- 102100038080 B-cell receptor CD22 Human genes 0.000 claims description 2
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 claims description 2
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 claims description 2
- 102100037904 CD9 antigen Human genes 0.000 claims description 2
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 claims description 2
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 claims description 2
- 101000738354 Homo sapiens CD9 antigen Proteins 0.000 claims description 2
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 claims description 2
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 claims description 2
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 claims description 2
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 claims description 2
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 claims description 2
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 claims description 2
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 claims description 2
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 claims description 2
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 claims description 2
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 claims description 2
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 claims description 2
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 claims description 2
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 claims description 2
- 230000028327 secretion Effects 0.000 claims description 2
- 230000000694 effects Effects 0.000 abstract description 15
- 210000002865 immune cell Anatomy 0.000 abstract description 6
- 239000003814 drug Substances 0.000 abstract description 5
- 230000004044 response Effects 0.000 abstract description 3
- 239000013598 vector Substances 0.000 description 34
- 235000018102 proteins Nutrition 0.000 description 23
- 108090000765 processed proteins & peptides Proteins 0.000 description 20
- 238000002965 ELISA Methods 0.000 description 19
- 150000007523 nucleic acids Chemical class 0.000 description 19
- 229920001184 polypeptide Polymers 0.000 description 19
- 102000004196 processed proteins & peptides Human genes 0.000 description 19
- 238000011282 treatment Methods 0.000 description 18
- 108020004707 nucleic acids Proteins 0.000 description 17
- 102000039446 nucleic acids Human genes 0.000 description 17
- 235000001014 amino acid Nutrition 0.000 description 16
- 125000003729 nucleotide group Chemical group 0.000 description 16
- 239000002773 nucleotide Substances 0.000 description 15
- 201000010099 disease Diseases 0.000 description 14
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 14
- 150000001413 amino acids Chemical class 0.000 description 11
- 238000010586 diagram Methods 0.000 description 11
- 239000000284 extract Substances 0.000 description 11
- 238000004091 panning Methods 0.000 description 11
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 10
- 238000006243 chemical reaction Methods 0.000 description 10
- 230000014509 gene expression Effects 0.000 description 10
- OYTPNWYZORARHL-XHNCKOQMSA-N Gln-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCC(=O)N)N OYTPNWYZORARHL-XHNCKOQMSA-N 0.000 description 9
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 9
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 9
- FMDHKPRACUXATF-ACZMJKKPSA-N Ser-Gln-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O FMDHKPRACUXATF-ACZMJKKPSA-N 0.000 description 9
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 9
- 239000000203 mixture Substances 0.000 description 9
- NXSFUECZFORGOG-CIUDSAMLSA-N Ala-Asn-Leu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O NXSFUECZFORGOG-CIUDSAMLSA-N 0.000 description 8
- KXEGPPNPXOKKHK-ZLUOBGJFSA-N Asn-Asp-Ala Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(O)=O KXEGPPNPXOKKHK-ZLUOBGJFSA-N 0.000 description 8
- LKIYSIYBKYLKPU-BIIVOSGPSA-N Asp-Asp-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)O)NC(=O)[C@H](CC(=O)O)N)C(=O)O LKIYSIYBKYLKPU-BIIVOSGPSA-N 0.000 description 8
- 108020004414 DNA Proteins 0.000 description 8
- 108060003951 Immunoglobulin Proteins 0.000 description 8
- CQQGCWPXDHTTNF-GUBZILKMSA-N Leu-Ala-Glu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(O)=O CQQGCWPXDHTTNF-GUBZILKMSA-N 0.000 description 8
- HVAUKHLDSDDROB-KKUMJFAQSA-N Lys-Lys-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(O)=O HVAUKHLDSDDROB-KKUMJFAQSA-N 0.000 description 8
- ODTZHNZPINULEU-KKUMJFAQSA-N Lys-Phe-Asn Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCCCN)N ODTZHNZPINULEU-KKUMJFAQSA-N 0.000 description 8
- CGGVNFJRZJUVAE-BYULHYEWSA-N Val-Asp-Asn Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N CGGVNFJRZJUVAE-BYULHYEWSA-N 0.000 description 8
- 108010044940 alanylglutamine Proteins 0.000 description 8
- 238000002659 cell therapy Methods 0.000 description 8
- 230000001472 cytotoxic effect Effects 0.000 description 8
- 108020001507 fusion proteins Proteins 0.000 description 8
- 102000037865 fusion proteins Human genes 0.000 description 8
- 102000018358 immunoglobulin Human genes 0.000 description 8
- 238000009169 immunotherapy Methods 0.000 description 8
- 239000002953 phosphate buffered saline Substances 0.000 description 8
- 108010031719 prolyl-serine Proteins 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 125000000539 amino acid group Chemical group 0.000 description 7
- 231100000433 cytotoxic Toxicity 0.000 description 7
- 238000002560 therapeutic procedure Methods 0.000 description 7
- PXFBZOLANLWPMH-UHFFFAOYSA-N 16-Epiaffinine Natural products C1C(C2=CC=CC=C2N2)=C2C(=O)CC2C(=CC)CN(C)C1C2CO PXFBZOLANLWPMH-UHFFFAOYSA-N 0.000 description 6
- RUXQNKVQSKOOBS-JURCDPSOSA-N Ala-Phe-Ile Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O RUXQNKVQSKOOBS-JURCDPSOSA-N 0.000 description 6
- 108020004705 Codon Proteins 0.000 description 6
- AMBLXEMWFARNNQ-DCAQKATOSA-N Pro-Asn-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)N)NC(=O)[C@@H]1CCCN1 AMBLXEMWFARNNQ-DCAQKATOSA-N 0.000 description 6
- 239000011230 binding agent Substances 0.000 description 6
- 108010057821 leucylproline Proteins 0.000 description 6
- 238000004020 luminiscence type Methods 0.000 description 6
- 230000001177 retroviral effect Effects 0.000 description 6
- 238000012546 transfer Methods 0.000 description 6
- 241000713666 Lentivirus Species 0.000 description 5
- 241000699670 Mus sp. Species 0.000 description 5
- JWOBLHJRDADHLN-KKUMJFAQSA-N Ser-Leu-Tyr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O JWOBLHJRDADHLN-KKUMJFAQSA-N 0.000 description 5
- XTOCLOATLKOZAU-JBACZVJFSA-N Tyr-Trp-Glu Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](CC3=CC=C(C=C3)O)N XTOCLOATLKOZAU-JBACZVJFSA-N 0.000 description 5
- 241000700605 Viruses Species 0.000 description 5
- 238000012790 confirmation Methods 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 238000002347 injection Methods 0.000 description 5
- 239000007924 injection Substances 0.000 description 5
- 239000000243 solution Substances 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide Substances CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 4
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 4
- WGNOPSQMIQERPK-UHFFFAOYSA-N Leu-Asn-Pro Natural products CC(C)CC(N)C(=O)NC(CC(=O)N)C(=O)N1CCCC1C(=O)O WGNOPSQMIQERPK-UHFFFAOYSA-N 0.000 description 4
- 239000005089 Luciferase Substances 0.000 description 4
- DCRWPTBMWMGADO-AVGNSLFASA-N Lys-Glu-Leu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O DCRWPTBMWMGADO-AVGNSLFASA-N 0.000 description 4
- 102100029215 Signaling lymphocytic activation molecule Human genes 0.000 description 4
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 4
- 206010045170 Tumour lysis syndrome Diseases 0.000 description 4
- ZRSZTKTVPNSUNA-IHRRRGAJSA-N Val-Lys-Leu Chemical compound CC(C)C[C@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](N)C(C)C)C(O)=O ZRSZTKTVPNSUNA-IHRRRGAJSA-N 0.000 description 4
- 238000005119 centrifugation Methods 0.000 description 4
- 239000003431 cross linking reagent Substances 0.000 description 4
- 206010052015 cytokine release syndrome Diseases 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 230000001976 improved effect Effects 0.000 description 4
- 238000007912 intraperitoneal administration Methods 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- 238000005259 measurement Methods 0.000 description 4
- 230000035772 mutation Effects 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 210000003370 receptor cell Anatomy 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 208000010380 tumor lysis syndrome Diseases 0.000 description 4
- DEAGTWNKODHUIY-MRFFXTKBSA-N Ala-Tyr-Trp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O DEAGTWNKODHUIY-MRFFXTKBSA-N 0.000 description 3
- DNLQVHBBMPZUGJ-BQBZGAKWSA-N Arg-Ser-Gly Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O DNLQVHBBMPZUGJ-BQBZGAKWSA-N 0.000 description 3
- 102100024263 CD160 antigen Human genes 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- ZNTDJIMJKNNSLR-RWRJDSDZSA-N Gln-Ile-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](CCC(=O)N)N ZNTDJIMJKNNSLR-RWRJDSDZSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 101000761938 Homo sapiens CD160 antigen Proteins 0.000 description 3
- 101000994375 Homo sapiens Integrin alpha-4 Proteins 0.000 description 3
- 101000633786 Homo sapiens SLAM family member 6 Proteins 0.000 description 3
- 102100032818 Integrin alpha-4 Human genes 0.000 description 3
- 102100032816 Integrin alpha-6 Human genes 0.000 description 3
- 108060001084 Luciferase Proteins 0.000 description 3
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 3
- 206010033128 Ovarian cancer Diseases 0.000 description 3
- 206010061535 Ovarian neoplasm Diseases 0.000 description 3
- 102000010292 Peptide Elongation Factor 1 Human genes 0.000 description 3
- 108010077524 Peptide Elongation Factor 1 Proteins 0.000 description 3
- 102100029197 SLAM family member 6 Human genes 0.000 description 3
- 239000004480 active ingredient Substances 0.000 description 3
- 230000000735 allogeneic effect Effects 0.000 description 3
- 238000010171 animal model Methods 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 238000010382 chemical cross-linking Methods 0.000 description 3
- 239000003795 chemical substances by application Substances 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 3
- 230000001086 cytosolic effect Effects 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 239000013604 expression vector Substances 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 208000015181 infectious disease Diseases 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 238000001990 intravenous administration Methods 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 239000012528 membrane Substances 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 230000004083 survival effect Effects 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- 239000013603 viral vector Substances 0.000 description 3
- 239000011534 wash buffer Substances 0.000 description 3
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 2
- WZFUQSJFWNHZHM-UHFFFAOYSA-N 2-[4-[2-(2,3-dihydro-1H-inden-2-ylamino)pyrimidin-5-yl]piperazin-1-yl]-1-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)ethanone Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)N1CCN(CC1)CC(=O)N1CC2=C(CC1)NN=N2 WZFUQSJFWNHZHM-UHFFFAOYSA-N 0.000 description 2
- YLZOPXRUQYQQID-UHFFFAOYSA-N 3-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)-1-[4-[2-[[3-(trifluoromethoxy)phenyl]methylamino]pyrimidin-5-yl]piperazin-1-yl]propan-1-one Chemical compound N1N=NC=2CN(CCC=21)CCC(=O)N1CCN(CC1)C=1C=NC(=NC=1)NCC1=CC(=CC=C1)OC(F)(F)F YLZOPXRUQYQQID-UHFFFAOYSA-N 0.000 description 2
- DEXFNLNNUZKHNO-UHFFFAOYSA-N 6-[3-[4-[2-(2,3-dihydro-1H-inden-2-ylamino)pyrimidin-5-yl]piperidin-1-yl]-3-oxopropyl]-3H-1,3-benzoxazol-2-one Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)C1CCN(CC1)C(CCC1=CC2=C(NC(O2)=O)C=C1)=O DEXFNLNNUZKHNO-UHFFFAOYSA-N 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- DVJSJDDYCYSMFR-ZKWXMUAHSA-N Ala-Ile-Gly Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(O)=O DVJSJDDYCYSMFR-ZKWXMUAHSA-N 0.000 description 2
- RWCLSUOSKWTXLA-FXQIFTODSA-N Arg-Asp-Ala Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(O)=O RWCLSUOSKWTXLA-FXQIFTODSA-N 0.000 description 2
- GXXWTNKNFFKTJB-NAKRPEOUSA-N Arg-Ile-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O GXXWTNKNFFKTJB-NAKRPEOUSA-N 0.000 description 2
- NMRHDSAOIURTNT-RWMBFGLXSA-N Arg-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N NMRHDSAOIURTNT-RWMBFGLXSA-N 0.000 description 2
- ZMUQQMGITUJQTI-CIUDSAMLSA-N Asn-Leu-Asn Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(N)=O)C(O)=O ZMUQQMGITUJQTI-CIUDSAMLSA-N 0.000 description 2
- 102000015790 Asparaginase Human genes 0.000 description 2
- 108010024976 Asparaginase Proteins 0.000 description 2
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 2
- 206010006187 Breast cancer Diseases 0.000 description 2
- 208000026310 Breast neoplasm Diseases 0.000 description 2
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 2
- 101100505161 Caenorhabditis elegans mel-32 gene Proteins 0.000 description 2
- 241000699800 Cricetinae Species 0.000 description 2
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 2
- QOSSAOTZNIDXMA-UHFFFAOYSA-N Dicylcohexylcarbodiimide Chemical compound C1CCCCC1N=C=NC1CCCCC1 QOSSAOTZNIDXMA-UHFFFAOYSA-N 0.000 description 2
- 101150029707 ERBB2 gene Proteins 0.000 description 2
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 2
- HSHCEAUPUPJPTE-JYJNAYRXSA-N Gln-Leu-Tyr Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)O)NC(=O)[C@H](CCC(=O)N)N HSHCEAUPUPJPTE-JYJNAYRXSA-N 0.000 description 2
- HGJREIGJLUQBTJ-SZMVWBNQSA-N Glu-Trp-Leu Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(C)C)C(O)=O HGJREIGJLUQBTJ-SZMVWBNQSA-N 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- TVUWMSBGMVAHSJ-KBPBESRZSA-N Gly-Leu-Phe Chemical compound NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 TVUWMSBGMVAHSJ-KBPBESRZSA-N 0.000 description 2
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 2
- 101001078158 Homo sapiens Integrin alpha-1 Proteins 0.000 description 2
- 101000994365 Homo sapiens Integrin alpha-6 Proteins 0.000 description 2
- 101001035237 Homo sapiens Integrin alpha-D Proteins 0.000 description 2
- 101001046687 Homo sapiens Integrin alpha-E Proteins 0.000 description 2
- 101000935043 Homo sapiens Integrin beta-1 Proteins 0.000 description 2
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 2
- 101001043809 Homo sapiens Interleukin-7 receptor subunit alpha Proteins 0.000 description 2
- 101000971538 Homo sapiens Killer cell lectin-like receptor subfamily F member 1 Proteins 0.000 description 2
- 101000633780 Homo sapiens Signaling lymphocytic activation molecule Proteins 0.000 description 2
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 description 2
- 241000701044 Human gammaherpesvirus 4 Species 0.000 description 2
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 2
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 2
- 102100025323 Integrin alpha-1 Human genes 0.000 description 2
- 102100039904 Integrin alpha-D Human genes 0.000 description 2
- 102100022341 Integrin alpha-E Human genes 0.000 description 2
- 102100022338 Integrin alpha-M Human genes 0.000 description 2
- 102100022297 Integrin alpha-X Human genes 0.000 description 2
- 102100025304 Integrin beta-1 Human genes 0.000 description 2
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 description 2
- 102100021593 Interleukin-7 receptor subunit alpha Human genes 0.000 description 2
- 102100021458 Killer cell lectin-like receptor subfamily F member 1 Human genes 0.000 description 2
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 2
- 239000002136 L01XE07 - Lapatinib Substances 0.000 description 2
- INCJJHQRZGQLFC-KBPBESRZSA-N Leu-Phe-Gly Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)NCC(O)=O INCJJHQRZGQLFC-KBPBESRZSA-N 0.000 description 2
- VQXAVLQBQJMENB-SRVKXCTJSA-N Lys-Glu-Met Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCSC)C(O)=O VQXAVLQBQJMENB-SRVKXCTJSA-N 0.000 description 2
- 239000007993 MOPS buffer Substances 0.000 description 2
- 229930195725 Mannitol Natural products 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 102100038082 Natural killer cell receptor 2B4 Human genes 0.000 description 2
- 229930012538 Paclitaxel Natural products 0.000 description 2
- FXPZZKBHNOMLGA-HJWJTTGWSA-N Phe-Ile-Arg Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)N FXPZZKBHNOMLGA-HJWJTTGWSA-N 0.000 description 2
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 2
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 2
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 2
- 108010025832 RANK Ligand Proteins 0.000 description 2
- 102000014128 RANK Ligand Human genes 0.000 description 2
- 206010039897 Sedation Diseases 0.000 description 2
- 102100027744 Semaphorin-4D Human genes 0.000 description 2
- QYSFWUIXDFJUDW-DCAQKATOSA-N Ser-Leu-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O QYSFWUIXDFJUDW-DCAQKATOSA-N 0.000 description 2
- 108010074687 Signaling Lymphocytic Activation Molecule Family Member 1 Proteins 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- BVOVIGCHYNFJBZ-JXUBOQSCSA-N Thr-Leu-Ala Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O BVOVIGCHYNFJBZ-JXUBOQSCSA-N 0.000 description 2
- YOPQYBJJNSIQGZ-JNPHEJMOSA-N Thr-Tyr-Tyr Chemical compound C([C@H](NC(=O)[C@@H](N)[C@H](O)C)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CC=C(O)C=C1 YOPQYBJJNSIQGZ-JNPHEJMOSA-N 0.000 description 2
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 2
- 210000001015 abdomen Anatomy 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 230000009824 affinity maturation Effects 0.000 description 2
- 108010076324 alanyl-glycyl-glycine Proteins 0.000 description 2
- 108010086434 alanyl-seryl-glycine Proteins 0.000 description 2
- 108010011559 alanylphenylalanine Proteins 0.000 description 2
- 230000000259 anti-tumor effect Effects 0.000 description 2
- 230000000890 antigenic effect Effects 0.000 description 2
- 229960003272 asparaginase Drugs 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-M asparaginate Chemical compound [O-]C(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-M 0.000 description 2
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- KGBXLFKZBHKPEV-UHFFFAOYSA-N boric acid Chemical compound OB(O)O KGBXLFKZBHKPEV-UHFFFAOYSA-N 0.000 description 2
- 239000004327 boric acid Substances 0.000 description 2
- 229960002092 busulfan Drugs 0.000 description 2
- 229940041514 candida albicans extract Drugs 0.000 description 2
- 229960004562 carboplatin Drugs 0.000 description 2
- 190000008236 carboplatin Chemical compound 0.000 description 2
- 230000005754 cellular signaling Effects 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 2
- 229960004316 cisplatin Drugs 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 230000021615 conjugation Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- CVSVTCORWBXHQV-UHFFFAOYSA-N creatine Chemical compound NC(=[NH2+])N(C)CC([O-])=O CVSVTCORWBXHQV-UHFFFAOYSA-N 0.000 description 2
- 238000012258 culturing Methods 0.000 description 2
- 229960000975 daunorubicin Drugs 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 229960004679 doxorubicin Drugs 0.000 description 2
- 230000008029 eradication Effects 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 230000029142 excretion Effects 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 2
- 229960002949 fluorouracil Drugs 0.000 description 2
- 235000013305 food Nutrition 0.000 description 2
- 230000006870 function Effects 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- 229960005277 gemcitabine Drugs 0.000 description 2
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 2
- BRZYSWJRSDMWLG-CAXSIQPQSA-N geneticin Chemical compound O1C[C@@](O)(C)[C@H](NC)[C@@H](O)[C@H]1O[C@@H]1[C@@H](O)[C@H](O[C@@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](C(C)O)O2)N)[C@@H](N)C[C@H]1N BRZYSWJRSDMWLG-CAXSIQPQSA-N 0.000 description 2
- 108010066198 glycyl-leucyl-phenylalanine Proteins 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 238000001597 immobilized metal affinity chromatography Methods 0.000 description 2
- 230000002519 immonomodulatory effect Effects 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 238000007917 intracranial administration Methods 0.000 description 2
- 239000007928 intraperitoneal injection Substances 0.000 description 2
- 230000002601 intratumoral effect Effects 0.000 description 2
- 238000010253 intravenous injection Methods 0.000 description 2
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 229960004891 lapatinib Drugs 0.000 description 2
- BCFGMOOMADDAQU-UHFFFAOYSA-N lapatinib Chemical compound O1C(CNCCS(=O)(=O)C)=CC=C1C1=CC=C(N=CN=C2NC=3C=C(Cl)C(OCC=4C=C(F)C=CC=4)=CC=3)C2=C1 BCFGMOOMADDAQU-UHFFFAOYSA-N 0.000 description 2
- 238000003670 luciferase enzyme activity assay Methods 0.000 description 2
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 2
- 239000000594 mannitol Substances 0.000 description 2
- 235000010355 mannitol Nutrition 0.000 description 2
- 235000012054 meals Nutrition 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 229960000485 methotrexate Drugs 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- 229960002087 pertuzumab Drugs 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 108091033319 polynucleotide Proteins 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 238000011321 prophylaxis Methods 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 229960004641 rituximab Drugs 0.000 description 2
- 230000036280 sedation Effects 0.000 description 2
- 230000035945 sensitivity Effects 0.000 description 2
- 238000013207 serial dilution Methods 0.000 description 2
- 239000011780 sodium chloride Substances 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 239000011550 stock solution Substances 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 238000010254 subcutaneous injection Methods 0.000 description 2
- 239000007929 subcutaneous injection Substances 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 231100000331 toxic Toxicity 0.000 description 2
- 230000002588 toxic effect Effects 0.000 description 2
- 238000010361 transduction Methods 0.000 description 2
- 230000026683 transduction Effects 0.000 description 2
- 229960001612 trastuzumab emtansine Drugs 0.000 description 2
- 241001430294 unidentified retrovirus Species 0.000 description 2
- 229960003048 vinblastine Drugs 0.000 description 2
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- 230000003612 virological effect Effects 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- 239000012138 yeast extract Substances 0.000 description 2
- 238000001086 yeast two-hybrid system Methods 0.000 description 2
- SNICXCGAKADSCV-JTQLQIEISA-N (-)-Nicotine Chemical compound CN1CCC[C@H]1C1=CC=CN=C1 SNICXCGAKADSCV-JTQLQIEISA-N 0.000 description 1
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 1
- LNAZSHAWQACDHT-XIYTZBAFSA-N (2r,3r,4s,5r,6s)-4,5-dimethoxy-2-(methoxymethyl)-3-[(2s,3r,4s,5r,6r)-3,4,5-trimethoxy-6-(methoxymethyl)oxan-2-yl]oxy-6-[(2r,3r,4s,5r,6r)-4,5,6-trimethoxy-2-(methoxymethyl)oxan-3-yl]oxyoxane Chemical compound CO[C@@H]1[C@@H](OC)[C@H](OC)[C@@H](COC)O[C@H]1O[C@H]1[C@H](OC)[C@@H](OC)[C@H](O[C@H]2[C@@H]([C@@H](OC)[C@H](OC)O[C@@H]2COC)OC)O[C@@H]1COC LNAZSHAWQACDHT-XIYTZBAFSA-N 0.000 description 1
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 1
- OHVLMTFVQDZYHP-UHFFFAOYSA-N 1-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)-2-[4-[2-[[3-(trifluoromethoxy)phenyl]methylamino]pyrimidin-5-yl]piperazin-1-yl]ethanone Chemical compound N1N=NC=2CN(CCC=21)C(CN1CCN(CC1)C=1C=NC(=NC=1)NCC1=CC(=CC=C1)OC(F)(F)F)=O OHVLMTFVQDZYHP-UHFFFAOYSA-N 0.000 description 1
- FPKVOQKZMBDBKP-UHFFFAOYSA-N 1-[4-[(2,5-dioxopyrrol-1-yl)methyl]cyclohexanecarbonyl]oxy-2,5-dioxopyrrolidine-3-sulfonic acid Chemical compound O=C1C(S(=O)(=O)O)CC(=O)N1OC(=O)C1CCC(CN2C(C=CC2=O)=O)CC1 FPKVOQKZMBDBKP-UHFFFAOYSA-N 0.000 description 1
- HMUNWXXNJPVALC-UHFFFAOYSA-N 1-[4-[2-(2,3-dihydro-1H-inden-2-ylamino)pyrimidin-5-yl]piperazin-1-yl]-2-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)ethanone Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)N1CCN(CC1)C(CN1CC2=C(CC1)NN=N2)=O HMUNWXXNJPVALC-UHFFFAOYSA-N 0.000 description 1
- GVJXGCIPWAVXJP-UHFFFAOYSA-N 2,5-dioxo-1-oxoniopyrrolidine-3-sulfonate Chemical compound ON1C(=O)CC(S(O)(=O)=O)C1=O GVJXGCIPWAVXJP-UHFFFAOYSA-N 0.000 description 1
- VZSRBBMJRBPUNF-UHFFFAOYSA-N 2-(2,3-dihydro-1H-inden-2-ylamino)-N-[3-oxo-3-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)propyl]pyrimidine-5-carboxamide Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)C(=O)NCCC(N1CC2=C(CC1)NN=N2)=O VZSRBBMJRBPUNF-UHFFFAOYSA-N 0.000 description 1
- IHCCLXNEEPMSIO-UHFFFAOYSA-N 2-[4-[2-(2,3-dihydro-1H-inden-2-ylamino)pyrimidin-5-yl]piperidin-1-yl]-1-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)ethanone Chemical compound C1C(CC2=CC=CC=C12)NC1=NC=C(C=N1)C1CCN(CC1)CC(=O)N1CC2=C(CC1)NN=N2 IHCCLXNEEPMSIO-UHFFFAOYSA-N 0.000 description 1
- FPQQSJJWHUJYPU-UHFFFAOYSA-N 3-(dimethylamino)propyliminomethylidene-ethylazanium;chloride Chemical compound Cl.CCN=C=NCCCN(C)C FPQQSJJWHUJYPU-UHFFFAOYSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- 102100023990 60S ribosomal protein L17 Human genes 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- 235000006491 Acacia senegal Nutrition 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 230000007730 Akt signaling Effects 0.000 description 1
- YYSWCHMLFJLLBJ-ZLUOBGJFSA-N Ala-Ala-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CO)C(O)=O YYSWCHMLFJLLBJ-ZLUOBGJFSA-N 0.000 description 1
- BTYTYHBSJKQBQA-GCJQMDKQSA-N Ala-Asp-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](C)N)O BTYTYHBSJKQBQA-GCJQMDKQSA-N 0.000 description 1
- KXEVYGKATAMXJJ-ACZMJKKPSA-N Ala-Glu-Asp Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(O)=O)C(O)=O KXEVYGKATAMXJJ-ACZMJKKPSA-N 0.000 description 1
- VGPWRRFOPXVGOH-BYPYZUCNSA-N Ala-Gly-Gly Chemical compound C[C@H](N)C(=O)NCC(=O)NCC(O)=O VGPWRRFOPXVGOH-BYPYZUCNSA-N 0.000 description 1
- BTRULDJUUVGRNE-DCAQKATOSA-N Ala-Pro-Lys Chemical compound C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(O)=O BTRULDJUUVGRNE-DCAQKATOSA-N 0.000 description 1
- ARHJJAAWNWOACN-FXQIFTODSA-N Ala-Ser-Val Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O ARHJJAAWNWOACN-FXQIFTODSA-N 0.000 description 1
- LTTLSZVJTDSACD-OWLDWWDNSA-N Ala-Thr-Trp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O LTTLSZVJTDSACD-OWLDWWDNSA-N 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- 108010083359 Antigen Receptors Proteins 0.000 description 1
- 102000006306 Antigen Receptors Human genes 0.000 description 1
- 206010002961 Aplasia Diseases 0.000 description 1
- ASQYTJJWAMDISW-BPUTZDHNSA-N Arg-Asp-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)O)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCN=C(N)N)N ASQYTJJWAMDISW-BPUTZDHNSA-N 0.000 description 1
- AQPVUEJJARLJHB-BQBZGAKWSA-N Arg-Gly-Ala Chemical compound OC(=O)[C@H](C)NC(=O)CNC(=O)[C@@H](N)CCCN=C(N)N AQPVUEJJARLJHB-BQBZGAKWSA-N 0.000 description 1
- YQGZIRIYGHNSQO-ZPFDUUQYSA-N Arg-Ile-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N YQGZIRIYGHNSQO-ZPFDUUQYSA-N 0.000 description 1
- GNYUVVJYGJFKHN-RVMXOQNASA-N Arg-Ile-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N GNYUVVJYGJFKHN-RVMXOQNASA-N 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- PCKRJVZAQZWNKM-WHFBIAKZSA-N Asn-Asn-Gly Chemical compound NC(=O)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O PCKRJVZAQZWNKM-WHFBIAKZSA-N 0.000 description 1
- AITGTTNYKAWKDR-CIUDSAMLSA-N Asn-His-Ser Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CO)C(O)=O AITGTTNYKAWKDR-CIUDSAMLSA-N 0.000 description 1
- RCFGLXMZDYNRSC-CIUDSAMLSA-N Asn-Lys-Ala Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C)C(O)=O RCFGLXMZDYNRSC-CIUDSAMLSA-N 0.000 description 1
- FBODFHMLALOPHP-GUBZILKMSA-N Asn-Lys-Glu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O FBODFHMLALOPHP-GUBZILKMSA-N 0.000 description 1
- AWXDRZJQCVHCIT-DCAQKATOSA-N Asn-Pro-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@@H](N)CC(N)=O AWXDRZJQCVHCIT-DCAQKATOSA-N 0.000 description 1
- VCJCPARXDBEGNE-GUBZILKMSA-N Asn-Pro-Pro Chemical compound NC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 VCJCPARXDBEGNE-GUBZILKMSA-N 0.000 description 1
- SUIJFTJDTJKSRK-IHRRRGAJSA-N Asn-Pro-Tyr Chemical compound NC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 SUIJFTJDTJKSRK-IHRRRGAJSA-N 0.000 description 1
- DXHINQUXBZNUCF-MELADBBJSA-N Asn-Tyr-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CC(=O)N)N)C(=O)O DXHINQUXBZNUCF-MELADBBJSA-N 0.000 description 1
- XYBJLTKSGFBLCS-QXEWZRGKSA-N Asp-Arg-Val Chemical compound NC(N)=NCCC[C@@H](C(=O)N[C@@H](C(C)C)C(O)=O)NC(=O)[C@@H](N)CC(O)=O XYBJLTKSGFBLCS-QXEWZRGKSA-N 0.000 description 1
- QNFRBNZGVVKBNJ-PEFMBERDSA-N Asp-Ile-Gln Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)O)NC(=O)[C@H](CC(=O)O)N QNFRBNZGVVKBNJ-PEFMBERDSA-N 0.000 description 1
- GYWQGGUCMDCUJE-DLOVCJGASA-N Asp-Phe-Ala Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](C)C(O)=O GYWQGGUCMDCUJE-DLOVCJGASA-N 0.000 description 1
- JDDYEZGPYBBPBN-JRQIVUDYSA-N Asp-Thr-Tyr Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O JDDYEZGPYBBPBN-JRQIVUDYSA-N 0.000 description 1
- 108010056102 CD100 antigen Proteins 0.000 description 1
- 108010017009 CD11b Antigen Proteins 0.000 description 1
- 102100038077 CD226 antigen Human genes 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 108010062802 CD66 antigens Proteins 0.000 description 1
- 102100027217 CD82 antigen Human genes 0.000 description 1
- 101710139831 CD82 antigen Proteins 0.000 description 1
- 101100512078 Caenorhabditis elegans lys-1 gene Proteins 0.000 description 1
- 102100033620 Calponin-1 Human genes 0.000 description 1
- 102100024533 Carcinoembryonic antigen-related cell adhesion molecule 1 Human genes 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 108091007741 Chimeric antigen receptor T cells Proteins 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- AEJSNWMRPXAKCW-WHFBIAKZSA-N Cys-Ala-Gly Chemical compound SC[C@H](N)C(=O)N[C@@H](C)C(=O)NCC(O)=O AEJSNWMRPXAKCW-WHFBIAKZSA-N 0.000 description 1
- HHABWQIFXZPZCK-ACZMJKKPSA-N Cys-Gln-Ser Chemical compound C(CC(=O)N)[C@@H](C(=O)N[C@@H](CO)C(=O)O)NC(=O)[C@H](CS)N HHABWQIFXZPZCK-ACZMJKKPSA-N 0.000 description 1
- 241000701022 Cytomegalovirus Species 0.000 description 1
- 102100027816 Cytotoxic and regulatory T-cell molecule Human genes 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- 102000001301 EGF receptor Human genes 0.000 description 1
- 108060006698 EGF receptor Proteins 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- 108091006027 G proteins Proteins 0.000 description 1
- 108091092584 GDNA Proteins 0.000 description 1
- 102000030782 GTP binding Human genes 0.000 description 1
- 108091000058 GTP-Binding Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 229930182566 Gentamicin Natural products 0.000 description 1
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 1
- GPISLLFQNHELLK-DCAQKATOSA-N Gln-Gln-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCC(=O)N)N GPISLLFQNHELLK-DCAQKATOSA-N 0.000 description 1
- MADFVRSKEIEZHZ-DCAQKATOSA-N Gln-Gln-Lys Chemical compound C(CCN)C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCC(=O)N)N MADFVRSKEIEZHZ-DCAQKATOSA-N 0.000 description 1
- JXFLPKSDLDEOQK-JHEQGTHGSA-N Gln-Gly-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CCC(N)=O JXFLPKSDLDEOQK-JHEQGTHGSA-N 0.000 description 1
- GFLNKSQHOBOMNM-AVGNSLFASA-N Gln-His-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)NC(=O)[C@H](CCC(=O)N)N GFLNKSQHOBOMNM-AVGNSLFASA-N 0.000 description 1
- MSHXWFKYXJTLEZ-CIUDSAMLSA-N Gln-Met-Asn Chemical compound CSCC[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)N)N MSHXWFKYXJTLEZ-CIUDSAMLSA-N 0.000 description 1
- HMIXCETWRYDVMO-GUBZILKMSA-N Gln-Pro-Glu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O HMIXCETWRYDVMO-GUBZILKMSA-N 0.000 description 1
- FQCILXROGNOZON-YUMQZZPRSA-N Gln-Pro-Gly Chemical compound NC(=O)CC[C@H](N)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O FQCILXROGNOZON-YUMQZZPRSA-N 0.000 description 1
- NYCVMJGIJYQWDO-CIUDSAMLSA-N Gln-Ser-Arg Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O NYCVMJGIJYQWDO-CIUDSAMLSA-N 0.000 description 1
- SYZZMPFLOLSMHL-XHNCKOQMSA-N Gln-Ser-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CO)NC(=O)[C@H](CCC(=O)N)N)C(=O)O SYZZMPFLOLSMHL-XHNCKOQMSA-N 0.000 description 1
- JILRMFFFCHUUTJ-ACZMJKKPSA-N Gln-Ser-Ser Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O JILRMFFFCHUUTJ-ACZMJKKPSA-N 0.000 description 1
- YQPFCZVKMUVZIN-AUTRQRHGSA-N Glu-Val-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O YQPFCZVKMUVZIN-AUTRQRHGSA-N 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- KRRMJKMGWWXWDW-STQMWFEESA-N Gly-Arg-Phe Chemical compound NC(=N)NCCC[C@H](NC(=O)CN)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 KRRMJKMGWWXWDW-STQMWFEESA-N 0.000 description 1
- XBWMTPAIUQIWKA-BYULHYEWSA-N Gly-Asp-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)CN XBWMTPAIUQIWKA-BYULHYEWSA-N 0.000 description 1
- FSPVILZGHUJOHS-QWRGUYRKSA-N Gly-His-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)CN)CC1=CNC=N1 FSPVILZGHUJOHS-QWRGUYRKSA-N 0.000 description 1
- MIIVFRCYJABHTQ-ONGXEEELSA-N Gly-Leu-Val Chemical compound [H]NCC(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O MIIVFRCYJABHTQ-ONGXEEELSA-N 0.000 description 1
- PDUHNKAFQXQNLH-ZETCQYMHSA-N Gly-Lys-Gly Chemical compound NCCCC[C@H](NC(=O)CN)C(=O)NCC(O)=O PDUHNKAFQXQNLH-ZETCQYMHSA-N 0.000 description 1
- YJDALMUYJIENAG-QWRGUYRKSA-N Gly-Tyr-Asn Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)CN)O YJDALMUYJIENAG-QWRGUYRKSA-N 0.000 description 1
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 1
- 241000696272 Gull adenovirus Species 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 101150054472 HER2 gene Proteins 0.000 description 1
- 229940125497 HER2 kinase inhibitor Drugs 0.000 description 1
- 102100029360 Hematopoietic cell signal transducer Human genes 0.000 description 1
- 102100029100 Hematopoietic prostaglandin D synthase Human genes 0.000 description 1
- 102000001554 Hemoglobins Human genes 0.000 description 1
- 108010054147 Hemoglobins Proteins 0.000 description 1
- 229920000209 Hexadimethrine bromide Polymers 0.000 description 1
- VHOLZZKNEBBHTH-YUMQZZPRSA-N His-Glu Chemical compound OC(=O)CC[C@@H](C(O)=O)NC(=O)[C@@H](N)CC1=CNC=N1 VHOLZZKNEBBHTH-YUMQZZPRSA-N 0.000 description 1
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000884298 Homo sapiens CD226 antigen Proteins 0.000 description 1
- 101000945318 Homo sapiens Calponin-1 Proteins 0.000 description 1
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 1
- 101000990188 Homo sapiens Hematopoietic cell signal transducer Proteins 0.000 description 1
- 101001046683 Homo sapiens Integrin alpha-L Proteins 0.000 description 1
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 1
- 101001046668 Homo sapiens Integrin alpha-X Proteins 0.000 description 1
- 101001015037 Homo sapiens Integrin beta-7 Proteins 0.000 description 1
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 description 1
- 101000589305 Homo sapiens Natural cytotoxicity triggering receptor 2 Proteins 0.000 description 1
- 101000873418 Homo sapiens P-selectin glycoprotein ligand 1 Proteins 0.000 description 1
- 101000633778 Homo sapiens SLAM family member 5 Proteins 0.000 description 1
- 101000633784 Homo sapiens SLAM family member 7 Proteins 0.000 description 1
- 101000596234 Homo sapiens T-cell surface protein tactile Proteins 0.000 description 1
- 101000809875 Homo sapiens TYRO protein tyrosine kinase-binding protein Proteins 0.000 description 1
- 101000652736 Homo sapiens Transgelin Proteins 0.000 description 1
- 101000795169 Homo sapiens Tumor necrosis factor receptor superfamily member 13C Proteins 0.000 description 1
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 description 1
- 101000679857 Homo sapiens Tumor necrosis factor receptor superfamily member 3 Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 101100321817 Human parvovirus B19 (strain HV) 7.5K gene Proteins 0.000 description 1
- XOZOSAUOGRPCES-STECZYCISA-N Ile-Pro-Tyr Chemical compound CC[C@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 XOZOSAUOGRPCES-STECZYCISA-N 0.000 description 1
- PELCGFMHLZXWBQ-BJDJZHNGSA-N Ile-Ser-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)O)N PELCGFMHLZXWBQ-BJDJZHNGSA-N 0.000 description 1
- PXKACEXYLPBMAD-JBDRJPRFSA-N Ile-Ser-Ser Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)O)N PXKACEXYLPBMAD-JBDRJPRFSA-N 0.000 description 1
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 1
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 1
- 108010065920 Insulin Lispro Proteins 0.000 description 1
- 102100022339 Integrin alpha-L Human genes 0.000 description 1
- 108010041100 Integrin alpha6 Proteins 0.000 description 1
- 108010030465 Integrin alpha6beta1 Proteins 0.000 description 1
- 102100033016 Integrin beta-7 Human genes 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 108010002350 Interleukin-2 Proteins 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- PMGDADKJMCOXHX-UHFFFAOYSA-N L-Arginyl-L-glutamin-acetat Natural products NC(=N)NCCCC(N)C(=O)NC(CCC(N)=O)C(O)=O PMGDADKJMCOXHX-UHFFFAOYSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- FEHQLKKBVJHSEC-SZMVWBNQSA-N Leu-Glu-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CC(C)C)C(O)=O)=CNC2=C1 FEHQLKKBVJHSEC-SZMVWBNQSA-N 0.000 description 1
- NRFGTHFONZYFNY-MGHWNKPDSA-N Leu-Ile-Tyr Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 NRFGTHFONZYFNY-MGHWNKPDSA-N 0.000 description 1
- KIZIOFNVSOSKJI-CIUDSAMLSA-N Leu-Ser-Cys Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](CS)C(=O)O)N KIZIOFNVSOSKJI-CIUDSAMLSA-N 0.000 description 1
- AIMGJYMCTAABEN-GVXVVHGQSA-N Leu-Val-Glu Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O AIMGJYMCTAABEN-GVXVVHGQSA-N 0.000 description 1
- 239000012097 Lipofectamine 2000 Substances 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- LPAJOCKCPRZEAG-MNXVOIDGSA-N Lys-Glu-Ile Chemical compound CC[C@H](C)[C@@H](C(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](N)CCCCN LPAJOCKCPRZEAG-MNXVOIDGSA-N 0.000 description 1
- ODUQLUADRKMHOZ-JYJNAYRXSA-N Lys-Glu-Tyr Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCCN)N)O ODUQLUADRKMHOZ-JYJNAYRXSA-N 0.000 description 1
- UGCIQUYEJIEHKX-GVXVVHGQSA-N Lys-Val-Glu Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(O)=O)C(O)=O UGCIQUYEJIEHKX-GVXVVHGQSA-N 0.000 description 1
- 108091054455 MAP kinase family Proteins 0.000 description 1
- 102000043136 MAP kinase family Human genes 0.000 description 1
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 description 1
- AFFKUNVPPLQUGA-DCAQKATOSA-N Met-Leu-Ala Chemical compound [H]N[C@@H](CCSC)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(O)=O AFFKUNVPPLQUGA-DCAQKATOSA-N 0.000 description 1
- SPSSJSICDYYTQN-HJGDQZAQSA-N Met-Thr-Gln Chemical compound CSCC[C@H](N)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@H](C(O)=O)CCC(N)=O SPSSJSICDYYTQN-HJGDQZAQSA-N 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 241000713333 Mouse mammary tumor virus Species 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101100236305 Mus musculus Ly9 gene Proteins 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- AFCARXCZXQIEQB-UHFFFAOYSA-N N-[3-oxo-3-(2,4,6,7-tetrahydrotriazolo[4,5-c]pyridin-5-yl)propyl]-2-[[3-(trifluoromethoxy)phenyl]methylamino]pyrimidine-5-carboxamide Chemical compound O=C(CCNC(=O)C=1C=NC(=NC=1)NCC1=CC(=CC=C1)OC(F)(F)F)N1CC2=C(CC1)NN=N2 AFCARXCZXQIEQB-UHFFFAOYSA-N 0.000 description 1
- AJHCSUXXECOXOY-UHFFFAOYSA-N N-glycyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)CN)C(O)=O)=CNC2=C1 AJHCSUXXECOXOY-UHFFFAOYSA-N 0.000 description 1
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 description 1
- 108091007491 NSP3 Papain-like protease domains Proteins 0.000 description 1
- 108010004217 Natural Cytotoxicity Triggering Receptor 1 Proteins 0.000 description 1
- 108010004222 Natural Cytotoxicity Triggering Receptor 3 Proteins 0.000 description 1
- 102100032870 Natural cytotoxicity triggering receptor 1 Human genes 0.000 description 1
- 102100032851 Natural cytotoxicity triggering receptor 2 Human genes 0.000 description 1
- 102100032852 Natural cytotoxicity triggering receptor 3 Human genes 0.000 description 1
- 101710141230 Natural killer cell receptor 2B4 Proteins 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 102100034925 P-selectin glycoprotein ligand 1 Human genes 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 102000035195 Peptidases Human genes 0.000 description 1
- OVJMCXAPGFDGMG-HKUYNNGSSA-N Phe-Gly-Trp Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)NCC(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O OVJMCXAPGFDGMG-HKUYNNGSSA-N 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 108010039918 Polylysine Proteins 0.000 description 1
- UIMCLYYSUCIUJM-UWVGGRQHSA-N Pro-Gly-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H]1CCCN1 UIMCLYYSUCIUJM-UWVGGRQHSA-N 0.000 description 1
- FYKUEXMZYFIZKA-DCAQKATOSA-N Pro-Pro-Gln Chemical compound [H]N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(O)=O FYKUEXMZYFIZKA-DCAQKATOSA-N 0.000 description 1
- GOMUXSCOIWIJFP-GUBZILKMSA-N Pro-Ser-Arg Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O GOMUXSCOIWIJFP-GUBZILKMSA-N 0.000 description 1
- VEUACYMXJKXALX-IHRRRGAJSA-N Pro-Tyr-Ser Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(O)=O VEUACYMXJKXALX-IHRRRGAJSA-N 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 102100029216 SLAM family member 5 Human genes 0.000 description 1
- 102100029198 SLAM family member 7 Human genes 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- YMTLKLXDFCSCNX-BYPYZUCNSA-N Ser-Gly-Gly Chemical compound OC[C@H](N)C(=O)NCC(=O)NCC(O)=O YMTLKLXDFCSCNX-BYPYZUCNSA-N 0.000 description 1
- UIGMAMGZOJVTDN-WHFBIAKZSA-N Ser-Gly-Ser Chemical compound OC[C@H](N)C(=O)NCC(=O)N[C@@H](CO)C(O)=O UIGMAMGZOJVTDN-WHFBIAKZSA-N 0.000 description 1
- XXXAXOWMBOKTRN-XPUUQOCRSA-N Ser-Gly-Val Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C(C)C)C(O)=O XXXAXOWMBOKTRN-XPUUQOCRSA-N 0.000 description 1
- VZQRNAYURWAEFE-KKUMJFAQSA-N Ser-Leu-Phe Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@H](C(O)=O)CC1=CC=CC=C1 VZQRNAYURWAEFE-KKUMJFAQSA-N 0.000 description 1
- YUJLIIRMIAGMCQ-CIUDSAMLSA-N Ser-Leu-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O YUJLIIRMIAGMCQ-CIUDSAMLSA-N 0.000 description 1
- HDBOEVPDIDDEPC-CIUDSAMLSA-N Ser-Lys-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(O)=O HDBOEVPDIDDEPC-CIUDSAMLSA-N 0.000 description 1
- AZWNCEBQZXELEZ-FXQIFTODSA-N Ser-Pro-Ser Chemical compound OC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(O)=O AZWNCEBQZXELEZ-FXQIFTODSA-N 0.000 description 1
- XJDMUQCLVSCRSJ-VZFHVOOUSA-N Ser-Thr-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O XJDMUQCLVSCRSJ-VZFHVOOUSA-N 0.000 description 1
- RTXKJFWHEBTABY-IHPCNDPISA-N Ser-Trp-Tyr Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)O)NC(=O)[C@H](CO)N RTXKJFWHEBTABY-IHPCNDPISA-N 0.000 description 1
- PMTWIUBUQRGCSB-FXQIFTODSA-N Ser-Val-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](C)C(O)=O PMTWIUBUQRGCSB-FXQIFTODSA-N 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 108010003723 Single-Domain Antibodies Proteins 0.000 description 1
- 241000191967 Staphylococcus aureus Species 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 102100035268 T-cell surface protein tactile Human genes 0.000 description 1
- 239000006180 TBST buffer Substances 0.000 description 1
- 102100038717 TYRO protein tyrosine kinase-binding protein Human genes 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- DGDCHPCRMWEOJR-FQPOAREZSA-N Thr-Ala-Tyr Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CC1=CC=C(O)C=C1 DGDCHPCRMWEOJR-FQPOAREZSA-N 0.000 description 1
- XSLXHSYIVPGEER-KZVJFYERSA-N Thr-Ala-Val Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(O)=O XSLXHSYIVPGEER-KZVJFYERSA-N 0.000 description 1
- KRPKYGOFYUNIGM-XVSYOHENSA-N Thr-Asp-Phe Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)N)O KRPKYGOFYUNIGM-XVSYOHENSA-N 0.000 description 1
- FQPDRTDDEZXCEC-SVSWQMSJSA-N Thr-Ile-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O FQPDRTDDEZXCEC-SVSWQMSJSA-N 0.000 description 1
- GXUWHVZYDAHFSV-FLBSBUHZSA-N Thr-Ile-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(O)=O GXUWHVZYDAHFSV-FLBSBUHZSA-N 0.000 description 1
- VRUFCJZQDACGLH-UVOCVTCTSA-N Thr-Leu-Thr Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O VRUFCJZQDACGLH-UVOCVTCTSA-N 0.000 description 1
- KZSYAEWQMJEGRZ-RHYQMDGZSA-N Thr-Leu-Val Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(O)=O KZSYAEWQMJEGRZ-RHYQMDGZSA-N 0.000 description 1
- AHERARIZBPOMNU-KATARQTJSA-N Thr-Ser-Leu Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O AHERARIZBPOMNU-KATARQTJSA-N 0.000 description 1
- MNYNCKZAEIAONY-XGEHTFHBSA-N Thr-Val-Ser Chemical compound C[C@@H](O)[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CO)C(O)=O MNYNCKZAEIAONY-XGEHTFHBSA-N 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- HYVLNORXQGKONN-NUTKFTJISA-N Trp-Ala-Lys Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCN)C(O)=O)=CNC2=C1 HYVLNORXQGKONN-NUTKFTJISA-N 0.000 description 1
- YEGMNOHLZNGOCG-UBHSHLNASA-N Trp-Asn-Asn Chemical compound [H]N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O YEGMNOHLZNGOCG-UBHSHLNASA-N 0.000 description 1
- SVGAWGVHFIYAEE-JSGCOSHPSA-N Trp-Gly-Gln Chemical compound C1=CC=C2C(C[C@H](N)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(O)=O)=CNC2=C1 SVGAWGVHFIYAEE-JSGCOSHPSA-N 0.000 description 1
- RCMHSGRBJCMFLR-BPUTZDHNSA-N Trp-Met-Asn Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(N)=O)C(O)=O)=CNC2=C1 RCMHSGRBJCMFLR-BPUTZDHNSA-N 0.000 description 1
- MBLJBGZWLHTJBH-SZMVWBNQSA-N Trp-Val-Arg Chemical compound C1=CC=C2C(C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O)=CNC2=C1 MBLJBGZWLHTJBH-SZMVWBNQSA-N 0.000 description 1
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 description 1
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 1
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 1
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 1
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 102100022156 Tumor necrosis factor receptor superfamily member 3 Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- NOXKHHXSHQFSGJ-FQPOAREZSA-N Tyr-Ala-Thr Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 NOXKHHXSHQFSGJ-FQPOAREZSA-N 0.000 description 1
- XMNDQSYABVWZRK-BZSNNMDCSA-N Tyr-Asn-Phe Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O XMNDQSYABVWZRK-BZSNNMDCSA-N 0.000 description 1
- OKDNSNWJEXAMSU-IRXDYDNUSA-N Tyr-Phe-Gly Chemical compound C([C@H](N)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)NCC(O)=O)C1=CC=C(O)C=C1 OKDNSNWJEXAMSU-IRXDYDNUSA-N 0.000 description 1
- SOAUMCDLIUGXJJ-SRVKXCTJSA-N Tyr-Ser-Asn Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O SOAUMCDLIUGXJJ-SRVKXCTJSA-N 0.000 description 1
- ANHVRCNNGJMJNG-BZSNNMDCSA-N Tyr-Tyr-Cys Chemical compound C1=CC(=CC=C1C[C@@H](C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)N[C@@H](CS)C(=O)O)N)O ANHVRCNNGJMJNG-BZSNNMDCSA-N 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 241000711973 Vesicular stomatitis Indiana virus Species 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 108010081404 acein-2 Proteins 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 238000011467 adoptive cell therapy Methods 0.000 description 1
- 108010008685 alanyl-glutamyl-aspartic acid Proteins 0.000 description 1
- 108010069020 alanyl-prolyl-glycine Proteins 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 239000000611 antibody drug conjugate Substances 0.000 description 1
- 229940049595 antibody-drug conjugate Drugs 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 239000012736 aqueous medium Substances 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 108010008355 arginyl-glutamine Proteins 0.000 description 1
- 239000013602 bacteriophage vector Substances 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 239000000378 calcium silicate Substances 0.000 description 1
- 229910052918 calcium silicate Inorganic materials 0.000 description 1
- 235000012241 calcium silicate Nutrition 0.000 description 1
- OYACROKNLOSFPA-UHFFFAOYSA-N calcium;dioxido(oxo)silane Chemical compound [Ca+2].[O-][Si]([O-])=O OYACROKNLOSFPA-UHFFFAOYSA-N 0.000 description 1
- 229940022399 cancer vaccine Drugs 0.000 description 1
- 238000009566 cancer vaccine Methods 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 229960003669 carbenicillin Drugs 0.000 description 1
- FPPNZSSZRUTDAP-UWFZAAFLSA-N carbenicillin Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)C(C(O)=O)C1=CC=CC=C1 FPPNZSSZRUTDAP-UWFZAAFLSA-N 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 1
- 108010072917 class-I restricted T cell-associated molecule Proteins 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000013601 cosmid vector Substances 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 229960003624 creatine Drugs 0.000 description 1
- 239000006046 creatine Substances 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 229940029030 dendritic cell vaccine Drugs 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 239000002270 dispersing agent Substances 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 229940121647 egfr inhibitor Drugs 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 108700020302 erbB-2 Genes Proteins 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 238000000684 flow cytometry Methods 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 108700004026 gag Genes Proteins 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000012215 gene cloning Methods 0.000 description 1
- 238000001476 gene delivery Methods 0.000 description 1
- 229960002518 gentamicin Drugs 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 108010078144 glutaminyl-glycine Proteins 0.000 description 1
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 1
- XBGGUPMXALFZOT-UHFFFAOYSA-N glycyl-L-tyrosine hemihydrate Natural products NCC(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 XBGGUPMXALFZOT-UHFFFAOYSA-N 0.000 description 1
- 108010067216 glycyl-glycyl-glycine Proteins 0.000 description 1
- XKUKSGPZAADMRA-UHFFFAOYSA-N glycyl-glycyl-glycine Natural products NCC(=O)NCC(=O)NCC(O)=O XKUKSGPZAADMRA-UHFFFAOYSA-N 0.000 description 1
- 108010089804 glycyl-threonine Proteins 0.000 description 1
- 108010010147 glycylglutamine Proteins 0.000 description 1
- 108010084389 glycyltryptophan Proteins 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 239000003102 growth factor Substances 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 229940022353 herceptin Drugs 0.000 description 1
- 238000005734 heterodimerization reaction Methods 0.000 description 1
- 108010040030 histidinoalanine Proteins 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 150000002463 imidates Chemical class 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 1
- 239000002955 immunomodulating agent Substances 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 230000006525 intracellular process Effects 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000010255 intramuscular injection Methods 0.000 description 1
- 239000007927 intramuscular injection Substances 0.000 description 1
- FZWBNHMXJMCXLU-BLAUPYHCSA-N isomaltotriose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)[C@@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)O1 FZWBNHMXJMCXLU-BLAUPYHCSA-N 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 210000003292 kidney cell Anatomy 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 230000004807 localization Effects 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 239000012139 lysis buffer Substances 0.000 description 1
- 235000019359 magnesium stearate Nutrition 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 210000003205 muscle Anatomy 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 229960002715 nicotine Drugs 0.000 description 1
- SNICXCGAKADSCV-UHFFFAOYSA-N nicotine Natural products CN1CCCC1C1=CC=CN=C1 SNICXCGAKADSCV-UHFFFAOYSA-N 0.000 description 1
- 229960003301 nivolumab Drugs 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 229960000572 olaparib Drugs 0.000 description 1
- FAQDUNYVKQKNLD-UHFFFAOYSA-N olaparib Chemical compound FC1=CC=C(CC2=C3[CH]C=CC=C3C(=O)N=N2)C=C1C(=O)N(CC1)CCN1C(=O)C1CC1 FAQDUNYVKQKNLD-UHFFFAOYSA-N 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000001575 pathological effect Effects 0.000 description 1
- 229960002621 pembrolizumab Drugs 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 108700004029 pol Genes Proteins 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920000656 polylysine Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000002335 preservative effect Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 239000000092 prognostic biomarker Substances 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 108010020755 prolyl-glycyl-glycine Proteins 0.000 description 1
- 108010079317 prolyl-tyrosine Proteins 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 229940024999 proteolytic enzymes for treatment of wounds and ulcers Drugs 0.000 description 1
- 238000004445 quantitative analysis Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 210000003289 regulatory T cell Anatomy 0.000 description 1
- 230000013878 renal filtration Effects 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 238000012827 research and development Methods 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 108700004030 rev Genes Proteins 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 108010026333 seryl-proline Proteins 0.000 description 1
- 231100000004 severe toxicity Toxicity 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- RPENMORRBUTCPR-UHFFFAOYSA-M sodium;1-hydroxy-2,5-dioxopyrrolidine-3-sulfonate Chemical compound [Na+].ON1C(=O)CC(S([O-])(=O)=O)C1=O RPENMORRBUTCPR-UHFFFAOYSA-M 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 235000010356 sorbitol Nutrition 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000011272 standard treatment Methods 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 239000006188 syrup Substances 0.000 description 1
- 235000020357 syrup Nutrition 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 239000003826 tablet Substances 0.000 description 1
- 239000000454 talc Substances 0.000 description 1
- 229910052623 talc Inorganic materials 0.000 description 1
- 235000012222 talc Nutrition 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 229940040944 tetracyclines Drugs 0.000 description 1
- 108010072986 threonyl-seryl-lysine Proteins 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 102000027257 transmembrane receptors Human genes 0.000 description 1
- 108091008578 transmembrane receptors Proteins 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 108010003137 tyrosyltyrosine Proteins 0.000 description 1
- 108010009962 valyltyrosine Proteins 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
- A61K47/6855—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell the tumour determinant being from breast cancer cell
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/40—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having five-membered rings with one nitrogen as the only ring hetero atom, e.g. sulpiride, succinimide, tolmetin, buflomedil
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/435—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having six-membered rings with one nitrogen as the only ring hetero atom
- A61K31/44—Non condensed pyridines; Hydrogenated derivatives thereof
- A61K31/4427—Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems
- A61K31/4439—Non condensed pyridines; Hydrogenated derivatives thereof containing further heterocyclic ring systems containing a five-membered ring with nitrogen as a ring hetero atom, e.g. omeprazole
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4611—T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4631—Chimeric Antigen Receptors [CAR]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4633—Antibodies or T cell engagers
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/464—Cellular immunotherapy characterised by the antigen targeted or presented
- A61K39/4643—Vertebrate antigens
- A61K39/4644—Cancer antigens
- A61K39/464402—Receptors, cell surface antigens or cell surface determinants
- A61K39/464403—Receptors for growth factors
- A61K39/464406—Her-2/neu/ErbB2, Her-3/ErbB3 or Her 4/ ErbB4
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/54—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an organic compound
- A61K47/545—Heterocyclic compounds
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6849—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a receptor, a cell surface antigen or a cell surface determinant
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2863—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against receptors for growth factors, growth regulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/44—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material not provided for elsewhere, e.g. haptens, metals, DNA, RNA, amino acids
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K19/00—Hybrid peptides, i.e. peptides covalently bound to nucleic acids, or non-covalently bound protein-protein complexes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N5/00—Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
- C12N5/06—Animal cells or tissues; Human cells or tissues
- C12N5/0602—Vertebrate cells
- C12N5/0634—Cells from the blood or the immune system
- C12N5/0636—T lymphocytes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/57—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2
- A61K2039/572—Medicinal preparations containing antigens or antibodies characterised by the type of response, e.g. Th1, Th2 cytotoxic response
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/10—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the structure of the chimeric antigen receptor [CAR]
- A61K2239/23—On/off switch
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/31—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterized by the route of administration
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/38—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the dose, timing or administration schedule
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K2239/00—Indexing codes associated with cellular immunotherapy of group A61K39/46
- A61K2239/46—Indexing codes associated with cellular immunotherapy of group A61K39/46 characterised by the cancer treated
- A61K2239/59—Reproductive system, e.g. uterus, ovaries, cervix or testes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/705—Receptors; Cell surface antigens; Cell surface determinants
- C07K14/70503—Immunoglobulin superfamily
- C07K14/7051—T-cell receptor (TcR)-CD3 complex
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/56—Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
- C07K2317/565—Complementarity determining region [CDR]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/60—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments
- C07K2317/62—Immunoglobulins specific features characterized by non-natural combinations of immunoglobulin fragments comprising only variable region components
- C07K2317/622—Single chain antibody (scFv)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
- C07K2317/732—Antibody-dependent cellular cytotoxicity [ADCC]
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/90—Immunoglobulins specific features characterized by (pharmaco)kinetic aspects or by stability of the immunoglobulin
- C07K2317/92—Affinity (KD), association rate (Ka), dissociation rate (Kd) or EC50 value
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2318/00—Antibody mimetics or scaffolds
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2318/00—Antibody mimetics or scaffolds
- C07K2318/20—Antigen-binding scaffold molecules wherein the scaffold is not an immunoglobulin variable region or antibody mimetics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/03—Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/33—Fusion polypeptide fusions for targeting to specific cell types, e.g. tissue specific targeting, targeting of a bacterial subspecies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2510/00—Genetically modified cells
Abstract
본 발명은 항-HER2 어피바디 및 코티닌이 결합된 항-HER2 어피바디를 포함하는 스위치 분자에 관한 것이다. 본 발명의 항-HER2 어피바디는 코티닌이 결합되었을 때, Cot-sCART와 함께 처리되는 경우 HER2를 발현하는 양성 세포주에 반응하여 면역세포 활성을 유도하므로 sCART 치료제의 스위치 분자로서 유용하게 사용할 수 있다.
Description
본 발명은 신규한 항-HER2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체에 관한 것이다.
초기 단계의 임상 시험에서 인상적인 성공을 거두었음에도 불구하고, 기존의 CAR-T 세포는 생체 내에서의 활성화 및 확장에 대한 제어가 불가하다는 점에서 한계를 가진다. 예를 들어, CAR-T 세포는 환자의 항원 양성 세포와 만났을 때 104 배수까지 급속하게 증식하여 종양 용해 증후군 (tumor lysis syndrome, TLS)과 치명적인 사이토카인 방출 증후군 (cytokine release syndrome, CRS)으로 인한 심각한 증세를 초래한다. 추가적인 합병증은 CAR-T 세포의 항원에 대한 지속적인 활성화(persistent on-target activity)에 의해 야기될 수 있다. 예를 들어, CART-19의 경우, 조작된 T 세포가 악성 B 세포뿐만 아니라 정상 B 세포를 무차별적으로 죽여 장기간의 B 세포 무형성(B cell aplasia)을 야기한다. 마지막으로, 기존 CAR-T 세포의 고정된 항원특이성은 CART-19 치료를 받는 모든 환자의 10%까지 재발의 근원인 것으로 밝혀진 항원-손실 탈출 돌연변이체(antigen-loss escape mutant)에 대한 표적화가 배제된다. 따라서, CAR-T 세포의 안전성을 향상시키기 위하여 심각한 독성이 나타나는 경우 CAR-T 세포의 활성을 조절할 수 있고, 항원의 돌연변이가 일어나는 경우 CAR-T 세포와 표적세포 사이의 상호작용을 중재할 수 있는 스위치 분자의 개발에 대한 요구가 점차 증가하고 있다.
인간 표피 성장 인자 수용체 2 (HER2, 또한 "HER2/neu" 또는 "ErbB-2"로도 호칭)는 표피 성장 인자 수용체 패밀리에 속하는 185 kDa의 막횡단 수용체이다. HER2 유전자의 증폭 및 단백질의 과다발현은 다수 유형 암의 발병과 진행에서 중추적인 역할을 한다. HER2는 유방암의 25-30%, 위암의 15-35% 및 난소암의 7-38%에서 과다발현되며, 불량한 생존율과 상관관계가 있다. HER2 단백질은 최근 암 요법의 중요한 예측성 바이오마커 및 표적으로서 대두되었다. 그의 패밀리의 다른 구성원과의 동종이량체화 또는 이종이량체화는 세포내 티로신 키나제 도메인의 활성화를 촉구하며, MAPK 및 Akt 신호전달 경로를 통해 매개되는 세포 생존과 증식을 촉발한다. 임상에서 이용가능한 HER2-표적화 요법은 수용체 이량체화를 방지하는 항체, 예컨대 트라스투주맙 (허셉틴(Herceptin), 제넨테크(Genentech)) 및 페르투주맙 (퍼제타(Perjeta), 제넨테크), 항체-약물 접합체, 예컨 대 T-DM1 (캐싸일라(Kadcyla), 제넨테크) 또는 티로신-키나제 도메인을 표적화하는 소분자 억제제 (예를 들어, 라파티닙, 타이버브(Tyverb), 글락소스미스클라인(GlaxoSmithKline); 이중 HER2 및 EGFR 억제제)를 포함한다.
본 발명자들은 종래 CAR-T에서 알려진 합병증 없이 HER2를 발현하는 암을 치료할 수 있는 키메라 항원 수용체를 개발하고자 예의 연구 노력하였다. 그 결과 코티닌과 결합한 항-HER2 어피바디를 스위치 분자로 이용하여 코티닌을 표적화하는 키메라 항원 수용체와 함께 처리하는 경우 HER2를 발현하는 암세포주에 반응하여 면역세포 활성을 유도하는 것을 규명함으로써, 본 발명을 완성하게 되었다.
따라서, 본 발명의 목적은 신규한 항-HER2 어피바디를 제공하는 것이다.
본 발명의 다른 목적은 코티닌이 결합된 항-HER2 어피바디를 포함하는 스위치 분자를 제공하는 것이다.
본 발명의 또 다른 목적은 상기 스위치 분자 및 상기 스위치 분자를 표적화하는 키메라 항원 수용체를 포함하는 스위처블 키메라 항원 수용체를 제공하는 것이다.
본 발명의 일 양태에 따르면, 본 발명은 하기 일반식으로 표시되는 아미노산 서열을 포함하는 항-HER2 어피바디를 제공한다:
일반식
VDNKFNKEX 9 X 10 X 11 AYWEIX 17 X 18 LPNLNX 24 X 25 QX 27 X 28 AFIX 32 X 33 LX 35 DDPSQSANLLAEAKKLNDAQAPK
본 명세서의 일반식에서 정의한 Xy의 형식으로 표현된 아미노산 잔기는 본 일반식의 아미노산 서열로 이루어진 폴리펩티드의 타겟 항원에 대한 특이적인 결합특성을 제공하는 아미노산 잔기의 위치로, 상기 Xy는 20가지의 모든 천연아미노산 잔기중에서 선택될 수 있으며, 상기 y는 일반식의 아미노산 서열 중 y번째에 해당함을 의미한다.
본 명세서에서 Xy의 형식으로 정의되지 아니한 위치의 아미노산 잔기는 스캐폴드 아미노산 또는 스캐폴드라고 지칭한다. 상기 스캐폴드 아미노산은 본 발명의 폴리펩티드의 타겟 항원과의 결합친화성을 부여하는 상기 Xy 형태의 무작위적 아미노산과는 구별되는 아미노산 서열로서 본 발명의 폴리펩타이드 또는 폴리펩타이드 복합체로서의 구조적 안정성을 부여한다.
상기 일반식에서,
(i) 상기 X9X10X11은 LRV이고, 상기 X17X18은 VK이고, 상기 X24X25는 PY, PP 또는 PK이고, 상기 X27X28은 SR 또는 IT이고, 상기 X32X33은 RS 또는 KQ이고, 상기 X35는 Y임;
(ii) 상기 X9X10X11은 LRG이고, 상기 X17X18은 TS이고, 상기 X24X25는 HS이고, 상기 X27X28은 IT이고, 상기 X32X33은 VS이고, 상기 X35는 Y임;
(iii) 상기 X9X10X11은 MRD이고, 상기 X17X18은 VR이고, 상기 X24X25는 RI 또는 PP이고, 상기 X27X28은 ST 또는 SV이고, 상기 X32X33은 RS 또는 RQ이고, X35는 Y임;
(iv) 상기 X9X10X11은 YML이고, 상기 X17X18은 VK이고, 상기 X24X25는 YP이고, 상기 X27X28은 QH이고, 상기 X32X33은 RS이고, X35는 F임; 또는
(v) 상기 X9X10X11은 INK이고, 상기 X17X18은 IS이고, 상기 X24X25는 KE이고, 상기 X27X28은 HH이고, 상기 X32X33은 HS이고, X35는 Y임.
본 발명의 일 구현예에 있어서, 상기 X35는 Y이다.
본 발명의 일 구현예에 있어서, X10은 R이다.
본 발명의 일 구현예에 있어서, X17은 V이다.
본 발명의 일 구현예에 있어서, X24는 P이다.
본 발명의 일 구현예에 있어서, 상기 항-HER2 어피바디는 서열번호 1 내지 8 중 어느 하나의 아미노산 서열을 포함한다.
본 명세서에서, "어피바디(Affibody®)" 분자는 황색포도상구균 (Staphylococcus aureus)의 단백질 A (Protein A) 중 IgG에 친화성이 있는 부위인 Z-도메인(Z domain)이다. 본 명세서에서 "어피바디(affibody)"는 "Z body" 또는 "Zb"로도 표현된다. 어피바디는 58개의 아미노산 잔기로 이루어진 작은 단백질이다. 이러한 어피바디 분자의 단백질 서열에서 IgG와 결합면을 형성하는 13개의 아미노산은 아미노산 서열에 따라 다양한 타겟 항원에 대한 결합이 가능하며, 무작위적인 배열이 가능하여 라이브러리(library)를 구축할 수 있다. 어피바디 분자는 항체와 유사하게 라이브러리로부터 파아지 디스플레이(phage display), 효모단백질 잡종법(yeast two hybrid, Y2H) 등의 스크리닝 방법을 통해서 다양한 타겟 항원에 대하여 결합할 수 있는 어피바디 분자들을 선별할 수 있다. 또한, 어피바디는 분자량이 6 kDa으로 매우 작아, 일반적으로 150 kDa의 분자량을 가진 IgG 형태의 항체와 비교하여 인체 투여시 전신적으로 확산되고, 신장여과로 빠르게 제거되는 특징이 있다. 따라서, 어피바디는 주로 진단시료 연구개발에 응용되고 있다(Goldstein R et al., 2013, Expert Rev Anticancer Ther.). 어피바디는 일반 IgG와 결합된 이중항체의 형태로도 개발되어 지고 있다(Yu F et al., 2014, MAbs). 제1 세대 Z 변이체(Z domain의 변이체)에 기반한 폴리펩티드 스캐폴드에 관한 발명이 PCT 공개공보 WO95/19374에 개시된 바 있고, 제2 세대 Z 변이체에 기반한 폴리펩티드 스캐폴드에 관한 발명이 PCT 공개공보 WO2009/080811에 개시된 바 있다.
본 발명의 다른 양태에 따르면, 본 발명은 상기한 항-HER2 어피바디를 인코딩하는 뉴클레오타이드 서열을 포함하는 핵산 분자를 제공한다.
본 발명의 일 구현예에 있어서, 본 발명의 상기 항-HER2 어피바디를 인코딩하는 뉴클레오타이드 서열은, 상기 항-HER2 어피바디를 구성하는 아미노산 서열을 코딩하는 뉴클레오티드 서열인 것으로 족하며, 어느 특정 뉴클레오티드 서열에 한정되지 않는다는 것은 당업자에게 자명하다. 이는 뉴클레오티드 서열의 변이가 발생하더라도 변이된 뉴클레오타이드 서열을 단백질로 발현하면 단백질 서열에서 변화를 가져오지 않는 경우도 있기 때문이다. 이를 코돈의 축퇴성이라고 한다. 따라서 상기 뉴클레오타이드 서열은 기능적으로 균등한 코돈 또는 동일한 아미노산을 코딩하는 코돈 (예를 들어, 코돈의 축퇴성에 의해, 아르기닌 또는 세린에 대한 코돈은 여섯 개이다), 또는 생물학적으로 균등한 아미노산을 코딩하는 코돈을 포함하는 뉴클레오타이드 서열을 포함한다.
본 명세서에서 용어 "핵산(nucleic acids)"은 DNA(gDNA 및 cDNA) 그리고 RNA 분자를 포괄적으로 포함하는 의미를 가지며, 핵산 분자에서 기본 구성 단위인 뉴클레오타이드는 자연의 뉴클레오타이드 뿐만 아니라, 당 또는 염기 부위가 변형된 유사체(analogue)도 포함한다(Scheit, Nucleotide Analogs, John Wiley, New York(1980); Uhlman 및 Peyman, Chemical Reviews, 90:543-584(1990)).
상술한 생물학적 균등 활성을 갖는 변이를 고려한다면, 상기 항-HER2 어피바디를 구성하는 아미노산 서열을 코딩하는 본 발명의 핵산 분자는 이와 실질적인 동일성(substantial identity)을 나타내는 서열도 포함하는 것으로 해석된다. 상기의 실질적인 동일성은, 상기한 본 발명의 서열과 임의의 다른 서열을 최대한 대응되도록 얼라인(align)하고, 당업계에서 통상적으로 이용되는 알고리즘을 이용하여 얼라인된 서열을 분석한 경우에, 최소 60% 이상의 상동성, 보다 구체적으로는 70% 이상의 상동성, 보다 더 구체적으로는 80% 이상의 상동성, 보다 더욱 더 구체적으로는 90% 이상의 상동성, 가장 구체적으로는 95% 이상의 상동성을 나타내는 서열을 의미한다. 서열비교를 위한 얼라인먼트(alignment) 방법은 당업계에 공지되어있다. 얼라인먼트에 대한 다양한 방법 및 알고리즘은 Smith and Waterman, Adv. Appl. Math. 2:482(1981); Needleman and Wunsch, J. Mol. Bio. 48:443(1970); Pearson and Lipman, Methods in Mol. Biol. 24: 307-31(1988); Higgins and Sharp, Gene 73:237-44(1988); Higgins and Sharp, CABIOS 5:151-3(1989); Corpet et al., Nuc. Acids Res. 16:10881-90(1988); Huang et al., Comp. Appl. BioSci. 8:155-65(1992) and Pearson et al., Meth. Mol. Biol. 24:307-31(1994)에 개시되어 있지만, 이에 한정되는 것은 아니다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상기한 항-HER2 어피바디를 코딩하는 핵산 분자를 포함하는 재조합 벡터를 제공한다.
본 명세서에서 용어 "벡터"는 숙주 세포에서 목적 유전자를 발현시키기 위한 수단으로 플라스미드 벡터; 코즈미드 벡터; 그리고 박테리오파아지 벡터, 아데노바이러스 벡터, 레트로바이러스 벡터 및 아데노-연관 바이러스 벡터 같은 바이러스 벡터 등을 포함한다.
본 발명의 구체적인 구현예에 따르면, 본 발명의 벡터에서 상기 어피바디를 인코딩하는 핵산 분자는 상기 벡터의 프로모터와 작동적으로 결합(operatively linked)되어 있다.
본 명세서에서, 용어 "작동적으로 결합된"은 핵산 발현 조절 서열(예: 프로모터, 시그널 서열, 또는 전사조절인자 결합 위치의 어레이)과 다른 핵산 서열사이의 기능적인 결합을 의미하며, 이에 의해 상기 조절 서열은 상기 다른 핵산 서열의 전사 및/또는 해독을 조절하게 된다.
본 발명의 재조합 벡터 시스템은 당업계에 공지된 다양한 방법을 통해 구축될 수 있으며, 이에 대한 구체적인 방법은 Sambrook et al., Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press(2001)에 개시되어 있으며, 이 문헌은 본 명세서에 참조로서 삽입된다.
본 발명의 벡터는 전형적으로 유전자 클로닝을 위한 벡터 또는 단백질의 발현을 위한 벡터로서 구축될 수 있다. 또한, 본 발명의 벡터는 원핵 세포 또는 진핵 세포를 숙주로 하여 구축될 수 있다.
예를 들어, 본 발명의 벡터가 발현 벡터이고, 진핵 세포를 숙주로 하는 경우에는, 포유동물 세포의 지놈으로부터 유래된 프로모터(예: 메탈로티오닌 프로모터, beta-액틴 프로모터, 사람 헤로글로빈 프로모터 및 사람 근육 크레아틴 프로모터) 또는 포유동물 바이러스로부터 유래된 프로모터(예: 아데노바이러스 후기 프로모터, 백시니아 바이러스 7.5K 프로모터, SV40 프로모터, 사이토메갈로바이러스 프로모터, HSV의 tk 프로모터, 마우스 유방 종양 바이러스(MMTV) 프로모터, HIV의 LTR 프로모터, 몰로니 바이러스,의 프로모터 엡스타인 바 바이러스(EBV)의 프로모터 및 로우스 사코마 바이러스(RSV)의 프로모터)가 이용될 수 있으며, 이들은 일반적으로 전사 종결 서열로서 폴리아데닐화 서열을 갖는다.
본 발명의 벡터는 그로부터 발현되는 폴리펩타이드 또는 단백질의 정제를 용이하게 하기 위하여, 다른 서열과 융합될 수도 있다. 융합되는 서열은 예컨대, 글루타티온 S-트랜스퍼라제(Pharmacia, USA), 말토스 결합 단백질(NEB, USA), FLAG(IBI, USA) 및 6x His(hexahistidine; Quiagen, USA) 등이 있다.
한편, 본 발명의 발현 벡터는 선택표지로서, 당업계에서 통상적으로 이용되는 항생제 내성 유전자를 포함하며, 예를 들어 암피실린, 겐타마이신, 카베니실린, 클로람페니콜, 스트렙토마이신, 카나마이신, 제네티신, 네오마이신 및 테트라사이클린에 대한 내성 유전자가 있다.
본 발명의 다른 일 양태에 따르면, 본 발명은 상기 재조합 벡터로 형질전환 된 숙주세포를 제공한다.
본 발명의 벡터를 안정되면서 연속적으로 클로닝 및 발현시킬 수 있는 숙주 세포는 당업계에 공지되어 있으며, 어떠한 숙주 세포도 이용할 수 있다. 예컨대, 상기 벡터의 적합한 진핵세포 숙주 세포는 원숭이 신장 세포7(COS7: monkey kidney cells), NSO 세포, SP2/0, 차이니즈 햄스터 난소(CHO: Chinese hamster ovary) 세포, W138, 어린 햄스터 신장(BHK: baby hamster kidney) 세포, MDCK, 골수종 세포주, HuT 78 세포 및 HEK-293 세포를 포함하나 이에 한정되지 않는다.
본 명세서에서 용어 "형질전환된", "형질도입된" 또는 "형질감염된"은 외인성 핵산이 숙주세포 내로 전달되거나 도입되는 과정을 지칭한다. "형질전환된", "형질도입된" 또는 "형질감염된" 세포는 외인성 핵산으로 형질전환, 형질도입 또는 형질감염된 세포이며, 상기 세포는 당해 세포 및 그의 계대 배양으로 인한 자손 세포를 포함한다.
본 발명의 다른 일 양태에 따르면, 본 발명은 코티닌과 결합된, 하기 일반식으로 표시되는 항-HER2 어피바디를 포함하는 키메라 항원 수용체 효과기 세포(chimeric antigen receptor-effector cell)를 활성화하기 위한 스위치 분자(switch molecule)를 제공한다:
일반식
VDNKFNKEX 9 X 10 X 11 AYWEIX 17 X 18 LPNLNX 24 X 25 QX 27 X 28 AFIX 32 X 33 LX 35 DDPSQSANLLAEAKKLNDAQAPK
상기 일반식에서,
(i) 상기 X9X10X11은 LRV이고, 상기 X17X18은 VK이고, 상기 X24X25는 PY, PP 또는 PK이고, 상기 X27X28은 SR 또는 IT이고, 상기 X32X33은 RS 또는 KQ이고, 상기 X35는 Y임;
(ii) 상기 X9X10X11은 LRG이고, 상기 X17X18은 TS이고, 상기 X24X25는 HS이고, 상기 X27X28은 IT이고, 상기 X32X33은 VS이고, 상기 X35는 Y임;
(iii) 상기 X9X10X11은 MRD이고, 상기 X17X18은 VR이고, 상기 X24X25는 RI 또는 PP이고, 상기 X27X28은 ST 또는 SV이고, 상기 X32X33은 RS 또는 RQ이고, X35는 Y임;
(iv) 상기 X9X10X11은 YML이고, 상기 X17X18은 VK이고, 상기 X24X25는 YP이고, 상기 X27X28은 QH이고, 상기 X32X33은 RS이고, X35는 F임; 또는
(v) 상기 X9X10X11은 INK이고, 상기 X17X18은 IS이고, 상기 X24X25는 KE이고, 상기 X27X28은 HH이고, 상기 X32X33은 HS이고, X35는 Y임.
본 발명의 일 구현예에 있어서, 상기 X35는 Y이다.
본 발명의 일 구현예에 있어서, X10은 R이다.
본 발명의 일 구현예에 있어서, X17은 V이다.
본 발명의 일 구현예에 있어서, X24는 P이다.
본 발명의 일 구현예에 있어서, 상기 항-HER2 어피바디는 서열번호 1 내지 8 중 어느 하나의 아미노산 서열을 포함한다.
상기 코티닌은 니코틴 대사의 주요 산물로, 하기 화학식 1의 구조를 갖는 물질을 말한다.
[화학식 1]
본 명세서에서 "스위치 분자(switch molecule)"는 상기 키메라 항원 수용체를 이용한 T 세포 치료제, 즉 CAR-T라고 불리는 세포치료제에 있어서, CAR의 타겟 인식 도메인과, CAR의 세포 시그널링 도메인을 분리하고, 이를 매개하는 어댑터 분자(adaptor molecule)를 의미한다. 스위치 분자는 Heterogenous target, 또는 resistant tumor에 대해서 CAR의 타겟을 교체하거나, CAR를 발현하는 세포의 과도한 활성화로 인해 부작용 발생시, 스위치 분자의 투여를 통한 CAR 세포의 활성 감소를 가능케 한다(Cao et al., Angew Chem Int Ed Engl. 2016 June 20; 55(26): 7520-7524.).
본 발명의 일 구현예에 있어서, 상기 효과기 세포의 활성화는 표적세포에 대한 세포독성, 사이토카인 분비, 및 이들의 조합이다.
본 발명의 일 구현예에 있어서, 상기 효과기 세포는 수지상 세포, 킬러 수지상 세포, 비만세포, 자연살해 세포, B 림프구, T 림프구, 대식세포 및 이들의 전구세포로 이루어진 군으로부터 선택되나, 이에 한정되는 것은 아니다.
본 발명에서 상기 스위치 분자를 구성하는 항-HER2 어피바디와 코티닌(cotinine)은 화학적 컨쥬게이션에 의해 결합된다.
상기 화학적 컨쥬게이션은 화학적 가교제에 의해 이루어질 수 있다. 상기 화학적 가교제로는 EDC (1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride), DCC (dicyclohexyl carbodiimide), NHS (N-hydroxysuccinimide), Sulfo-NHS (N-hydroxysulfosuccinimide), imidoester 계열 가교제, Sulfo-SMCC (sulfosuccinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate) 등이 있으나, 이에 한정되는 것은 아니며, 본 발명이 속하는 분야에서 통상적으로 사용되는 화학적 가교제를 제한없이 사용할 수 있다.
본 발명의 일 구현예에 있어서, 상기 스위치 분자를 구성하는 항-HER2 어피바디에는 코티닌이 1개 분자 이상, 2개 분자, 또는 3개 분자 이상 결합될 수 있다.
본 발명의 구체적인 구현예에 있어서, 상기 항-HER2 어피바디를 구성하는 폴리펩타이드의 N-말단, 또는 C-말단에 코티닌이 결합될 수 있다.
본 발명의 다른 구체적인 구현예에 있어서, 상기 항-HER2 어피바디를 구성하는 폴리펩타이드의 N-말단 및 C-말단 모두에 코티닌이 결합될 수 있다.
본 발명의 일 구현예에 있어서, 상기 스위치 분자를 구성하는 항-HER2 어피바디와 코티닌 직접적으로 연결되거나, 또는 링커를 통해 간접적으로 연결될 수 있다.
통상의 기술자라면, 융합 단백질의 제작시 보통 융합하고자 하는 기능적 일부분(moiety) 사이에 링커를 사용하는 것을 포함할 수 있으며, 서로 다른 특성을 가진 다른 종류의 링커, 예를 들어 유연성 아미노산 링커, 비유연성 링커 및 절단 가능한 아미노산 링커가 있다는 것을 알고 있을 것이다. 링커는 융합단백질의 발현량 증가, 생물학적 활성 향상, 타겟팅을 가능하게 하거나, 약동학을 변경시키기 위한 목적으로, 또는 융합단백질의 안정성을 증가시키고 폴딩(folding)을 향상시키기 위해 사용되어 왔다.
따라서 본 발명의 구체적인 구현예에 따르면, 상기 스위치 분자는 적어도 하나의 링커, 예컨대 유연성 아미노산 링커, 비유연성 링커 및 절단 가능한 아미노산 링커로부터 선택되는 적어도 하나의 링커를 포함할 수 있다. 본 발명의 구체적인 일 구현예에 있어서, 상기 링커는 상기 항-HER2 어피바디와 코티닌의 사이에 배열된다.
이 경우 상기 링커는 일반식 (GnSm)p 또는 (SmGn)p로 표시되는 아미노산 서열로 이루어질 수 있다:
여기에서 상기 n, m 및 p는 독립적으로,
n은 1 내지 7 범위의 정수이고;
m은 0 내지 7 범위의 정수이며;
n과 m의 합은 8 이하의 정수이고; 및
p는 1 내지 7 범위의 정수이다.
본 발명의 다른 구체적인 구현예에 따르면, 상기 링커는 n = 1 내지 5이고, m = 0 내지 5이다. 보다 구체적인 구현예의 경우, n = 4이고, m = 1이다. 보다 더 구체적인 구현예의 경우, 상기 링커는 (G4S)3 또는 (S4G)3 이다. 또 다른 구현예의 경우, 상기 링커는 GGGGS이다.
또 다른 구체적인 구현예의 경우, 상기 링커는 VDGS이다. 또 다른 구체적인 구현예의 경우, 상기 링커는 ASGS이다.
본 명세서에서, 상기 스위치 분자를 구성하는 항-HER2 어피바디를 비롯한 본 명세서에서 발현되는 폴리펩타이드 또는 융합단백질은 폴리펩타이드/융합단백질의 C-말단 및/또는 N-말단에 적어도 하나의 추가적인 아미노산을 포함할 수 있다. 상기의 추가적인 아미노산 잔기는 예를 들어, 생산성, 정제(purification), 생체 내 또는 생체 외에서의 안정화, 복합체의 커플링 또는 검출을 향상시키기 위한 목적으로 개별적 또는 집합적으로 추가될 수 있다. 예컨대 상기 폴리펩타이드 또는 융합단백질은 상기 폴리펩타이드 또는 융합단백질의 C-말단 및/또는 N-말단에 시스테인 잔기를 추가적으로 포함할 수 있다. 추가적인 아미노산 잔기는 정제 또는 폴리펩티드의 검출을 위한 "태그(tag)"를 제공할 수도 있으며, 예를 들어 그 태그는 그 태그와 특이적인 항체와의 상호작용을 위한 것이다. His6 태그의 경우 고정화된 금속 친화성 크로마토그래피(IMAC)를 위하여, His6 태그, (HisGlu)3 태그 ("HEHEHE" tag) 또는 "myc"(c-myc) 태그 또는 "FLAG" 태그와 같은 태그를 제공할 수 있다.
본 발명의 다른 일 양태에 따르면, 본 발명은 상술한 스위치 분자; 및 약제학적으로 허용되는 담체를 포함하는 면역치료용 약제학적 조성물을 제공한다.
본 명세서에서 "면역치료(immunotherapy)"란, 면역체계가 암을 제거하도록 돕는 암의 치료방법이다. 면역치료는 능동적 면역치료와 수동적 면역치료로 구분된다. 능동적 면역치료는 i) 암세포 또는 암세포에 의해 생성된 물질을 인체에 주입하여 면역체계를 활성화시키는 암 백신 치료(cancer vaccine therapy), ii) 사이토카인(인터페론, 인터류킨 등), 성장인자 등 면역조절제(immune-modulating agents)를 투여하여 특정 백혈구를 활성화시키는 면역조절 치료를 포함한다. 수동적 면역치료는 특정 암세포에 결합하는 치료적 항체(therapeutic antibody)와 면역세포치료(immune cell therapy)를 포함한다. 면역세포치료는 구체적으로 수지상세포 백신 치료(dendritic cell vaccine therapy)와 CAR-T(chimeric antigen receptor T cell) 치료, NK 세포 치료(natural killer cell therapy), CTL 치료(cytotoxic T lymphocyte therapy), 입양 세포 전이(adoptive cell transfer) 등을 포함하나, 이에 한정되는 것은 아니다. 본 발명에서 면역치료는 주로 상술한 면역세포치료를 의미한다.
본 발명의 스위치 분자는 HER2 항원에 특이적으로 결합하는 어피바디를 포함하는 바, 본 발명의 스위치 분자를 유효성분으로 포함하는 약제학적 조성물을 사용하여 치료할 수 있는 질환은 HER2를 발현하는 세포와 연관된 인간 및 포유동물의 질환이다. 구체적으로 상기 질환은 유방암, 위암, 난소암, 직결장암, 자궁내막암이나, 이에 한정되는 것은 아니다.
본 발명의 약제학적 조성물에 포함되는 약제학적으로 허용되는 담체는 제제시에 통상적으로 이용되는 것으로서, 락토스, 덱스트로스, 수크로스, 솔비톨, 만니톨, 전분, 아카시아 고무, 인산 칼슘, 알기네이트, 젤라틴, 규산 칼슘, 미세결정성 셀룰로스, 폴리비닐피롤리돈, 셀룰로스, 물, 시럽, 메틸 셀룰로스, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 활석, 스테아르산 마그네슘 및 미네랄 오일 등을 포함하나, 이에 한정되는 것은 아니다.
본 발명의 약제학적 조성물은 상기 성분들 이외에 윤활제, 습윤제, 감미제, 향미제, 유화제, 현탁제, 보존제 등을 추가로 포함할 수 있다. 적합한 약제학적으로 허용되는 담체 및 제제는 Remington's Pharmaceutical Sciences (19th ed., 1995)에 상세히 기재되어 있다.
본 발명의 약제학적 조성물은 경구 또는 비경구로 투여할 수 있고, 예컨대 정맥내 주입, 피하 주입, 피내 주입, 근육내 주입, 복강내 주입, 흉골 내 주입, 종양 내 주입, 국소 투여, 비내 투여, 뇌내 투여, 두개골 내 투여, 폐내 투여 및 직장내 투여 등으로 투여할 수 있으나 이에 한정되는 것은 아니다.
본 발명의 약제학적 조성물의 적합한 투여량은 제제화 방법, 투여방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 다양하며, 보통으로 숙련된 의사는 소망하는 치료 또는 예방에 효과적인 투여량을 용이하게 결정 및 처방할 수 있다. 본 발명의 바람직한 구현예에 따르면, 본 발명의 약제학적 조성물의 1일 투여량은 0.0001-100 ㎎/㎏이다. 본 명세서에서 용어 "약제학적 유효량"은 상술한 질환을 예방 또는 치료하는 데 충분한 양을 의미한다.
본 명세서에서 용어 "예방"은 질환 또는 질환 상태의 방지 또는 보호적인 치료를 의미한다. 본 명세서에서 용어 "치료"는 질환상태의 감소, 억제, 진정 또는 근절을 의미한다.
본 발명의 약제학적 조성물은 당해 발명이 속하는 기술분야에서 통상의 지식을 가진 자가 용이하게 실시할 수 있는 방법에 따라, 약제학적으로 허용되는 담체 및/또는 부형제를 이용하여 제제화 함으로써 단위 용량 형태로 제조되거나 또는 다용량 용기 내에 내입시켜 제조될 수 있다. 이때 제형은 오일 또는 수성 매질중의 용액, 현탁액 또는 유화액 형태이거나 엑스제, 산제, 좌제, 분말제, 과립제, 정제 또는 캅셀제 형태일 수도 있으며, 분산제 또는 안정화제를 추가적으로 포함할 수 있다.
본 발명의 약제학적 조성물은 또한 상술한 스위치 분자 이외에 다른 약제학적 활성 약제 또는 약물, 예를 들어, 아스파라기나제, 부설판, 카보플라틴, 시스플라틴, 다우노루비신, 독소루비신, 플루오로우라실, 겜시타빈, 하이드록시우레아, 메토트렉세이트, 파클리탁셀, 리툭시맙, 빈블라스틴, 빈크리스틴 등의 화학치료제를 포함할 수 있다.
본 발명의 다른 일 양태에 따르면, 본 발명은 다음을 포함하는 스위처블 키메라 항원 수용체를 제공한다:
(a) 상술한 코티닌이 결합된 항-HER2 어피바디를 포함하는 스위치 분자; 및
(b) 다음을 포함하는 키메라 항원 수용체:
i) 상기 스위치 분자를 표적화하는 항체 또는 그의 항원 결합 단편을 포함하는 세포외 도메인(extracellular domain);
ii) 막관통 도메인(transmembrane domain); 및
iii) 세포내 신호전달 도메인.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상술한 본 발명의 스위치 분자, 및 상기 본 발명의 스위치 분자를 표적화하는 키메라 항원 수용체를 포함하는 CAR-효과기 세포 치료적 시스템을 제공한다.
본 발명의 따른 CAR-효과기 세포 치료적 시스템을 이용하면, 특정 암세포의 표면 항원(e.g. HER2)에 특이적으로 결합하는 스위치 분자, 및 상기 스위치 분자를 표적화하는 키메라 항원 수용체를 발현하는 효과기 세포(e.g. T 세포, 수지상 세포, NK 세포)를 투여가 필요한 환자에게 투여하여 암(e.g. HER2 발현과 관련된 세포의 암)을 치료할 수 있다.
본 명세서에서, 용어 "키메라 항원 수용체(chimeric antigen receptor, CAR)"는 효과기 세포 신호전달 또는 효과기세포 활성화 도메인(e.g. T-세포 신호전달 또는 T-세포 활성화 도메인)에 연결된 타겟 결합 도메인(e.g. 단일쇄 가변 단편(scFv))을 포함하는 인공적으로 제작된 하이브리드 단백질(융합 단백질) 또는 폴리펩타이드이다. 키메라 항원 수용체는 일반적으로 단일클론항체의 항원-결합 성질을 이용하여 비-MHC-제한 방식으로, 선택된 표적에 대한 T-세포 특이성 및 반응성을 재유도하는 능력을 갖는다. 비-MHC-제한된 항원 인식은 CAR을 발현하는 T-세포에게 항원 처리와 무관하게 항원을 인식하는 능력을 제공하여, 종양 도피의 주요 메카니즘을 회피시킨다. 또한, CAR은 T-세포에서 발현될 때, 유리하게는 내재성 T-세포 수용체(TCR) 알파 및 베타 사슬과 이량체화되지 않는다.
본 발명의 키메라 항원 수용체는 스위처블 키메라 항원 수용체(switchable chimeric antigen receptor, sCAR)이다. 일반적인 종래의 클래식 키메라 항원 수용체(classical chimeric antigen receptor)의 세포외 도메인은 특정 항원(예컨대, HER2 항원, CD19 항원 등 종양관련항원(tumor associated antigen, TAA))을 표적화하는 항체 또는 항원결합단편을 포함한다. 그러나 본 발명의 키메라 항원 수용체의 세포외 도메인은 상술한 스위치 분자(구체적으로는 스위치 분자의 코티닌)를 표적화한다.
본 발명의 일 구현예에 있어서, 상기 i)의 항체 또는 그의 항원 결합 단편은 항-코티닌 항체 또는 그의 항원 결합 단편이다.
본 발명의 구체적인 구현예에 있어서, 상기 항-코티닌 항체 또는 그의 항원 결합 단편은 서열번호 9의 HCDR1, 서열번호 10의 HCDR2, 서열번호 11의 HCDR3, 서열번호 12의 LCDR1, 서열번호 13의 LCDR2, 서열번호 14의 LCDR3를 포함하는 것이나, 이에 한정되는 것은 아니다.
본 발명의 일 구현예에 있어서, 상기 막관통 도메인은 T-세포 수용체, CD27, CD28, CD3, 엡실론, CD45, CD4, CD5, CD8(CD8α), CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 및 CD154의 알파, 베타 또는 제타 사슬로 이루어진 군으로부터 선택된 단백질의 막관통 도메인인, 스위처블 키메라 항원 수용체.
본 발명의 일 구현예에 있어서, 상기 세포내 신호전달 도메인은 자극 분자, 보조자극 분자의 세포내 신호전달 도메인으로서, 상기 CAR가 발현되는 세포의 활성화를 담당한다.
상기 세포내 신호전달 도메인은 비제한적으로 TCR, CD3 제타, CD3 감마, CD3 델타, CD3 입실론, CD86, 통상적인 FcR 감마, FcR 베타 (Fc 입실론 R1b), CD79a, CD79b, Fc감마 RIIa, DAP10, DAP12, T 세포 수용체(TCR), CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, 림프구 기능-관련 항원-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, CD83과 특이적으로 결합하는 리간드, CDS, ICAM-1, GITR, BAFFR, HVEM(LIGHTR), SLAMF7, NKp80 (KLRF1), CD127, CD160, CD19, CD4, CD8알파, CD8베타, IL2R 베타, IL2R 감마, IL7R 알파, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96, CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, NKp44, NKp30, NKp46, NKG2D, 본 명세서에 기재된 다른 공동자극 분자, 이들의 임의의 유도체, 변이체 또는 단편, 동일한 기능상 능력을 갖는 공동자극 분자의 임의의 합성 서열, 및 이들의 임의의 조합을 포함한다.
본 발명의 구체적인 구현예에 있어서, 상기 세포내 신호전달 도메인은 CD3 제타) 사슬로부터 유래된 도메인이다.
본 발명의 구체적인 구현예에 있어서, 상기 CD3 제타 사슬로부터 유래한 세포내 신호전달 도메인은 서열번호 23의 염기서열에 의해 인코딩되는 아미노산 서열을 포함하는 것이다.
본 발명의 구체적인 구현예에 있어서, 상기 세포내 신호전달 도메인은 OX40 (CD134), CD2, CD27, CD28, CDS, ICAM-1, LFA-1(CD11a/CD18) 및 4-1BB (CD137)로 이루어진 군으로부터 선택된 공동자극 분자(costimulatory molecule)를 추가적으로 포함하는 것이다. 상기 세포내 신호전달 도메인은 상술한 도메인 외에도 당해 분야에서 공지된 다른 세포내 신호전달 분자로부터 수득되거나 유래될 수 있고, 세포내 신호전달 도메인이 유래되는 분자의 전체 또는 그의 단편을 포함할 수 있다.
본 발명의 키메라 항원 수용체의 막관통 도메인 및 세포내 신호전달 도메인은 상술한 구체적인 막관통 도메인 및 세포내 신호전달 도메인들 중 1 이상 선택된 조합으로 포함될 수 있다. 예를 들어 본 발명의 키메라 항원 수용체는 CD8 힌지 및 막관통 영역, CD137 세포질 영역 및 CD3ζ의 세포내 신호전달 도메인을 포함할 수 있다. 또 다른 예로 본 발명의 키메라 항원 수용체는 CD8α 막관통 도메인 및 CD28 및 CD3ζ의 세포내 신호전달 도메인을 포함할 수 있다.
본 발명의 일 구현예에 있어서, 상기 키메라 항원 수용체는 선행 서열 (leader sequence, LS)을 선택적으로 더 포함한다. 상기 선행 서열은 키메라 항원 수용체를 구성하는 재조합 폴리펩티드의 아미노-말단(N-terminal)에 위치한다. 상기 선행 서열은 키메라 항원 수용체의 세포내 프로세스 및 세포막으로 국재화(localization)되면서 항원 결합 도메인으로부터 임의로 절단된다.
본 발명의 구체적인 구현예에 있어서, 상기 선행서열은 서열번호 20의 염기서열로 인코딩되는 아미노산 서열을 포함하는 선행서열이다.
본 발명의 키메라 항원 수용체의 상기 HER2 결합 도메인은 힌지 도메인(또는 스페이서)에 의해 상기 막관통 도메인에 연결된다.
본 발명의 다른 구현예에 따르면, 상기 힌지 도메인은 IgG1, IgG2, IgG4, 또는 IgD에서 유래한 힌지, CD8 또는 CD28에서 유래한 힌지, CD28에서 유래한 세포외 도메인(ECD) 또는 이들의 조합이다.
본 발명의 구체적인 구현예에 있어서, 상기 힌지 도메인 및 막관통 도메인은 서열번호 21의 염기서열에 의해 인코딩되는 아미노산 서열을 포함한다.
본 명세서에서, 용어 “항체(antibody)"는 특정 항원에 특이적으로 결합하는 항체로서, 완전한 항체 형태뿐만 아니라 항체 분자의 항원 결합 단편(antigen binding fragment)을 포함한다. 완전한 항체는 2개의 전체 길이의 경쇄 및 2개의 전체 길이의 중쇄를 가지는 구조이며 각각의 경쇄는 중쇄와 다이설파이드 결합으로 연결되어 있다. 중쇄 불변 영역은 감마(γ), 뮤(μ), 알파(α), 델타(δ) 및 엡실론(ε) 타입을 가지고 서브클래스로 감마1(γ1), 감마2(γ2), 감마3(γ3), 감마4(γ4), 알파1(α1) 및 알파2(α2)를 가진다. 경쇄의 불변영역은 카파(kappa) 및 람다(lambda) 타입을 가진다 (Cellular and Molecular Immunology, Wonsiewicz, M. J., Ed., Chapter 45, pp. 41-50, W. B. Saunders Co. Philadelphia, PA(1991); Nisonoff, A., Introduction to Molecular Immunology, 2nd Ed., Chapter 4,pp. 45-65, sinauer Associates, Inc., Sunderland, MA (1984)).
본 명세서에서, 상기 항체는 단일클론항체, 다클론항체, 합성 항체, 인간 항체, 인간화 항체, 단일 도메인 항체, 및 단쇄 가변 단편으로 이루어진 군으로부터 선택된 항체를 포함한다.
본 명세서에서, 용어 "항원 결합 단편(antigen binding fragment)"은 항원 결합 기능을 보유하고 있는 단편을 의미하며, Fab, F(ab'), F(ab')2 및 Fv 등을 포함한다. 항체 단편 중 Fab(fragment antigen binding)는 경쇄 및 중쇄의 가변영역과 경쇄의 불변 영역 및 중쇄의 첫 번째 불변 영역(CH1)을 가지는 구조로 1개의 항원 결합 부위를 가진다. Fab'는 중쇄 CH1 도메인의 C-말단에 하나 이상의 시스테인 잔기를 포함하는 힌지 영역(hinge region)을 가진다는 점에서 Fab와 차이가 있다. F(ab')2 항체는 Fab'의 힌지 영역의 시스테인 잔기가 다이설파이드 결합을 이루면서 생성된다. Fv는 중쇄 가변부위 및 경쇄 가변부위만을 가지고 있는 최소의 항체조각으로서, Fv 단편을 생성하는 재조합 기술은 PCT 국제 공개특허출원 WO 88/10649, WO 88/106630, WO 88/07085, WO 88/07086 및 WO 88/09344에 개시되어 있다. 이중쇄 Fv(two-chain Fv)는 비공유 결합으로 중쇄 가변부위와 경쇄 가변부위가 연결되어 있고 단쇄 Fv(single-chain variable fragment, scFv)는 일반적으로 펩타이드 링커를 통하여 중쇄의 가변 영역과 단쇄의 가변 영역이 공유 결합으로 연결되거나 또는 C-말단에서 바로 연결되어 있어서 이중쇄 Fv와 같이 다이머와 같은 구조를 이룰 수 있다. 이러한 항체 단편은 단백질 가수분해 효소를 이용해서 얻거나(예를 들어, 전체 항체를 파파인으로 제한 절단하면 Fab를 얻을 수 있고, 펩신으로 절단하면 F(ab')2 단편을 얻을 수 있다), 또는 유전자 재조합 기술을 통하여 제작할 수 있다.
본 명세서에서, 용어 "중쇄"는 항원에 특이성을 부여하기 위한 충분한 가변 영역 서열을 갖는 아미노산 서열을 포함하는 항체의 가변 영역 도메인 VH 및 3개의 불변 영역 도메인 CH1, CH2 및 CH3를 포함하는 전체길이 중쇄 및 이의 단편을 모두 의미한다. 또한 본 명세서에서 용어 "경쇄"는 항원에 특이성을 부여하기 위한 충분한 가변영역 서열을 갖는 아미노산 서열을 포함하는 항체의 가변 영역 도메인 VL 및 불변 영역 도메인 CL을 포함하는 전체길이 경쇄 및 이의 단편을 모두 의미한다.
본 명세서에서, 용어 "CDR(complementarity determining region)"은 면역글로블린 중쇄 및 경쇄의 고가변 영역(hypervariable region)의 아미노산서열을 의미한다 (Kabat et al., Sequences of Proteins of Immunological Interest, 4th Ed., U.S. Department of Health and Human Services, National Institutes of Health (1987)). 중쇄(CDRH1, CDRH2 및 CDRH3) 및 경쇄(CDRL1, CDRL2 및 CDRL3)에는 각각 3개의 CDRs이 포함되어 있다. CDR은 항체가 항원 또는 에피토프에 결합하는 데 있어서 주요한 접촉 잔기를 제공한다.
본 명세서에서 용어 "인간화 항체"란, 비-인간(예를 들어 쥐) 항체의 비-인간 면역글로불린으로부터 유래된 최소 서열을 함유하는 키메릭 면역글로불린, 그의 면역글로불린 쇄 또는 단편(예를 들어 Fv, Fab, Fab', F(ab')2 또는 항체의 다른 항원-결합 하위서열)이다. 대부분의 경우에, 인간화된 항체는 수용자의 상보성-결정 영역(CDR)의 잔기가, 목적하는 특이성, 친화성 및 능력을 갖는 비-인간 종(공여자 항체), 예를 들어 마우스, 래트 또는 토끼의 CDR의 잔기에 의해 대체된 인간 면역글로불린(수용자 항체)이다. 일부의 경우에, 상기 인간 면역글로불린의 Fv 프레임워크 영역(FR) 잔기는 상응하는 비-인간 잔기에 의해 대체된다. 또한, 인간화된 항체는 수용자 항체에서도 또는 수입된 CDR 또는 프레임워크 서열에서도 발견되지 않는 잔기를 포함할 수 있다. 이러한 변형은 항체 성능을 추가로 개선 및 최적화하기 위해 이루어진다. 일반적으로, 상기 인간화된 항체는 적어도 하나, 및 전형적으로 2개의 실질적으로 모든 가변 도메인을 포함할 것이며, 상기 도메인에서 상기 CDR 영역의 전부 또는 실질적 전부는 비-인간 면역글로불린의 CDR 영역에 상응하고, 상기 FR 영역의 전부 또는 실질적 전부는 인간 면역글로불린의 FR 영역의 서열을 가진다. 상기 인간화된 항체는 면역글로불린 불변 영역(Fc region)의 적어도 일부 내지 실질적인 인간 면역글로불린의 불변 영역(Fc region)서열을 포함한다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상기 키메라 항원 수용체 폴리펩타이드를 인코딩하는 뉴클레오타이드 서열을 포함하는 핵산 분자를 제공한다.
본 발명의 또 다른 양태에 따르면, 본 발명은 상기 키메라 항원 수용체 폴리펩타이드를 인코딩하는 핵산 분자를 포함하는 재조합 벡터를 제공한다.
본 명세서에서 용어 "벡터"는 전달 벡터와 발현 벡터를 포함한다.
본 명세서에서 용어 "전달 벡터"는 단리된 핵산을 포함하고 단리된 핵산을 세포 내부로 전달하는데 사용될 수 있는 물질의 조성을 지칭한다. 선형 폴리뉴클레오티드, 이온성 또는 양친매성 화합물과 연결된 폴리뉴클레오티드, 플라스미드 및 바이러스를 포함하나, 이에 한정되는 것은 아니다. 보다 구체적으로 상기 전달 벡터는 자가 복제성 플라스미드 또는 바이러스를 포함한다. 상기 용어는 세포 내로의 핵산의 전이를 촉진시키는 비-플라스미드 및 비-바이러스성 화합물, 예컨대 폴리리신 화합물, 리포솜 등을 추가적으로 포함할 수 있는 것으로 해석되어야 한다. 바이러스성 전달 벡터는 아데노 바이러스 벡터, 아데노-연관 바이러스 벡터, 레트로바이러스 벡터, 렌티바이러스 벡터를 포함하나, 이에 한정되는 것은 아니다.
본 발명의 일 구현예에 있어서, 상기 벡터는 렌티바이러스 벡터이다. 본발명의 구체적인 일 구현예에 있어서, 상기 벡터는 프로모터를 추가로 포함한다. 상기 프로모터는 예컨대 EF-1alpha 프로모터일 수 있으나, 이에 한정되는 것은 아니다.
본 발명의 구체적인 구현예에 있어서, 상기 EF-1alpha 프로모터는 서열번호 19의 염기서열을 포함한다.
본 발명의 다른 일 구현예에 있어서, 상기 벡터는 레트로바이러스 벡터일 수 있다. 레트로바이러스는 유전자 전달 시스템을 위한 편리한 플랫폼을 제공한다. 유전자 전달을 위해 선택된 유전자는 레트로바이러스 벡터 내에 삽입되고, 레트로바이러스 입자 내에 패키징될 수 있다. 이어서 재조합된 레트로바이러스는 인 비보, 또는 인 비트로에서 목적하는 숙주 세포로 전달될 수 있다. 많은 레트로바이러스 벡터가 관련 기술분야에 알려져 있다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상기 키메라 항원 수용체를 발현하는 효과기 세포(effector cell)를 제공한다. 상기 키메라 항원 수용체는 상술한 스위치 분자를 표적화한다.
본 발명의 일 구현예에 따르면, 상기 효과기 세포는 수지상 세포, 킬러 수지상 세포, 비만세포, 자연살해 세포, B 림프구, T 림프구, 대식세포 및 이들의 전구세포로 이루어진 군으로부터 선택된다.
본 발명의 구체적인 구현예에 따르면, 상기 T 림프구는 염증성 T 림프구, 세포독성 T 림프구, 조절 T 림프구 또는 헬퍼 T 림프구로 이루어진 군으로부터 선택될 수 있다.
본 발명에서 상기 효과기 세포는 자가 세포 또는 동종이형 세포의 집단을 포함한다. 즉, 상기 효과기 세포는 본 발명의 키메라 항원 수용체를 발현하는 자가 세포 또는 동종이형 세포의 집단을 포함한다.
본 명세서에서, 용어 "자가"는 개체에게 재도입될 예정인, 동일한 개체로부터 유래된 임의의 물질을 나타낸다. 본 명세서에서, 용어 "동종"은 물질이 도입되는 개체와 동일한 종의 상이한 동물로부터 유래된 임의의 물질을 나타낸다.
또한, 본 발명의 일 구현예에 따르면, 상기 효과기 세포는 본 발명의 키메라 항원 수용체를 인코딩하는 핵산 분자를 포함하는 벡터로 형질감염 또는 형질 도입된 세포의 집단을 포함한다. 상기 형질 감염 또는 형질 도입은 상술한 바와 같이 당업계에 알려진 다양한 수단에 의해 제한없이 이루어질 수 있다.
따라서, 본 발명의 구체적인 구현예에 따르면 본 발명의 효과기 세포, 예컨대 T 림프구, 또는 자연살해 세포로 전달되고, 본 발명의 키메라 항원 수용체를 인코딩하는 핵산 분자는 mRNA로 전사되며, 상기 mRNA로부터 키메라 항원 수용체가 번역되어 효과기 세포의 표면에 발현된다.
본 발명의 실시예에서 입증된 바와 같이, 본 발명의 코티닌과 결합된 항-HER2 어피바디를 포함하는 스위치 분자 및 상기 스위치 분자의 코티닌을 표적화하는 키메라 항원 수용체를 발현하는 효과기 세포는 표면에 HER2를 발현하는 암세포주인 SKOV3(난소암 세포주)를 효과적으로 사멸시킨다. 따라서, 본 발명의 항-HER2 스위치 분자 및 상기 스위치 분자를 표적화하는 키메라 항원 수용체를 발현하는 효과기 세포는 HER2를 발현하는 암종에 대한 치료용 약제학적 조성물의 유효성분으로서 유용하게 사용될 수 있다.
본 발명의 약제학적 조성물은 상술한 CAR-발현 효과기 세포, 예를 들어 복수의 CAR-발현 효과기 세포를 하나 이상의 제약상 또는 생리학상 허용되는 담체, 희석제 또는 부형제와 조합으로 포함할 수 있다. 상기 약제학적 조성물은 완충제, 예컨대 중성 완충 염수, 포스페이트 완충 염수 등; 탄수화물, 예컨대 글루코스, 만노스, 수크로스 또는 덱스트란, 만니톨; 단백질; 폴리펩티드 또는 아미노산, 예컨대 글리신; 항산화제; 킬레이팅제, 예컨대 EDTA 또는 글루타티온; 어주번트 (예를 들어, 수산화알루미늄); 및 방부제를 포함할 수 있다. 본 발명의 일 구현예에 있어서, 상기 약제학적 조성물은 정맥내 투여를 위해 제제화된다.
본 발명의 약제학적 조성물은 경구 또는 비경구로 투여할 수 있고, 예컨대 정맥내 투여, 피하 투여, 피내 투여, 근육내 투여, 복강내 투여, 종양 내 투여, 뇌내 투여, 두개골 내 투여, 폐내 투여 및 직장내 투여 등으로 투여할 수 있으나 이에 한정되는 것은 아니다.
본 발명의 효과기 세포를 포함하는 약제학적 조성물은 피부내 또는 피하 주사에 의해 환자에게 투여된다. 일 구현예에 있어서, 본 발명의 약제학적 조성물은 정맥내 주사에 의해 투여된다. 다른 구현예에 있어서, 본 발명의 약제학적 조성물은 종양, 림프절, 또는 감염 부위 내로 직접 투여될 수 있다.
본 발명을 필요로 하는 대상체는 고용량 화학요법을 이용한 표준 치료를 받을 수 있다. 본 발명의 일 구현예에 있어서, 본 발명을 필요로 하는 대상체는 상기 화학요법 이후에 또는 화학요법과 동시에, 본 발명의 증식된 CAR-T 세포를 투여받을 수 있다. 다른 일 구현예에 있어서, 증식된 CAR-T 세포는 수술 이전 또는 수술 이후에 투여된다.
본 발명의 약제학적 조성물의 "면역학적 유효량", "항종양 유효량", "종양-억제 유효량", 또는 "치료량"에 적합한 투여량은 제제화 방법, 투여방식, 환자의 연령, 체중, 성, 병적 상태, 음식, 투여 시간, 투여 경로, 배설 속도 및 반응 감응성과 같은 요인들에 의해 결정되며, 보통으로 숙련된 의사는 소망하는 치료 또는 예방에 효과적인 투여량을 용이하게 결정 및 처방할 수 있으며, 적절한 투여량은 임상 시험에 의해 결정될 것이다. 본 명세서에서 용어 “치료”는 질환상태의 감소, 억제, 진정 또는 근절을 의미한다. 본 명세서에서 용어 "항종양"은 종양 부피의 감소, 종양 세포 수의 감소, 전이의 수의 감소, 기대 수명의 증가, 종양 세포 증식의 감소, 종양 세포 생존의 감소, 또는 암적 병태와 연관된 다양한 생리학적 증상의 개선을 포함하나 이에 제한되지는 않는다.
본원에 기재된 T 세포를 포함하는 약제학적 조성물은 104 내지 109 세포/kg 체중, 몇몇 경우에 105 내지 106 세포/kg 체중 (상기 범위 내의 모든 정수 값 포함)의 투여량으로 투여될 수 있는 것으로 일반적으로 언급될 수 있다. T 세포 조성물은 또한 이들 투여량으로 다수의 횟수로 투여할 수 있다. 세포는 면역요법에서 일반적으로 알려진 주입 기술을 이용하여 투여할 수 있다 (예를 들어 [Rosenberg et al., New Eng. J. of Med. 319:1676, 1988] 참조).
본 발명의 약제학적 조성물은 또한 상술한 유효성분 이외에 다른 약제학적 활성 약제 및 요법과 조합하여 사용될 수 있다. 상기 "조합"은 동시 또는 병용투여로 표현될 수 있다. 본원에 기재된 CAR-발현 효과기 세포 및 적어도 하나의 추가의 치료제는 동시에, 동일한 조성물 내에 또는 별개의 조성물 내에, 또는 순차적으로 투여될 수 있다. 순차적인 투여를 위해, 본원에 기재된 CAR-발현 효과기 세포가 먼저 투여될 수 있고 추가의 작용제는 두 번째로 투여될 수 있거나, 투여 순서가 역전될 수 있다.
상기 본 발명의 약제학적 조성물과 조합하여 사용될 수 있는 치료제로는 당업계에 공지된 1 이상의 화학치료제(예컨대 아스파라기나제, 부설판, 카보플라틴, 시스플라틴, 다우노루비신, 독소루비신, 플루오로우라실, 겜시타빈, 하이드록시우레아, 메토트렉세이트, 파클리탁셀, 리툭시맙, 빈블라스틴, 빈크리스틴 등), 1 이상의 표적치료제(예컨대 베바시주맙(bevacizumab), 올라파립(olaparib) 등), PD-1/PD-L1 특이적인 면역관문 억제제(예컨대 옵디보, 키트루다)가 있으나, 이에 한정되는 것은 아니다.
본 발명의 또 다른 일 양태에 따르면, 본 발명은 상기의 키메라 항원 수용체를 발현하는 효과기 세포; 및 상기 키메라 항원 수용체와 결합하는 스위치 분자를 치료가 필요한 대상체에 투여하는 단계를 포함하는 HER2 발현과 관련된 질환의 치료방법을 제공한다.
CAR-T를 이용한 종양 또는 암과 관련된 질환의 치료 도중, 암 세포의 세포표면 분자에 돌연변이가 생기는 경우(e.g. HER2 항원의 변이)에는 기존의 CAR가 돌연변이가 발생한 암 세포를 인식하지 못하므로 치료효과가 감소되거나, 치료가 불가하다. 이 경우, 돌연변이가 발생한 세포의 표면 분자를 표적화하는 신규한 스위치 분자를 대상체에 추가적으로 투여하면 먼저 투여된 스위치 분자를 대체하여 지속적인 암의 치료효과를 기대할 수 있을 것이다.
또한, 본 발명의 다른 양태에 따르면, 본 발명은 (a) 상술한 키메라 항원 수용체를 발현하는 효과기 세포(CAR-effector cell) 및 상기 키메라 항원 수용체와 결합하는 본 발명의 스위치 분자를 치료가 필요한 대상체에 투여하는 단계; 및 (b) 대상체에 먼저 투여된 스위치 분자와 상이한 표적세포의 세포표면 분자와 결합하는 1 이상의 스위치 분자(e.g. cotinine-conjugated anti-EGFR), 또는 표적화 모이어티가 없는 스위치 분자(e.g. cotinine only)를 대상체에 추가적으로 투여하는 단계를 포함하는 대상체 내 CAR-효과기 세포의 활성을 억제하는 방법을 제공한다.
CAR-T를 이용한 종양 또는 암과 관련된 질병 또는 상태의 치료 도중, CAR-T 세포의 활성화가 과도해지는 경우 종양 용해 증후군 (tumor lysis syndrome, TLS), 사이토카인 방출 증후군 (cytokine release syndrome, CRS) 등의 합병증이 발생할 수 있으며, 이는 환자에게 치명적이다. 본 발명의 스위치 분자를 이용하는 CAR-효과기 세포 치료 시스템을 이용하는 경우, CAR를 발현하는 효과기 세포가 직접적으로 암 세포의 세포표면 분자를 인식하지 않고, CAR가 표적화 하는 스위치 분자를 통하여 간접적으로 인식한다. 따라서 대상체에 먼저 투여된 스위치 분자와 상이한 표적세포의 세포표면 분자와 결합하는 1 이상의 스위치 분자, 또는 표적화 모이어티가 없는 키메라 항원 수용체에 결합하는 스위치 분자를 대상체에 추가적으로 투여하면 CAR가 더 이상 기존의 암세포를 표적화하지 못하고, 이것에 의해 CAR-T 세포의 과도한 활성을 억제할 수 있다.
본 발명은 항-HER2 어피바디 및 코티닌이 결합된 항-HER2 어피바디를 포함하는 스위치 분자를 제공한다. 본 발명의 항-HER2 어피바디는 코티닌이 결합되었을 때, Cot-sCART와 함께 처리되는 경우 HER2를 발현하는 양성 세포주에 반응하여 면역세포 활성을 유도하므로 sCART 치료제의 스위치 분자로서 유용하게 사용할 수 있다.
도1은 HER2에 특이적으로 결합하는 어피바디를 periplasmic extract 형태로 확인한 도이다.
도2는 3종의 HER2 발현세포를 대상으로 HER2에 결합하는 어피바디들의 세포 결합 능력을 확인하고, MFI 값을 그래프화 한 도이다(A. NCI-N87, B. SK-OV-3, C. MDA-MB-231).
도3은 HER2에 결합하는 5종의 어피바디를 Fc 결합 형태로 생산하여, HER2 단백질의 결합 정도를 정량적으로 비교 확인한 도이다.
도4는 HER2에 결합하는 5종의 어피바디를 Fc 결합 형태로 생산하여, HER2 발현세포 4종의 세포에 대한 결합 정도를 정량적으로 분석한 도이다(A. NCI-N87, B. SK-OV-3, C. MDA-MB-453, D. MDA-MB-231).
도 5는 코티닌이 결합된 어피바디 5종의 HER2 단백질 결합 정도를 정량적으로 확인한 도이다.
도 6은 HER2 양성 세포인 SK-OV-3와 HER2 음성 세포인 Raji 세포에 대해 코티닌이 결합된 어피바디와 항 코티닌 항체를 이용한 키메릭항원수용체 T세포(Cot-sCART)의 세포독성효과를 측정한 도이다.
도 7은 면역결핍 마우스(NSG)에 SKOV3-Luc세포주로 질환모델을 형성한 후, 해당 모델에 대한 코티닌이 결합된 어피바디와 Cot-sCART의 효능을 측정한 도이다(A. Luminescence 측정 이미지, B. Luminescence signal 정량 자료).
도 8는 SKOV3-Luc 세포주로 형성된 질환모델에 대한 코티닌이 결합된 어피바디와 Cot-sCART의 효능 평가에서 코티닌이 결합된 어피바디의 농도에 따른 효능을 확인한 도이다(A. Luminescence 측정 이미지, B. Luminescence signal 정량 자료).
도9은 친화도가 향상된 클론들을 Fc결합 형태로 생산하여, HER2 단백질의 결합 정도를 정량적으로 비교 확인한 도이다.
도10은 코티닌이 결합된 최적화된 어피바디들의 HER2 단백질 결합 정도를 정량적으로 확인한 도이다.
도 11는 코티닌이 결합된 최적화된 어피바디들의 HER2 발현세포인 SK-OV-3에 대한 결합능을 측정한 도이다.
도 12은 HER2 양성 세포인 SK-OV-3에 대해 코티닌이 결합된 최적화된 어피바디와 Cot-sCART의 세포독성효과를 측정한 도이다.
도2는 3종의 HER2 발현세포를 대상으로 HER2에 결합하는 어피바디들의 세포 결합 능력을 확인하고, MFI 값을 그래프화 한 도이다(A. NCI-N87, B. SK-OV-3, C. MDA-MB-231).
도3은 HER2에 결합하는 5종의 어피바디를 Fc 결합 형태로 생산하여, HER2 단백질의 결합 정도를 정량적으로 비교 확인한 도이다.
도4는 HER2에 결합하는 5종의 어피바디를 Fc 결합 형태로 생산하여, HER2 발현세포 4종의 세포에 대한 결합 정도를 정량적으로 분석한 도이다(A. NCI-N87, B. SK-OV-3, C. MDA-MB-453, D. MDA-MB-231).
도 5는 코티닌이 결합된 어피바디 5종의 HER2 단백질 결합 정도를 정량적으로 확인한 도이다.
도 6은 HER2 양성 세포인 SK-OV-3와 HER2 음성 세포인 Raji 세포에 대해 코티닌이 결합된 어피바디와 항 코티닌 항체를 이용한 키메릭항원수용체 T세포(Cot-sCART)의 세포독성효과를 측정한 도이다.
도 7은 면역결핍 마우스(NSG)에 SKOV3-Luc세포주로 질환모델을 형성한 후, 해당 모델에 대한 코티닌이 결합된 어피바디와 Cot-sCART의 효능을 측정한 도이다(A. Luminescence 측정 이미지, B. Luminescence signal 정량 자료).
도 8는 SKOV3-Luc 세포주로 형성된 질환모델에 대한 코티닌이 결합된 어피바디와 Cot-sCART의 효능 평가에서 코티닌이 결합된 어피바디의 농도에 따른 효능을 확인한 도이다(A. Luminescence 측정 이미지, B. Luminescence signal 정량 자료).
도9은 친화도가 향상된 클론들을 Fc결합 형태로 생산하여, HER2 단백질의 결합 정도를 정량적으로 비교 확인한 도이다.
도10은 코티닌이 결합된 최적화된 어피바디들의 HER2 단백질 결합 정도를 정량적으로 확인한 도이다.
도 11는 코티닌이 결합된 최적화된 어피바디들의 HER2 발현세포인 SK-OV-3에 대한 결합능을 측정한 도이다.
도 12은 HER2 양성 세포인 SK-OV-3에 대해 코티닌이 결합된 최적화된 어피바디와 Cot-sCART의 세포독성효과를 측정한 도이다.
이하, 실시예를 통하여 본 발명을 더욱 상세히 설명하고자 한다. 이들 실시예는 오로지 본 발명을 보다 구체적으로 설명하기 위한 것으로, 본 발명의 요지에 따라 본 발명의 범위가 이들 실시예에 의해 제한되지 않는다는 것은 당업계에서 통상의 지식을 가진 자에 있어서 자명할 것이다.
실시예
본 명세서 전체에 걸쳐, 특정 물질의 농도를 나타내기 위하여 사용되는 "%"는 별도의 언급이 없는 경우, 고체/고체는 (중량/중량) %, 고체/액체는 (중량/부피) %, 그리고 액체/액체는 (부피/부피) %이다.
실시예
1.
HER2에
대한
어피바디
(
Affibody
) 개발
실시예
1-1. Panning을 통한
어피바디의
선별
HER2-ECD-Fc 단백질을 이용하여 어피바디 library에서 panning을 통해 HER2에 특이적으로 결합하는 클론들을 선별하였다. 또한 HER2를 발현하는 세포에 결합하는 클론들을 확인하여 5종의 어피바디를 선별하였다.
어피바디 library는 VSCM13 helper phage를 이용하여 Phage 형태로 rescue를 하여 Panning에 사용하였다. 처음 항원에 결합시키는 library phage의 수는 1013개 이상으로 사용하였고, 4회의 panning round를 거쳐 진행하였다. Affinity가 높은 phage를 선택적으로 선별하는 전략으로 panning round가 늘어감에 따라 항원양은 줄이고(10 μg, 5 μg, 2 μg, 1 μg), wash횟수 (3회, 5회, 7회, 10회) 는 늘이는 방법을 적용하였다.
Panning의 각 round에서 얻은 binder phage는 ER2537에 infection 시켜 얻은 colony를 ELISA 방법으로 항원에 대한 결합여부를 확인하였다. Binder phage를 infection 시켜 얻은 colony를 SB media(MOPS 10 g/L, Bacto YEAST extract 20 g/L, Trypton 30 g/L)에 접종 한 다음 OD600에서 0.8이 될 때까지 배앙한 후, 1 mM IPTG(엘피에스솔루션, IPTG025)를 넣고 30℃에서 shaking incubation하여 어피바디가 과발현 되도록 하였다. BBS buffer(200 mM Boric acid, 150 mM NaCl, 1 mM EDTA)를 이용하여 periplasmic extraction을 진행 하고, 이를 이용하여 ELISA 방법을 통해 binder를 screening 하였다. ELISA는 2 μg/mL의 농도로 HER1-ECD-Fc, HER2-ECD-Fc, HER3-ECD-Fc, HER4-ECD-Fc 단백질이 coating된 plate에 어피바디 periplasmic extract를 처리하였으며, 2차항체(anti-HA-HRP(Roche, 12013819001))를 처리한 후 TMB(biofx, TMBC-1000-01)로 발색반응을 발생시켜 ELISA 리더기 (Perkinelmer, Victor3)를 이용하여 OD450 값을 측정하였다(도 1). ELISA 결과 HER2 단백질에 특이적으로 결합하는 어피바디를 확인하였고, sequence를 확인한 결과, 23종의 unique clone을 확인하였다.
Unique한 clone들의 periplasmic extract를 이용하여, HER2 발현 세포 3종 - NCI-N87 (ATCC, CRL-5822), SK-OV-3 (한국세포주은행, 30077), MDA-MB-231 (한국세포주은행, 30026)을 이용하여 cell binder를 확인한다. 3종의 HER2 발현세포들을 5 x 105 cells/tube로 준비한 다음 1200 rpm으로 3분 원심 분리하여 cell을 모으고, 5% FBS 포함 PBS로 wash 한 후, 어피바디가 포함된 periplasmic extract를 200 μL 처리하고 4℃에서 1시간 incubation 한다. 200 μL의 5 % FBS 포함 PBS를 이용하여 1200 rpm에서 3분동안 원심 분리하는 방법으로 cell을 3회 wash하였다. 그 다음 anti-HA-FITC (Life Technologies, A11013)를 1 μg/mL로 cell에 처리하고 빛을 차단한 채로 4℃에서 45분간 incubation 하였다. 200 uL의 5 % FBS 포함 PBS를 이용하여 1200 rpm에서 3분동안 원심 분리하는 방법으로 cell을 3회 wash 한 후, FACS 기기(Beckmann coulter, FC500)를 이용하여 형광의 세기를 측정하였다(도 2a 내지 2c). ELISA와 cell binding test를 통해 결합능이 우수한 5종의 어피바디(ZQAA1, 7, 8, 11, 22)를 선별하였다(표 1).
명칭 | 서열 | 서열 번호 |
ZQAA1 | VDNKFNKELRVAYWEIVKLPNLNPYQSRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK | 1 |
ZQAA7 | VDNKFNKELRGAYWEITSLPNLNHSQITAFIVSLYDDPSQSANLLAEAKKLNDAQAPK | 2 |
ZQAA8 | VDNKFNKEMRDAYWEIVRLPNLNPPQSTAFIRSLYDDPSQSANLLAEAKKLNDAQAPK | 3 |
ZQAA11 | VDNKFNKEYMLAYWEIVKLPNLNYPQQHAFIRSLFDDPSQSANLLAEAKKLNDAQAPK | 4 |
ZQAA22 | VDNKFNKEINKAYWEIISLPNLNKEQHHAFIHSLYDDPSQSANLLAEAKKLNDAQAPK | 5 |
실시예
1-2. 선별된
어피바디의
결합능
확인
선별된 5종의 어피바디를 Fc 결합 형태(Zb-Fc)로 cloning 하여, HER2 단백질의 결합과 HER2 발현 세포의 결합 정도를 확인한다. ELISA는 2 μg/mL의 농도로 hHER2-ECD-His 단백질이 coating 된 plate에 정제된 Zb-Fc 5종을 60 nM부터 1/5 dilution 하여 7 point 로 처리하였으며, 2차항체 (anti-hIgG-Fc-HRP(Invitrogen, H10007))를 처리한 후 TMB로 발색반응을 발생시켜 ELISA 리더기를 이용하여 OD450 값을 측정하였고, Graph prism을 통해 EC50 값을 구하였다(도 3, 표 2).
구분 | ZQAA1 | ZQAA7 | ZQAA8 | ZQAA11 | ZQAA22 |
EC50 (nM) | 3.6 | 68.5 | 1.8 | 6.9 | N/D |
어피바디의 HER2 발현세포에서 결합 정도를 확인하기 위해, HER2 발현이 높은 순으로 NCI-N87, SK-OV-3, MDA-MB-453(한국세포주은행, 30131), MDA-MB-231 4종의 세포를 5 x 105 cells/tube 로 준비한 다음 1200rpm으로 3분 원심 분리하여 cell을 모으고, 5% FBS 포함 PBS로 wash 한 후, Zb-Fc 5종을 60 nM부터 1/5 dilution 하여 7 point 로 처리하고 4℃에서 1시간 incubation 하였다. 200 μL의 5 % FBS 포함 PBS를 이용하여 1200 rpm에서 3분동안 원심 분리하는 방법으로 cell을 3회 wash하였다. 그 다음 anti-human-Fc-FITC(Life Technologies, A11013)를 1μg/mL로 cell에 처리하고 빛을 차단한 채로 4℃에서 45분간 incubation 하였다. 200 μL의 5 % FBS 포함 PBS를 이용하여 1200 rpm에서 3분동안 원심 분리하는 방법으로 cell을 3회 wash 한 후, FACS 기기를 이용하여 형광의 세기를 측정하였다. 측정된 MFI값을 Graph prism을 통해 EC50 값을 구하였다(도 4a 내지 4d, 표 3).
EC50 (nM) | ZQAA1 | ZQAA7 | ZQAA8 | ZQAA11 | ZQAA22 |
NCI-N87 | 3.3 | 2.4 | 5.7 | 7.3 | 5.4 |
SK-OV3 | 2.7 | 1.9 | 6.2 | 14.8 | 8.3 |
MDA-MB-453 | 2.5 | 3.0 | 8.0 | 52.4 | 26.6 |
MDA-MB-231 | 2.3 | 7.1 | 5.6 | N/D | N/D |
실시예
2.
코티닌이
결합된
어피바디
개발 및 이의 활성 확인
실시예
2-1.
코티닌이
결합된
어피바디의
제조
본 발명의 항-HER2 어피바디를 항스위처블 CAR 시스템의 스위치 분자로 사용하기 위하여, 코티닌이 결합된 어피바디-코티닌 복합체(Switch molecule, 스위치 분자)를 합성하였다(표 4).
명칭 | 서열 |
Cot-ZQAA1-Cot | trans-4-Cotinine carboxylic acid-VDNKFNKELRVAYWEIVKLPNLNPYQSRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK-trans-4-Cotinine carboxylic acid |
Cot-ZQAA7-Cot | trans-4-Cotinine carboxylic acid-VDNKFNKELRGAYWEITSLPNLNHSQITAFIVSLYDDPSQSANLLAEAKKLNDAQAPK-trans-4-Cotinine carboxylic acid |
Cot-ZQAA8-Cot | trans-4-Cotinine carboxylic acid- VDNKFNKEMRDAYWEIVRLPNLNPPQSTAFIRSLYDDPSQSANLLAEAKKLNDAQAPK-trans-4-Cotinine carboxylic acid |
Cot-ZQAA11-Cot | trans-4-Cotinine carboxylic acid- VDNKFNKEYMLAYWEIVKLPNLNYPQQHAFIRSLFDDPSQSANLLAEAKKLNDAQAPK-trans-4-Cotinine carboxylic acid |
Cot-ZQAA22-Cot | trans-4-Cotinine carboxylic acid- VDNKFNKEINKAYWEIISLPNLNKEQHHAFIHSLYDDPSQSANLLAEAKKLNDAQAPK-trans-4-Cotinine carboxylic acid |
실시예
2-2.
코티닌이
결합된
어피바디의
HER2
결합능
확인
본 발명자들은 상기 실시예 2-1에서 제작한 코티닌이 결합된 어피바디 5종의 HER2 단백질에 대한 결합여부를 확인하였다. 먼저 HER2-ECD-His 단백질을 항원으로 이용한 ELISA를 진행하였다. HER2-ECD-His 단백질이 코팅된 플레이트에 코티닌이 결합된 어피바디를 2 μg/mL 처리하였다. 2차 항체(Anti-Cotinine IgG)를 HER-ECD-His 단백질과 코티닌이 결합된 어피바디의 복합체에 처리한 후, 3차 항체(anti-hIgG-Fc-HRP(Invitrogen, H10007))로 결합된 2차 항체를 표지 하였다. 표지된 복합체의 정량은 TMB로 발색반응을 발생시켜 ELISA 리더기(PerkinElmer, Victor3)를 이용하여 OD450 값을 측정하였다(도 5).
실시예
2-3. 항-
코티닌
항체 단편이 연결된
키메라
항원 수용체를 포함하는 렌티바이러스의 제작
항-코티닌 항체 단편을 이용하여 키메라 항원 수용체를 개발하였다. 키메라 항원 수용체는 CD8 리더, scFv 형태의 항-코티닌, CD8 힌지 및 막관통 영역, CD137 세포질 영역, 및 CD3제타의 세포질 영역을 코돈 최적화한 후 pLenti6-V5/DEST 렌티바이러스 벡터 (Invitrogen, V53306)에 SpeI/XhoI으로 절단 및 결찰시켰다. 제조된 컨스트럭트는 염기서열 분석을 통해 확인하였다. 상기 항-코티닌 항체 및 그의 항원 결합 단편의 아미노산 및 염기서열은 서열번호 9 내지 18에 나타내었다.
제조된 렌티바이러스 컨스트럭트를 바이러스 외피 단백질인 VSV-G(vesicular stomatitis indiana virus G protein)를 코딩하는 핵산과 gag, pol 및 rev 유전자를 포함하는 플라스미드인 pCMV-dR8.91과 함께 Lenti-X 293T(Takara Bio Inc., 632180) 세포주에 형질도입시켰다. 형질도입은 리포펙타민 2000(Invitrogen, 11668019)을 사용하여 제조사의 프로토콜대로 수행하였다. 72시간 후, 렌티바이러스가 함유된 배양액을 원심분리형 필터장치(Millipore, UFC910024)를 사용하여 10배 농축하여 보관하였다.
실시예
2-4. 항-
코티닌
항체 단편을 포함하는
키메라
항원 수용체가 표면에 제시된 세포 독성 T 세포(Cot-
sCART
)의 제조
실시예 2-3에서 제조된 렌티바이러스를 이용하여, 항-코티닌 항체 단편을 포함하는 키메라 항원 수용체가 표면에 제시된 세포독성 T 세포를 제조하였다.
먼저, 인간의 naive T 세포를 분리하여 Dynabeads?? Human T-Activator CD3/CD28(Thermofisher scientific, 11131D)로 24시간 동안 자극하고, 폴리브렌(Sigma-Aldrich, H9268) 및 상기 렌티바이러스를 상기 세포에 첨가하여 24시간 동안 배양하며 형질도입 시켰다. 이후, IL-2(Gibco, CTP0021)가 포함된 배지로 교체하여 5% CO2, 37℃의 조건에서 배양하였다. 제조된 항-코티닌 항체 단편을 포함하는 키메라 항원 수용체가 표면에 제시된 T 세포(Anti-Cotinine CAR-T cell, Cot-sCART)는, 제조 후 24시간 이내로 이후의 실험에 사용하였다.
실시예
2-5.
코티닌이
결합된
어피바디와
Cot-
sCART를
이용한 세포독성효과 확인
실시예 2-4에서 제조한 Cot-sCART와 코티닌이 결합된 어피바디를 사용하여, 상기 T 세포와 코티닌이 결합된 어피바디 복합체가 세포 표면의 HER2를 인식함으로써, 키메라 항원 수용체 세포의 활성화를 유도하는지 여부를 확인하였다.
구체적으로, HER2 양성 세포주인 SKOV-3와 HER2 음성 세포주인 Raji에 GFP-Luciferase가 발현되는 렌티바이러스(Biosettia, GlowCell-16p-1)를 도입하여 유전자 도입 세포주인 SKOV3-Luc 및 Raji-Luc 세포주를 구축하여 실험에 사용하였다. 먼저, SKOV3-Luc 세포주 및 Raji-Luc 세포주를 96-웰 플레이트에 웰 당 1x104개가 되도록 분주하였다. Luc 세포주가 분주된 플레이트에 웰 당 처리 비율에 맞게 제조한 세포독성 T세포를 첨가하였다. Luc 세포주와 세포독성 T세포가 처리된 시험군에 코티닌이 결합된 어피바디를 농도에 맞게 첨가(0.1, 1, 10nM)하고, 5% CO2 및 37℃의 조건으로 24시간 동안 배양하였다. 배양 후, 세포독성 T세포의 독성 효과를 luciferase 측정(Bio-Glo Luciferase assay system, Promega, G7941)을 통하여 확인하였다. 세포 독성 효과는 세포독성 T 세포, 코티닌과 결합된 어피바디와 Luc 세포주의 배양 후, 남아있는 SKOV3-Luc 혹은 RaJi-Luc 세포주를 3X Lysis buffer(75 mM Tris(pH8.0), 30% glycerol, 3% Triton X100)로 파쇄하여 용출되어 나오는 luciferase를 substrate와 반응시켜 확인하였다. Luc 세포주만 배양한 well에서 나오는 signal을 100%로 하여 lysis 비율을 결정하였다. 도 6에 나타난 바와 같이, 처리된 코티닌이 결합된 어피바디의 농도에 따라 세포 독성 효과가 나타나는 것을 확인할 수 있었으며, 3종(Cot-ZQAA1-Cot, Cot-ZQAA8-Cot, Cot-ZQAA11-Cot)의 코티닌이 결합된 어피바디의 세포독성이 상대적으로 우수함을 확인하였다.
실시예
2-6.
코티닌이
결합된
어피바디와
Cot-
sCART를
이용한 질환 동물모델 효능 평가
실시예 2-4에서 제조한 Cot-sCART와 코티닌이 결합된 어피바디를 사용하여, 상기 T 세포와 코티닌이 결합된 어피바디 복합체를 이용한 키메라 항원 수용체 세포의 활성을 질환 동물 모델에서 확인하였다.
구체적으로, 실시예 2-5에서 구축한 HER2 양성 세포주인 SKOV3-Luc세포주를 면역결핍된 NSG 마우스(The Jackson Laboratory, 005557)에 복강 투여하였다. 투여 후, 5일 차에 luciferin(Promega, P1043)을 복강 주사 후 Luminescence 측정 기기(Perkin Elmer, IVIS 100)을 이용하여 복부에 형성된 SKOV3-Luc세포주를 측정하여 무작위로 그룹을 나누었다. 7일 차에 Cot-sCART(2.0E+6 CART cells)를 복강 투여한 후, 2일 간격으로 코티닌이 결합된 어피바디(Cot-zHER2; 0.25mg/kg)를 복강 투여하였다. 코티닌이 결합된 어피바디를 복강 투여 후 SKOV3-Luc세포의 변화를 Luminescence 측정 기기 으로 측정하였다. 도 7a 및 7b에서 확인할 수 있듯이, Cot-sCART에 코티닌이 결합된 어피바디가 투여된 NSG 마우스에서만 SKOV3-Luc세포가 감소하는 것을 확인할 수 있었다.
코티닌이 결합된 어피바디의 농도에 따른 키메라 항원 수용체 세포의 활성 변화도 질환 동물 모델에서 확인하였다. 상기 실험과 동일하게 복강 투여를 통하여 복부에 SKOV3-Luc세포주가 자리잡은 NSG 마우스에 Cot-sCART를 복강 투여하였다. Cot-sCART를 복강 투여한 NSG 마우스에 코티닌이 결합된 어피바디를 25μg/kg, 2.5μg/kg으로 나누어 처리하였다. 처리한 결과, 도 8a 및 도 8b에서 확인할 수 있듯이 농도에 따라 코티닌이 결합된 어피바디가 많이 투여된 NSG 마우스에서 SKOV3-Luc세포가 더 빨리 감소하는 것을 확인할 수 있었다.
실시예
3.
ZQAA1과
ZQAA8에
대한 affinity maturation
실시예
3-1. Panning을 통한 affinity가 향상된
어피바디의
선별
어피바디 ZQAA1 과 ZQAA8의 affinity maturation sub library를 제작하여, HER2에 대한 affinity가 향상되는 어피바디를 선별하였다.
어피바디는 3개의 helix를 가지고 있는 구조인데, 그 중 Helix1과 Helix2는 Target의 결합에 관여하고 있고, 총 13개의 아미노산의 variation을 가지고 있다. ZQAA1과 ZQAA8을 토대로, 각 Helix1 의 7개 아미노산에 무작위 variation을 주는 sub-library와 Helix2의 6개 아미노산에 무작위 variation을 주는 sub-library를 제작하였다. 각 sub-library는 VSCM13 helper phage를 이용하여 Phage 형태로 rescue를 하여 Panning에 사용하였다. 처음 항원에 결합시키는 library phage의 수는 1013개 이상으로 사용하였다. Dynabeads M-280 streptavidin(Invitrogen, 11205D)를 통해 biotin-HER2-ECD-Fc를 결합시키고 rescue한 phage를 결합하는 방식으로, 5 round의 panning 을 거쳐서 진행하였다. Affinity가 높은 phage가 선택적으로 선별하는 전략으로 panning round가 늘어감에 따라 항원양은 줄이고(100 nm, 10 nM, 1 nM, 0.1 nM, 0.01 nM), wash횟수 (10 회, 15회, 20 회, 25 회, 30 회)는 늘이는 방법을 적용하였다. Panning의 각 round에서 얻은 binder phage는 ER2537에 infection 시켜 얻은 colony를 ELISA 방법으로 항원에 대한 결합여부를 확인하고 sequence 분석 결과, ZQAA1의 helix1 sub-library는 10종, ZQAA1의 helix2 sub-library는 23종, ZQAA8의 helix1 sub-library는 0종, ZQAA8의 helix2 sub-library는 35종의 unique clone을 확인하였다.
Unique 한 clone들의 periplasmic extract를 이용하여, extended wash 방법과 발현대비 결합정도를 비교하는 두 가지의 방법을 진행하여 parental clone과 대비하여 선택을 한다. Binder phage를 infection 시켜 얻은 colony를 SB media(MOPS 10 g/L, Bacto YEAST extract 20 g/L, Trypton 30 g/L)에 접종 한 다음 OD600에서 0.8이 될 때까지 배앙한 후, 1 mM IPTG(엘피에스솔루션, IPTG025)를 넣고 30℃에서 shaking incubation하여 어피바디가 과발현 되도록 하였다. BBS buffer(200 mM Boric acid, 150 mM NaCl, 1 mM EDTA)를 이용하여 어피바디의 periplasmic extraction을 진행하였다.
Extended wash 방법은 2 μg/mL의 농도로 HER2-ECD-Fc 단백질이 coating된 plate에 어피바디 periplasmic extract를 처리하였으며, 2차항체(anti-HA-HRP(Roche, 12013819001))를 처리한 후 TMB(biofx, TMBC-1000-01)로 발색반응을 발생시켜 ELISA 리더기 (Perkinelmer, Victor3)를 이용하여 OD450 값을 측정하였다. 이와 동시에 HER2-ECD-Fc 단백질이 coating된 plate에 어피바디 periplasmic extract를 처리한 후, wash buffer (0.05 % tween in PBS)에서 두 시간 방치한 후, 2차항체(anti-HA-HRP(Roche, 12013819001))를 처리 TMB(biofx, TMBC-1000-01)로 발색반응을 발생시켜 ELISA 리더기 (Perkinelmer, Victor3)를 이용하여 OD450 값을 측정하였다. Wash buffer에 방치하지 않은 plate의 O.D값 대비 wash buffer에 방치한 plate의 O.D 값을 parental과 비교하여 향상된 clone을 고를 작업을 수행하였다.
발현대비 결합 정도를 비교하는 방법은 2 μg/mL의 농도로 HER2-ECD-Fc 단백질이 coating된 plate에 어피바디 periplasmic extract를 원액부터 serial dilution 하여 처리하였으며, 2차항체(anti-HA-HRP(Roche, 12013819001))를 처리한 후 TMB(biofx, TMBC-1000-01)로 발색반응을 발생시켜 ELISA 리더기 (Perkinelmer, Victor3)를 이용하여 OD450 값을 측정하였다. 동시에 NC membrane에 periplasmic extract를 원액부터 serial dilution 하여 dotting 을 진행한다. Membrane에 extract들이 흡착되고 마른 것을 확인 한 후, NC membrane을 5% BSA in TBST가 담긴 통에서 1시간 incubation 시킨다. 이후, anti-HA-HRP(Roche, 12013819001)를 처리한 후, EDC solution (AbClon, Abc-3001)으로 발색반응을 발생시켜 Imaging system(Bio-rad, CemiDoc touch)를 이용하여 발현 정도를 확인한다. 발현 정도가 보이지 않는 희석 농도에서 ELISA OD450값을 parental 과 비교하여 우수한 clone을 선정하였다. ZQAA1 기반으로는 5 clone, ZQAA8을 기반으로는 1 clone을 선택하였고, Zb-Fc 형태로 cloning을 진행하였다.
동물세포에서 생산된 Zb-Fc 이용하여 각 HER2 단백질의 결합을 ELISA법과 BLI법을 을 이용한 KD 측정을 통해 parental clone과 비교 확인하였다. ELISA는 2 μg/mL의 농도로 hHER2-ECD-his 단백질이 coating 된 plate에 정제된 Zb-Fc들을 60 nM부터 1/5 dilution 하여 7point 로 처리하였으며, 2차항체 (anti-hIgG-Fc-HRP(Invitrogen, H10007))를 처리한 후 TMB(biofx, TMBC-1000-01)로 발색반응을 발생시켜 ELISA 리더기 (Perkinelmer, Victor3)를 이용하여 OD450 값을 측정하였다(도 9a 및 도 9b).
ELISA법을 통하여 선별된 일부 clone에 대해 BLI법을 통해 KD 값을 측정하였다. AR2G 센서칩(PALL,18-5092)에 Zb-Fc 단백질을 2-5 μg/mL의 각 clone에 맞는 농도로 EDC/NHS를 이용한 아민 커플링 방법으로 고정시켰다. Zb-Fc가 고정된 센서칩에 hHER2-ECD-his 단백질을 800 nM 부터 12.5 nM 사이의 각 clone에 맞는 농도로 10분간 결합시키고 15분간 해리시키는 방법으로 KD 값을 측정하였다. 측정 결과 parental 대비 약 11배 이상의 KD값을 가지는 clone을 확보하였다(표 5). 측정된 결과값을 바탕으로 최적화된 HER2에 대한 어피바디로 ZQAA1234, ZQAA1239, ZQAA8293을 선별하였다.
명칭 | Full R2 | kon(1/Ms) | kdis(1/s) | KD(M) |
ZQAA1 | 0.98 | 2.5E+04 | 7.4E-03 | 2.9E-07 |
ZQAA1218 | 0.99 | 2.1E+04 | 3.1E-03 | 1.5E-07 |
ZQAA1233 | 0.99 | 2.4E+04 | 1.5E-03 | 6.5E-08 |
ZQAA1234 | 0.99 | 5.5E+04 | 1.4E-03 | 2.6E-08 |
ZQAA1239 | 0.98 | 3.3E+04 | 1.6E-03 | 4.9E-08 |
ZQAA1245 | 0.99 | 4.2E+04 | 5.5E-03 | 1.3E-07 |
ZQAA8 | 0.99 | 2.0E+04 | 5.0E-03 | 2.5E-07 |
ZQAA8293 | 0.99 | 4.0E+04 | 4.5E-03 | 1.1E-07 |
실시예
4. 최적화된
HER2에
대한
어피바디를
이용한 스위치 생산 및 활성 분석
실시예
4-1.
코티닌이
결합된
어피바디의
제조
본 발명을 통하여 최적화된 항-HER2 어피바디를 항스위처블 CAR 시스템의 스위치 분자로 사용하기 위하여, 코티닌 결합을 통한 어피바디-코티닌 복합체(Switch molecule, 스위치 분자)를 합성하였다(표 6).
명칭 | 서열 |
Cot-ZQAA1234 | trans-4-Cotinine carboxylic acid-VDNKFNKELRVAYWEIVKLPNLNPPQITAFIRSLYDDPSQSANLLAEAKKLNDAQAPK |
Cot-ZQAA1239 | trans-4-Cotinine carboxylica cid-VDNKFNKELRVAYWEIVKLPNLNPKQITAFIKQLYDDPSQSANLLAEAKKLNDAQAPK |
Cot-ZQAA8293 | trans-4-Cotinine carboxylic acid- VDNKFNKEMRDAYWEIVRLPNLNRIQSVAFIRQLYDDPSQSANLLAEAKKLNDAQAPK |
실시예
4-2.
코티닌이
결합된
최적화된
어피바디의
HER2
결합능
확인
본 발명자들은 상기 실시예 4-1에서 제작한 코티닌이 결합된 최적화된 어피바디 3종의 HER2.ECD 결합여부를 확인하였다. 실시예 2-2에서 사용된 방법과 동일하게 코티닌이 결합된 최적화된 어피바디에 대한 HER2.ECD의 결합능력을 ELISA 분석법으로 확인하였다(도 10).
또한, HER2 양성 세포주인 SKOV-3 세포주에 대한 결합능을 확인하였다. 실시예 2-3과 같은 방법으로 코티닌이 결합된 최적화된 어피바디를 표지하고, 세포주에 결합한 항체 단편에 대한 분석을 유세포 분석기를 통하여 측정하였다(도 11).
도 10과 11에 나타낸 바와 같이, 본 발명의 코티닌이 결합된 최적화된 어피바디 3종(Cot-ZQAA1234, Cot-ZQAA1239, Cot-ZQAA8293)의 결합능을 측정할 수 있었다.
실시예
4-3.
코티닌이
결합된
최적화된
어피바디와
Cot-
sCART를
이용한 세포독성효과 확인
실시예 2-4에서 제조한 Cot-sCART와 코티닌이 결합된 최적화된 어피바디를 사용하여, 상기 T 세포와 코티닌이 결합된 어피바디 복합체가 세포 표면의 HER2를 인식함으로써, 키메라 항원 수용체 세포의 활성화를 유도하는지 여부를 확인하였다. 실시예 2-5와 같은 방법으로 SKOV3-Luc 및 Raji-Luc 세포주, 코티닌이 결합된 최적화된 어피바디와 Cot-sCART를 배양 후, 세포독성 T세포의 독성 효과를 luciferase 측정(Bio-Glo Luciferase assay system, Promega, G7941)을 통하여 확인하였다. 도 12에 나타난 바와 같이, 처리된 코티닌이 결합된 최적화된 어피바디의 농도에 따라 세포 독성 효과가 나타나는 것을 확인할 수 있었다. 3종(Cot-ZQAA1234, Cot-ZQAA1239, Cot-ZQAA8293)의 코티닌이 결합된 최적화된 어피바디 중, Cot-ZQAA1234, Cot-ZQAA1239의 세포독성활성이 상대적으로 우수함을 확인하였다.
<110> AbClon Inc.
<120> Anti-HER2 affibody and switchable chimeric antigen receptor using
the same as switch molecule
<130> PN200069
<160> 23
<170> KoPatentIn 3.0
<210> 1
<211> 58
<212> PRT
<213> Artificial Sequence
<220>
<223> ZQAA1
<400> 1
Val Asp Asn Lys Phe Asn Lys Glu Leu Arg Val Ala Tyr Trp Glu Ile
1 5 10 15
Val Lys Leu Pro Asn Leu Asn Pro Tyr Gln Ser Arg Ala Phe Ile Arg
20 25 30
Ser Leu Tyr Asp Asp Pro Ser Gln Ser Ala Asn Leu Leu Ala Glu Ala
35 40 45
Lys Lys Leu Asn Asp Ala Gln Ala Pro Lys
50 55
<210> 2
<211> 58
<212> PRT
<213> Artificial Sequence
<220>
<223> ZQAA7
<400> 2
Val Asp Asn Lys Phe Asn Lys Glu Leu Arg Gly Ala Tyr Trp Glu Ile
1 5 10 15
Thr Ser Leu Pro Asn Leu Asn His Ser Gln Ile Thr Ala Phe Ile Val
20 25 30
Ser Leu Tyr Asp Asp Pro Ser Gln Ser Ala Asn Leu Leu Ala Glu Ala
35 40 45
Lys Lys Leu Asn Asp Ala Gln Ala Pro Lys
50 55
<210> 3
<211> 58
<212> PRT
<213> Artificial Sequence
<220>
<223> ZQAA8
<400> 3
Val Asp Asn Lys Phe Asn Lys Glu Met Arg Asp Ala Tyr Trp Glu Ile
1 5 10 15
Val Arg Leu Pro Asn Leu Asn Pro Pro Gln Ser Thr Ala Phe Ile Arg
20 25 30
Ser Leu Tyr Asp Asp Pro Ser Gln Ser Ala Asn Leu Leu Ala Glu Ala
35 40 45
Lys Lys Leu Asn Asp Ala Gln Ala Pro Lys
50 55
<210> 4
<211> 58
<212> PRT
<213> Artificial Sequence
<220>
<223> ZQAA11
<400> 4
Val Asp Asn Lys Phe Asn Lys Glu Tyr Met Leu Ala Tyr Trp Glu Ile
1 5 10 15
Val Lys Leu Pro Asn Leu Asn Tyr Pro Gln Gln His Ala Phe Ile Arg
20 25 30
Ser Leu Phe Asp Asp Pro Ser Gln Ser Ala Asn Leu Leu Ala Glu Ala
35 40 45
Lys Lys Leu Asn Asp Ala Gln Ala Pro Lys
50 55
<210> 5
<211> 58
<212> PRT
<213> Artificial Sequence
<220>
<223> ZQAA22
<400> 5
Val Asp Asn Lys Phe Asn Lys Glu Ile Asn Lys Ala Tyr Trp Glu Ile
1 5 10 15
Ile Ser Leu Pro Asn Leu Asn Lys Glu Gln His His Ala Phe Ile His
20 25 30
Ser Leu Tyr Asp Asp Pro Ser Gln Ser Ala Asn Leu Leu Ala Glu Ala
35 40 45
Lys Lys Leu Asn Asp Ala Gln Ala Pro Lys
50 55
<210> 6
<211> 58
<212> PRT
<213> Artificial Sequence
<220>
<223> ZQAA1234
<400> 6
Val Asp Asn Lys Phe Asn Lys Glu Leu Arg Val Ala Tyr Trp Glu Ile
1 5 10 15
Val Lys Leu Pro Asn Leu Asn Pro Pro Gln Ile Thr Ala Phe Ile Arg
20 25 30
Ser Leu Tyr Asp Asp Pro Ser Gln Ser Ala Asn Leu Leu Ala Glu Ala
35 40 45
Lys Lys Leu Asn Asp Ala Gln Ala Pro Lys
50 55
<210> 7
<211> 58
<212> PRT
<213> Artificial Sequence
<220>
<223> ZQAA1239
<400> 7
Val Asp Asn Lys Phe Asn Lys Glu Leu Arg Val Ala Tyr Trp Glu Ile
1 5 10 15
Val Lys Leu Pro Asn Leu Asn Pro Lys Gln Ile Thr Ala Phe Ile Lys
20 25 30
Gln Leu Tyr Asp Asp Pro Ser Gln Ser Ala Asn Leu Leu Ala Glu Ala
35 40 45
Lys Lys Leu Asn Asp Ala Gln Ala Pro Lys
50 55
<210> 8
<211> 58
<212> PRT
<213> Artificial Sequence
<220>
<223> ZQAA8293
<400> 8
Val Asp Asn Lys Phe Asn Lys Glu Met Arg Asp Ala Tyr Trp Glu Ile
1 5 10 15
Val Arg Leu Pro Asn Leu Asn Arg Ile Gln Ser Val Ala Phe Ile Arg
20 25 30
Gln Leu Tyr Asp Asp Pro Ser Gln Ser Ala Asn Leu Leu Ala Glu Ala
35 40 45
Lys Lys Leu Asn Asp Ala Gln Ala Pro Lys
50 55
<210> 9
<211> 5
<212> PRT
<213> Artificial Sequence
<220>
<223> CDRH1 of Anti-cotinine antibody
<400> 9
Arg Asp Trp Met Asn
1 5
<210> 10
<211> 15
<212> PRT
<213> Artificial Sequence
<220>
<223> CDRH2 of Anti-cotinine antibody
<400> 10
Ala Ile Gly Arg Ser Gly Asp Thr Tyr Tyr Ala Thr Trp Ala Lys
1 5 10 15
<210> 11
<211> 11
<212> PRT
<213> Artificial Sequence
<220>
<223> CDRH3 of Anti-cotinine antibody
<400> 11
Ile Pro Tyr Phe Gly Trp Asn Asn Gly Asp Ile
1 5 10
<210> 12
<211> 13
<212> PRT
<213> Artificial Sequence
<220>
<223> CDRL1 of Anti-cotinine antibody
<400> 12
Gln Ser Ser Gln Ser Pro Tyr Ser Asn Glu Trp Leu Ser
1 5 10
<210> 13
<211> 7
<212> PRT
<213> Artificial Sequence
<220>
<223> CDRL2 of Anti-cotinine antibody
<400> 13
Arg Ile Ser Thr Leu Ala Ser
1 5
<210> 14
<211> 12
<212> PRT
<213> Artificial Sequence
<220>
<223> CDRL3 of Anti-cotinine antibody
<400> 14
Ala Gly Gly Tyr Asn Phe Gly Leu Phe Leu Phe Gly
1 5 10
<210> 15
<211> 119
<212> PRT
<213> Artificial Sequence
<220>
<223> Heavy chain of Anti-cotinine antibody
<400> 15
Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly
1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly His Leu Arg Arg Arg Asp
20 25 30
Trp Met Asn Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45
Ala Ala Ile Gly Arg Ser Gly Asp Thr Tyr Tyr Ala Thr Trp Ala Lys
50 55 60
Gly Arg Phe Thr Ile Ser Ala Asp Thr Ser Lys Asn Thr Ala Tyr Leu
65 70 75 80
Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys Ser
85 90 95
Arg Ile Pro Tyr Phe Gly Trp Asn Asn Gly Asp Ile Trp Gly Gln Gly
100 105 110
Thr Leu Val Thr Val Ser Ser
115
<210> 16
<211> 357
<212> DNA
<213> Artificial Sequence
<220>
<223> Heavy chain of Anti-cotinine antibody
<400> 16
gaggtgcagc tggtggagtc tggcggcgga ctggtgcagc ctggcggaag cttgcggctg 60
tcctgcgccg cctccgggca tcttcggagg agggactgga tgaactgggt gcggcaggcc 120
cctggcaagg gcctagagtg ggtggccgcc attggtagaa gtggagacac atactacgcg 180
acctgggcga aaggccggtt caccatctcc gccgacacct ccaagaacac cgcctacctg 240
cagatgaact ccctgcgggc cgaggacacc gccgtgtact actgctccag aattccttat 300
tttggttgga ataatggtga catctggggc cagggcacac tcgtgaccgt gtcctcc 357
<210> 17
<211> 110
<212> PRT
<213> Artificial Sequence
<220>
<223> Light chain of Anti-cotinine antibody
<400> 17
Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly
1 5 10 15
Asp Arg Val Thr Ile Thr Cys Gln Ser Ser Gln Ser Pro Tyr Ser Asn
20 25 30
Glu Trp Leu Ser Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu
35 40 45
Leu Ile Tyr Arg Ile Ser Thr Leu Ala Ser Gly Val Pro Ser Arg Phe
50 55 60
Ser Gly Ser Arg Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu
65 70 75 80
Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Ala Gly Gly Tyr Asn Phe
85 90 95
Gly Leu Phe Leu Phe Gly Gln Gly Thr Lys Val Glu Ile Lys
100 105 110
<210> 18
<211> 330
<212> DNA
<213> Artificial Sequence
<220>
<223> Light chain of Anti-cotinine antibody
<400> 18
gacatccaga tgacccagtc cccctcctcg ctgagcgcct ccgtgggcga ccgggtgacc 60
atcacctgcc agtccagtca gagtccttat agtaacgagt ggttatcctg gtatcagcag 120
aagcctggca aggcgcctaa gctgctgatc tacaggatat ccactctggc atctggcgtg 180
ccttcccggt tctccggatc ccggtccggc accgacttca ccctgaccat ctcctccctg 240
caacctgagg acttcgccac ctactactgc gcaggcggtt ataattttgg tttgtttctc 300
ttcggccagg gtaccaaggt ggagatcaag 330
<210> 19
<211> 1184
<212> DNA
<213> Artificial Sequence
<220>
<223> EF-1alpha promoter
<400> 19
tgtgaggctc cggtgcccgt cagtgggcag agcgcacatc gcccacagtc cccgagaagt 60
tggggggagg ggtcggcaat tgaaccggtg cctagagaag gtggcgcggg gtaaactggg 120
aaagtgatgt cgtgtactgg ctccgccttt ttcccgaggg tgggggagaa ccgtatataa 180
gtgcagtagt cgccgtgaac gttctttttc gcaacgggtt tgccgccaga acacaggtaa 240
gtgccgtgtg tggttcccgc gggcctggcc tctttacggg ttatggccct tgcgtgcctt 300
gaattacttc cacctggctg cagtacgtga ttcttgatcc cgagcttcgg gttggaagtg 360
ggtgggagag ttcgaggcct tgcgcttaag gagccccttc gcctcgtgct tgagttgagg 420
cctggcctgg gcgctggggc cgccgcgtgc gaatctggtg gcaccttcgc gcctgtctcg 480
ctgctttcga taagtctcta gccatttaaa atttttgatg acctgctgcg acgctttttt 540
tctggcaaga tagtcttgta aatgcgggcc aagatctgca cactggtatt tcggtttttg 600
gggccgcggg cggcgacggg gcccgtgcgt cccagcgcac atgttcggcg aggcggggcc 660
tgcgagcgcg gccaccgaga atcggacggg ggtagtctca agctggccgg cctgctctgg 720
tgcctggcct cgcgccgccg tgtatcgccc cgccctgggc ggcaaggctg gcccggtcgg 780
caccagttgc gtgagcggaa agatggccgc ttcccggccc tgctgcaggg agctcaaaat 840
ggaggacgcg gcgctcggga gagcgggcgg gtgagtcacc cacacaaagg aaaagggcct 900
ttccgtcctc agccgtcgct tcatgtgact ccacggagta ccgggcgccg tccaggcacc 960
tcgattagtt ctcgagcttt tggagtacgt cgtctttagg ttggggggag gggttttatg 1020
cgatggagtt tccccacact gagtgggtgg agactgaagt taggccagct tggcacttga 1080
tgtaattctc cttggaattt gccctttttg agtttggatc ttggttcatt ctcaagcctc 1140
agacagtggt tcaaagtttt tttcttccat ttcaggtgtc gtga 1184
<210> 20
<211> 63
<212> DNA
<213> Artificial Sequence
<220>
<223> CD8 leader
<400> 20
atggccctgc ctgtgaccgc tctgctgctg cccctggctc tgctgctgca cgccgctcgc 60
ccc 63
<210> 21
<211> 207
<212> DNA
<213> Artificial Sequence
<220>
<223> CD8 hinge and TM region
<400> 21
accacaactc cagctccccg gccccctacc cctgcaccaa caatcgccag ccagcctctg 60
tccctgagac cagaggcatg taggccagct gcaggaggag cagtgcatac aagaggcctg 120
gacttcgcct gcgatatcta catttgggct cctctggcag gaacttgtgg cgtgctgctg 180
ctgtctctgg tcatcaccct gtactgc 207
<210> 22
<211> 126
<212> DNA
<213> Artificial Sequence
<220>
<223> CD137
<400> 22
aaaaggggcc gcaagaaact gctgtatatt ttcaagcagc ccttcatgcg gcccgtgcag 60
accacacagg aggaagacgg gtgctcctgt agattccccg aggaagagga aggcgggtgt 120
gagctg 126
<210> 23
<211> 336
<212> DNA
<213> Artificial Sequence
<220>
<223> CD3z
<400> 23
cgcgtcaagt tcagccgatc agccgatgct cctgcataca agcagggcca gaatcagctg 60
tataacgagc tgaatctggg gcgccgagag gaatacgacg tgctggataa gcggagaggg 120
agggaccccg aaatgggagg caaacctagg cgcaagaacc cacaggaggg actgtacaat 180
gaactgcaga aggacaaaat ggccgaggct tattccgaaa ttgggatgaa aggagagcga 240
cggagaggga agggacacga tgggctgtat cagggactgt ctaccgccac taaagatacc 300
tacgacgctc tgcacatgca ggctctgcca cctcgc 336
Claims (16)
- 코티닌과 결합된, 서열번호 1, 3, 및 6 내지 8 중 어느 하나의 아미노산 서열로 표시되는 항-HER2 어피바디를 포함하는, 키메라 항원 수용체 효과기 세포(chimeric antigen receptor-effector cell)를 활성화하기 위한 스위치 분자(switch molecule).
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 삭제
- 제1항에 있어서, 상기 효과기 세포의 활성화는 표적세포에 대한 세포독성, 사이토카인 분비, 및 이들의 조합인 것을 특징으로 하는 스위치 분자.
- 제1항에 있어서, 상기 효과기 세포는 수지상 세포, 킬러 수지상 세포, 비만세포, 자연살해 세포, B 림프구, T 림프구, 대식세포 및 이들의 전구세포로 이루어진 군으로부터 선택되는 것을 특징으로 하는 스위치 분자.
- 제1항, 제8항 및 제9항 중 어느 한 항의 스위치 분자; 및 약제학적으로 허용되는 담체를 포함하는 암세포 표면에 HER2를 발현하는 암의 치료용 약제학적 조성물.
- 다음을 포함하는 스위처블 키메라 항원 수용체:
(a) 제1항, 제8항 및 제9항 중 어느 한 항의 스위치 분자; 및
(b) 다음을 포함하는 키메라 항원 수용체:
i) 제1항, 제8항 및 제9항 중 어느 한 항의 스위치 분자를 표적화하는 항체 또는 그의 항원 결합 단편을 포함하는 세포외 도메인(extracellular domain);
ii) 막관통 도메인(transmembrane domain); 및
iii) 세포내 신호전달 도메인.
- 제11항에 있어서, 상기 막관통 도메인은 T-세포 수용체, CD27, CD28, CD3, 엡실론, CD45, CD4, CD5, CD8(CD8α), CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 및 CD154의 알파, 베타 또는 제타 사슬로 이루어진 군으로부터 선택된 단백질의 막관통 도메인인, 스위처블 키메라 항원 수용체.
- 제11항에 있어서, 상기 세포내 신호전달 도메인은 CD3ζ(CD3 제타) 사슬로부터 유래된 도메인인, 스위처블 키메라 항원 수용체.
- 제11항에 있어서, 상기 세포내 신호전달 도메인은 OX40 (CD134), CD2, CD27, CD28, CDS, ICAM-1, LFA-1(CD11a/CD18) 및 4-1BB (CD137)로 이루어진 군으로부터 선택된 공동자극 분자(costimulatory molecule)를 추가적으로 포함하는 것인, 스위처블 키메라 항원 수용체.
- 제11항에 있어서, 상기 i)의 항체 또는 그의 항원 결합 단편은 항-코티닌 항체 또는 그의 항원 결합 단편인, 스위처블 키메라 항원 수용체.
- 제11항에 있어서, 상기 i)의 항체 또는 그의 항원 결합 단편은 서열번호 9의 아미노산 서열을 포함하는 HCDR1, 서열번호 10의 아미노산 서열을 포함하는 HCDR2, 서열번호 11의 아미노산 서열을 포함하는 HCDR3, 서열번호 12의 아미노산 서열을 포함하는 LCDR1, 서열번호 13의 아미노산 서열을 포함하는 LCDR2, 및 서열번호 14의 아미노산 서열을 포함하는 LCDR3를 포함하는 것인, 스위처블 키메라 항원 수용체.
Priority Applications (9)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020200047025A KR102502287B1 (ko) | 2020-04-17 | 2020-04-17 | 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 |
AU2021218069A AU2021218069B2 (en) | 2020-04-17 | 2021-04-16 | Anti-HER2 affibody and switchable chimeric antigen receptor using same as switch molecule |
PCT/KR2021/004793 WO2021210939A1 (ko) | 2020-04-17 | 2021-04-16 | 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 |
US17/424,970 US20220315666A1 (en) | 2020-04-17 | 2021-04-16 | Anti-her2 affibody and switchable chimeric antigen receptor using same as switch molecule |
CA3125855A CA3125855C (en) | 2020-04-17 | 2021-04-16 | Anti-her2 affibody and switchable chimeric antigen receptor using same as switch molecule |
JP2021549988A JP7237387B2 (ja) | 2020-04-17 | 2021-04-16 | 抗her2アフィボディ及びこれをスイッチ分子として用いるスウィチャブルキメラ抗原受容体 |
EP21743362.2A EP4137520A4 (en) | 2020-04-17 | 2021-04-16 | ANTI-HER2 AFFICOBODY AND SWITCHABLE CHIMERIC ANTIGEN RECEPTOR USING THE SAME AS A SWITCHING MOLECULE |
CN202180001956.1A CN113825772B (zh) | 2020-04-17 | 2021-04-16 | 抗her2亲合体及将其用作开关分子的可切换嵌合抗原受体 |
KR1020230015852A KR102624213B1 (ko) | 2020-04-17 | 2023-02-06 | 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020200047025A KR102502287B1 (ko) | 2020-04-17 | 2020-04-17 | 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020230015852A Division KR102624213B1 (ko) | 2020-04-17 | 2023-02-06 | 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 |
Publications (2)
Publication Number | Publication Date |
---|---|
KR20210129318A KR20210129318A (ko) | 2021-10-28 |
KR102502287B1 true KR102502287B1 (ko) | 2023-02-22 |
Family
ID=78085224
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020200047025A KR102502287B1 (ko) | 2020-04-17 | 2020-04-17 | 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 |
KR1020230015852A KR102624213B1 (ko) | 2020-04-17 | 2023-02-06 | 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020230015852A KR102624213B1 (ko) | 2020-04-17 | 2023-02-06 | 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 |
Country Status (7)
Country | Link |
---|---|
US (1) | US20220315666A1 (ko) |
EP (1) | EP4137520A4 (ko) |
JP (1) | JP7237387B2 (ko) |
KR (2) | KR102502287B1 (ko) |
AU (1) | AU2021218069B2 (ko) |
CA (1) | CA3125855C (ko) |
WO (1) | WO2021210939A1 (ko) |
Families Citing this family (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR102530111B1 (ko) * | 2022-03-11 | 2023-05-10 | 앱클론(주) | 코티닌을 표적하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이들의 용도 |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20150307564A1 (en) | 2013-10-15 | 2015-10-29 | The California Institute For Biomedical Research | Peptidic chimeric antigen receptor t cell switches and uses thereof |
Family Cites Families (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU601273B2 (en) | 1987-03-20 | 1990-09-06 | Creative Biomolecules, Inc. | Leader sequences for the production of recombinant proteins |
JPH02500876A (ja) | 1987-03-20 | 1990-03-29 | クリエイティブ・バイオマリキュールズ・インコーポレーテッド | 組換えポリペプチドの製品およびその製造、単離および精製方法 |
DE3853515T3 (de) | 1987-05-21 | 2005-08-25 | Micromet Ag | Multifunktionelle proteine mit vorbestimmter zielsetzung. |
SE9400088D0 (sv) | 1994-01-14 | 1994-01-14 | Kabi Pharmacia Ab | Bacterial receptor structures |
EP2077272A1 (en) | 2007-12-21 | 2009-07-08 | Affibody AB | Polypeptide libraries with a predetermined scaffold |
EP3957332A1 (en) | 2010-12-22 | 2022-02-23 | General Electric Company | Radiolabeled her2-binding peptide conjugates |
WO2017030370A1 (ko) * | 2015-08-17 | 2017-02-23 | 서울대학교산학협력단 | 항-코티닌 항체가 연결된 키메라 항체 수용체 및 이의 용도 |
CN110475857B (zh) * | 2017-01-05 | 2023-07-18 | 韩国生命工学研究院 | 表达抗-可替宁嵌合抗原受体的天然杀伤细胞 |
JP2021517907A (ja) * | 2018-04-18 | 2021-07-29 | アブクロン・インコーポレイテッドAbclon Inc. | スイッチ分子及びスイッチャブルキメラ抗原受容体 |
KR20200047025A (ko) | 2018-10-26 | 2020-05-07 | 최영문 | 진공 금형 장치를 이용한 성형방법 |
-
2020
- 2020-04-17 KR KR1020200047025A patent/KR102502287B1/ko active IP Right Grant
-
2021
- 2021-04-16 EP EP21743362.2A patent/EP4137520A4/en active Pending
- 2021-04-16 AU AU2021218069A patent/AU2021218069B2/en active Active
- 2021-04-16 US US17/424,970 patent/US20220315666A1/en active Pending
- 2021-04-16 WO PCT/KR2021/004793 patent/WO2021210939A1/ko unknown
- 2021-04-16 JP JP2021549988A patent/JP7237387B2/ja active Active
- 2021-04-16 CA CA3125855A patent/CA3125855C/en active Active
-
2023
- 2023-02-06 KR KR1020230015852A patent/KR102624213B1/ko active IP Right Grant
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20150307564A1 (en) | 2013-10-15 | 2015-10-29 | The California Institute For Biomedical Research | Peptidic chimeric antigen receptor t cell switches and uses thereof |
Non-Patent Citations (2)
Title |
---|
(PDB: 2KZI_A) |
PROC NATL ACAD SCI USA, 2010 AUG 24, VOL107, NO34, P15039_44. [DOI: 10.1073/PNAS.1005025107] |
Also Published As
Publication number | Publication date |
---|---|
US20220315666A1 (en) | 2022-10-06 |
KR20230022422A (ko) | 2023-02-15 |
JP7237387B2 (ja) | 2023-03-13 |
CA3125855C (en) | 2024-02-27 |
AU2021218069A1 (en) | 2021-11-04 |
JP2022532468A (ja) | 2022-07-15 |
WO2021210939A1 (ko) | 2021-10-21 |
CN113825772A (zh) | 2021-12-21 |
CA3125855A1 (en) | 2021-10-17 |
EP4137520A1 (en) | 2023-02-22 |
KR20210129318A (ko) | 2021-10-28 |
KR102624213B1 (ko) | 2024-01-15 |
AU2021218069B2 (en) | 2024-03-07 |
EP4137520A4 (en) | 2024-05-15 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
JP7324789B2 (ja) | ヒト化抗muc1* 抗体 | |
JP5430928B2 (ja) | 抗cd16結合分子 | |
KR20220071263A (ko) | Cd3을 표적으로 하는 항체, 이중 특이성 항체 및 이의 용도 | |
KR20220050971A (ko) | 신규 항-cd39 항체 | |
KR102250234B1 (ko) | Lag-3에 특이적으로 결합하는 단클론항체 및 이의 용도 | |
US11649294B2 (en) | Anti-HER2 antibody or antigen-binding fragment thereof, and chimeric antigen receptor comprising same | |
JP2022548947A (ja) | Ceacam5およびcd3に対する二特異性抗体 | |
US11945878B2 (en) | Switch molecule and switchable chimeric antigen receptor | |
KR20190067125A (ko) | 악성 b 세포를 특이적으로 인지하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항체 수용체 및 이의 용도 | |
KR20200042467A (ko) | 이중특이적 항pd-1 tim3 항체 | |
US20220242948A1 (en) | Anti-l1cam antibody or antigen-binding fragment thereof and chimeric antigen receptor comprising same | |
KR102624213B1 (ko) | 항-her2 어피바디 및 이를 스위치 분자로 이용하는 스위처블 키메라 항원 수용체 | |
JP7138989B1 (ja) | メソテリンに特異的に結合する抗メソテリンキメラ抗原受容体 | |
JP2023505415A (ja) | 抗pd-l1/抗b7-h3多重特異性抗体及びその使用 | |
JP2023535485A (ja) | 抗cd22シングルドメイン抗体および治療用コンストラクト | |
CN113825772B (zh) | 抗her2亲合体及将其用作开关分子的可切换嵌合抗原受体 | |
KR102530111B1 (ko) | 코티닌을 표적하는 항체 또는 그의 항원 결합 단편, 이를 포함하는 키메라 항원 수용체 및 이들의 용도 | |
KR102393776B1 (ko) | Cd22에 특이적인 인간화 항체 및 이를 이용한 키메라 항원 수용체 | |
EP4219553A1 (en) | Anti-tigit antibody and double antibody and their application | |
CN117186235A (zh) | 抗4-1BB/抗EGFRvⅢ的双特异抗体及其制备方法和应用 | |
CN116635406A (zh) | 一种包括抗间皮素scFv的嵌合抗原受体及其用途 | |
CN116135884A (zh) | 抗tigit-抗pd-l1双特异性抗体、其药物组合物及用途 |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
A302 | Request for accelerated examination | ||
E701 | Decision to grant or registration of patent right | ||
A107 | Divisional application of patent | ||
GRNT | Written decision to grant |